1F4WL

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTTSNYANWVQEKPDHLFTGLIGATNNRAAGVPVRFSGSLIGGKAALTITGAQTEDEAIYFCALWYSGHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTNPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
total genus 47
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4wL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4wL01
1QPXA 5GGTL 1TJIH 4EDWH 2W9LA 4K9EH 4NZRL 1C1EL 2Q7YA 3LKOA 5CZVH 1HXMB 3QXWA 3WHXA 4IRSD 5GQBA 4Z77B 5HHMB 5I8EA 1JZ7A 4TSCL 3H7LA 1HILB 1J1PH 3NIFE 4HWBA 5L9DH 5C0IA 2E6JA 4JPVH 4HWNA 5D5MB 1ZANH 1TPXB 1LO3H 3KHQA 1RU9L 2X70B 4GUPA 2ZG2A 1KCSL 5J89A 1KPVA 1OAUL 1T5WA 2JJTC 4FFVD 4YDVB 3VRJA 3QEHB 5DD3L 3NN8A 4JM2C 5IMKA 3RRQA 1EJOH 1FVCB 3DSNA 4TVPH 4BQ8A 2R0KH 3C9NA 3D85A 3VXNA 3BKCL 3CFDA 4MDIB 1CF8H 1FNGA 4NUGL 5ANME 3DIFA 3QG6A 1CG9B 3BN3B 4G7YH 3STBA 1MUJA 5C8JB 2Z93B 5IFJB 4N8CH 1W0VB 4UTBH 3QIWD 4L3ED 3G9VA 3W0WD 2QADB 3MBXH 3LSOA 3QI9D 3VWKB 3HE6A 5HHQB 2ITDB 4OD1L 4XWGH 1JWUB 4HIIB 1LO2H 4UTAH 2YKLL 3VMOA 3WCYA 2YA2A 3MNVB 4KU1A 3A6CL 5GHWL 5FM5O 2BJML 1CD9B 4YDIL 2B1HH 3MV7B 2ICWA 2J8UF 1SM3H 1C7SA 3RWHA 2GEEA 3O4OC 4JFOA 4K23H 3WD5H 5JHDB 4HIIA 3TCLA 2BERA 1H3TA 2O5XL 1U8QA 2VWEC 3KS0J 4LLDB 2Z35A 3BPLC 3KPRD 1S8DA 1UM5H 1CIUA 3U83A 4LLUB 1YQVH 1JGDA 2E27H 5IOPA 1AHWB 2UWEF 2C26A 3DIFB 3OQ3B 4C58B 4WJ5A 3RFZC 1H3UA 4HEME 4PRIB 4R4FH 4X6BA 3VXRA 4YHML 4WUKH 4JE4B 5E8EA 1EHLH 4N0FA 4HXBL 2ITDA 2UVFA 1TJGL 3TN0C 3TPKA 4PTUB 1KFAH 6FABH 3VJ6A 3ARDD 4OCWH 3MTRA 4U1GB 4GRLD 2B7DT 2IH3A 4JHZA 4NP4L 3SPVB 2P5WE 3B9AA 5C6PB 4UI2A 4K55A 4Z0BL 1C5CH 3OKOA 4LPVA 3TEUA 5TE4H 2OYPA 2CRIA 1IFHL 3F58H 1XIWD 1XGTB 4G7YL 2C7UA 3DXAE 1FVCA 3UJJL 4WUUA 2CO7B 3NN8B 5E4EB 5JXED 3CX5J 2APFA 2XY2A 5BZDB 3GKZA 3T09A 4YDIH 1EH9A 2VAAB 1AGBB 1BZ9B 3VFRA 1OY3B 4GUPB 4Y88A 3QHZH 3EFDH 1VGEH 2O5XH 3MJ7B 4R3SA 1RZIA 2YPLB 1EPFA 2BNQB 3HAEG 5ALBL 4ZXBD 4ODWA 3V8OA 4N9GB 3MLYL 5I1IL 4OIBA 4XPFL 4NKOB 1AR2A 2I07B 2BNQE 4OZFH 4POZC 3U0TA 3FB8A 1MHHB 5ID0A 1UB6B 5BRZA 1FNEB 5D5MA 3HN3A 1MSPA 5IVZB 4KK9C 1ZHBB 3C8KB 4XP4L 1CF8L 2DQDL 2Y06L 5AD0B 4R4BB 1BZ7A 3VGAB 4O58H 4U3XA 2OZ4L 3C60B 4HUVB 3O6KL 5C0BB 1TNNA 2GY5A 3EJYD 4P0DA 3U79A 3GBNL 4M7JH 3ILQC 4PJEA 5AUMA 2F15A 4HKBB 5IFAH 2ZCLH 3NIFF 5T1KB 5C0BE 2AJXL 3MRDA 2CPCA 1MH5B 4F9PC 1D5IL 4A2MA 3ZSSA 2FECI 3PWLA 4PG9B 3TT1L 2AEPL 3NPSC 3IFOB 1JNHB 1E6JL 4JQVC 4LVOC 2H32A 4YHIB 4LSUL 5EIVA 2V2TB 2VUYA 2BJMH 4UBDD 3FN0H 2YUZA 4PLKC 3UTOA 3MO1A 3S4SA 5JOPD 3P9MA 5D96C 2CLVB 2EXYD 1ZVSA 3DBXA 4UOW0 2AQ3A 4MQ7A 4OAWB 3IDJB 4B7IA 3H0TB 4FQIH 12E8L 3WFEH 5ABDE 2J6EL 3L3DA 3KGRA 2Z8VC 3JWOL 3C6SA 3X3FH 5F7YC 1S7TA 4WUUD 1P5UA 1OSPL 2MKLC 4X6CA 1FC1A 5GGSY 2Q76A 1KLUA 2IAMB 4E9LA 3CX5K 2MFNA 4M8QB 5KANG 3KYMB 1RHFA 2VITA 1P4LB 1AGDA 3IDXL 1AXTH 4WV1B 1BQHA 1JZ2A 3RZCB 3DX9A 3RVXC 3V5DA 1VEPA 3MFGB 4MQTB 5IJVB 1ADQH 1RMFL 1W0WB 2H32B 3GSOB 5SWSD 2HT3D 3L6FB 3PDOA 3W0WB 2YRLA 4UOJA 2PR4L 4YDJB 2KZWA 4U7KA 4WTWA 1KTRL 5IQ9B 3D87B 1DBML 3KPSA 4IEFB 3VGFA 4ZTPH 5F1IB 3QUYD 3V0WH 3SOBL 3V79C 2OR9H 1JYWA 1XGYL 2D03L 1DSFL 3CU7A 1WZMA 3LS5L 4JZNA 4PJ7F 4NHCH 4MD5B 2DI9A 4LCYA 3PHSA 3ZKXB 5MERB 3B6SB 4M02A 3EW3B 4O2CB 1ZANL 4IHOA 4WI2A 5GGSB 5AZ2L 4D9RD 2OK0L 1HH9A 2WUCL 1ZHBA 2EDHA 3C8KA 3ZE2F 4U7SA 3VH8A 4MCYB 2ZSWA 5GRUH 2NX5D 5HVFB 1MCLA 4DK3A 4XBPB 4OFVA 4YUEH 1UB6A 2D2OA 4Q9CA 1MFBL 5DJ6A 4LSSL 4HIEA 2FIKA 4PRDB 3F7VA 5EBMB 4ZS7H 3RGVC 4H25B 4JO3L 4LHQB 2P7TA 3NH7H 2HH0L 5C08B 4LSPL 2R29L 3T3MF 5I30L 3WN5B 2GTWB 6CGTA 2YBRA 2MSPA 1KFAL 2BNQD 2H3NB 4J8RA 4G5ZH 4C55A 1A8JH 4F33B 5IGXL 5FO8B 2RIKA 3FO2B 5LGKA 1IGML 1IT9H 4XNUL 1OSPH 5DD6B 5MEOA 1YY8A 5L8KB 4RX4D 5KS9A 4LSVH 4M00A 4RZCA 5DDHB 5DUMH 4GFTB 4JZNB 1G7IB 4YIQB 1M05A 1A64A 3T0VA 3GHBH 3ARFA 4XVJL 2RFXB 1N64H 3D85D 1X3DA 3KPRA 3VRIA 3JUZA 4NUJB 4MZ2A 4HF5L 4WI7A 5GZND 4QRTB 4OIAA 2HJFB 2JK5B 2W0PA 2IQAA 5GXBB 4MNQE 1HSBA 1A7NL 2YS4A 4LLAA 4JO2H 4PGEB 4L9DA 2EDNA 4HKZA 4QRPE 2IGFH 4ZUSA 2PYEA 1VFAB 5FO7A 3A6BL 1AQDB 3OXSB 5BS0E 1U95B 3CLEH 4MJIE 1A3RL 3EZ8A 1OAUH 1MCQA 5E8OB 5JW5A 3FO0L 2NQCA 2N4IA 3OKMA 2DB8A 2X44D 4U6XB 1MUJB 3JBG7 1KJMA 5GRJH 2E7CA 3CH8A 3L5IA 4HXAL 4TVPL 1URLA 3PHQA 4U1IA 5KSAD 3MZTA 4HLZH 5E2WL 3OKLB 4G6JL 5B4MD 3QFJD 4JO3H 4BFIA 5I8KH 4P59H 3HKFA 1TJGH 5D6CB 2C5DC 2HG5B 3H0TA 4Z78A 1MREL 1JPSH 2EDEA 1NGPL 3VWKC 1DN0A 3HG1A 5T1MA 2A74A 1C12B 5CFHA 1C16B 1D5MB 1YEEH 4LMQE 5IBLD 4JO4H 2YN5A 3OJ2C 4EIZC 2V17H 3G6DH 4JFXA 4OCSL 4Y4KA 3TLRA 3O2DL 4HUUA 4X98A 3QYCA 2GSGB 5J12B 3BAEL 1E6JH 2ID5A 2NNAA 5FDWB 2P45B 3F12A 3TYGH 5C0AA 4RGNB 1MHCA 4JANB 4AM0A 2L7JA 1JTPA 5FM5M 4HKJB 3VD5A 4LGSB 3LIZL 4PJ5E 3HA0A 4U1NA 4FTVA 2KBGA 4O9HH 3SY0A 