1F4WL

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTTSNYANWVQEKPDHLFTGLIGATNNRAAGVPVRFSGSLIGGKAALTITGAQTEDEAIYFCALWYSGHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTNPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4wL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4wL01
1D5ZB 2DLFL 4YXHH 1ZTXH 3AU1B 4EOWH 4MNGA 3NAAL 3AS1A 2L7UA 4HJGB 1E4XI 2RJMA 4LU5H 4QRTB 4XRCB 5GZOD 4OB5L 3EO0A 1RHFA 3RL2A 2XKNB 3MLWH 1I1AC 4WO4D 3CDGB 4AT6A 1W8OA 4ACPA 5CEZE 2FX9H 5C2UB 1GL4B 5C0CD 5BMFH 1S7WB 3KJ6L 3MODL 1SY6H 1K2DB 2FLBT 1OP9A 3KYMB 1S3KH 1W72H 1CBVH 2YOCA 5D96C 1WZLA 3VFOB 2CKNA 3EYUH 4X6DF 5FKPA 5C6TH 2LAGB 3S3PA 3EYFA 4XVUD 5T3XL 4OFDA 3GSVA 4MAYC 4XVSH 2XPGB 2A83A 5C1MB 3GDBA 1QBAA 3AXLA 2BHUA 1R3KA 5DHYB 4HGWB 4PGZA 2RFXA 2P47B 4G6ML 4JFFD 3DYPA 2FECI 2MSPA 4FFWC 4LOUC 2CQVA 1XIWB 4JM2D 4YAQB 3VJ6B 3QEGL 5DQJA 3JV6A 4JO4L 6FABH 1G0XA 3DXAA 5HYIA 3VXNB 5JW4R 4NO3A 4OCSL 1HWGB 7FABH 3BJ91 3L3IA 4GKSB 2CPCA 4K7FA 3RJQB 4QO1A 1MF2L 2WLYA 3LEVL 2XZAH 4OZ4B 2WWKT 4GLRI 5IT2H 2J4WL 1IEBB 3FFCB 4DZ8A 5L2KB 2UUDK 3TM6A 1NMBL 4IRJD 5BJTB 4NNPH 4WUUE 2UWEB 3T1FA 5ANME 1U3YA 1A3LH 2ZUXA 3UJIL 1KF9B 3BP4A 1X4ZA 4NZUH 4QWWD 3HC3L 4CVXA 1S7SB 4HMCA 2I60L 2NW2B 4HHAA 2RCSH 5H8DA 3T3MF 3EYOA 2VZUA 5IVXE 2VLLB 3OB0K 2X6MA 4WUKL 4G6AC 3U83A 4ZG1A 4G80B 5I1KL 4I4WB 2E5EA 3LKQA 4ZQKA 1UB5B 4YC2B 5EU6E 1AFVL 1D9KA 4HKXB 2P24B 3TIEB 1OB1B 3N9GL 1BJ8A 3QULB 4PJ8C 4G43B 2EEDA 5DD3H 4IMKA 5F96H 1DJSA 1QBML 4TTGA 4XPGH 1GHFH 3L3OB 4XZUA 1T0MA 1FNLA 4UDTB 5HHOB 2GKIA 3C5ZB 1AGBA 3E2HC 1EO8H 4XCFH 3T0EB 2EYTA 4YNYB 1AGFB 5EFIA 4XVJL 2EDXA 4AIXA 4NM4L 4X9GA 3PQYD 3IDNA 5KSUA 1JFQL 1ZT1B 5I19L 2IPUG 1FZJA 4V1DD 2R23B 3QQ4A 1HK6A 2CJUL 1CDGA 1F4XL 3GI9H 3GSWB 4S2SA 1BHGA 4ONHB 2XWJB 1T6WA 1UA6H 4PJHE 5DRXB 3RVXD 4W70A 1K8IB 1LILA 1DTUA 2H3NA 3V0WH 2B7DT 3RRQA 4HK0B 4TVPL 1V5JA 5E24E 3CXDH 1N26A 4PJCB 1DEDA 3X14A 4GG6E 4XB7A 4TNWK 5FUZH 4MDJA 5E8PA 2BOCB 4G9FE 4RA0C 3SJVB 3BDYH 5SWZE 3S36L 4FZEH 1FL6A 4JFQB 4HDIB 4OLWH 3PWNB 3MRRA 2A9MH 4LVHC 2QKIA 1LK2B 3VDAA 5INCA 2AI0H 2IFFH 4G8FB 4ZO6A 5JQ6L 1A7RL 1PEWA 3ZKND 1RZJL 5EZLB 2P5ED 4QYOA 4PY7A 1FO0H 4MD0B 1JPSH 1UH2A 2WQRA 3BIBX 5EIQA 3BPNB 3MUY1 4GG8B 2RR3A 4OTXL 3ALXA 2CR3A 4P4KB 1JWSA 2PETA 2QJDA 2V5RA 3MR9B 4QRUA 3BAEH 4DUWA 1NC4A 5E6ID 4HT1L 4PJ9B 4K8RD 4JVPA 5GGSY 2IAMD 2OMNA 3KLAB 5F7NC 5I1JL 1MHPL 1W0YT 2JIXD 3L5XH 1BFOA 2C3VB 2G5RA 3MLZL 5FHBL 2A73B 1P2CA 1DR9A 3LOWA 3NTCH 5I1IL 1GGIH 2OXHA 1MFBH 3R06B 4XBGB 4XH2B 5D7JB 2HWZH 4K3DL 5KW9H 4Z7NE 2C1OB 4UQ3A 5J3HD 1AY1H 1BZ7B 2EYSB 2PTUA 5HD8C 4MD5B 3RAJL 1P6FA 3OR6B 4HS3B 1T7XA 4X6DE 3WNNA 1I1AD 1WFNA 3UAJD 3ME0A 2DB8A 1KV3A 1S78C 4WCYL 4WUUA 5ANMA 1FZKA 1DQMH 3DX6B 4NUGL 2CK0H 1MHHB 4YHYC 2H26B 1EPFA 2OS7A 3MRHB 2EH8L 1JRHL 3MUJA 4M7LL 3MRBB 4NRXA 2HRPL 2P8MB 2VISB 1VSCA 1TVHA 1AJ7H 4LSPH 4MAYD 3ZYOA 2PW1B 2F53E 2IH1B 1U92A 4I0PC 4L8BA 4MVBC 3RVVC 5IVXA 1AE6H 1AP2B 4NRZA 1UB6A 1P4LA 3UBXI 3QXTA 5I75B 5KZCD 1UKTA 2VDOL 3BEVB 3MXVL 4JZNB 3ULVF 1AIFA 5EU6A 5J56B 4OCRL 2R29L 5F9WC 4HWBH 4QRPB 1BQHA 3LKSB 4FFWD 1R3JB 4LOUD 2DQFB 5CBAB 2C9AA 1IAIM 3IVKB 5KJRL 5CZVL 5J7CC 2M1KA 5EO9A 1HSAB 3VGAC 2E3VA 2KBGA 2NZ9C 2DQGL 4LPVA 1DANU 4Q58C 3ZTNH 4NC1E 1YPZB 4PV8A 2F8VA 5EUOB 2DWDB 3MQIA 3M17B 2V2XB 4J8RB 5DMGC 5ICXA 1H15A 1HXMA 3F7RA 3G6JB 4X99A 4OLEA 1CXEA 1HI6B 4BA8A 3O3BA 1Z0MA 4O4YL 4ELKA 5GRYA 2WBWB 4EDXB 2DQCH 5DDHB 3L9RB 4G5ZL 5HGGS 2DMKA 4Z78B 4PRDA 1CICB 1NGPH 4YEFA 5FF6A 1F6AB 4BELD 4M6NH 4PJXB 1UENA 2Q3ZA 5D9SB 1UM5L 4FS0A 1I3RA 3DX9A 2J88H 5C0AE 3RWJB 1FV1A 4XCYB 1X5XA 4ZUTA 4PJHA 1HHGB 2MFNA 2XKUA 4WJ5A 5HHQA 2OXGA 3RI5K 3MRCA 3QXAA 3CMGA 4IIQC 2ICWA 5CP7B 4OD3L 4U1NB 4G6AD 4Y5VA 5J57B 2FO4B 3S9DB 3IAPA 3QHTC 2OL3B 5B39G 1KFAL 2VAJA 4FP8L 5T1DH 1QRNE 4IS6B 3H42H 4JANA 4G9FA 4PRID 2FL5A 3JTSA 3VXSA 5SWZA 5EB9A 5DRWA 4PJ8D 2XN9E 2BK8A 2YRPA 4I18C 3NFNB 4XP9L 2Q20A 2YPVL 5E1AA 3H0TB 2AEPL 1D9KC 1TCRB 1YMHB 4DUVA 1NLDL 2NY5L 3O8XD 3FO0L 5JZ7C 4X7CC 5GS0H 4RISH 4UIMB 3K2UL 4I48A 3NFPB 2B5IC 3MRMA 3TJEH 2JCCF 5DGQA 3RIAF 1FVCB 4WFHD 3I6GB 2IBZY 5FYKL 4PJDF 4OF8A 3CUPB 3NCCB 2GQHA 1FRGL 5I8CA 4G9DB 4PP2A 3M1BA 3NAAH 1SJEB 1U8OA 2F54D 4YXLH 4OB5H 3N85L 4UILL 4KKCC 3UTTB 4WFFD 1DVFA 1IGML 3LPFA 3RFZC 2MHAA 4HJ0C 4Z7OE 3BZFB 1CZ8L 2ADGB 3MODH 4Y16C 1F5WA 3P30H 1RHHB 3FOMB 3BW9B 1OD7A 1FVEA 1FZMB 4NC0B 1T7WA 5ADPL 1JHLH 3V6OA 1EEYB 5T3XH 3U0TB 4XC3H 3ZO0A 25C8L 5T1KB 5DRZA 4L29A 3H3BC 4G42B 4L3ED 1WITA 5DHVA 4X5WA 3FONB 3DOSA 1OGTB 5F1NB 3GSNH 4KDWA 3CFKB 2R56L 4ENEC 1UJ3B 1FCCA 4X6DA 2E6PA 1B2WL 2XXMB 2AKRB 4M7JL 2A6KA 2AJZA 4G6MH 3WJJC 1A9EA 2W65A 3VMPA 2AJVL 3SKNA 5HDQL 3QEGH 4JO4H 5ESVA 3UX9B 4JY4A 1JNLL 1OWRM 5BO1L 1DN2A 3WNMA 2RHEA 4NJAL 4DKFH 1L9NA 4OCSH 3QRGL 1MAJA 3AMLA 3OGCB 3D69A 3O6FB 4IHOA 3V4PL 3AFLA 1AGCA 4YXKL 1P5UA 5IB3B 3BVNA 1RK0B 2J4WH 4X9IA 5A2JH 2F74B 2HVJA 2YA0A 1NMBH 3CU1A 1DUYB 3BMVA 4JG0L 3REVA 4JGMA 4ZAKA 12E8L 1Q0YH 1X4YA 1NMCB 5F44A 5HVFB 3LQZA 5KS9F 4UU9A 3LCYA 1HHIA 3HC3H 1T80A 