4OUOA 3IJHA 3UBXB 5ACZA 4E41B 4JPIB 1NCDL 2IPUK 1AGCA 2HFGH 4N8VB 3P9LB 3RDTA 1R6VA 3DXAA 2VISA 2BNRA 2XT1B 4KTEH 2AJUH 4P46C 1OM3H 4QHNA 1OAKL 2FSEA 5I17A 1A14L 4R7NA 3UYRH 2C7UB 4ORGA 3RVVC 2BP3A 3QDMB 3VCLB 3W11D 3UZVB 2P47B 1MRDL 1WZLA 4KI5F 2P43B 4WTZA 2WIIA 4Y4HD 1CFQA 5LAXA 1EFXA 5KN5A 1XGPB 1U9KA 4AEEA 4F7PB 5ENWA 3RKDD 4G5ZL 4GW4B 3LOWA 3D3VA 1SMOA 2JB6A 3PGFH 1JI1A 1GJIA 4LFHD 3V0VA 5IFAL 4HS8H 2J4WH 2HFFB 4NN7B 3HAEA 4HBQA 1KOAA 1EO8H 4YK4C 1M1SA 1QD0A 5FYJD 5E6IC 3LV3A 4PRAA 3HRPA 4J2XA 1IC4H 4NHCL 2QR0B 2YRPA 1Q1JH 2R0LH 3BKJH 2N7BA 2D9QB 4PJ9C 1NGQH 1TNMA 2V17L 2AKRB 2XWBB 4LU5L 4DFIA 2OS7A 1K3IA 4OM0H 1U92A 4JKPL 5I1KL 4IRSC 3BDYH 1TMCB 3CH1B 3VFGL 5CEYB 5IROA 1DN0B 3I84A 5E6ZA 2R0WL 2XA8L 4DCQB 5DO2D 1U6AH 5C0CB 3MRCB 2MNUA 4IJ3C 1NMBL 3H7BB 4X6BB 4HJGA 1FCCA 4E0RB 2NW3B 3BPCA 1VACA 1A6WL 2ZOKA 4PRIA 2J5LC 4MNQA 4IRZH 1KIPA 2VZOA 3MLUL 1BPVA 3B2UD 4U1KA 5DZOA 1JWUA 1JZ3A 2M26A 2VLLA 3S36X 3MODH 4X7CC 4XNUH 5E8OA 5JW5B 4EUPG 1Y18B 4NQSB 5HGBA 2QQNL 1JHKL 4M62H 1NUFA 3UYRL 5C8JA 5JW4N 2Y72A 1KIPB 4HWEL 4PRHB 4LSRH 1KCVH 4JPWL 4LVHB 1VGKB 4U6HB 2UY6A 5E2VL 3TO4C 5ESQA 3NFSL 1BM3H 3HC3L 1X6NA 4NRYA 1BHGA 3UTPE 3U4EB 2X9WA 2RFXA 4PP2B 2J6EH 2JKXA 2B39A 5EO0B 4J12A 3CSBA 4AQOA 1RZ7H 5B38B 4YO0A 2NY7H 5DQ9A 3S5LG 4M8VA 1T2QL 1HWGB 3PP4L 4NSKA 5EUKA 4P2RE 1AI1L 1R0AH 4GRWE 1QYGL 1O5DT 2A38A 4EQ2A 1YECL 4OD3L 3ULUC 1OARL 3L3HB 5T1LA 4XGZA 1TPXC 1CQYA 5TH2B 3EJZD 4U0QB 5E2WH 2R1YB 5BZWB 4JFFA 5HI5C 4XP6L 4H26B 1PG7X 2Q87A 3DPBA 5HVHC 1OAKH 4Y16C 1TTGA 4MLSA 1KULA 4EVNB 4G3YL 3LB6D 2DJUA 1DLHB 4NQVB 3WXWH 1GAFL 5F9JB 1UKSA 4NQDD 5INCA 4DGIH 3F62A 5EZIL 1KB5A 4X4MA 4FABL 1RUAL 2D31A 1T1XB 3DETC 1G7PA 1ZLSL 4GXVL 3Q5OA 3QXVA 1M71B 4HS3A 4GRLC 4TYUA 5T3XH 4LCYB 4OB5H 3KYOA 3NTCH 1UH2A 1AD9B 4HS8L 3KJ6L 3FQRB 2APWA 4HV8B 4PBXA 3MODL 1ES0B 1AQKL 1EBAA 1V7NL 3LRGA 4KK8D 2YKLH 5ITFA 1EHXA 3UAJC 5IB2A 1CDJA 3NA9H 2F54D 3RTQD 4GSDL 4ZNEA 3RWGB 1PZUB 4ONFL 4OZIE 1I7RA 3UXFA 1VFMA 5JW4R 3S97C 3NMEA 3QG7H 2XG4A 4OGXL 5L8LB 1Z5LA 3F6LA 2AXGA 4QXWA 4JQIH 4NQXB 2FBJH 4NO2B 3MBEA 4E41E 1DQQA 3LPWA 1ZHKB 1IM9D 2DQTL 1CL7I 3O6LL 1RQ5A 4XPTL 5FOJA 4PJGE 5HHOB 1MY7A 1T89A 2IWGA 3UP1A 4WV1C 4LNRB 2AK4B 3TPUB 1HHHB 4PJGB 2V2TA 4ZUVB 4JB9H 1U41A 2C1OB 1D9KC 1BVLA 1RD6A 1P5VA 1U8JB 2AK4E 1IT9L 1PEZA 1DBBL 1B90A 1BFVL 3GMQA 3WXVH 5D7LE 4IMLB 1MREH 3LN5A 2AV1A 2MHAA 1WVZA 1U3HC 1L4IA 1JZ6A 1W72L 1DVFC 3DARA 4R4FL 1BFSA 5DVOA 3T3ME 1ZSDA 1T6WA 5HPOA 2ZCKH 5DTFA 3ORJA 1OGTB 4JY5H 2P8PB 3C6LB 3QUXB 1FVDA 4BUGA 1XF4B 4X6FA 4DK6A 3C2AH 4POYA 3UPAA 2QSCL 4H0HB 3VFWB 1ITBB 2EEAA 2EKSB 1Q1JL 2R0LL 3FTGB 4ODVH 2VR5A 2OZ4A 4TOYH 4R4ND 2PYFA 3HMWH 1AD9A 4JCMA 3BIKB 4IIQA 1FSKB 3QWOA 4GLRI 1U42A 1W72B 3V95A 5TQ0L 1G7LA 1S7WB 3E6FA 5I9QB 4P9HL 2CH8A 1C5BH 5BV7C 5EZOH 3LEVL 3O6FA 3OZ9L 2A6KB 5HI3D 5C7XH 4N0RA 3DGGA 4APQB 3NA9L 5GIRA 2V6HA 1K8DA 1A6WH 4QWWD 3ZLQC 3IDGA 5CWSB 4P57B 3MLUH 1IRAY 2BVEA 4MD5A 3HPJB 2NXYB 4Y2DC 3S98A 3ZE0F 4HXBH 4Q6IC 1NMBH 1FAIL 4QEGA 4R4BA 1WAAE 1CCZA 4PV8A 1NEZG 5FM8A 2JJVA 1KPRA 5DJ8A 3SKUD 3HAEH 4L3EE 5C0RL 3H9SB 3MYJB 1UQSA 3E0GA 2V7NB 3EOAA 3O45A 4V1DB 2JF1A 1TJHH 4H0GA 3G6DL 4GG8A 2OTUB 4PRHE 3IGAB 3RVXD 1D7FA 5CKGA 3NFSH 4FABH 1MFDH 2CLZA 1G7LB 1S7WA 3LEXA 2BVYA 4UINH 4QHMB 3V0AC 5B3JF 3UJJH 1IC4L 2Q3ZA 3O0RL 3AXLB 3S5LB 3QNZB 4LSRL 1U3HA 4JZOA 1Q94B 4P23D 3GEWB 5DQDH 4YDJA 2MOVA 1S7XA 1SM3L 4QRPA 4O4YL 5SX4I 4M8QA 5TE4L 5K9OB 1LNUB 3TZVD 5I0ZA 1FZOA 4WEUD 3NCJH 2V9QA 5DUBB 1R0AL 4FQLL 5D2LE 2O61B 4QTIH 2XZAL 2AEPH 4MVBD 5DSCA 4GS7C 1DP0A 3ZL4H 4NKMA 1JJUA 1NL0L 3C6SB 1N0LA 3C09B 4XCEB 3VD9A 5DT1L 5D2LB 1NC2B 4IRJD 4J4PC 3DWTA 3VXME 4MYWB 3BISA 3QO0A 4NKIL 2AJUL 1T2QH 1RIHL 3O2WL 2CRZA 5I1LA 1GH7A 3O3BA 2L4OA 1CBVH 1GRWA 5I6XC 5DF0A 3EFDL 3RDTC 4ONHA 2NY6C 2F58H 4RDQG 3SE3C 4P4RB 2QKIA 3GJFA 4QNPF 4QRRB 4U6YA 4G8FA 2BNRD 3DGCR 4QOKD 4XPHL 5TJWK 3RGVD 1JRHL 4RA3A 3QJFB 5ADPH 5GZOC 3HTLX 2IANE 4OLUH 3MOBL 4PRPE 5DFTA 1JHKH 3P77A 3U36B 5C6TH 2EDWA 3AREC 5CUSH 3IJSB 5JPNA 4PRPB 2H9GA 1OTSC 4YFEA 3DRTB 3HS0A 3NTCL 5DHXB 4HUVA 1AXTL 1C5CL 4JPWH 2K7PA 3WNMA 1GGTA 1CE6B 1JFQH 5DK0B 5HDOA 3WFDL 5IUSA 1FAIH 2UUDH 5EZIH 5L0QC 3L9RA 4NRXB 1S7TB 2D7OA 2M2DA 4N1HB 4N8PA 4X99A 5D72L 3VE0B 4D9QD 3FONB 3PL6A 1MLBA 5CD3B 5HGGS 1ONQA 3AREA 4PLJD 5FYJU 4X4XA 5C0ND 4TSAL 1ZSDB 2LAAA 3D3VE 3PP4H 2H26B 4JKPH 5I1KH 4YXLL 4EOWH 4JFDE 3HG1D 1A6AA 1X5JA 5DD3H 3N1QC 1OF2A 3VFGH 3CFCH 3D3VB 3O8XC 4GBXA 4UINL 4YNYB 2B0SH 2Z93A 4WFHE 5IFJA 4LASL 2AXHA 4RAVB 3CFJA 5I16B 1ACYH 3RVUC 3QPXL 4U1MA 4LQ1A 4M3JA 5IESH 3S88H 3SKMA 2W65B 1MJ8L 5HJ3A 1YJDL 1RJYA 4I0CC 5F93C 3GM8A 5C2BL 1LILA 4JFZH 5ISZE 4R3SB 4WWKC 2XTJE 5EORH 3VFVB 3PABB 1A21A 2R56L 3CVHH 1UZ8B 5D1ZB 1BM3L 4K7PL 4C56B 1SBBA 1FE8H 3LKRB 5F71A 4M5ZH 3RL2B 25C8L 2ZWLT 4GBXC 5C0IB 4N5EC 4HWEH 4C56E 1CFQB 4N8VG 3PGDA 3TN0A 1RI8A 3QUKB 2ZCHL 3FB5A 1EAPA 5IF0A 1XGYH 1MCRA 1JK8A 1WF5A 3IXTB 1P2CA 5D70L 4M7LT 3OHXA 1MCWM 3PF2A 4XVJH 3OAZK 1ZVYA 4L4TE 5DHYB 1QQDB 3VXRB 2W9DH 4U0RB 3LQAH 4MX7B 3WFZA 3VFSB 5DJ2B 4L4TB 3HZMA 1CFNB 5D96B 2CUMA 1C5BL 3W82A 3G6JA 2WINA 4ZSOB 4RDQF 3X3FL 5EBLA 1X6LA 3H42L 1I1FB 5I1IH 5K9QG 4NUGH 3TBVA 1F4XL 3BXNA 5T3XE 5D7LD 2GAZA 4XNYH 1QBMH 4ZUUA 5E8PA 4XC3H 4P46D 1KB5L 3G6JF 3KPOB 3B4NA 2FIRT 2NLJA 3EFFB 3KNBB 3TIDA 3U9UA 1QFWM 2BSTB 1Z2KA 5EC1A 5JPNB 3D0LB 1YEDA 4PJCF 3THMH 4R0LC 1QNZL 1UCBL 1C16A 1D5MA 1J1OH 3G04A 2WP3O 1QO3B 4IRSB 2H26A 4XPHH 1U58B 4ESKA 1I8LC 3PWUB 5JHDA 4ZUSB 3CSYB 4E41D 1FPTH 1IKNC 3BHBB 3I6KB 2X4QB 4GMTH 1QSFA 3MV7E 2CUHA 3RGHA 3ROOA 3H2WA 1W0VA 1VEOA 4NCC1 5HYSB 4I2XE 2IJ0C 3GMNA 1MCCA 3DNKA 1YEEL 4ZTPL 3D6GA 4K8RH 1MCWW 3WDIA 3QXDA 5E5MA 1A3LL 3SOBH 5HGDB 4I2XB 1T2XA 3PV6B 3SQOH 5K9OA 4P9MH 3ULVE 5BO1L 4M5YL 5JQ6H 4KWUA 4XXCC 1HH6A 4KRMB 4K3DH 2XZAH 4PRPA 2ILLA 1JYVA 2HRPH 4NYLB 4OGAD 5BJTB 1YY8B 3BPNC 5DC9B 2IPKB 2DQTH 4E42B 4PJ9D 1WWCA 2FHFA 5E95B 4DWHA 3HZVB 4TULL 4PJ8A 4QT5B 1E4WL 3VFSA 1A7NH 2OSLB 5F3BA 1WICA 1Y6NR 5FKAB 1BVKB 3WFEL 4NBZB 4N0UA 4P5TD 1N7ML 3X3GL 2DS4A 2M1KA 4KKLD 4UT9H 3MNVA 5LXGL 1NEZB 2KKQA 1PY4A 4UB0L 4NGHL 1TETL 2ATPB 2CDFA 3HI5L 5DO2C 2QQNH 4BELD 4UQ3A 1T5WB 1NQBA 4JQXA 1T20A 3V7MA 2QADC 4DOHB 5A1AA 1FFNA 1I3RB 3G5VB 2VDKL 1XCQA 1QHPA 1T66C 1CDUA 4LLWA 4DOHE 2BSSA 2E7MA 5C07B 2W1NA 4YXKL 4JLRA 5L0QB 2L0DA 3NA4A 5EU3B 2OMNA 2ZSVA 1AGCB 3O2VH 4MD4A 5CEZE 1DSFH 4XNQB 5EG6C 3HUJF 4LKCB 2W0FA 3DX7A 1J8KA 1A2YA 3V52L 5BQ7B 1KJ2H 2GTWA 2Z8SA 4M5ZL 3HFML 3FOLA 2DKUA 1UCBH 2EH8H 4R2GB 4UBDC 4RMSA 5LBSH 3P4NA 4HFWB 2ESVE 3PIQB 3R1GH 4HUUB 4X98B 5FUCC 5B21A 2UYLA 4YR6B 1KCKA 3WIFA 3V8CA 1QRKA 4EI5C 5C0JB 2PNDA 4AENA 4RGOL 3JUYA 4OFDA 2Q8AL 4AEFA 3LAFA 2ERJC 2DF3A 4DZ8A 4ZOAA 1A47A 1KEMH 1G1CA 3HB3C 3WE6A 4LU5H 3FO0H 3QUXA 2CK0L 2GW5A 3OGCA 4D0CA 3OAUH 3CSPA 1R5VA 1TTFA 3MRGB 4F15C 1CD1A 5GS2H 3BZ4A 2X89A 3Q6FB 5D7IF 1MCOL 4TUJA 3D5OF 4KTEL 4Y1AD 3MRHA 1UWEL 3FO9A 3EYUL 3KWWA 1ZLSH 5I1AB 5FUOH 2JIXB 1GZQA 2CJUH 5I8OL 1N64L 3ZDZF 1WAAF 5ITBH 3O11A 3ARUA 5DTFB 4QXTA 5EORL 3S4SB 3L5WB 2ZUYA 3G5YA 1CFBA 4IMLA 2JELH 1K6QL 1D6VH 1I4FA 3DV4A 3VXSB 5JXEC 4M9OA 3K46A 3OJVC 5MI0B 3KDMA 4OGYL 3QXUA 5IT2L 3V6OC 4KKBC 3N9GH 1NDGA 3Q6GH 5A40E 1RIUL 1FL6B 2NY5C 1JPFB 5EU7C 2XWTA 3LIZH 2ZCHH 3TPUA 1YEJL 1S78C 3HPLA 4G9DA 1KT2A 4LDLB 5BO1H 5CLWA 4DKFH 5IB3A 3RJQB 1FVEA 5CD5C 2CO6B 4O2FA 4PLNC 4XNXL 1F4YH 4BFIB 3VMNA 2DQEH 4F7MB 2DBLH 3KWWB 1CGUA 3QUMH 4QRQA 4KRPC 4ZO7A 3O3AB 2HMID 3GSWB 3UJTH 1T83A 3BDXA 2R4RL 2VIRA 4KK9D 4MDJB 1DLHA 4RGOH 3M1BA 2ED7A 4Z5RA 5DA0B 1QNZH 4ZUWA 1FBIL 4NO3A 3EO1A 1T21A 3W0WE 3UPRA 1PYWB 4RIRA 2X4NA 1L0YA 4HQQH 3QIWB 1B3JA 1HOCA 4U4BA 2VLKD 1KB5H 3BP6B 1ZLVK 3WBDA 4NO5B 4JN1H 4ZO6A 4V1DA 2YUXA 3MJGX 4PJ5D 3H9SA 4P4KD 4WFEE 4H1LA 2GITB 1HH9B 1S7SB 4OT1L 2ENSA 2Y06H 1ES0A 1S5HA 5F89A 3LEVH 4KROC 4CU6A 5F89B 4L4TD 2CIKA 3VFNB 3C5ZB 5CGTA 3A6CH 4UZGA 3HUJA 2H2SD 4CVUA 2AQ2A 1MFAL 2D7PA 1INEL 4EZMA 4DVRL 3R0NA 2AP2A 2XFXA 4TUKH 1AQKH 3SQOL 4R4NC 5F9JA 4DAGH 3TBYB 3GBML 2EO1A 2HFTA 4M7LL 4NSKB 2EH7L 4PJ9B 2DJSA 4RAUA 2XZZA 4ZUWB 2D9CA 1NCCH 4PY7A 3LHPH 4LSPH 4CU8A 4AK1A 2IALA 2B4CH 5E6IB 4KHXL 3P9WB 2VITB 5EOCL 2DWDA 5BW7A 4WIQA 5HI3C 4QCIB 1BF2A 2Z8RA 2DWEA 1CXHA 3MROB 1K8IB 5EN2A 1MLCA 1VSCA 2E7BA 1EZVY 3FTGA 4M6ML 5HI5D 4JQVA 3F7QA 5FOBB 4L8CA 3BP4B 5DD5L 5IG7B 3WJJC 3SDAC 5A3ID 3P0VL 4XNZC 5GGSA 4K94L 1O0VA 1UYWL 1FBIH 3VG9B 1LO2L 2ARJB 5KG9A 1WBZB 5DVNA 2CRMA 2R4RH 2R1XB 5CBAA 4UTBL 2P5EE 4JY6A 3DX6A 4OZGE 2IC2A 3RWHB 4K9EL 4LF3B 1MY5A 2J4WL 3LN4B 3NCJL 1CICA 2DQFA 5EU5A 2XWBA 1YA5A 3HC3H 1YEIL 1IC1A 4ETQA 4S0TD 1S7RA 4TNWK 1EEUA 1FNLA 3PUCA 4G43A 3U30C 5D7SH 4KK8C 5T1KA 2X42A 2DQCL 5FEBA 4L1HA 5GSRA 5H2BA 4IS6B 2ED9A 3J8F7 4OKDA 3L3OA 1SJXA 1KXQE 3FRUB 3TZVC 1J0IA 1K5NB 3QULA 3T4YB 5IIEB 4WU5B 2JB6B 1XF1A 5SX5H 3BP4A 3GSVA 5TFSH 3BPOC 1F5WA 1MFAH 2I60L 4PR5A 3NCMA 5H94B 2ZUTA 3VWJB 3FOMA 4EIGB 3GSUB 4FMKA 4F7TA 1CVSC 2P1YA 5HTSA 3BHBA 4JRXE 1EZVX 3ELAT 4M7LH 1XF3A 2V7HB 3T0AA 3O41B 1ETZA 4WW1B 5JOFB 4HZAA 1VKXA 2A83A 4NP4H 1SJHA 4AY0A 1MJUL 1QFWI 1U3JA 3BH9B 3NCCB 1A0QL 1D5ZA 4XWGL 4Z95L 3C08H 4AIZB 2WWMC 3IDUA 3SKJH 1DBJL 2CKBA 1IGJB 1SYVB 2CKBB 2W0LA 4LFHG 4MLIA 4F37K 3GSNA 3O6KH 3RWEB 4NRZA 4JKMA 3MCLH 1I7UA 3OB0H 5EZJB 4WEBL 4M7KH 4BSWA 3PABA 1HYSC 1UYWH 4O2EA 4YBLC 4HJJL 4JVUA 1DEEB 3X12B 1A9BB 4IOFC 4LSUH 4R96B 4JY4B 2HKFL 3RWEA 3BD3A 4JLRB 5BRZD 5IMMA 4DN3L 