3NFSL 2IQAB 2I60H 1PQZA 1BEYH 1J05A 3NVQA 5LGHH 3QH3A 5J8OA 5HHMD 5IF0A 1CU4L 4PTTA 4MWFB 3WUZA 1MRCL 4CW1B 4JFOA 3U36B 1DBAL 2DM7A 5HD8D 4ZFZA 5I1KH 1QLFA 1QSEE 3D87B 4OIBA 2C7UA 1AFVH 1SBBA 3N1MC 1IM9A 3CPLB 4KI5F 2NY2B 3O9WA 3N9GH 4AQ1B 2BSRA 1S78D 4F3FA 2AJ3A 3TZVC 1HH9A 4JFXB 1OAQH 1HIML 5C0AA 1ORQA 4H8WC 4GSDH 2HT4C 1QOKA 4R26L 1ONQA 4HXBL 3VXMB 3QB7C 1HCFX 1G9MC 4NBZB 4P3CL 4I0PD 4NKMB 4MVBD 4NM4H 3RVVD 3H7BB 5D5MB 3IXTB 4R4BA 1Z2KA 1JFQH 5I19H 5IESL 4BFEA 4JDVA 4PJAB 4MMZC 3E8UL 3NGBB 1QRNA 3T2QA 3B8SA 1F4XH 2WBJB 2XN9A 4N0UE 5ECJE 3HNSL 5C0GA 3WFBH 1GZPA 2FRGP 2BCKB 4FFYH 3EOAA 4ESKA 4OZGF 2NZ9D 1EFXA 3TBWA 2ZUSA 1S5HB 2I9LA 2X70B 3BPLB 4XNYL 4GAJH 4CU8A 3WFHB 4X5LA 4ZTPH 2G75A 3CFEA 3SE9H 1ZMYA 5DMGD 4TVPH 2Q6WB 5CP3A 4HSQA 3RY4A 1A9BB 3EYVB 1MEXL 3S35X 1VKXA 3S36H 4XX1G 2EICA 2VITA 2X2YA 1X5HA 2J8UB 4RX4A 3ECBB 1JHKL 1WLHA 1RZKC 3VFWA 2BOBA 3L3KA 1A6VL 3D39B 3T0BA 1K4CB 5GRWA 1VGEL 1RZJH 4XNQA 1YNKL 5E5MA 1LEIA 1ZWIB 4YX2H 3HI1B 2FWOA 4UUJA 1C5DA 4M4PA 3F7YB 1SEBB 3BYTA 2R4RH 3IXAA 1EEZA 3MUZ1 4WGWB 1XCTB 2OM5A 2DTMH 2GW5A 4UOW0 3P77B 4MQXC 5DS8A 1L7IL 1SJHA 3ARWA 3PG2A 3I2CL 3VFVA 3VXUB 2WP3T 4GRMA 4MCYA 4PV9B 1ZLWK 5MI0B 3OXSA 2JCCE 5I1JH 1MHPH 5IFHH 4BSJA 2PYFB 4PJDE 4WFED 2V6HA 3HNTL 5JZ7D 4FA8A 5DJ6B 3UMTA 3MLZH 1G7HB 4A2LA 3ZMRA 2NXZC 5D2LB 4Z95L 1ZA6B 4NO0D 4WEBL 4LCUB 1JGVL 3RDTB 3MJ9A 4K3DH 5C09B 4BFIA 1U6AH 1GGBL 5JXEA 2B0SL 2Y7QB 1CFNA 3CFCH 3NABL 5I8EB 4DQOH 3U4EB 4LASL 3RAJH 2ED7A 5GSRA 5I30L 4KKCD 2WUBL 5HYJB 5A2IH 1UXWB 3OKOA 4P2YA 3LEXA 4BUHA 4U3CA 3SKMA 1CDCA 1ZKAA 4UBDC 4HG4J 4HJ0D 2PXYC 1QNZL 3C60A 1NJ9B 3L3JB 3W5NA 2VKWA 4Y16D 1S7VB 4GS7C 4CL7A 3M45A 5JLZA 1DVFC 4ZD3L 2EH8H 1FIGL 2H9GA 2HRPH 4DVRH 3EOBA 3HRZB 4E41E 4PJCF 4TULL 5LWYL 2X1QA 1L6XA 4JR9H 4HS6A 1LE9B 1JK8B 4R6UA 1ETZA 5FAAA 3PF2A 2IAND 4ODSL 3F7VB 4ENED 4XHQA 4CJ0A 4NQVA 1QSEA 1NCCL 4JN2B 1DLFL 5DZLA 2O61A 3QDMB 2R29H 4OQTA 1QUNA 4WW1A 2DWEA 1HNGA 4JQVC 5IM7B 1BJ1H 1BFVL 1KIRB 5KJRH 1VGKA 5CZVH 4MJ6B 1AGEB 4JPWL 5I1CH 1FYTB 2DQGH 2H1PL 3D2UA 3UCRA 3OKLA 2DQIL 4Y1AB 4MCZB 4AQOA 5KSVA 1RJLA 4YR6B 43CAB 1N64H 2W91A 3LZFL 4Y4KA 4NWUL 4I13B 5GRVK 1KCKA 4GFTB 5DJ2A 3LS4L 2Q8BH 1KSRA 3HNVL 3GMPA 1DSFL 4D9QE 2J7LA 1CVRA 5KS9E 1QPPA 3RHWK 4O4YH 3B43A 5FYJD 3UDWA 4MX7B 1KGCE 4TUOA 4ZO9A 4JRXE 4AENA 5JNYB 5LBSL 4G5ZH 1YYML 5F3BA 5B39A 3IGAB 1BIHA 3HG1E 3RWGB 1BQSA 1X7QB 2NY3C 4FQ1H 5DI8A 5LKNA 2BNQB 1E27A 1JWMB 2DKSA 1UM5H 4N0UA 5IVZA 1JHTB 4CMMB 5F88A 1JZ3A 1IQWL 1KTLB 2IPKA 4G8GD 4LCWB 1HNFA 3S37X 3OTTA 4UT9L 3U30B 2CDFB 2H2SC 3RWIB 3DYOA 4IM8A 4UQ2A 2GY7B 4ZAKC 4XXDB 3OGOE 4KI5E 4U6HA 2XFXA 3GMQB 4NHUA 3ZYIA 3ZDYF 5C08B 3KPMA 5F7DA 5EO0A 5E03A 1Q9LB 2F9BT 4NC1C 4TRPL 1KFAH 2V7HB 4XHJC 3PIQB 4FP8H 4N0FA 1BVKA 2JELH 3PL6B 4LQFL 4WENB 4E42A 2D9CA 2X4QB 4MJ5A 4NKDB 3TZVD 4OM1L 4M8QA 4U3XA 4XP9H 5FUOL 5F7LB 5FB8A 1TTFA 4G6FB 5DK0B 3KYAA 2AEPH 4RMRA 5IWLA 2HT4D 1HDMB 2NY5H 4XTRC 3O9WC 1LHZA 1ZHKA 1NC2D 4P5KB 3ARDC 5JMOC 2QL1A 4JLRA 4ETQA 3LKNA 1I75A 1KG0A 2MPAL 5EC2A 5I1GL 2WIIB 2AJSL 3VD4A 2J8OA 4YHIA 4DGYH 5FYKH 3ES6A 4XWGL 1FJ1A 3PV6A 5HY9A 4Z9KB 5D6DA 3DI3B 4P5MB 4KK8C 1XGUB 4DFIA 4K71B 5IB4B 2XQBL 1A2YB 1U8NB 2JB5L 3LV3B 4DK6A 2JCCA 1EJ6A 3P0YL 5CEYB 5EO1A 3BD5A 4PJDA 4LLQB 3TNMB 2EDEA 3ZZ1A 2CO7B 3FFCE 4XNUL 5L2KE 1YPZF 5GJSL 2V2WA 3VRJA 5EUOF 2G2RA 1FL3A 4JJ5A 2UWEE 5D1ZB 3MV11 5ADPH 2VZ1A 2VQTA 4PTUA 3NCMA 25C8H 3ULVL 4E9LA 3ZE2E 1F6LL 3K4DA 1D5MB 3TBYA 1IC4H 2ORBL 1C16A 1RUKL 3RNQB 4KRPB 2R56H 2PR4L 3NCYS 1T20A 1B2WH 4PJXF 1NBZA 4M7JH 3B2VH 1L0QA 3IF1B 5EOTA 3V79C 5HPOA 1WK0A 4O2CA 3O3DB 1ZVSB 1PLGL 5HYEA 1Q9OB 3QHZH 3KHOA 4CNIB 4GUPA 1XF5B 5EIVA 2WIMA 2VZVA 2Z8SA 5BO1H 5HHNA 4ZXBA 4NJAH 3ARRA 3QRGH 4K8RL 3RIFK 3BHBB 3N0PB 3IFOB 4JAMA 3VW3H 1DBMH 1D5XB 4MQXD 4BSVB 4E41A 1JN6A 4ZFFA 4YXKH 3T4AB 4HH9B 5HHOE 2DLEA 4GQ9L 1CXHA 2FLRT 1NGXA 4LARL 4IMLB 3T0EE 1UWEH 3WIHA 1IE5A 1JPFA 3HR5A 3DBXB 1KCLA 3KG5A 3LSOA 5EZJB 4G9FD 3SCMB 5KSAA 1KT2B 1MWAL 5IGXL 5DJDA 4P59L 2NXZD 5ADOH 3TVMC 1G6VK 5GRUH 4EXKA 4NWTH 2CRIA 5FO7B 1R24B 2BVQA 4MAUL 1I8KB 5DJYA 1CU4H 5E2UL 2YN5A 4OSUL 4YE4L 1MRCH 1PX3A 1AHWC 1M1SA 5HXMA 2DQDL 5KS9A 1YEIL 3EDEA 3HB3C 3O2DL 4NIKB 2D0FA 3P9MB 2VZSA 3RPIB 5C86A 4JRXA 2Z8RA 4HUXB 1ND0A 1T2QL 4UBDD 5ENWA 3CU7A 4PJCE 2PXYD 4X9HA 3WO4C 4NSKA 3HG1A 1HN1A 1QKZL 5MEPB 4LCCC 1V8HA 1J8KA 3SO3B 1IGIL 1JYWA 1JGLL 2GJ6D 3BPCB 3N1FC 3HR6A 1DVFD 1WC7B 3TF7C 3QBTB 2DJSA 3Q6FB 3FZUC 4JY6B 1DQLL 4N0YH 4NHCL 1A7QL 4HXBH 4XRCA 4QRTA 2YD5A 4P3CH 3HAEH 2XKNA 4HEME 3TBVB 1TQBB 3CDGA 2QLVB 1HKLL 1A4JB 5IESH 3F6IA 3SGJC 4I0CC 5FGCB 5I8OH 1KJ2L 1TVBB 3HNSH 3RGVB 3MRFB 1YMMB 1FAIL 2J3SA 1P7QA 3CVHL 4BUGA 2YEZB 2XPGA 1QZ1A 3AB0C 1NKRA 3U9UB 3WIIL 5D2NC 5DHYA 4ZS6C 5FYJU 1CL7I 2YRZA 4TPRL 4HGWA 2W0PA 4Q6IC 4KVNH 1RURL 1U3HC 5JPNB 2K7QA 2DL2A 4Z7VB 1XIWA 4YAQA 3VJ6A 3MRJA 2A74B 5KG9B 3ARBB 4RAHA 1JZ5A 1MEXH 4XC1H 2F53D 4YLQT 2NY3D 5INDA 3ZDYE 3VXNA 2CUHA 4XB8A 1BFTA 3D0LB 3DJ9A 1WIOA 4JKKA 4Z76B 4KRNA 1JHKH 2NQCA 1GGCL 5F8RC 2H2SD 