4X7TB 2YD9A 3NVQA 5CIPH 5C0NC 3MGOB 1I7ZB 1LE5B 3RA7L 5IBUG 4P2OD 4XC1L 2VDKH 43C9A 1OARH 5C3LD 4BSVB 3MC0A 4CU7A 4LMQI 4MHHG 1F4YL 2BVPA 3TZVB 2HVKB 3IB4A 4YWGH 4NKOA 4PYGA 3M1BB 1FIEA 3HI5H 4U1LA 2AABL 4UAOB 5TFSL 5CCKL 2CQVA 3MQIA 3LPGA 5D1ZC 4K8RD 2BSED 2G75B 1BWWA 4Z7QE 5GJTH 3CD4A 2NPLX 3CFIC 3L3GA 3UBXA 5ACZB 4OKVA 2ICWJ 2X2YA 4NZRH 4YXKH 2PW2A 4YHYC 3BZDA 3FO1B 5KSAA 1WJ3A 3MMEB 3QZWG 1T0MB 3ZDXF 3CJJA 4G9DB 3HPLB 4LVNC 2OP4H 4MCZA 4OF0A 2IAND 3WFBL 1XGQB 4G42B 4M6OH 4R97C 4JFFE 3QFDB 2C3WA 4NNPH 2SEBA 1AO7E 4R9HA 3CFKA 4JFFD 5HYJA 1N3NA 3BKML 3GJFB 3C08L 3FL7A 3SDAB 3H7BA 4CMMB 5AZEH 2XZQH 2WW8A 3ZE2E 4J3WA 4ONFH 3CSGA 3MACH 1YEFL 2IAMD 3GJFH 5ALBH 2R0KL 1P6FA 2XA8H 5TQ2H 4L3AA 4FN0A 4XP9L 2FEDD 4N0FB 3BGMB 2HG5A 1Q72L 5FO7B 1NC2A 3KPTA 3T08A 4QKXB 3MRIB 5TGBA 3BUYA 5I1AA 3DV6A 1JHLL 3FFDA 3QBTB 4CRPA 5TDPA 3GFUA 2B0SL 1UA6H 4OCNC 4UV7H 5E1AA 2EYRB 2F5AL 2OJEB 5C6WH 1DUYB 2NY5H 4ZFGH 5I1LB 4K94H 3GSNH 3RDTD 2NXYC 4YZFE 4OLZL 1G7IA 4HJ0C 5JXAH 1I3VA 4WFED 4Y5XB 1FNFA 1XGRA 3TBWA 1HCVA 5IG7A 5GZOD 4NNXA 4L29A 3QCVL 1N5YH 1C5DB 1KB9J 2P5EB 2C3GA 4U2YA 1J87A 1NCNA 5JDJA 4LBEA 5FKPA 5HY9A 4FNLH 4GSDH 3AUVA 2Y23A 3E6HB 3MRMB 1PG7H 3RTQC 1NCUA 4MA7L 2FBJL 1T0NA 3N1FC 2OTWB 1HDMB 4Y19D 4LRNH 3VI4E 4Y0GA 2WUCH 4C56D 1O7SA 5KVDL 1YEJH 1S9VA 2PO6D 2RJMA 3BIBX 3EYSL 4JFED 3ME0A 3TCXA 3MR9B 4Y4FB 4JO2L 4E5XA 5F1NA 3KPMB 4IHOB 3JWOH 1LDPH 3WFHB 1S3KH 1QBBA 3N1MC 3G6JE 2J5LB 1LEGA 2DQCH 3QNZA 3WN5A 3SO5A 2B4CL 2AV7B 1RIHH 4XAKD 3LHPL 4NWTL 1T1YB 3SKOA 2DMCA 2E6QA 3GI9L 2A1WH 4NWUH 5CSBA 5E6YA 4KK6D 3CZFB 2VLRE 4OLXH 3RI5F 1NEZA 5GRVL 2VRAA 3EOAB 2NR6C 3FZUC 5E24E 3ARBB 2VJXA 1F8TH 5BXFA 3LRSA 3PGCA 1UWXH 4YNYA 4M48H 1WCBA 3TH3T 5DD1H 2IQ9L 1CT8B 5IMLA 2QHRL 1Q9OB 3WHE0 1FVEB 1UA6L 3V7AG 3AS3A 3Q0HA 3LQMA 4Z5RB 4XH2B 5HYEA 1SJVA 4KROB 4P2RD 3HNVL 4ZFGL 1JTTA 4OZIB 1ZA6A 1U8OB 2IBZX 3HE7A 1I8MB 2ARWA 1CGWA 4HJJH 5FIEA 3Q2CA 4NJ9H 4GMTL 5JA9A 4FXGA 25C8H 3ISWA 2LU4A 1F2QA 1MJJA 2RCSH 2ZUQB 4KMLB 4GOSA 4P3WA 2OK0H 4X5WB 1RAMA 5IEHA 3QIBB 3GMRB 1P7QA 3MCKB 3RGVB 2A6IA 3HCVA 3QFJA 3OB0K 4X8XA 4U1HA 1D5XB 4I18B 3EJZC 4QWWC 5E8NA 3HNTH 3TNMB 1DANU 1R3LB 1G7MA 1RZ7L 3T77A 1NCCL 1F4XH 4XAWH 5IESL 3S88L 5FB8A 2HJLB 4KY1L 1MAKA 1PKOA 1GGYA 2I26N 2VXVH 4XC3L 1DFBH 2R2EB 5F7KC 3CPLA 1JPGB 4XNZB 2ICEB 2A1WL 4MD0A 4NWUL 2A9NH 1A1NA 5DYOB 1D5XA 3L5WA 4HWUA 1EXUB 3TBVB 3L7FA 1Q9KB 1WIPA 3HE7B 4MS8D 4D8PA 3SO3C 4LCCB 2VLRA 3VG0L 2NY4B 2VLMD 3ZTJH 1IEHA 4NO0D 4JJ5B 3RHWF 1AE6L 3VGDA 4LSVL 1T5XB 1YEIH 5F72S 1FYTD 4GRMB 5BQ7A 2JIXA 1LVEA 1JPSL 3I2CH 2EDFA 3KLDA 5ICXB 4C57C 3GHBL 3MRHB 4QO1A 4HFUL 1X5HA 5KS9F 4F57L 1JTOA 5JOPE 1H0DB 1JGVH 3DUHA 1OWWA 4O4YH 3REVA 1DE4A 4QYOA 4LK4A 4RFOH 1HEZA 3FB8B 3P4NB 3GSQA 2RGSA 4FQLH 1U36A 3QDGD 1KLGA 3QWRD 3MV11 4XI5D 3O2DH 3CZFA 5EU7E 2FRGP 3ZMRA 4XMKH 3OKKB 4ISVA 4FXKB 5BV7B 1QPPA 2HRPL 5DJ6B 2HKFH 1DR9A 1ACYL 1IGTA 1MHEA 3QEGL 1MVFA 2J8HA 4YHZH 3O3EA 3N85L 1VHPA 4BA8A 1JHLH 3VFUA 4K7FB 4KHTH 1U91B 4DQOL 1MFEH 3UTTA 3SDCB 4ZTOL 4NQEE 5T1KD 4YWGL 4K7PX 2IPKA 3C6LD 3SJVD 3TVMA 3QIBC 2NY5L 4X6CF 4NGHH 1QBML 3QUXC 2DIBA 3OR7B 2C3HA 5TE7L 5HDBE 1CXKA 5HHVL 4KKLC 5GRVK 5JMOC 1KJ2A 3JSSA 4A6YB 1UXWB 2PR4H 3GMPB 4F15B 2EC9U 4KUZH 3GSNB 2DQHH 3MJ7A 3G5ZB 5EUOA 1KXVC 5FCSH 4DVBA 3ZSTA 4PJIA 4KKCC 3ARED 3T0EE 2F53A 2P46B 4NNXB 4XPAL 4QT5A 2P5EA 2X1PA 2XZCH 2EYSA 3VFMB 2Z4QA 2BY0A 1AE6H 3VDAA 4P49A 5DD1L 2X4TB 3ZE0E 1UXSA 5DQJA 1F3RB 1R5WA 2VAJA 4BKLB 5IMOA 3VRLF 5MHSE 4WUUB 3OF6A 2FWOB 4WDIB 4JM2B 2MKWA 3OKDB 4K8RL 1NCWL 2VDNL 4U1KB 4NC0B 4A6YL 5KOMC 1KSRA 4IOIA 3MNZA 3P2TA 5D1XD 4HGWA 4KROD 4P2RB 1H5BC 3RWDB 2H41A 4OV5A 5D1QC 4DZBB 5IHBA 4LLUA 3RIFK 5D7KD 3TO2A 4LEXL 5C9KA 5E8DH 1FYTE 2Q8AH 1MJ8H 1AD0B 4YAQA 4WVRA 4EI5D 1Q9LA 3BYYA 2PUQT 4V2CB 1JWSA 1TVBB 3VXUD 4L8DA 3CFBB 5C2UB 5T3ZE 2ARJQ 4ETQB 4UV4L 2F5AH 5CJ5A 1YYMH 2IANB 3CFKB 2P8MB 4NZTH 2AEQL 2GSIA 1AHWA 5EU6D 3OZ9H 2APVA 4KRLB 5IJKA 3D0VA 4LIQE 3DX6B 4I1NB 1XT5A 1SYSA 3BZEB 5E4EC 4NQCE 4PJAB 3LD8B 1HE7A 3JWDC 4JO4L 3QCVH 1N5YL 2BNUB 1VB9A 3P11L 4Q7DA 4A2LA 3RL2A 4KV5F 4JFEA 2JELL 2VXSH 4K07A 3V52H 1KJ2L 1KCUH 2ZUUA 2F54E 3C8HA 3UTSA 3CX2A 5ENWB 4CVWA 1VESA 1X7QB 4QRPB 1U8IB 1H15B 4NO0B 1ZT7B 5J1AB 5IK3A 4Y19E 1WWBX 5GGQH 3QDJE 3Q6GL 1WC7B 2EH8L 5EBLB 1IKNA 4WI8A 5CP3A 1XCTB 4M1CC 1E4XL 1OW0A 2JCCE 2PW1A 3U0TB 2ZJSL 3MV8E 3R0MA 4R7NB 3HZYB 2J3SA 1KN4H 4PJCA 5D1QA 4QRSA 4XB7A 1S3KL 4X6DE 5DK3A 3REVB 3MV8B 3V5KA 5SX5K 3DVNA 4CVZA 3V6ZB 1NCWH 4DVRH 1I75A 1GZPB 1OGAB 2A73B 5DRWB 4UNTA 1P2CB 1YEHH 5ACMA 3X14B 1XEDA 5IW1A 2HVKA 5IMKB 2HT4D 4X7SL 3TC9A 2FJFA 3ZL4L 1ACZA 4XWOC 1G6RL 2CMRH 1MCHA 1NAMA 1S9XB 4Z18A 1KN2H 1TITA 4H26A 3CCHB 2QEJA 5T5NG 1MHCB 5FUCE 3DYMA 3MGOA 4Y4FC 2Z91B 3WXVL 4FNLL 2F74B 2W60B 5GIRB 3AGVA 1OT2A 1A7QH 3PNWA 1J05B 4FQQA 1YMHB 1NCAH 4GW1A 5C08D 3U9PH 3IJHB 1X4YA 3RTQB 1J8HE 5INDB 2DMKA 5I75C 1YYML 5C09D 5HGAB 3QEQB 5HHMD 4I77H 2VABB 3IDYC 2YD1A 4HWZB 2WBJC 1W72A 1I1RA 4HQQL 3RWCB 1KLGB 3VXRE 1F6FB 3U4EA 3AREB 3CU1A 3MRFB 4LP4A 4OD2B 3GB7B 1EEZA 1TZIA 5IVXE 2EECA 1JPTH 4MQSB 4F8QA 3QG7L 1CLCA 3FB7B 4OGXH 5GJSL 1BQUA 1DBMH 3PJSA 4TSBH 5TF0A 3UROR 1U8IA 4XZUB 3FFCE 2NY2D 1HYSD 5IEKB 4XX1G 3BO8A 2D7NA 3C87A 3VI4F 1VKXB 1MRDH 4XMKL 3ARFC 2VE6A 3DTXB 4JFYB 2XN9A 4W4OC 4Y4HB 1GYAA 4XX1E 1NFDF 1Y18A 4NQSA 2AJYH 1RPQA 1N5AA 4XPFH 5I1GL 4WI5A 1PX3A 2UZIH 4RMUA 1HHIA 5H94A 3WUWB 1FL6A 3QH3B 5GGUA 4G6ML 4N0CD 3D0VB 1TTUA 3K80A 4IRZL 2A9NL 4ZPTB 4S1DC 1Z9OA 5IHLB 2RHEA 2H6PB 4P4RA 4G9FD 4ERSL 5KZCD 1U8JA 3O8XA 3QAZB 5LG1A 4W6WB 3VG0H 2V5MA 5FYKH 3QQ9C 2LV4A 4LNRA 5E2JA 1UWEH 2R23B 1JWSB 1TVBA 2APBA 3D1MC 3BVNB 4K8RC 1A7PH 1YC7A 3C8DA 5D2LA 2NY0B 5I1HL 3QCUL 3N9GL 1MJUH 4EDXB 5CEXB 3ZHKA 2XXCB 4JHBA 3ES6A 1D6VL 1N6UA 4ZD3L 1AXSB 1CICC 1DLFH 3MOQA 4S1SH 3IU3B 4AJ0A 4K7PH 4MNQD 3KPRB 4NN6C 3K2MC 5I1JH 4NQDA 1IM3A 1F58H 3FN0L 1ZHLB 2BZDA 5D7IA 1FN4B 3U2SB 1T4KA 2ARJA 5D9SB 1R3HB 2VDNH 4ZAKA 3O4LA 2UV3A 1IQDB 1CN4A 1LE9A 1RJLA 1PQZA 4JFEE 5IB5A 4UV7L 4L8BB 1QBAA 4GQ9H 1U8PB 1GC1L 5MI0C 3TM6A 1MNUH 3QXAA 4X0KB 3CZJA 1ZTXH 1PDKA 5FYJH 2BVOB 3SKNA 1U3YA 1HOCB 3AXLA 2FEDC 3EYVA 5I8EB 3ZTJG 3VXOA 4CDHA 2GTZB 3L7EB 5HDLA 3Q3GA 2Q86A 4RZCB 5DDHA 1ZLWK 1T7YA 2P5WD 2DKSA 3P4OB 4P5MB 5DD5H 3F8UB 4K3EL 5A2FA 3C5ZD 4KQ4L 4OQTA 3DSFH 3SKJL 3BZFB 5EUKB 5HHNA 1GOHA 1LO0H 2P7TB 5C08A 3QISA 3NCYS 1Q9KA 4TOYL 1J0YA 2XPGB 2FH6A 3QRGH 4IIQB 1U8LB 3V2AR 5GS3A 2VQTA 1KIRA 3JWNC 2JCCB 5EZOL 2OJZH 3H9HA 2ADIB 5C86A 3NPSB 3HI1B 4TSBL 1BVLB 1E28A 4PUBL 2R8SH 1GGCH 1OSZA 2X7LB 3PWPA 4TUKL 5HGHA 1JV5A 1U2CA 2K7QA 2DIJA 3EO1B 1T4KB 3VGAC 5FHBL 2GY7B 3UCRA 3GBMH 2BNRE 3ULUE 3RX7A 3QWOB 3OJMB 4URTB 5BVPL 3LDBC 3MFFA 4K3DL 4LLYB 5KSBE 4NJAH 3MFFB 4LLYA 1MHPL 3MMEA 3DVGA 1U3ZA 1H3WM 1BIIB 3STZA 1PFCA 2CGRL 3REWB 5JHDD 5I1GH 2BXYA 1T83C 4FQCH 1N2RA 2AEQH 3IKKA 1IGFH 5DRNB 1GXEA 4O58L 1HHJA 4XVUD 3JV5A 4WI4A 1IAMA 1SY6L 1EUUA 2IQ9H 4TULH 3IFOA 2Y1VA 5D7JB 1CDIA 1T80A 1A7QL 4TRPH 1ZS8A 2J8UB 3O6FC 4ODXB 3AAZB 4XPBH 2VZ3A 5I66B 3PWJB 2X4SB 4KK6C 2Y25A 3HNVH 3BRGC 2I9TA 5T5FH 2YPVL 3BE1L 1HHIB 2CLVA 2XWTB 3VXSE 3LMJH 4YPGA 1GOGA 1N5AB 3TVMC 1M71A 2XWJB 4U3CA 4J3OC 4LLQB 7CGTA 1MRFL 4UNVA 2WBWB 4ZNEE 3OG4B 2J8UA 5J6GB 3RVWD 1WIUA 1ZT1A 1BGXH 5J4MA 2ZZUT 3ROLB 1J5OL 8FABA 3S96B 3Q6FA 3ZDZE 5HVWA 3LZFL 5HYFA 3VG9C 1DLFL 4MQ7B 4OAWA 4YXLH 5BRZB 2X1OA 1ZA6B 2ESVA 1EEZB 1TZIB 4NNYA 3KVQA 3MACL 2C1PA 1ZHKA 1EFXD 5FA4B 4M1GH 5BRZE 2ZP0T 1A6VL 2NXZB 3HB3D 1CDYA 4JHAH 1VFBB 3UYOD 2I5YL 1RY7B 2R69H 3IDNB 2HAZA 3BDBA 2B4CC 2XTJD 4NDMB 4F7PA 1OLZA 5C0JA 1RUKH 3V4UL 3OTTA 1A4JB 3PNWB 1EEQA 2DM7A 1D5ZB 1J1XL 2FO4B 3IAGC 4YO0B 1FFRA 1U8LA 5AYQA 3W9EA 2PKDA 5FGCB 1ADQL 1RMFH 5HGAA 1DBJH 4DKDC 4U2ZA 5EOTB 2ATPA 1KG0A 5FHBH 4KI5C 3H3BC 1KCUL 2BNQA 5GJTL 5CBEB 4XMPL 5ESQB 1I1YB 3RDTB 1LD9B 1KTKE 1NC4A 4IDLA 2BHUA 5E4IA 4PG2C 3FQUB 3RI5K 5T5NF 4PJ8B 3RQ3A 5E5UB 1JZ8A 4UILL 4JG1L 1G6VK 1FNEA 3D18A 5LGJA 3P0YL 4I9WD 4UIMB 4ZODA 5FV2A 3FRUA 3P4MA 1QR1A 3ARBD 5AZ2H 1KNOB 5DQDL 4EKXA 1DTUA 1RK1A 3QIUC 3QEGH 5T5FL 3ZKNC 4DN3H 5CKAA 3EO9H 4MAYD 3L3IA 4WY7L 3L5XH 4HUWB 4YUEL 3WLBA 4M4PA 5SWZA 5T1DL 2YC1B 4WI6A 1CFSB 2YWZA 4HZLB 3MRCA 3H9ZA 4ETYA 3RY4A 1IQDA 2VLKB 2BCKA 4YAQB 5KVDH 4G9FB 4X4XB 1MF2L 3ZKQD 3IDIA 4LOUD 4NKDB 5C09B 1WBZA 2VDML 2XRAH 3KPPA 4YH6A 4G9FE 1YEDB 2XACC 4OV5B 3FCTB 2Y7QA 1MHPH 1TJHL 5KSVB 4XNXH 1F45A 5DVKA 1J1XH 4LCWE 4GG6B 3QDGE 4PJDA 5SV4A 1BQSA 5IEKA 1UCTA 4HJGB 1FJ1B 1G7JB 2ZNWA 5DRXB 1P6AB 4OLUL 3N0PB 4POZD 5L88H 3BP5B 3QULB 3ULVL 5C07D 3DVFA 4OF3A 2XN9B 3FMGL 4L8DB 1RZFL 4K3GA 2VLLB 5KTEL 2VNCA 2VN7A 3PV6A 4S1QH 2AK1H 1PGRB 2NY3C 4KJPD 2GSIB 3QRGL 5JZ7D 2AS5M 4QLRA 4ZD3H 3DI2B 5EC1B 3I02A 4WJ5B 4PJEF 4HW6A 5CEZL 3S3JA 3LCYA 4ONHB 2XTLA 2QR0A 5C70A 3JV4A 1IGCH 3RIAF 4F3FB 2Y6SC 4IOFD 2FR4A 1A22B 1WFTA 2UUDK 3V4VL 3CFDB 4MDIA 3BKMH 5IBTH 4G6FB 3OR7A 1J5OH 1YUHB 5I15L 2GJ6B 1I8LA 1P7HL 2PXYB 5CJBA 1AGEB 5F3HA 4HXAH 1OTTC 2P5WA 1T04A 4BSJA 4EBQH 2P24A 5HHPB 1YMHA 4GW1B 4X7TA 1EDQA 3T0WA 4NCDA 3SE4C 2ICWB 1D3CA 3QPXH 3IETA 5KSBB 4NQEA 1ZTXL 5FYJL 1E4KC 4JRXB 4NZJA 4ZFFA 1ORQA 3MRQB 2CK0H 3L5XL 4QCIA 3RY5A 1H9VA 1H5BB 5T1DH 1FNSL 4LDEB 3MRFA 5CJXC 4AG4L 4PRBB 2R1WA 3S9DB 5IF0B 1A9EA 1IGFL 3GJFK 4MJ6B 4WFGD 2NY3B 4OI8A 1I1AD 4UAOC 3H6JA 4MNGA 2LVCA 3V6ZA 3D18B 4F2MB 4G7VH 5ESVA 2QHRH 1JI2A 1VPOL 2BY3A 3OHXB 1F58L 1UEMA 4MB3A 3WKNA 1ZE3C 5FUZH 3RUGE 4TSAH 