1N8ZB 4OQ1A 4OZ4A 1OSPL 4ZAKD 1YNKH 1FCGA 3QWOB 3GRWL 3VDCA 4FTVB 4HBCL 2CKBB 1IEBA 3FFCA 5L2KA 4ORZC 5BJTA 4HUWA 2APTA 2UWEA 1N6VA 2VIRA 3WHE1 2Z31B 4WRLA 4XHJD 5E9DB 2ZP0T 4LF3B 4MMXC 5IQ9A 3IDXL 1NDGB 1L7IH 3VGDA 1S7SA 2NW2A 4OJFL 2NXYB 2ZNXA 2X1XR 3ORJA 1YEKL 3PWPB 4H1LB 4C83B 1SYVB 1ES0A 3CH1B 4XTRD 2VLLA 3O9WD 2D7TH 3HNTH 4EIGB 4YHLL 4G80A 3KS0H 1FNFA 4I4WA 3ARDD 3G6AB 1CLOL 1UB5A 4A6YH 5KVEL 4HKXA 2P24A 4QRPE 3TIEA 2YPKB 1INEL 3GJEA 4LPWA 3GSUB 1B9ZA 3QULA 1JGVH 4KUZH 5DJZB 4G43A 2DQTH 1RMFL 5D5MF 4HV8B 1GGBH 1CFQB 5HGDA 1Z3GH 2B0SH 3E6FB 3DIFB 1RUQL 1YPZE 4KK8D 4PJAF 5HHOA 4LASH 5GGRY 5EUOE 5I30H 2HG5B 5BRZD 3T0EA 4YNYA 1AGFA 1DQJB 5JHDA 3NA9L 1QNZH 2KQNA 3SGEI 1NQBA 4EI5B 1ZT1A 4HAGA 5SX4I 3SGKA 3BESR 4ZD3H 4M93B 5IBUB 4RAVB 4PJXE 4IBLT 4S1SL 3I02B 4ONHA 3DMMB 4TULH 5LWYH 5HDBE 2XWJA 3KYOB 3VU2A 3TP4A 3IJHB 4AEHL 2Y9RT 3VG9C 1E0OB 3QXVA 1K8IA 1NCCH 3GMMB 5D7KE 1DLFH 1EMTH 4NDMB 4UMGA 4Z7UB 4PJCA 4FMKA 1QFWI 3D6GA 3QUYC 2AQ1A 1BFVH 4X7DC 3UPAA 3SBWA 4JPWH 1WBYB 2DQIH 2HH0H 4Y5XC 4JFQA 3LZFH 4NWUH 1PVHA 5EU5B 2ESVD 3PWNA 3JWOL 3LS4H 5HTSA 3HNVH 1DSFH 3HKFA 4Y89A 2DKMA 4NN5B 1QQDA 4G8FA 1YEDB 3GKWL 3E6HB 1UKQA 5EZLA 3ULUC 3MZTA 3ALWA 4MD0A 5LBSH 5ID0B 5T3ZE 5IW6B 3GJFA 2Q7NA 3P11L 4WEUD 3VE0B 3IFNL 3MR9A 3TVMD 32C2A 3BQUB 2CIKB 3BKCL 3K8MA 4UT9H 2VDLL 2NY4B 1CLZL 4PJ9A 5IROA 4R7NB 3HC0B 1KB5L 3UTTE 2BXYA 4M1GL 1I7UB 3BISA 3KLAA 3MFFB 4QXUL 1HZHL 2DICA 1VESA 1I8LA 5I1EH 2C3VA 3HB3D 5B8CB 1KBGL 2WQ8A 4TRPH 3VMOA 2EE3A 2OI9B 2A73A 3A6BH 5KBNC 1PKOA 3O41B 4Z0BH 4QRRD 3HMWL 3S34L 1NUGA 3ILPA 3NCBB 3UROR 4LQFH 3DRQA 4XBGA 4KZEL 2R1YB 3Q48A 1MCWW 2AJXL 5D7JA 1LWRA 3DVNA 1Y0LB 1N5YL 1N5AA 5FUOH 2C1OA 4CADB 1DCLA 1BZ7A 2EYSA 3FZUD 1DN0B 1T3FB 2ZOLB 4KJYA 3ARYA 4MD5A 1OL0A 4KHTH 3OR6A 4HS3A 3T65B 4OZHF 1OAYL 3C6LB 5I1GH 1ZLVH 3IDYB 4H20L 2AJSH 2AQ3A 1T83A 3H9HB 1Q9KA 5H2BB 5FOBB 1S9YB 3DUSB 2XRAL 1VFOA 3DX6A 4KI5C 5LGJB 4JE4B 2H26A 3JZ7A 1BECA 3MRHA 5E2JA 1EVUA 5C92A 1KN2L 1WWBX 2BY1A 3MRBA 3TV3L 2XQBH 2JB5H 5B22A 4Z77B 1QSED 2PW1A 3P0YH 5E5RB 2IH1A 3NACL 5EBGA 1AP2A 3S96B 4PREB 3TO2B 4ZS6D 4XNUH 3BEVA 5MEOB 1T0NB 4UT7L 1I3GL 2MQ0A 1U3HD 1BWWA 4QRPA 5J89A 1R3JA 4WI9A 2DQFA 3WD5L 3WFCL 1J8HB 3MGOB 3IVKA 4GW4B 1HSAA 3ULVH 4R7DB 1J0HA 3O4LB 3VD5A 4NNYB 4OF5A 1EHLL 3VFTB 1CD8A 2ORBH 4GAYA 1YPZA 2FECL 3EFDL 4RSVA 2PR4H 3QG6B 3LHPL 5EUOA 1CGUA 2DWDA 1XIWC 1A6WL 3M17A 4ZOBA 1GZQA 4KMTL 4YHOL 2KL6A 2V2XA 4KUCF 4Q9RL 3WL9B 1T1WB 4DN4L 1HI6A 4M5YL 1QVOB 4YHZL 3BWUC 1PLGH 1UJTA 2VR5A 1MCDA 5DDHA 3L9RA 2ZSWB 3QUZC 1EZVY 4Z78A 1CICA 2Q86B 4GKOA 4GRWF 1J10A 1F6AA 2BHZA 4K8RH 3C09B 4PJXA 5D9SA 1X4XA 2DD8H 4HEPG 4IEFB 3VFRB 5JDJA 3RWJA 5I18L 3GK8L 1J0ZA 2FYYB 3PHQB 3VXME 1XGPB 4GQ9H 1CGWA 1DBKH 3TBSB 1H3PL 1TQCC 1A47A 4OF6A 5F93C 5CP7A 5I15L 4U1NA 5D5ME 5IFAL 2EKSB 1J7VR 1MWAH 2FO4A 1JYXA 4R9HA 4P59H 3KLHC 1EGJL 2OL3A 2GUOA 4PJAE 1INDL 5I17B 3MRKA 1XH3A 1N0LA 3QZWA 2JJSC 1OQOA 4WI2A 3PXJA 5FO8B 1KULA 3DRTB 1A1OB 4IS6A 3RWDA 3QFJD 2H8PB 1NEZB 1H8NA 1GAFL 5I8KL 2NY7L 3NFNA 4OSUH 4YE4H 3L5WB 2Y6SC 3H0TA 4HQQL 5I16B 1TCRA 1YMHA 1BOYA 2DQDH 1NLBL 1A6AA 1NBVH 1YEIH 3O2DH 1N2RB 3TYFA 1IGTB 2XXCB 3SOBL 3TT1H 3OJ2C 4XNZC 1T2QH 1YNTB 2JTDA 3NFPA 4XP4L 1QKZH 4DCQB 5B3JE 4Q9QL 3C5ZC 2Y5EA 3I6GA 5CKGA 3UTPE 4EZMA 3CUPA 1JGLH 3T0EC 1S9XB 1J1XL 4G9DA 4Y19B 1QACA 5T5NF 1FGNL 4NHCH 1A7QH 1SJEA 5L9DL 2J8UE 4U6YB 3D85B 2ZCHL 3CDFA 4MGXA 3SKJL 4RNRB 3J8F7 1AO7D 3A0OA 4WWKC 1KJMB 4WY7L 1PDKA 3BZFA 4EVNB 1CXIA 2VL5B 3RY6A 2X4OB 2ADGA 2EYRB 4NM8L 1RHHA 3FOMA 3FQTB 5DXWA 1RK1A 3KYKL 3DPBA 1FZMA 2FH6A 1F3RB 4YH6A 2X10A 1KJ2H 2VUYA 3QUYD 1QLRB 1U9KA 4XP6L 3V6ZB 5BV7L 1FAIH 3U0TA 3CVHH 3VDBA 5T1KA 5J4MA 4G42A 2DM2A 5EBWB 3FONA 4YGVB 3CFKA 1A3RL 4DGVL 3WIIH 2P43B 1UJ3A 2I07B 2CXKA 2AKRA 4KTEL 4CU6A 1RURH 3BFOA 5T5NG 4HXAH 3DLQR 4IOIB 3ULUD 3BD3A 4Z8FH 5D2LE 2EEBA 4YFLI 4E41D 2GI7A 3AC0A 2X4UB 3P4LA 1FO0B 4P2OB 4LKCA 4LHUB 5C09E 5J9PB 1I85A 2GFBB 2VNCA 3OGCA 3O6FA 3BWAB 2AK4B 5E94B 4GH7B 1GGCH 3UP1A 1IEAB 1MJ7H 3BPNC 2IPTH 4HULB 2VR9A 1OSPH 4FQIL 1OT2A 3RTQB 3GRWH 3F5WB 4P4KC 4OCWL 3C6SA 4HBCH 5HYJE 3BOVA 3LRHA 3AY4C 2F74A 4X0KB 1DUYA 1KPUB 1RU9H 3Q5OA 4MA3B 3BKYL 3FJTA 4TYUA 3IDXH 2IQAA 1LO2L 4OJFH 3H9SD 4Q9BA 2OTPA 4D9QD 3O3AB 1I8LC 2A38A 2J6EA 1YEKH 3UYRL 4P4RB 4F7EA 4LKXB 3WS3A 2HLAB 4F57L 4M9OA 1KGCD 4J1UB 4JRXD 4MXWH 1GC1C 1MLCB 3SDXB 3U36A 1X5IA 2Q87A 1G7QB 2KKQA 2XY1A 4HD9A 5D7JC 3K3QA 4IRSB 1CLOH 3PABB 4HLJA 1INEH 4HC1A 5A1AA 1AGDB 5F3HA 3CSPA 3K4AA 1U41A 4KI5D 4JFXA 1FYTE 5H35B 4AIOA 1MLBB 5EU3A 4LMQI 3VXMA 3LPGA 4HWEL 3SQBA 2IEPA 3NA9H 2VXUL 1ORSB 3OJVC 2YS4A 1W2KT 4LLDB 1FFQA 4NKMA 4F7MB 5GIRB 5D5MA 1MI5B 3IXTA 2WZPD 4JKLA 4PJAA 2VN7A 2BNQE 3MRGB 4S1SH 3FB5A 1NMAL 1CR9L 2WBJA 2ZZUT 5GRXG 2BCKA 1RZKL 1ED3B 3DTXB 1JPTH 4LCWE 2Z35A 1S5HA 4LRNH 2AAVA 1U8MB 1X44A 3WFHA 1F3DH 4MNQD 1OQXA 1XIWD 2IFGA 5BQ7B 1R0AL 5C08E 2DMBA 1R3LA 1XF2B 4HPYH 4P2CG 2Q6WA 3ZHLA 2R0ZL 2LE9A 1DEEB 3GO1L 5E0QA 4FQCL 4M7LT 2YD1A 3FFDA 1A9BA 3QUZD 3EYVA 1FG2B 5CSGA 1LP9B 4GT7A 4NT6B 4OUOA 4DKDC 2HFEB 3VH8B 3JWOH 3S97C 2J8UA 3FFCD 5HGAB 1KTDB 4HFWB 3LIZH 3RQ3A 1CICC 4ZUSB 1K4CA 3C5SB 3GKWH 4FG6C 1ZWIA 1VEOA 1VEPA 1ZAGA 3HI1A 4NN7B 1I1FB 4K3JL 3ZE1E 2HJKB 3B6SB 3P11H 4YO0B 3MREB 1LNUB 3F7YA 4C57C 1E28A 1W0VB 3IFNH 3NIDE 5DRNB 3KLHD 1XCTA 3SQOL 1C5BL 1MJJB 3P77A 4OIIH 2J6EL 3O2VL 3BKCH 1YEFH 1MIML 2VDLH 1ZHNA 1BF2A 1CLZH 4EQ2A 4PV9A 1KB5H 1TITA 1OP5H 4M1GH 4AEIL 3GHEL 4YDLB 3U4BL 2Y6SD 1E6JH 2E6JA 3QNXB 1TZGL 3WNPA 5DJ6A 5C3LD 1LD9B 1G7HA 1F00I 1N3NB 5D2LA 3HI5L 1ZA6A 3S34H 1Y6MR 2HKHL 4LCUA 4LLMB 3K0WA 4GKZB 3C5ZD 3ZHDA 3KNBB 5TF1H 3TIDB 5C09A 4TUKL 5T33L 3T0ED 4I3RL 3DGGB 3BO8B 1Z6JT 4GW5B 2Y7QA 5JIIA 2VXVL 5I8EA 2YKLL 4NZJA 4LAQL 2B39A 4H1LG 1JBJA 3MJ8B 2Q8AL 5HYJA 4PGBA 1OAYH 1WFUA 4K3EH 2R0WL 4H20H 3QUMA 1QEWB 4WWKD 1WIUA 4JCLA 3SKOB 5IQ7L 1NJ9A 1KPVA 3L3JA 2Q7YB 5IMOA 1E4XH 2XRAH 2O5XL 4WI3A 3UTZB 3WO3B 4ONFL 3TN0C 1S5IL 4PR5B 5MP6H 4LPCA 4M7ZC 3X3FL 1KN2H 3TV3H 3MBXH 3QUXB 2CDEA 4Z7UF 3OKDB 3QDHA 2VJXA 4G6JL 4EUPH 2YZ1A 3GBNL 4UZGA 1LE9A 1JK8A 5HHVL 3FN0H 3DO3A 1TNMA 3HUJB 1WV7T 2I25N 4UT7H 1I3GH 1EHXA 2XTJB 2Y72A 3JWDC 3SJVD 1QD0A 4G6KH 3A6CH 3OAYH 3WD5H 2NMSA 3ARFA 5IM7A 4X8JB 1KIRA 3OZ9L 4MA1C 1AGEA 3ZKSD 5IBUG 1FYTA 4ZS7L 1EHLH 2NX5B 5DFTA 4YR6A 43CAA 4D94A 3LHPH 1A64A 1A6WH 4YHOH 3QDJA 1V7NL 2VE6B 5C0BB 1PBYA 2LFGA 5TE4H 2ZCLL 8FABB 4L8SB 3QEHB 2DDQL 1BGXL 4MSWB 4P4KD 5KANG 1I85C 5JNYA 5CJ8A 3V5KA 3O6FC 3I75A 5FDWA 3IGAA 5JOPD 3K4ZA 4WI7A 3RWGA 1X7QA 4QRSB 2BNQA 4UT6L 1KB9J 5GGRB 3D48R 5FM8A 4GLRH 1JHTA 4CMMA 3A6OA 1KTLA 4JZOA 4FFZL 4WHDA 5I18H 2V9RA 3GK8H 4LCWA 1BVLA 3V0VA 5C9JA 4PJIB 5IMKB 3QNYB 3RWIA 3QP3A 1NGYB 4XXDA 3M8OH 1NMCC 1H3PH 2V5YA 3GMQA 5C08A 4KXZI 1MRFL 3I85A 1V3JA 1JF1A 2HJLB 3HLAA 5I15H 2XA8L 5IFAH 1I3VA 1Q9LA 2VLRE 5IKCB 4UV4H 5D7JD 1EGJH 2WP3O 3NH7H 2V7HA 3B9EA 3PIQA 5JW5B 3H3PH 5ALCL 3ARQA 5FGCE 3ZE0F 2AXGB 1K5NB 4H25B 4ZUVB 3PL6A 1JF5A 2X4QA 1YMME 2DLHA 5I8KH 2NY7H 1A6ZB 3SGDI 3R0NA 5DK0A 2GYSA 3O6KL 3BDBA 1HDMA 2GAZA 2NY2C 3QUML 3MTRA 5B38B 4P5KA 4I3SL 3HI6L 4XP4H 3P4MB 2C3HA 4PGDA 3T8XB 5F6IC 3U7YL 4MHHG 4Z7VE 2W9EL 5IMLB 1MAKA 1J1XH 1RIVL 1UG9A 2VKXA 1GH7A 2YWYA 1WWAX 4HIXL 4P5MA 5FKPB 5TPWL 4NQTA 2VR4A 1XGUA 4ONGL 4P0DA 5IB4A 3EYFB 1A2YA 1U8NA 1A6PA 1OPGL 5LAXB 2DQJH 2ZCHH 4XNMB 3LV3A 1CYGA 3SKJH 1ZXQA 2NZIA 5CEYA 2XNAB 4X4ZA 5E8NB 5FO9B 4LLQA 1VADB 4QRPD 3TNMA 2Y4SA 3MXWH 1DBBH 2WBJC 4FTVE 3KHQA 4NM8H 4XXCA 5D7LB 1RULL 3DV6A 3ILQC 5E08L 5D1ZA 3BPLC 3PWVA 2P46B 5BV7H 4RGNB 3GMOA 5E9DE 2G9HB 5DQJB 3JV6B 1BJ1J 2YPLD 1IEHA 1U2CA 2VL4A 1NCWL 1V05A 2VZ3A 4NKOB 3DUUB 5FYJH 3PWPE 4KKLC 1OLZA 3RUGF 1A1NB 3IF1A 1KXVC 4KTEH 1FLRL 1CICD 1T7VA 3ISWA 4FG6D 3O3DA 1ZVSA 1MFEL 3QHFL 2VLJB 1I3UA 1Q9OA 4NPYA 1CD0A 4CNIA 4KQ4H 1CDBA 1XF5A 3NPZB 1NAML 1A7NL 3T1FB 4U1LB 1J9CT 5D1QC 1HILB 5EOCJ 2PW2B 3BHBA 4KC3B 3IFOA 3ZKXB 1JNJA 5C0JB 1MCSA 4BSVA 4X83A 5MENB 2MWCA 5CMAB 1H3GA 5D7KD 3T4AA 4HH9A 1FLTX 1IGJB 5IBLC 5HYSG 1CGVA 4I2XB 1ACYL 2APVA 4OCWH 4RZCA 5F7WC 4IMLA 3MLYL 3PP3K 3EYOB 1HKFA 3DBXA 1VFAB 5EZJA 3GKZA 4HCRL 4PJ5B 4Y2DB 1RZ8B 4FFVD 1KT2A 1K3IA 4L5FH 5MI0C 2JK5A 1FBIL 3B9KB 1B88A 2R0LL 4NQDD 1KENH 3GSQA 5FO7A 5E7FA 4ZDHB 1R24A 3UJTL 2P1YA 2P4AB 1I8KA 4KZDL 4F57H 1L4IA 1UVQB 3QIBB 5SWSB 5DGRA 3UC0H 1AKJD 1XZ0A 3IKKA 2PCPB 1NCDH 1WFTA 3RDTC 4RGOL 3P9MA 2EYTB 4RQQB 3RPIA 4FQHA 2HRLA 3SDAA 4HUXA 4OLXH 1BZ9B 4Z7UE 1R3HB 5EC1B 5HGBB 3SDCB 5I71B 3IDNB 5KSUB 5MEPA 3TN0D 1VFBB 3BPCA 3UTTD 3OJDB 3QQ4B 1WC7A 5AZEL 3Q6FA 4JY6A 3FO1A 2B1HL 3BN3B 3IDJB 1XAUA 3RU8H 1FSKC 4HWEH 1H8OA 5L0QB 1BFSA 2VXUH 3TBVA 1JNNH 5L6YL 3G9AB 4PBWD 2VLRA 4PRPB 1A4JA 3REWA 4WVRA 4ELMB 5F7YC 5T1KD 4KK5C 1YZZA 2HMIC 3X14B 3OKNB 4UI2A 1NMAH 3JWNC 3GHBL 3RGVA 3MRFA 1YMMA 3RL1A 4N9GB 4MDJB 3HE7C 1RZKH 1CGXA 4PJGB 3W0WB 1MJUL 2V17L 1NBQA 2C4FU 4JREC 3U9UA 1WUNT 1R0AH 3P3YA 2QKIB 2VUOA 3O6MH 4PY8I 3GO1H 3DVFA 5JPNA 1A8JH 5M95B 5K9OB 4QYOB 4Z7VA 4OUUB 3FOLB 4RRPG 1EIBA 3O6LL 5I76B 2A74A 3O6FD 1KNOB 5KG9A 3ARBA 1P9MC 4PY8J 4Z0XB 1JWSB 3D0LA 1S7XB 4KHXL 3MACL 4G7VL 4Z76A 4QRUB 3BIAX 2FSEB 1N8ZA 3ZE0E 4TNVK 4K55A 3QWOA 4FTVA 2CKBA 2Y36L 4K3JH 3VXRD 2AW2A 1VERA 1AD9A 3L1OL 2XIDA 3U30C 3FQXB 1IRAY 2IBBA 4PLOB 4Z7QF 3UO1H 3SQOH 1C5BH 5E9DA 3SDXF 3B8YA 1P2CB 4LF3A 1N7MH 3O2VH 1JJUA 3WFEL 1NDGA 1F42A 1Q0XL 1JWUB 4LHUG 2PO6C 1RIHL 1U36A 4F58L 4AEIH 3GHEH 3PWPA 4H1LA 4UQ3B 4C83A 5IB1B 4ZTOH 3E3QC 3CH1A 4LRIC 1T22B 1TZGH 2NY2D 4P23A 3PL6C 4RCAA 2DM4A 5EPMB 3ZYZA 2IH3A 3HI5H 3G6AA 4KROC 2YPKA 3RX5A 2ERJB 1KXQE 4M4RA 3GSUA 4JG1L 5DJZA 4LPYA 3VXMD 1J8HE 1QHPA 1IM3B 2Z0BA 4I3RH 4HV8A 1CFQA 3O4LE 3STLA 3E6FA 3DIFA 2VXVH 4U1SA 1NGQL 1KPRA 2HG5A 1X3DA 2Q8AH 2E7HA 5KANI 4OGXL 1DQJA 3R1GL 2R0WH 1KCUH 3N1QC 5IVXB 2W0FA 4EI5A 1P4LB 2WBJD 2ZCKH 4R96A 2O5XH 1L0XA 4ONFH 1S5IH 1BJMA 3ILQD 1QBLL 4RAVA 2R1WB 4Q97A 3QISA 4X7EC 1TJHH 3I02A 5ACLA 3DMMA 3KYOA 1PJ9A 4XXCC 1GOGA 3IJHA 3GBNH 3FO9B 1ZV5A 1YEGL 5D1ZC 5HHVH 3ULUL 3L7EA 3WDIA 4AEEA 4CN1A 4KKLD 1LP9F 5FYLE 3GMMA 3QCUL 2CRZA 4UTAL 1ZK9A 4Z7UA 5CLWA 