2OL3A 2ZCKL 5B39A 5E2VH 4GXUN 2HA1A 2FEEI 3OAZH 4JRYB 4N90D 1SVCP 4HUXB 5GS0C 1AC6A 1I3UA 1YMMD 1G9EA 3I2CL 1PG7L 2OJZL 2AGJH 4OGYH 2HTLC 4OF6A 2DBJA 3P9LA 3K1KC 3TH2T 1QFOA 3OKLA 3OKOB 1CVRA 3F7YA 2RAMA 4G8EA 5DZNA 1YEHL 1QOKA 3DHMA 3FQXA 1V3LA 3GHEH 2ZG3A 3IDNA 3T4YA 3KS0H 5ADOL 1FG2B 4WHTB 3LQZB 3QRFM 1A9EB 5ISZB 1UZ6E 4HEPG 5LXGH 5GSRB 3G08B 4S2SA 4I18C 4Z7UE 5KW9H 2HKHH 5MENE 2CKNA 3ARGA 4W6YB 5JNYA 2HLAA 4XVSH 4KUCD 3K2UL 1FE8L 4R0LA 2BDNL 3N85H 4NRXA 5HHVH 1FGNL 4PRNB 3IVKA 2NXYD 2NW2B 2R9HC 5GSVB 3VE0A 4MNGE 3KAAA 3RWIA 5I8OH 2DD8H 5C0GA 2YXMA 4KTYA 3O9WD 4O2FB 1I8MA 2I60H 1UKTA 3DX8B 1KXTB 2X89D 3T8XB 1U93B 4OQTH 1QR4A 4RRPA 2EZ0D 3P77B 3U36A 4R8WL 1ZHNA 1MRFH 1A7RL 2EDKA 3HFMH 3PL6C 1FL3A 1JGVL 2IFFL 3CK0L 4TUOB 3U82B 2ZCLL 1BJ1J 4S1QL 2FYYA 2EYSB 5IEHB 5DK0A 5DJDA 4MWFB 4UILH 4H0IA 2P8MA 1MLCB 4TTDD 4JKWA 5EBWB 1Z9MA 1YEFH 4NFDA 5FAAA 5DUPL 3H42H 5SWZE 4XP9H 1MFCL 4QOKA 4HKBA 4RMTA 4M7KL 5IWLC 3O6LH 2I5YH 4P2OC 4Y5YB 3BRFA 4CJ1A 2VXVL 4BJLA 4U6YB 3GI8H 5CIPA 5I0DA 3EAKA 2VXTL 5C09E 4HBCH 5EU3A 5ERWA 5DT1H 3I3BA 5JXEA 1JNNL 2HKHL 4D94A 1XF2A 1JGEA 3BEWB 4HUNB 5TE7H 4PJBB 5C09A 2VLJA 1CBVL 3TP4A 1HN1A 5I1CH 1RURH 2NMSA 3KPLB 4WGVB 4QHMA 5DJXB 4UDTB 3EOBB 3L3JA 4KAQH 1JNJA 3FT4B 2BVOA 2FB4L 4JFHD 4RMWA 1QSFD 3QXAB 5INCB 5L7XL 4M7ZB 4X6EA 5F97E 3QI9C 1SBSL 4M3KB 4UOW1 5DVLA 1ZXQA 1HILA 3DMMD 4JN1L 2ADJB 5F1NB 3VXMA 3TJEL 4P5TA 5C0DB 4ISVB 1QBLL 4FP8L 3S3PA 3UPRB 4QGTA 3DXAD 4WTXA 1YEGH 2EDTA 4HIEB 1INEH 2GFBB 2ADGB 2DIAA 4DGYH 4PRID 1S5HB 4Q6IB 3DUUA 1RUQL 1XGTA 4JDVB 4YHZL 4IRJB 4DKFL 2GCYA 3Q48A 4PRIE 3SE8L 1CICD 5T1LB 3QUYC 2ADJA 5JUEL 4M1CD 2ICEA 1LK2A 3S7GA 1FZMA 4AIOA 1ZT1B 3V4VH 1OWRM 1V3JA 3F7PC 1GGUA 1CTNA 2WNGA 3EYOA 5CGYC 1ZVHA 1I9IL 3I6KA 2VLJE 3E6FB 4PB0L 4HSQA 3MUY1 3M8OH 4P57A 3IF1A 1K4DA 4LASH 4FA8A 1UB5A 5ECJE 3UTPD 5I18H 2O5ZL 3CNKA 3U7YH 4MAYA 3QUZC 5IM7B 2A6KA 4LPXA 5EBWA 1DE4B 4ODXA 4QYOB 2HT4C 1R3IH 5D7JA 3BD5A 1FRGH 1RURL 5D1XA 1D6EB 1NSNH 2DM3A 5I1EH 5ITBL 2P8PA 3QZWA 4KAQL 1KN2L 1T5XA 1BD2B 4ZNCD 2XV6B 2HLAB 2VR9A 1MEXL 1VEMA 5DS8A 4JQXC 5FGSA 5IB3B 4I3SH 4J4PA 4PREA 5ALCH 3PP3H 3B83A 4G6AD 4BZ2L 1VPOH 1NCAL 2YPLE 1CU4L 1P53A 3M17A 1JP5A 5E03A 1G9NL 3RIFF 1NLBH 5DRZA 3QCUH 4PY8I 2COQA 2VDPL 1FL5A 4PJ8C 4ZPTA 4G8EB 3MRNB 4OZIA 1I1CA 4I77L 4JGMA 2HVJB 2HT2D 4X7DC 3E2HB 4GT7A 4FQIL 1GCFA 3IF1B 3TBTA 4WHTA 2DTSA 2I07A 2VKXA 2ZOLB 3MJ9A 2FHBA 3GNMH 2X09A 4NQXA 5I6XB 5DFWH 4DUWA 1DQQB 5J06A 5CILH 3ARFD 3KPOA 3SJVA 4LVHC 1GSMA 2CJUL 4XC1H 3L3GB 2ESVD 4PJHA 2EXWD 4IBLT 5CZXD 4Q97A 4UUJA 5ESVB 2NR6D 1B0RB 3FZUD 1GOFA 3QDHA 3VFVA 3J7HA 4HV8A 1CL7H 5E9DA 4Q6IA 4JM4H 4OJFH 3WUWG 4J1UA 2HFFA 4Y2DA 5FK9B 4JFDA 5JLZB 1U8KA 3QEHA 4MXQD 4YEFA 3OGCB 2E8ZA 1QUNA 3C2AL 1B2WH 4HGMA 1QLFA 4ODWB 2FX8H 5CEZH 2P42B 2MPAL 3L3HA 1FO0A 5D5ME 4AEHL 1IM9B 3EJYC 4X9HA 4N90E 3LRSB 3PGCB 1NJ9B 5HHME 3MA7B 4ZFFB 1IGYB 5FYKL 3CVIL 1C5DA 1JK8B 3AROA 4QXUH 3TA3A 3B3IB 3EGSB 1G0DA 4NNPL 2E9WA 2LVEA 1NLBL 1DN2A 3SCMD 5HY9B 1WLHA 5C7XL 4N0UB 4DAGL 4XGZB 5DJAA 4ELMF 1RIVH 4ODSL 1OB1B 5GS1A 1N6QL 3V6OA 4M5YH 5JQ6L 3L1OH 5J7CC 4FQJL 3VD4A 1BD2D 4QHLB 4ENEC 2CK2A 5CEXA 1OVZA 4GMSH 5DQ9B 4U05A 5ANMB 5MEQA 4U1NB 1XGUB 4CVXB 1Y0LA 1Y6KR 3K8LA 4HKJA 5DJ0B 5L6YH 5I73C 3ZO0A 4Y16A 2FLRT 5HGBB 5HPMA 4NN7C 3ZKMC 2XQBL 3RA7H 3SO3B 1I9IH 4KGLA 1MCKA 3VXOB 2DQHL 4OF8A 5C2BH 3O41A 1YNLH 4I3RH 5IV2A 4V1DD 4YE4L 4PLOB 3CFJB 5I16A 3FQNA 3JV4B 1SJEB 1NFDB 1RVFL 3ARZA 2H1PH 2R56H 3NCFB 1G0XA 2DQFB 2IG2H 2IPTH 5JHDE 1PQZB 1N59A 4KY1H 4NT6B 4OLZH 4FQ1L 3EO0B 3U7AA 1C12A 1KC5H 1T1WB 3HNSL 4R8WH 4JKLA 4TRPL 3NFPA 4WWKA 3DO7A 5T1MB 2Y7QB 4KI5D 5B38G 4U33A 5E70A 5BVJA 1I9JL 4YBQC 2W0KA 3G04B 1Z9LA 2YPVH 3BE1H 4UT7H 3ZHDA 3RNQB 4A6YH 1CXEA 4YHNA 1DUYA 5C0BD 1HSAB 2XXMB 2P44B 2NY1D 4ZYKB 3SGDI 1KEGH 4YGVA 5TDOA 5E6ID 1U3HB 1T0MA 3GMMB 4PBVC 1CFTA 5EUOF 1RZKH 5AZEL 4PJDF 4MJID 4RFNC 1XR8B 1PW3A 2NX5A 4I5BB 1K4CB 4RAUB 4H1LG 4G8IB 3V5HB 4EN3C 4GQ9L 1G6RH 1RK0B 1CR9H 2A6DB 3DROA 4U1GC 3QIBD 4LARH 2YUVA 4D2NA 4QOKE 1JNNH 3SBWA 4M1GL 3LY6A 4MX7A 5HHOD 3S35H 4CMMA 2F8VA 4XWOD 4HK3J 4PUBH 1MI5B 3SDDB 4JHAL 5DGQA 3ULVH 4NWTH 4AEIL 1T22B 2X4UA 1JMZA 3VRIB 3LV3B 4Z77A 5CUSL 3ZHLA 1FHGA 3IRZA 4WHYH 5F70A 5ACLA 3VW3L 4L8SA 4YXHH 3E2HC 4ZTOH 4Z7OE 4OZGB 1F02I 2R2HA 1QSVA 3PWVB 4NQED 3WFDH 5IMOB 5CSZB 3TBSA 2GT9B 5LGJB 3CFEB 3DXAB 4Z8FH 3IDGB 2X70A 3LKRA 5IW1B 5DUBA 4Y19B 4OZFG 3RBGA 1J7VR 3TYFB 3TYGL 3OG6B 1OAZL 3SE3A 3QQ3B 1LHZA 1S5IH 5FXCH 4OLWH 4X9GA 4X4YA 2X9YA 3O4OB 3EDKA 4FTVB 2IALB 4OUUB 1RUQH 4DGYL 4JFQB 4Q9BA 1KB9K 1BQHG 1U8KB 3T2QA 2HLFC 3SE9H 3F12B 1RZJC 2DLEA 1HKFA 2GSGA 5INDA 3E1F1 4QHNB 1A6VH 1I1AA 3TO4A 2XFXB 2CDEB 