4HAFA 4Y4FA 4ELKB 5A2FA 4KRPC 2EECA 3HN3A 4NGHL 4N90E 1KACB 1WBYA 5ERWB 4OD2A 1KC5H 2W07A 4ZS7H 5D1QD 3D39D 4I5BA 3T2NL 1QHOA 4XP5L 4EI6B 5EU5A 4K9EL 1I3RB 3DX9B 4C55A 2JE8A 3BIKB 5F71A 1U8PB 2IMMA 2ZCLH 5IBLD 4MNHA 1YEDA 5DD0L 3E6HA 2VH5L 3MRCB 3QXAB 5T5FH 2H45A 4AJ0A 2GCYB 4TSAL 5ID0A 3WMSA 4LSVL 1RJZB 4OF7A 3PV7A 3VE0A 1JV5B 4UT6H 3VXUD 1IQDB 4MXVF 5FGBC 1M7DB 2X4PB 1F45A 4Y19E 5FA4B 3BQUA 3LAFA 3SO5A 3VXSB 1P69B 3V9FA 4BH8A 3GMRA 4FQLL 3SCMC 3VH8G 3LKPA 4R7NA 3HC0A 1F11B 1I7UA 2EDOA 3MFFA 4OV5B 4BYHA 1MRFH 2WM0A 4X7SL 2IG2L 2MKWA 3TFKC 5GGUB 4UB0L 1YJDL 4JN1L 4UAOB 3RDTD 2X40A 5C09D 3KS0J 5ALCH 4I48B 2DIJA 5F7EH 4K94C 1DL7L 3QIUB 3ESUF 1CTOA 4APQB 4L4VB 1Y0LA 5SX5K 5HYJD 1RQ5A 3O6KH 4CADA 1EBAA 1DN0A 1T3FA 1U8OB 5FCSH 4OKDA 2ZOLA 3MRDB 4NUJB 3T65A 4M02A 1KN4H 4I3SH 3C6LA 1XT5A 4L8CB 1T0PB 3HAEB 5DUBB 3U7YH 5H2BA 5CWSB 5FOBA 1S9YA 3DUSA 1AR2A 4O9HL 5I1AB 1PG7L 1O7SA 3GNMH 2RB8A 4KK5D 2HMID 4RBPH 4W4OC 5J12B 1TQBC 1CT8B 4HIXH 2P5WD 1SY6A 2EC8A 4JFED 1W72A 3WKNA 2R8SL 2QEJA 1OPGH 3HE7D 3GBMH 2E27L 2FB4L 2IC2A 5GSVA 2UY6A 3QDMD 2BSED 5D8JL 5E00A 3S96A 3IAGC 4PREA 3RGVC 5FK9B 3TO2A 1OTTC 2BNRE 5MEOA 3TCLB 1FYTD 1WAAF 3T4YB 1RULH 5KSBF 4PS4L 5E08H 5JDSB 3WHXB 4Y1AD 3LY6A 5E8DL 5MERA 4OLUH 1KIUA 1J8HA 2C3XA 3MGOA 4GW4A 1CL7L 4R7DA 2OK0L 5F1KC 1K4DB 4ZOEA 4NQED 4PJBF 3VFTA 4J3SA 1LO0L 4OGAC 4NRYB 3LEYL 3QG6A 1WISA 4L1HA 1WEJL 5CBEB 5HVWA 2DI7A 4Z7QE 1F6FB 3AS2A 3ARBC 3WL9A 1IILE 4WNQB 3SDXE 1T1WA 2BNQD 5T1MB 2OMBA 5DVKA 1T21B 2ZPKL 3QT2A 1MFEH 4JRYB 1IMHC 5ABDE 1SJVA 2EDNA 1NAMH 1A7NH 2OBGA 2CSPA 2Q86A 3MRLA 2XT1B 4ZNEE 4RMQA 3LQZB 3ARGB 4KH2A 3S5LG 4YZFF 5A43C 2WBKA 5D1XD 1J05B 1CXFA 2FYYA 1KJ3H 3ZT5A 2PO6D 3PHQA 5GPRA 3T08A 5DJ0B 3BPOB 4ZOAA 2Z31C 5A16B 3TBSA 4UOJA 1B0RB 3WSQL 2HFGH 1ZLUH 3EHBC 4HCRH 1MI5E 3EYSH 3TESA 2NXYC 2EKSA 1I8IB 2VDKL 5C9KA 5I17A 1FBIH 4KROD 5FO8A 2R0LH 4QHLB 4G6FD 1A1OA 4X98B 4AZ8A 4RMVA 3MV01 4AIZB 1NEZA 3UJTH 4KZDH 4O5LL 2Z8WC 4FXKB 1D3CA 1ORQB 3W82A 1HHHA 1UH3A 3L5WA 4PB0L 5I16A 1ZTXL 2QSCL 2COQA 4LU5L 1N2RA 3C9NB 3BRGC 2BJML 3O4OB 5C0EB 4P2RD 2FX9L 4DCQA 3HCVB 3K46A 2FR4A 4NFCA 1SY6L 4F80A 3D0VB 5TE6H 1W72L 4YBQC 1S9XA 4Y19A 2I9TB 5DTFB 5AZEH 1LP9E 1GYAA 3SHSA 1D6VL 3FKUS 1GPOL 4NP4H 2XN9B 3TA3A 5HGHB 5C6TL 1GZPB 3VI4E 4RDQF 3I9GH 3D85A 4U6YA 1OP3K 4RNRA 1WICA 4M93C 1KJMA 5D1ZD 1CS6A 5L6YH 4S11A 4EVNA 3IDGB 4NYLB 5B38G 2VL5A 3OV6A 3BGFB 2X4OA 2YUXA 1WZ1L 1I1YA 1PY9A 3DMMC 3FQTA 4LNRB 3RBSA 3B4NA 4RRPA 4JM2B 1OVZA 4Y5YC 3GHBH 3MOAH 1QLRA 4KRPD 3GSXB 3OQ3B 2VDPH 1YYLL 3O0RL 1MJUH 4F15B 1WVZA 1QFWL 4JQIH 1IKFL 7FABL 3NCFB 2CIIA 5D70L 2I07A 1RVFL 1P84K 2VQ1B 4MXVE 2BOBB 3L3KB 5EU7C 2DOCA 2B4CL 4XVTH 2XZAL 2XZQL 4OFKA 4IRJB 4IOIA 4POUB 1Q1JH 2PF6A 3HTLX 3O6LH 1QA9A 2X4UA 1G6RL 3OG6B 2AEQL 4YBLB 3FRPG 4NN5C 1FO0A 4P2OA 2IBZX 1EEZB 3IS0X 1CVSC 2DQUL 1CGTA 4LHUA 5C2BL 4EDWL 2GFBA 4ZFGL 2YR3A 1GC1L 3MACH 4ZPTB 3BWAA 2VSDA 1R3IL 5E94A 3MYJA 3VFVB 3SCMD 1PYWB 1X6NA 2RCSL 4HUVB 4D0CB 3UTSA 2DN7A 3RTQA 4XPAL 4LGSB 3F5WA 4OM0H 1WTGT 3IKCB 2Y36H 2EDFA 2BNRA 4X0KA 3WUWA 3QXDA 1J12A 3L1OH 4WW2F 3VXQB 3TFKD 1KPUA 4P57A 4HUUB 43C9B 1DDHB 4K7PL 4B5EA 5DD5L 3RZCA 2E7MA 5EUKB 4MA3A 4M03A 3WFEH 1JGEB 2VLME 3O3AA 3BEWB 4F58H 5B8CC 3FAXA 4P4RA 4XMPL 5F96L 4D9LH 4LKXA 2HLAA 2BRQA 4J1UA 2BNUB 2CLZB 4B0MM 4XPGL 1GHFL 5KAQG 4GAFB 1MLCA 4HWUA 4XGZA 5T3XE 2MOVA 4MB3A 3SDXA 3GI8H 3FRUA 4HS8H 3GGWB 1G7QA 3HUJE 5F70A 5TQ0H 3TWCH 3LEXB 4IRSA 3PABA 2XTJE 5AAWA 2GY5A 1QBBA 3BZDA 1WJ3A 3O3EB 4LIQL 4N8PA 1AGDA 4ZNEA 4K3HA 1A0QL 1N6QH 5JLZB 5H35A 1MLBA 1CIUA 2V7NB 1A1MB 2NX5E 3VMNA 1F97A 5AYQA 1H0DB 1WAAE 3JBG7 4NZRH 3GI9L 4ZUWB 5KSBE 4O51B 4OGXH 4YPJA 4KMLB 3G6DH 1CFVL 4LLDA 2BERA 5GIRA 1MI5A 5C07B 4PJGF 3RGVD 3HS0B 1DFBL 1HINL 1OTTD 3C87A 3NIFE 3V0WL 2EDQA 4NJ9H 1G7IB 3K80A 4K3GA 2C3WA 3MRGA 4WW1B 4PJFB 2VTFA 2IALA 5FUZL 4HWBA 1SHMA 1ED3A 1N6UA 3DTXA 5FGSA 2ZG3A 4GJTB 3EDKA 4PJIE 1RJLB 1YEGH 4BK5A 3ULUH 4OGAD 1U8MA 4KMQA 4Y4KB 4WGVB 3QCUH 1XF2A 1MFDL 1BVZA 3ARBD 4LLAA 4QRQB 1ZA3B 4K23L 1DEEA 2GJZB 4YZFE 5ITBH 3MRQB 4DEPB 4TUOB 1FO0L 2JKXA 1MUJB 1JPSL 1FG2A 4J3VA 2ZSVB 4S1DC 1LP9A 3SEPA 2BVTA 3T2NH 4NT6A 1F8TL 2A2QT 4N0UB 5IVZB 2HFEA 3VH8A 4X6BA 4FTVD 2A6DB 5I6XB 3BAEL 5HGAA 1KTDA 4HFWA 2IAMB 2X9YA 4ZUSA 5F72S 2JIXB 4HIHB 3VD3A 2XFXB 2Z31D 5CJXA 3BXNB 1CDJA 5HVHB 5F7DB 2HJKA 4OZFB 4LCYA 3EHBD 1K3ZA 3B6SA 4LSVH 2R2BB 3C8KB 3MREA 1LNUA 4GQPH 1ZLVK 4F7CB 2NXYD 1OCWL 5SV3A 5DRNA 5HI4C 1B4JL 3PWPD 4N0FB 1BVKB 1MWAB 3FCTB 5CCKL 3NTCL 1T66C 1CDYA 2JJVA 2UZXB 5HBBA 1MFBL 2UUDH 4FQLH 4E42B 2HWZL 2Y5TB 3AVEA 4I0KA 3DHMA 3PXHA 3NIGF 1OGAB 1HOCB 2IG2H 1MVFA 2XWTB 3QNXA 1MPAL 1YEEH 1I1AB 5J6GB 4UB0H 1YJDH 4JN1H 1LD9A 1N3NA 5D7LE 3NN8B 3MNVB 1H3XA 2APBA 1DL7H 3VWKB 4LLMA 1IGYB 4YHIB 4TVPE 4RGNE 4F7PB 3KNBA 1RY7B 4HF5H 4YBQD 4J4PC 4LGRB 3DGGA 4GW5A 4C56E 1H3UA 3MLUL 3SE3A 2JJTA 3V8OA 1HHJA 5HPMB 3BGMA 2B1AL 3MJ8A 5BOPA 1AJ7L 4LSPL 1UYWL 3D5OF 3JWDL 1NBYB 1QEWA 2QTEA 4TN9A 3SKOA 4OKVA 2Q7YA 4OZIF 2VLJE 4M6AA 3UTZA 3HHRB 2DAVA 3DMMD 1PKQA 2BDNL 5KOVC 1QSVA 4PR5A 2DRUA 2F15A 4PGCB 4DFHA 1EO7A 4WWID 1HYSC 2HYMA 5DEZA 4KJPC 3T09A 4PTUB 3OKDA 3Q2CA 3C08L 5MENE 1LO4H 2Z9TA 1KJ2B 2E27H 2FB4H 3PGDB 4Y4HB 1MY5A 5D8JH 5EIIB 4I2XE 3CVHB 3S98A 4K2UL 4JFDD 1T20B 3U6RB 1MRDH 4H5SB 3HUJA 4PRHD 2FIRT 1LGVA 1NBZB 3GSNA 2EH7H 1WBZB 1I7RB 4PJ5E 2FCBA 15C8L 3DWTA 4KDTA 5DSCA 1CL7H 1BQHG 2OK0H 2ED9A 4J3XA 5HHNB 4ZXBB 4DWHA 2HN7B 1LO0H 5I73C 3W9EB 3LN9A 3LEYH 4JAMB 3PWUB 4NN6C 1WAAA 2VLKB 5KSBA 5LXGH 1EXUB 5HI3C 2VE6A 5SWSE 5ESAA 2DJ4A 1F4WH 4L8SA 3QEHA 3MOQA 4P2OC 2ZPKH 5CZKA 5FM5M 4MSWA 4XMLL 3BH9B 4PJBA 4KRLB 1NCUA 4X6CB 3Q0HA 3HR5B 1J87A 2O5ZL 1V3LA 1MOEA 4QRSA 5GGRA 1VCAA 3IFPB 3RTQC 4I77H 5GISH 3H42L 4DUXA 4HKJB 3HE6B 4JB9H 4PJIA 3QNYA 4HLZG 4N68A 3RIAK 3O8XB 3WSQH 2V5TA 4R2GB 5KS9B 4PRPE 5IKCA 5GS0L 1FL5A 4ELME 5KTEL 5JW5A 1ND0B 3BZ4B 3SY0A 5ENWB 2AXGA 2A6IB 2XG4A 4H25A 3HG1B 4TSBH 2NTFB 4N5UA 2VWEE 4WTXA 4M7KH 1YECL 3IU3A 4IRSC 4PJGE 3W0WE 4PB0H 2QSCH 2AGJL 5JOFB 4YXLL 4FZ8L 5KVGL 4JCMA 2BJMH 5B38A 4M48L 1JTOA 2D3VA 3KPRD 3P4MA 4WFGE 3T8XA 4L4TD 3OB8A 3LKRA 5DF0A 3S8WA 5IMLA 3G5VB 4BH7B 1V7ML 3P30L 4OAWA 4ALAL 4EN3C 1D6VH 1GPOH 1NFDF 3SGEH 1JHLL 3ARSA 3I6LE 2NR6C 4J23A 5JA9A 1P7QB 5LAXA 4XC3L 4XNMA 4ERSL 3OBAA 5SX4H 5J1TC 5FUCE 2XNAA 3CSYB 4UOW1 5E8NA 5FO9A 1VADA 3GSNL 4JZJC 1WZ1H 3INUH 1J8HD 3HMXH 4LLVB 5D7LA 3O4LD 2GK2A 4OZGB 2DYPB 3QEQB 1M05B 2OR9H 1JGDB 4GBXB 3FRPA 3G08B 2BVEA 2G9HA 5JMRA 3MRJB 1YYLH 4EKXA 3QO0A 3X11A 2H6PB 3O0RH 2NNAB 5IHUH 5JUEL 4C56A 5INDB 4S1DD 4DKFL 4NKOA 1QFWH 1IKFH 3DUUA 3HZMB 2QQNH 5D70H 3G9VA 1RVFH 1RZIB 2ARJB 1A1NA 3ABZA 2B4CH 2H32H 2W59A 2XZQH 1Z9LA 5DZOA 2VLJA 4MQSB 4HUWB 3IDIB 1JZ4A 1G6RH 2AEQH 3EO9L 3L5JA 3V7AG 2YD6A 4U1LA 2VIRB 3N06B 1VEMA 2YSSB 1HILA 3QJFB 1Q0YL 2PW2A 2DQUH 5HI4D 5C2BH 4EDWH 5C0JA 4XBEH 4ZFGH 1GC1H 1MCEA 3O2WL 5MENA 4NN7C 1R3IH 5CMAA 5IQ9B 5FYLD 5FYKE 1T66D 5HHMB 1BEYL 3S4SB 1IGJA 4I2XA 3MNWB 5LGHL 5ICYA 4XPAH 3RX7A 2JF1A 4LEOA 1ES0B 4N90D 1VFAA 1KB5B 4YDVA 1KYOK 3TC9A 5DQDH 4PJ5A 4Y2DA 1RZ8A 3BRDA 4K7PH 2MJWA 5JXAL 5DD5H 1E4KC 3EW3B 3FO2A 3B9KA 4YDLC 3VWJB 4AG4H 3GJEB 4YHYB 3OX8A 5DJ8B 1CLCA 4ZDHA 1JRHI 3I3DA 4XMPH 1OAQL 4WW2A 1IARB 3VFMA 4J4PD 5HGDB 1UVQA 3QIBA 5SWSA 4GSDL 1QR4A 5I1DB 2PCPA 4I0PB 1GXEA 3ZHKA 3N1GC 1ADQL 4D0DB 4QOKD 4RQQA 1AR1C 5JHDB 4WV1C 2KH2B 4HFUH 3FB7B 3CVIL 5E8EB 1BZ9A 4NBXB 1R3HA 3DGCR 5EC1A 3SDCA 5HGBA 1D6EB 4LIQH 5DA0B 5DVOA 2DQEH 3DSFL 1YN6B 1A0QH 3D85D 1VFBA 2XV6B 3OJDA 4MB4A 4UIKH 3VGAB 1HYSD 3IDJA 4KJPD 3WFBL 4JM2F 5ALBL 4FFYL 4D8PB 5GS1A 1CFVH 5DYOA 4GAJL 1I7ZB 4PRPA 4ZTPL 4EUPB 1DFBH 2UZYB 4NQXB 3QUXC 1CWVA 1HINH 3SE9L 4ELMA 2ATPA 1MNUL 4MQTB 5KVFH 4LVNB 3OAUH 5BZWB 3OKNA 2SEBB 1U8KB 3ET9F 3TT3L 4P5TC 4N9GA 3V6BR 3C2SA 3AM8C 3VXSE 4PJGA 3W0WA 5DQ9B 4KGLA 1ZE3C 3WNOA 2RIKA 1NKOA 2OSLB 5DT1L 3I3EA 5D7IF 5HI3D 4KDTC 4MLSA 4PGJA 1MFDH 1QQDB 4K23H 5TDPB 1MCJA 1FIEA 3GMNB 4P2OD 4XAKE 3QWRA 5IVOA 4BFBD 5K9OA 4R4FH 4OUUA 4LHUD 4YX2L 3FOLA 3JTTB 4R3SB 5I76A 3GJFB 1CGYA 1KNOA 2AK4D 2QR0B 4N1EA 1UWXK 4Z0XA 2R4RL 4E5XB 3UPRB 1F8TH 4L4VE 3RTQD 1S7XA 2DTML 4BK4A 32C2B 3JV5A 3QNZB 2OLDA 4KTYA 1AD0B 1RPQA 4I18B 1FQ9C 1IVLA 1P1ZA 3VCLB 2FSEA 3I3BA 3WEXB 5I2IB 4XNXH 2FBOJ 5IFHL 1OF2B 4J2XA 2X4TA 3IAQA 5IEKB 4DN3L 5T1LB 2XZZA 3FQXA 5BW7A 1OCWH 5IVNA 3O81A 2Z8VC 1B4JH 1TZIB 3KPSD 4LQ1A 4RGMC 3ILPB 5FM5O 5CCKH 3IU4H 3EUUA 2AXFA 3KPPB 3DRQB 1JWUA 4CKVX 1LEKA 2F19L 3F12A 3V6OE 3B5GA 5AD0B 3DVNB 2EXYC 3JUZA 1N5AB 2FX7L 1U6AL 5EBMB 5IB1A 4IRSD 3SN6N 3CFCL 1MPAH 1T22A 2E7CA 3KPQB 4KJYB 2E9WA 2BC4A 4DQOL 4ZOCA 2DS4A 3W39B 5EPMA 2EDTA 5FEBA 2X05A 3V4VH 2W9DH 4B7LA 4OFYD 4Y16B 4LK4A 1D5IH 4GKNB 1M4KA 3JV4B 1MVUA 3DX7B 1Q9KB 3V7AE 1CD1B 1MCQA 1G0YR 2VDQL 1IM3A 4OI9A 4EN3D 3VFGH 3MLUH 4DVRL 2B1AH 3B83A 2NR6D 1NCAH 1UYWH 3CZJA 3QFDA 4NQCD 4PJFF 4JR9L 3JWDH 3PNWB 3K74B 3H8NA 5DJXA 3GJFK 1CF8H 1IC5L 1JPGB 3FN3A 4I8DA 4JRYE 4DZBA 1D7FA 2BDNH 2YXFA 4LSDA 2R1WA 4JFZL 4WU7B 5E6ZA 1AXIB 1CGSL 1UC6A 3C08H 3PJSB 5I1CL 4Q7DA 4Z7WF 5BV7B 3FO9A 3E0GA 4GAYB 1N64L 4K2UH 2ICWI 4RGNC 1GZQB 4F33B 3AS3A 2CO6B 2IGFL 2Q8BL 5KOMC 4BSWB 4GRLB 4FMFA 4RMWA 4CGTA 3FQNB 1IBGL 5GXBB 15C8H 1KCVH 3RY5A 3EZ8A 1RV6X 3NZ8B 2ICWJ 5ERWA 5IOPB 3PE9A 5EOCL 3T3ME 2BRRH 4FQ1L 2WNGA 4EEEA 1D5BB 1QSFA 4EI6A 3WNKA 1U8QB 3BIKA 2WUCL 4O02H 1U8PA 1RZJC 3LN4B 4P46A 4BQBA 5GJTL 1G7LB 4KY1L 5C0FB 5IR1B 4QHNA 2HA1A 4XMLH 2GITB 3ZKXC 2GCYA 4M6ML 4PJ7F 3CXHK 4K94L 2O5ZH 1ZOXA 3TH2T 2BZDA 1RJZA 1UGNA 1JV5A 2A77L 2YD4A 1IQDA 5ISZB 1M7DA 2GUOB 2X4PA 1RJCA 1XH3B 3MRKB 3QZWB 4DJMA 5FA4A 3TZVB 4DW2L 3RWDB 2JELL 3SPVB 1C7TA 3Q5TA 5CJOL 2QQLL 4Y2DC 4MJ4A 1GIGL 2EDLA 3QXUA 2AQ2A 2Z93B 3D9AL 3UXFA 1F11A 4OV5A 4JEGB 1A6AB 4U1MA 1J88A 4Y88A 5GGUA 3TYFB 1NFKA 3L5HA 1XR8B 5KTEH 4OZFG 4IMKC 1AR1D 2BFVL 3QIBC 1MCFA 2AEIT 3VGFA 3QIUA 1MCBA 4APQA 4DGYL 3BKJL 3B5HA 2F5AL 4L4VA 3EAKA 1YECH 1II4E 1L9MA 1MH5A 4L4JA 3SDDA 1BIIB 3I50H 4S10A 4OBRA 1T5WB 2AGJH 3GEWB 5I71C 3MRDA 4FZ8H 5GGVH 4NUJA 5KVGH 9CGTA 4M48H 3QYCA 4L8CA 3HAEA 4J3WA 4XPFL 5DUBA 