3EYFA 1KBGL 1KJVB 3FQUA 4C56A 1PJ9A 1QSFE 3WDHA 1NCBH 4HUMB 3HC4L 4X7SH 1IL1A 1EA9C 4NJAL 4KJYB 5F21B 4UQ2A 4U1SA 4PGJA 3WEXA 2DBLL 5DR5H 5E9DB 4ELMA 1F3JA 4X99B 1WEJH 2VXQL 4D3CL 1IMHC 1A7PL 4EN3B 3L9RB 4M48L 5F9OH 3LRHA 3C5SB 4PJHB 3NPZB 1YNLL 2VB5A 4PGDA 1DUZA 3BKYL 4BH8A 3VGEA 4LLVA 3F6IA 2R2CA 4PB9L 4QRSB 5CLTA 3M17B 5T33H 5TDNA 3TNMA 3V5DB 4I3SL 3RL1A 4PJ5B 1A4KB 4I13B 5D70H 4W70A 4WHDA 4Z8FL 4I3GA 1XR8A 5I1JL 3R8BB 2K1MA 1IGIH 5AWNL 5I74C 3OX8B 2R1XA 1XCTA 3FMGH 2G5BA 5IR1B 3EDFA 4EXKA 1OAQL 3LQAL 1NGWA 3CDFA 5I66A 3W81A 4UDUA 3GIZH 3FO9B 2R2BA 1ND0B 4PP1D 4GG6A 1DBAL 3MV9B 4NBXB 2JJSA 5ICZA 3U6RA 4FQJH 5CP7A 3REWA 4LLQA 1ZLWH 3T77B 4QF1A 5FA3A 3DRTA 2UZIL 5DEZA 4HX1B 1QTYT 1AKJD 1P7QB 1R5WB 4BKLA 3BEVA 4MNHB 3IS1X 3OAUL 2VDMH 2XRAL 5FOBA 4DQOH 1KN4L 4OLXL 2IQAB 3W11C 2F53B 4EI5B 1YPZB 2WIMA 3IRPX 5C0FA 1QSED 2APTA 2BRQA 2EIDA 2F53E 1NFDE 1SY6H 2XPGA 4KHXH 2Y5EA 2DYPD 2UZXB 4LGRB 5JXAL 3AVEA 4JDVA 2UWEB 3EHBD 2X5PA 3SKOB 1FNSH 2CIKB 2KL6A 2N7AA 3VFNA 5MHSD 3CK0H 1WSST 3MV7D 1I9JH 5GGRA 3VGHA 4P46A 3ZYZA 4K94C 2IPUG 4JG1H 1WAAA 4RFOL 4P5KA 4E5XB 4I9WE 5EC2B 5HSFA 4OCRH 2J7LA 3UTTE 2EZ0C 3C09C 4AQ1B 3HUJB 4LPYA 5C0CD 2VN4A 3TWCH 3FQRA 2E6PA 1K9TA 2NY3D 3P30L 5KTEH 2MQCA 2HFEA 5C0CE 5C08E 4W81A 1V3KA 5KS9B 2GFBA 3LKNB 3X13B 3GIZL 1EVUA 3DYOA 3LKNA 3X13A 4NO3B 4ZFZA 1OAXH 4C4KT 3NCYP 4PGBB 4P5TB 2CXGA 4KJQC 3VFMA 1QRNB 2A6JB 3U1SL 4ALAL 1YPZA 1UGNA 3KPQB 1Z3GH 1X9QA 5JW4Q 4EI5A 1IEAA 2HWZL 3TYFA 1TETH 4KUCF 4OFIA 4WFHD 4JDTL 2KQNA 5D93C 1AGBA 1BZ9A 1Q8MA 4F37F 2R69L 4YC2B 1UXWA 3GMPA 4RRPG 4FZEL 4ODBD 4XVUC 1RUKL 3V4UH 5I74B 3MRPB 4HPOH 1CR9L 3MSPA 4MDJA 1HDMA 2FCBA 4D8PB 3F65A 1WFUA 2AJYL 1BFOA 2IPTL 3EYVB 2R39A 4J3VA 2WM0A 4L4VA 4OGZA 2YWYA 1JE6A 1T22A 1VA9A 3DGGB 4APQA 4PG2A 3QR2A 5E0QA 3SPVA 4K9EC 3RHWK 5E9DD 2C3VB 3EJJX 4AG4H 2XA3A 3FT4A 5I73B 2BOBB 4WWKD 4UDTA 3TJHD 2R23A 5I1DB 4XCYB 4LCCC 3BVNA 4U1HB 3TO4D 5D5MF 1FZJB 2X05A 3KPSB 3IXAB 3KXFD 3ECBB 3LN5B 1QEWA 2JCCF 2PYFB 3DMMC 1P84K 4GBXD 5IT2H 4MJIB 3H3PL 1KPUB 3BT2L 4WWID 1BAFH 1GGCL 2X4OA 4BH8B 4LEXH 3RX8A 3NACL 4LP5A 2WANA 1NBVH 4B53A 2IH1A 2GHWB 5I75B 2WQRA 1I1FA 1F90H 3BSZL 1MFEL 2C4FU 1QSFB 2AGJL 1FV1B 3RAJH 1BZQK 5JHLL 4FXLA 4M6NH 3MO1B 2VE6B 4OFYD 5E8DL 5MP6H 5HGDA 4NZTL 3LPFA 3P9MB 3BO8B 5AG9A 4Z7UA 3RVVD 5KVEL 4NT6A 1CTOA 1HZHL 3BESR 4JVPA 5C0AE 4FZEH 3GMLA 4MWFA 1W72H 3KDMB 2J2ZA 1DVFB 4Q0XH 1R5VB 2P4AB 3W5NA 5A2LH 3T4AA 1MIML 3UTZA 1T1ZB 2ZUVA 3MLWH 4WCYH 5IB4A 2NY6D 5I76A 3QUZD 3TN0B 2HN7B 4XVSL 3RGVA 4ORGB 3VD7A 3S37L 3QUMB 4CN4A 3EIFA 4JFYA 3CDCA 4X6CE 2FJHA 1C8PA 1BREA 5ETUA 4ZFOL 3NIGE 4LQFL 3VXPB 1RIUH 1BGXL 1FCGA 1TZHB 3RBSA 1H3PL 5GGQL 1FO0L 2Y07L 3AS2A 5D7JC 2WZPD 3ARBC 1RZ8A 2VLRD 2GK0B 3GUTB 4K2UH 1UH4A 3FFCD 1HIMH 4PRNA 3PQYB 3FQTB 4MAYC 2VXSL 1QFHA 2G2RB 3GDBA 4C59B 4Y1AE 3PG2A 3BRDA 3BPLB 1CYGA 5L2JB 1A5FH 3EGSA 5GJSH 1MCFA 2R1YA 4KJYA 4JM2F 3D2UA 1FC2D 4I8DA 5FFLA 2B2XL 3X14A 3TV3L 3KG5A 5C9JA 2X4UB 1SQ2N 1UM6H 4MQXC 1WCQA 1ZT7A 1RJZB 5HVGB 3HC4H 3SE8H 4OFYA 1U8PA 2X40A 4XCNB 4BH7B 4X6EB 1R3KB 1G9ML 2AJZA 5F9WB 1CL7L 3SEPA 2Z91A 4Q9QL 4YHKH 5ELIA 5T1LD 5KZCB 1TVHB 3I6GA 4O2EB 3RVUD 3VGGA 2BHYA 3MNWB 3A67L 4R97B 4GRWF 4P5TC 4CN6A 2EXWC 3WS6C 4RBPH 3P11H 4F3FA 2W65A 3TVMD 4XMLL 1RZ8B 2C4FT 1QACA 1U8NB 1PZ5B 1AXIB 4Y5VB 4ZAKD 3SY0B 5CIPB 4KGJA 1D9KA 5DEFB 4R26L 1SBSH 3ZZ1A 1QG3A 1QZ1A 3IDMA 4LSQH 3ROOB 1IGCL 1AGEA 3RNQA 4NC1E 3U7WH 5ID1A 3I85A 5D2NB 5H2BB 3BZEA 2OTWA 4WEBH 1OAQH 3ZYOA 4OBSA 1Q9LB 4WO4C 4NQCD 4X8JB 2DL9A 1YEGL 2DQIL 2F19H 5M95B 5ISZD 3GKWL 3MRRB 1L6XA 2ZJSH 3BI9X 4LRIC 1OAXL 4XP5H 3PL6B 1H8OA 4QTIL 1N59B 1F6AB 3WS3B 4NIKB 1MCJA 3GMLB 3EZJB 1M7DA 4FQ2L 4PGCB 2HJFA 2E8YA 1QFPA 2JK5A 1Z3GL 3IT8D 4QXGH 1MF2H 4P48A 1NBVL 3ZYJA 4FRWA 4GKSB 1AH1A 1U58A 1DANT 3O9WB 1EGJA 1ZGLP 4X4ME 5J3HD 15C8H 3VMPA 3BWAB 4YGVB 1CDBA 2EE9A 2H1PL 5I18L 1JRHH 4QHLA 1G7HA 3T3PF 1PZ5A 1VFUA 1G7HB 4H8WL 5CGMA 4ZS6C 1II4E 2X4OB 5L88L 5KVEH 4Y2OA 1T3FA 3DV6B 5HYSA 1M7XA 4HUWA 3HS0B 1OCWH 2P5ED 3SDCC 4HHAB 1LP9A 1UB5B 3BGMA 2DD8L 3HR6A 5C0CA 2CXKA 3MRRA 5AYUL 2WMPA 5HHQA 2H2PC 2LTQC 4K3EH 4PRDA 4UNUA 4X8JA 3B43A 3DETD 1MWAH 4HH9B 4GRWB 3EO0A 3BP5A 2EIZA 4PGCA 4KKNA 3G5ZA 5EUOB 3MCLL 3KPSE 4RGND 3MRLB 1CD8A 3IXTA 3O3BB 1FYTB 5I15H 4K2UL 1K8IA 3MROA 1YDPB 2DYPA 1DBAH 3X12A 4JG0H 4F7CB 3MXWH 2O93L 4YDVA 3VRJB 1NAMB 4Y2DB 4XCEA 2X1XR 5FK9A 4BZ2H 1BQLH 2FJFB 2X4RA 3U1SH 3OAYK 1NCDH 4PJ8D 5EFIA 1KIQA 1R5IA 2OL3B 4QRRE 5B39B 3M45A 5GGRY 1MCNA 4IRJC 4P99A 3VFTB 1HHKB 2ZKHL 2J6EA 2OQJA 2VLJD 1S78D 1SYVA 1I1YA 4F2MA 4U1JB 3D69A 4L5FH 5HD8C 1P7KA 4RIRB 4KI1A 3QQ4B 1OF2B 1HXMA 4CJ0A 5I9QC 4APQD 2AABH 1RJCA 4I0PC 4JJ5A 4RGMB 5HJ3B 