4YK4C 5CWSA 3QUXD 1V7MH 5I1AA 1RK1B 4ALAH 2BVOB 1CT8A 3S88H 1ZANL 5T3XD 3MV8D 4P5TD 5DEGB 4N5EC 3QAZC 3QXWA 4ERSH 2W1NA 1I8MB 1IC4L 3UBXB 5TJWK 4M5ZL 2AK1L 4KAQL 3QDGD 5GGTH 3PWJB 5FK9A 3TBTB 2VWEC 2JB6B 3TCLA 3WXWL 3B2VL 3T4YA 3ZTJH 4BZ1H 5JDSA 3WHXA 2NX5D 1S9WB 5D93C 3S36X 1WBXB 3QHZL 4YDIL 4P49A 5C0BD 1A02N 3IRZA 5CKAA 5JUEH 1K4DA 3K8KA 2NW3A 4LKCB 4OCMC 4P2QB 4X6CF 1BBDH 4NRYA 3VW3L 1DBML 3LQAC 3F6LA 3D1MC 5CBEA 3RWHB 4BQ8A 4W4NA 1F3JB 4WNQA 2UYLB 5CINL 5TGBB 3MLVL 5T1MA 1T21A 3C6SB 1EHNA 1C5CH 1UWEL 1CD9B 4JRYA 5IP4A 1BLNB 4AL8L 4Q2ZB 1ZVYA 3EO9H 1Y18A 5FUCC 1REIA 3U48A 3SE4A 5ADOL 3ARGA 3AREB 1A3QA 3O2WH 2VO5A 1IT9L 5GRUL 4NWTL 3VXPA 3MV7D 5DJ0A 4F7EB 1JMZA 2EXYD 5A16A 3WS3B 1H5BB 1B0RA 3TJHC 3WNLA 3FTGA 5C07E 3B2UC 5JXAH 2PXYB 4YHNB 1I8IA 1FNSL 1P4IL 3BP6B 4QHLA 5IFJB 1RUAH 4X98A 2GJ6B 4PJFE 5F3HB 2BXZA 4AIZA 1E4JA 2E6QA 4FXKA 4UDUB 4FQPA 2A6JB 1C12B 4N0YL 5EU3B 3ULVE 4NO2A 3C9NA 5F7UA 1ADQH 3FHAA 1J1PL 2LV4A 2JJWA 3CVIH 1LK3H 5C0EA 1JCKA 3MMEB 3WJLA 3HCVA 2YBRB 3DSFH 4OCYL 2ADFL 4M1CC 3D0VA 2I9TA 1T2XA 5I8OL 5DTFA 4TOYH 3OR7A 2A1WL 3FB5B 5HGHA 5SV4A 5ALBH 2EDKA 1WCBA 2XKSA 2Z35B 5EA0H 1BF8A 5HDLA 2HT2C 1Z5LB 3IDGA 4NYLA 2EDJA 1N4XL 4RGND 1YA5A 3KLDA 1INQB 1R3LB 1MNUH 4LNRA 2P8LB 1VPOL 4JM2A 4KVNL 3DXAD 2VABA 1TTUA 3TT3H 5C0IA 2E7BA 2RGSA 2NY3B 4HGKC 2EIDA 3FFDB 5K9QG 3GSXA 1QFPA 4HK3N 4JKMA 4XC1L 3RWEA 2XG5A 1YC8A 4OLYL 5ACZB 3CAFA 5DT1H 3QR2A 4HIJB 3MJ7B 2VLJD 5D71L 3MBEB 4QF1B 1OGAE 4PBVC 2VQ1A 1V3KA 2GK0A 2XYCA 1ZT4A 2Q76A 4OT1L 4IRJA 4HZAA 4PLKC 3JVGA 5J13B 4EBQL 4IJ3C 1N0XL 3RJDA 5MEND 2Y06L 4GXUM 3IJSA 4BZYA 5D7IA 1E28B 3BP5A 1IL1B 1UCBL 2V2TA 1WT5A 4ZPTA 3PDGA 3P73A 2ID5A 3OPZH 5I9QB 1ZHNB 5DJCA 1KUMA 1PYWA 4KK9C 5EBLB 4PJ5D 4Y2DD 4HUVA 4Y5VC 4D0CA 1OM3L 1C08A 3IKCA 4PJEB 4PG2A 3DI2B 1U95B 1D9KD 1KELH 5EN2B 4KGJA 5EU4B 4DN3H 3ARDB 2D7TL 3VXQA 4YPGB 3GMLB 3LD8B 4HUUA 43C9A 1DDHA 2XWBB 1N59A 1ZS8B 1G9NC 5EUKA 4GXVH 4XI5C 4A6YL 3HPLB 3X17A 4KXZH 3QIBD 4DAGH 1JGEA 5SWSD 2F19H 2AABH 4KUZL 3T3PF 3X13B 3BEWA 4UAOC 2DQTL 2EIZB 2FX7H 2BNUA 2CLZA 3S4SG 1Z3GL 1GOHA 4PIRF 2FDBP 3CC5B 3Q3GB 3QIUC 4NO5A 3GGWA 3I84A 1I9RL 4APQC 4PGBB 2FGWL 3SGDH 1KXTB 3QUMB 5E2TL 1KPVB 3O3EA 5IMOB 5IB2B 2VDQH 5E56A 1FN4A 4YFEA 1CE6A 3QQ3A 4U2ZA 5F7FA 3S3SA 2V7NA 1A1MA 5LVEA 4OZHB 2E7LA 3O11B 1H0DA 2VLKE 2CDEB 4ZUWA 2F58H 1G1CA 3BSZH 4O51A 1JE6A 1RIUL 3BH8B 1QFUL 4N5ED 3TNNB 4FQ2L 2Y25A 5ITFB 1KIQB 4K7PY 2ATKB 5EZOL 5C07A 1IC5H 3HS0A 3V6OC 2UZIH 4X6CE 3TYGL 5IIEA 2VB5A 1G7IA 1EMTL 4P9HC 1JZ7A 2YK1L 3W0WD 4O00A 4JFZH 2AP2A 3ARFB 4PJFA 1CGSH 2K3TA 3EGSB 5IJVA 5CIPH 2DBLH 2ESVB 2HH0L 5E2VL 3CX5J 1X5GA 5CEZD 4WFGD 4PYHA 4U4BA 2VOTA 3QDJB 2IGFH 4UTBH 5KVDH 1T03L 1ITCA 1S7QB 2P5EA 4QRQA 1ZA3A 4M8VA 4XCEB 5F8QC 2GJZA 4FQXB 5H94B 4TTDC 4FHBD 1IBGH 3MRQA 2CD0A 3I6LD 3PWLB 4WFHE 1MUJA 3V5KB 3I75B 5FDWB 1T4KB 4B53A 5EOCH 2MNUA 2ZSVA 1NC4D 3TVMB 4ZFOL 3VGGA 3MCG1 2OZ4L 5E6IA 1NAMB 1NGZB 2A6DA 4JZOB 2C3GA 5IHBA 2WUCH 3F62A 4BQ9A 3W2DL 3V0VB 5C9JB 1BVLB 3WKMH 2IAMA 5GJTH 4KY1H 1AHWB 3FT3B 1IAKA 1S7TA 2JIXA 4HIHA 4PB9H 3SE4C 3BXNA 4GRWB 4IRZL 3ARGC 4M6MH 4K94H 1JF1B 4OZFA 2ARJQ 3HLAB 1J1OL 3TJHD 2R2BA 3C8KA 5I1EL 1XEDA 2A77H 4Q6YA 4QRRB 4F7CA 3B2UD 3A6BL 5CGMA 4LCCB 4Z0BL 4DW2H 1MWAA 3FCTA 1YUHA 4YDKL 1FVDA 5CJOH 2QQLH 1CG9B 5DMYA 1GIGH 2Y5TA 4U7SA 3D9AH 5EWIL 1Q94B 1OGAA 1HOCA 1IAII 4ZODA 2GAZB 2XWTA 1RUMH 1NCBL 1I1AA 2WANA 5J6GA 4WUUD 4NKIL 3UTQB 1B6DA 1NUDA 1SBSH 3KJ4B 4KHTL 2YA2A 1QR1B 2BFVH 5I1HH 3NN8A 3O2DA 1RJYB 3MNVA 3IDMB 5CEXB 2LU3A 5HSFA 2YWZA 4OZGE 4PGDB 5FYKD 3VWKA 3QEQE 4YHKL 3C2AH 1IGYA 1FHGA 3BKJH 4F7PA 5DMKB 1EAPB 2F5AH 4M1CD 1ZLSL 5J1AB 5TQ2H 3B5TA 3O4OC 2QHRL 2BHYA 5HPMA 3WJLC 4JY5L 3WE6B 3ZL4L 4TQEH 3AB0B 3DUHA 3L3DB 5EU6D 5D2NB 1M71B 1NBYA 2HT2D 4XPFH 3W9DB 4HKZB 4Q6IB 1U3HB 3WN5B 2I27N 2YRLA 2FJFB 2EEAA 3DV6B 4PGCA 1ZANH 3PWVB 4W6YB 3GMOB 4ODUA 5GGSB 5CZXC 3D25B 1C1EH 3Q6GH 1KJ2A 1Q72H 5HHME 1UEMA 2PTTB 3PGDA 1CE1L 4JM2C 4Y4HA 5EIIA 4M5ZH 1CTNA 2AK1H 4KAQH 3CVHA 2D03L 1Y6KR 3U6RA 4H5SA 5HJ3B 4XMKH 3WXWH 3HRPA 3T0AA 1MQKL 1WBZA 1I7RA 1MJ8L 4PLKD 5F9JB 1W0WB 2ADIB 2YZ8A 1J5OL 4NPYB 4F7TB 4YDIH 2D0GA 5FV2A 2DF3A 1ITBB 5KN5B 2OTUB 3QO1B 3T0XA 2CK2A 3F8UB 2HN7A 4WDIB 3W9EA 1AI1L 1SMOA 3PWUA 4H0IA 2DD8L 2VLKA 5AYUH 1EXUA 1NL0L 2C1PB 4KK9D 5CINH 4YBLC 4WU5A 1YEJL 3MLVH 1ACZA 5F1IA 4RZCB 1DBKL 3L5IA 4DGIL 3BH9A 1K6QL 5JHDE 4X6CA 4AL8H 4BZ2L 4F37K 1IGFH 4U33A 2DIBA 3GRWA 2FX8L 4H88L 3VXSD 5SWZD 5DEFB 3IFPA 2GTZB 4PRIA 1U58B 4M43H 2JK5B 4XI5D 4PG2C 1IT9H 4I3GA 5EDXA 4HKJA 3HE6A 3GSQB 5E1HB 4MA8L 3IFLL 2FEEL 3O8XA 5DVNA 1BBJB 2IF7A 5KVMC 1A4KB 1MCIA 1YN7B 5C0NC 1XZ0B 3IETA 3U2SB 1NBVL 3QIUD 1FNHA 1HE7A 1FC1A 3HFMH 4APQD 3TT1L 4FABH 2OR8A 3ROLB 5ETUB 1FNSH 4L4VD 3WIFA 4FQHB 2GEEA 3KPOA 1K8DB 3SDAB 1P4IH 3BZ4A 5JXEC 2A6IA 1X5ZA 4XCNB 2LVEA 2NTFA 3QZWG 4OBSA 1EX0A 2HVKB 1M6OB 4N1CA 4LLUA 5AAMA 4WTZA 2IBGA 1LEGB 3FO1B 5JOFA 1LDSA 3C60C 3EO1A 1AO7B 3VG9B 5CUSH 3K81A 1J1PH 5DJAA 4Y8AA 3MX0A 2VLRB 2E7LC 2J5LC 3REWB 3G5VA 4OCYH 2ADFH 2EDRA 3KDMB 4BH7A 1U3JA 5F89B 3QUYB 4S0SD 1HWHB 5JA8B 3L7FB 3V6FB 2A1WH 5E2WL 1DLHB 2KQMA 2EDYA 3IJYB 3RL1B 4LSRL 4Y5XB 4D0BB 1FNGA 3ROOB 1MY7A 4PJHF 3CSYA 3BKMH 3P0GB 3UTOA 4WFEE 3P40A 1N4XH 2N7BA 3PP4H 2AERT 4LGPB 1MHEB 1F90L 4FN0A 1VPOH 4LLVA 1MFAH 4CRPA 1BP3B 4OZGA 2DYPA 4HXAL 4TTDD 4GG6F 3QEQA 1M05A 4Z8FL 1JGDA 3PDDA 4GBXA 3ULVC 1A6TB 3KLSA 4Y4KC 3G08A 3MFGB 4RAUB 1ZVHA 4WI8A 4KKAC 5GGVY 2H6PA 2NNAA 1JF6A 4OLYH 1O5DT 5I66B 4CMHB 4U2YA 1SVCP 1ERNA 4FOMA 3HZMA 3DROB 3UDWC 5D71H 4NOFA 1RZIA 3UBXG 2ARJA 1MJ7L 2D0HA 2IPTL 4OT1H 2F8OA 4ODHL 4I9WE 5F97E 4EBQH 4DOHE 3ARGD 1N0XH 2Y06H 3HC4H 1AD9B 3IDIA 3KGRA 5I6XC 1RU9L 1QRKA 2YSSA 5C6PB 3QJFA 3H9SB 1UCBH 4YDJB 3F58H 1PW3A 4X6EB 3S4SA 3MNWA 5A40E 1OM3H 3MZGB 2IANE 4W6WB 4MXWL 1JPST 1IM9D 3KPNB 4P23B 4PP1C 2F5BH 1KB5A 5HHPB 1WFOA 4QT5B 4FRWA 3H6JA 2HKFH 2IH3B 4FQQB 5C0AD 1BREA 3VWJA 2HTLC 3CNKA 5IWLC 3U46B 5DJ8A 4PD4K 3UAJC 3NCJH 5E99H 4Z7NF 2XQYK 3STLB 3PGFL 4U1SB 5I1DA 1XGYL 3VWKC 4I0PA 4R90H 1I9RH 1KPRB 5F9OH 4AH2B 1OAUL 4D0DA 3KAAA 2L4OA 2FGWH 5D6DC 5FYJE 3FB7A 5E2TH 5E8EA 1TXKA 2W0FB 1QRND 4QKXB 1D6EA 5IMMB 1NPUA 4DVBB 4R96B 2XN9D 4RWYL 3DVGB 1DQTA 3H9YA 2ZG1A 3HZVB 2WINB 3AUVA 1YN6A 1EFXD 4JFYA 5JTWA 1GCFA 5L88H 4G8GE 3PUCA 4PRBA 5CZXD 3BRFA 1RIUH 1QFUH 1CK0L 2ADJB 4D8PA 4FQ2H 2HFTA 1JPTL 4MNQB 4AEFA 1UWGL 1BPVA 2HJFA 4LRNL 4RFNB 3L7EB 5EZOH 1I7ZA 1T89A 4OCXL 4EUPA 4NQXA 2APWA 3TYGH 4HPYL 4ZPVB 3M07A 2YK1H 5BZWA 4Y4HC 4Y4FB 3OAZH 2FZ3B 1B6UA 2N7AA 2SEBA 1NAKH 1U8KA 3PHOA 3QUZB 1QLEL 5ISZE 4NCDA 2PYEB 1U91B 4RX4D 4OD2B 3MROA 2FJGB 1MELA 4JO1L 5E2VH 1WIPA 4I5BB 2CLVA 3GSRA 5DQ9A 4JO3H 2OSLA 3MLTA 3X12A 1CXKA 3MCKB 3WFDL 1CDHA 4JFHE 4JDTL 1T03H 4IIQA 3LIZL 2FJHB 1TQCB 5TDPA 3GMNA 4MNHB 4ZXBC 1DZBA 3OKEB 4O58L 1M7IB 5AZ2L 1DQDL 2BP3A 3JTTA 4R3SA 3STZB 5CSZB 5FYLH 2QR0A 4PJEF 4E5XA 3UPRA 2P48B 2OZ4H 3OKKA 1ZEAH 4OIIL 4X4ME 1JUFA 3QNZA 1YEFL 1AD0A 3W2DH 4I18A 4BH8B 5KSAC 3GMRB 3VCLA 3NPSB 3LKPB 3WEXA 4U1GB 1FORL 4JHZA 3QUKB 5I2IA 4IRZH 1OF2A 5IBTH 5C0ND 1E6JL 1J1OH 5IEKA 2FNBA 5A2LH 4XNZB 4D9RE 4NO0A 3HE6C 5T1LA 5JR1H 2LVCA 3O8XC 1TZIA 1X6LA 2D7OA 3QI9B 4AYFA 5JXED 4YJZL 2X9XA 4R2GC 3KPPA 1EGJA 4YDKH 3QIWB 5D72H 3CXHJ 5AD0A 4CU7A 5TF1L 5BXFA 3KXFB 5EWIH 2OCFD 2J8HA 5EBMA 1CN4A 5TH2B 3OF6A 1EVTC 1RAMA 2ICEB 2AXHA 1U0QA 1NCBH 3LDBB 3KPQA 3C60D 3OXRB 4NKIH 1ODAA 3W39A 4WWKB 3WS6A 3K2MC 4K3EL 4Y16A 3RZWA 4QHMB 4GKNA 3JV4A 4YHKH 5E95B 3CDYA 3DX7A 1E4XL 1CD1A 1ZLSH 4LSUL 5MP6L 3TH3T 2QHRH 4P2QE 3UEZA 1W72B 1S7RB 3MBXL 4JY5H 2WWMC 5C07D 3ZL4H 1AH1A 5ID1B 5FDYA 5K59F 2IANA 3EDJA 2DMCA 5DD6B 5GSVB 3BT2H 3PNWA 2M8XA 1TMCB 4Z7OF 5E00B 1IZKA 3FN0L 4KWUA 3WJJA 1JPGA 3FT4A 3MLSL 3MV9B 3VRLF 5BS0B 3D2UD 1FZOB 1QFOA 1R5WA 2V9QA 4G6KL 3A6CL 5MERB 4WU7A 3ULVD 4Y4KD 3AMKA 2A0LC 1NUFA 3EJYC 3PJSA 1TPXB 4KKAD 4L8DB 4U05A 2VDNL 1CE1H 5DR5L 2D03H 3LB6C 4LSTL 4GBXC 5E7BA 4F33A 1MQKH 4BSWA 1O7VA 4F9LA 4GRLA 3ETBF 5TE4L 5IG7B 3X3GL 2FBJL 3FQNA 1MJ8H 1J5OH 1XR9B 4OI7A 2H32B 1B4RA 3NZ8A 1HEZB 5IOPA 2GJ6E 2XOTA 2VSCA 3MRLB 3JWOC 1AI1H 1CLYL 3RUGB 3CFJB 4G8GA 1AXSB 4LDLB 1D5BA 1G6RB 1NL0H 2CRMA 2LTQB 3ARPA 3V5DA 1U8QA 3JUYA 3LN4A 1YEJH 1G7LA 2HP4A 2CDGB 5C0FA 5IR1A 3M8OL 4DGIH 5F9DC 1CFBA 2GITA 1K6QH 5TF0A 1RD6A 4BZ2H 4PP1D 5K9KA 2FX8H 4H88H 4QHKI 2DM3A 3CFIC 4UV4L 2J2ZA 5ISZA 1AQKL 3NH7L 4Q74A 3H3PL 4MDIB 1OGAD 2HTLD 3TZVA 4RFOL 3SPVA 4MA8H 3IFLH 3LS5L 4XBPB 2Z93A 1A7OH 4QHKJ 4F37F 1HHHB 4YC2C 3VFUA 2G60L 3VWJC 1NC2A 4D3CL 1OT1A 3VWKD 3ZT6A 2O5YH 1XR8A 4U1JB 5JQHC 2FR4B 4XPBL 4X4MA 1H3VA 3BJLA 4ODVH 5IHZB 1BIIA 4A2MA 3DURB 1T5WA 2OR7A 3TA3B 1TIUA 5BZDB 2EE2A 3T0WA 1IC7H 3VGEA 2DQJL 2BVYA 3SGKC 5J0BA 5JW3H 3MXWL 1DBBL 2MCPL 1A6UH 1I1YB 5DK2B 1H3WM 2BVOA 5GQBA 3S35L 4Y4HD 5E2WH 5CEZL 3BE1L 2YPLB 4JPVL 1KCSL 3LQAL 1T89C 5DEGA 4LSRH 1YQ2A 2VN4A 4LVNC 1I8MA 3UBXA 1UT9A 1X5FA 5FYJL 1P4BL 2CIIB 4PJEE 3PWJA 3SBWC 3TBTA 1F90H 2JB6A 4LP5A 4Z6AT 4ZXBD 3L6FB 1S9WA 2VLKD 1QA9B 1WBXA 3MJGX 4JO2H 4QXWA 4KQ4L 4KKBC 1T5XB 2RAMA 3HZKA 4C4KT 2NY1B 1LQSR 1VHPA 4F8QA 4P2QA 2QQKL 3D18A 3IT8D 3WDHA 4GG6A 3RWHA 5BRZE 5L2JB 2EC9T 1T04A 3MYJB 1F3JA 5KSAD 1BOGB 2UYLA 3DVIA 4ODHH 5TGBA 2Z92B 3UTSB 4X80L 3TO4B 4Z18A 2Q3AA 3P9LB 1BLNA 2BNRB 3WUWB 3QXDB 2BY0A 3D3VB 4Q2ZA 3UYOD 4DKEH 4P57B 3HE6D 3T04D 4PJ9C 2G5BB 2NPLX 3RZCB 5IROC 4NQDB 5C7XL 4L5FL 2GHWB 3AREA 3OKYA 4H8WL 4XPHL 3THMH 4J7RA 2R39A 3CX2A 4R2GD 4NFDA 2XA3A 4MQ7A 1EEUA 4OZHE 2ITDB 1KENL 4XT1C 3V4UH 1G9ML 2VXQH 4U0QB 1U8HB 8CGTA 5DMIL 1AKJB 4PFEA 1H5BA 3DHJA 4XGZB 3UC0L 3HG1D 4QCIB 3FRUB 5C0DB 1NCDL 2DLFH 2R2CA 2PXYA 3BUYB 4YHNA 2QADB 4KQ3L 3BP6A 4OLXL 5K59E 5IFJA 3B9DA 5H37H 1OTSC 2GJ6A 3TN0B 3T1WA 4M7ZB 2Y23A 2MKLC 3WS6C 2ZJSL 2ESVE 4NOBA 3KJ6H 4UV7L 3PGFH 4UDUA 2A6JA 1C12A 5F7KC 1UZ6F 4WHCA 1XGYH 1T83C 3VRLE 2WWMD 2FHBA 3RU8L 1ULVA 1OAUH 3QDJE 5JW4M 1JI2A 3U79A 1U42A 1JNNL 3DX8B 3MMEA 1DE4A 4L9LB 3VXTB 4RWYH 2YBRA 3ARZA 1I1RA 1P7QD 1KLUA 4JQVA 2YN3A 1FNEB 4MA1B 2XZCL 1IZJA 4L1DA 4X4XA 3ULUF 5DC0A 3QQNA 2IALB 2A0LD 3GFUA 1CK0H 3EJYD 5I75C 2HT3C