1O7VA 5TPWL 4KFZC 5DLML 1DVFD 4LEOB 3CGTA 1G84A 4KQ4H 3JVGA 1NAML 1DFBL 4R90L 3S35X 1J0JA 4F7TB 5DYOA 1MCDA 2OXGA 1FRGL 1RSFA 1U91A 2DL2A 5FUZL 2GI7A 3B9KC 4X6CB 5KJRL 1LO0L 3HG1E 3QDJB 1NBYA 1E4XH 1VFBA 1OQOA 3FN3A 5K9KA 4IDJH 1HIML 4RBPK 3DSFL 3IDJA 1K5NA 3OJDB 4NNYB 3T1FB 3OKKA 2W92A 3CC5B 2Q1EA 1YUHA 4QRUB 1A5FL 1QFWH 4X6DB 5FF6B 1I7UB 1HEZB 3GRWL 1FH5L 1ZLUH 5HBBA 2FJGB 3JWDL 1UADC 5FB8B 1IE5A 2G9HA 5DHVH 3LZFH 1MWAL 4NDMA 3D48R 1YY9C 1UFUA 1NGXB 2C1OA 3VFWA 5DK2A 1KTLA 1UJ3B 3GMOB 2GQHA 1HKLH 4KC3B 2N56A 4MAYB 3ZE1E 2D7TH 2OBGA 3K8MA 1R3LA 3DI3B 3O8XD 2D7QA 5KW9L 1U95A 4QRUA 2XTJB 3HHRB 4ZMAT 3GNML 1Q72H 1U8OA 2PTTB 3VXTA 5B8CA 5FV1L 3GMRA 3NIDF 1OW0C 3T4AB 5F7DB 3T8XA 2GKIA 4TPRL 3GI9H 2OCFD 1JGUL 3RWJA 3HE7D 3MRNA 3VGBA 1EUTA 4JFPA 3LS4L 5ICZB 3U9PL 2D4FA 2NY6B 5E99H 4D9LH 5J8OA 4OCLC 3CIQA 1FLRH 3IFNL 5E2TL 3ZT5A 3BN9D 1I1AC 5ITFB 1CZ8H 3DUSA 4HIJB 1WBYA 2EDRA 3QFJE 5CHNA 2DWEB 5AWNH 4JM2A 3T0DA 2DLTA 2YRZA 4HAGA 2FWOA 5JW4M 3LKQA 3HCVB 3QFJB 3VXQA 1MI5D 1U8HB 4FQXA 1H3PH 3JTSA 3ABZA 4X7EC 1BBJB 2AQ1A 5DK2B 3GKWH 2J1KA 1MELA 5SWZB 1K6QH 2D0GA 2HTLD 2WWKT 2VMFA 4M4RA 4L9LB 4LCIL 3RAJL 5JHLH 1IQWL 1PKQE 3CC5A 3DUUB 4ZDHA 1S7QA 1T89C 4PTTA 1NMAH 3AU1A 1BFOB 5LGHL 2MJWA 3N50A 2DM2A 2B2XH 4XH2A 3O3UN 1AP2A 3I3EA 1RZKL 1DL7L 1NFIB 2CIIB 3I75B 1IL1B 3WFHA 1ZA3A 1N7MH 4L3EB 3X3GH 1T1XA 2YA0A 5FHAL 1BOGA 3FB6A 3OL2A 3SDDC 3WNNA 2QJDA 4L4JA 1E4KA 1PLGH 2FX9L 1YYLH 1FZOB 3GRWH 1AFVH 2FEEL 3KLAA 4TSCH 1CWVA 2ATKA 5DGRA 5KSUB 1FIGL 1MRCH 2F9BT 4MA8H 4Z6AT 1UJ3C 1ZWIA 3PIQA 2ZUWA 3BQUB 3MYZA 5I1HH 4XPBL 2YA1A 4PP2A 4JRXD 4GRLA 5SV3A 5SWQB 3W9EB 4YK4B 5L7XH 4ZQKB 5F7UA 4BFEA 3LMJL 1AC0A 1SHMA 2LFGA 3SN6N 5GISL 2ATKB 2YD5A 3MUZ1 4M61B 4NQVA 5CEZD 1EGJH 2FYYB 2DRUA 1N26A 5DURB 1NANH 1FLRL 5TE6L 3BUYB 1U8HA 4FQXB 4Z7WA 1NC4D 1QKZH 1JBJA 3MUGB 2AXJA 2W9EL 5FYLL 2LTQB 3CMOH 5L8JB 3MXVL 4L8SB 4GKSA 3STLA 3GO1L 1TENA 1IAKB 5CP7B 5C3TA 4HMDA 1OAZH 5E1AB 4OGAC 1QHOA 5C0FB 3CDGB 2NW3A 3M07A 1PKQA 2BFVL 3NIGF 2Z31C 1RIVL 1N6QH 4PB0H 2XQBH 3BP6A 1LP9E 2Q20A 4L5FL 5E8NB 4XHQA 3L3KA 2EH7H 4LARL 2CDGA 3S37X 3G08A 4S2SB 5C07E 3U7YL 1LP9B 1AIFB 1U93A 5DJCA 5ISZA 4JM4L 4OJFL 4YHKL 5EH1A 5DR5L 3V7AE 3RZCC 1JNHA 4CUCA 1TVDA 1AKJA 1G7QB 3EYQC 2K9UA 4OZ4B 4TUOA 4HLZG 3DHJA 4ZUVA 3U7WL 5GS1C 5C0AD 1KLFA 3BZ4B 3LEYL 2AJVL 5KJRH 5EOCJ 3MRIA 5B3JE 3FFCA 1AY1H 3C2SA 2YSSA 3GB7A 3CUPA 2GJZA 4QRPD 1AGFA 4WUKL 3IFPB 3GSXB 3TA3C 4PD4K 1A4KA 1J9CT 4G6FD 5IVXA 3EUUA 3BT2H 4CNIA 5DI8B 2PCPB 3QNYA 4Y8DC 1YMMB 4M43H 4NKQB 5IVNA 2H8PA 1MVUB 1V8HA 2AK1L 5IBTL 3H9HB 3C5SA 2Y9RT 2G9HB 3K81A 4PGDB 3IAPA 5BVPH 5K9JL 3NIDE 1J0ZA 2NZ9C 5KVFH 3OXRB 4HS3B 4QGYA 2A0LC 1WISA 1S9XA 4PJEB 5AUMB 3QQ4A 5TE6H 4ORZC 1AR1D 2AKRA 4JN2A 1LE5A 3BZFA 5DMKB 4KQ3H 5ADOH 2G75A 4ALAH 3UC0L 5KSBA 1HQ4A 3D25A 1LD9A 2GT9A 1PVHA 3AY4A 1CZ8L 1GPOL 3EDJA 1QVOA 3HZYA 5AAMA 3BJLA 3S36H 3SGJA 5JORB 2H45A 4EI6B 3B9EA 1PD6A 4R90H 4CADB 4G7VL 2MPAH 3IAQA 1XZ0B 3MRLA 4JFDD 4OUUA 4XCNA 3V4PH 4BH7A 1GZPA 1OGAA 4OT1H 1J86A 3AC0A 3ULSB 2XKSA 3EHBC 3CVIH 1ROWA 5IMMB 1Z0MA 4G6AC 2HRLA 4OV6F 4OQTL 3MREA 5HYIA 3U30B 2A83B 1CE1L 4XVTH 1ETZB 4WW1A 5JOFA 4G8IA 3IFPA 3BGAA 2B20A 1NDMA 2IFFH 1B0GA 2AJVH 2WBJB 3MLXL 3EO9L 4P23A 5EIIB 3OGOE 2CLRB 3MLVH 5D7JD 4H20L 2QHLA 4OI7A 2NNAB 5FDWA 2EE2A 4JPIA 4PRHA 1AKJB 4B41A 5TDPB 4EN3D 4F9PA 1PY9A 1QA9B 3CVHA 4XCCL 2Q6WA 4JR9H 3L3OB 4JDTH 3PWVA 3NACH 4KJQD 4AEIH 3V5HA 3TNNA 4H5SA 3FRPG 2XWJA 5AAWA 3ZDYE 1RK0A 2A6DA 3DROB 2BDNH 4PJAA 3PWPD 1OP9A 1JYXA 1NAKH 4XCYA 3GSXA 4I3RL 1OAYH 1DQTA 4N1CA 5L2KA 4PJFA 4HBCL 1T03H 3UC0H 3R06A 5HYJE 1OP3H 5KG9B 3GMMA 4Y5YC 3IFNH 3OBAA 3I02B 4PJAF 1T3FB 5HYJB 1NAMH 4IOIB 2YMXH 2WWKO 3UEZA 5GISH 5K59F 3JV6A 3SGEI 2NXZD 4JM2D 4KXZI 5EN2B 1JIBA 4OLWL 2XI9A 4YX2L 1NKRA 3LSOB 3OV6A 4P4KC 4W4NA 3VWKA 4EUPH 1OQXA 5FYKD 1AD0A 1E4JA 5F8RC 4Z7WB 1XGUA 4CVXA 5GRYA 3X17A 3AMLA 3MXVH 3V6BR 4OZ4A 4C54A 3DO3A 4GQPH 2OP4L 4X9IA 3NFPB 1J88A 4OKVB 4WWKB 3DO7B 3HI6H 1LNUA 1C7TA 4FZ8H 3TJHC 2IANA 3WLWC 1I9RL 4K3JH 1FH5H 4Z7NE 5EPMA 3MLTB 2DWDB 1CICB 3CDGA 2FZ3B 2Y5TB 2FGWL 2BVUA 1Q38A 4FFZL 4GW5A 2E7LC 1I7TA 1RV6X 4HWZA 5T3ZD 3NZHL 4U7MA 4WHYG 5DFVC 3TIEA 5DJ0A 3BQUA 5JUEH 3B5TA 2NY0C 1BECA 1MFCH 5LWYH 5ILTL 1EX0A 4RA0C 3QDGB 3WIHH 1E6OL 5MP6L 1VENA 5CMAA 3ULSA 1WEJL 2UY7A 1XGPA 2W38A 2VXQH 4KDTA 5K93A 2YOCA 4D9RE 2YUWA 1ZMYA 1CG9A 1KPRB 1N6VA 5FO8A 1MIEL 4LVOB 3TF7C 4U49A 3CDYA 5IFHH 3JTTA 1BLNA 3OKDA 5CJOH 1S9YA 4WDIA 4P2OA 1RZKC 5IWLA 2WBJA 4FQCL 2QQKL 3BPNB 5EZLB 1ZGLB 1MFBH 4YBQD 4K7FA 1G0YR 4I4WA 4E41A 1CLZL 3O45B 2X4PB 4YE4H 2O26U 1NCTA 4HIHA 4PGBA 2GJ6E 32C2A 2W9EH 4ZFZB 3ARDC 4FQ1H 3EOBA 2QSVA 4P4KB 1G1YA 3I6LE 4S1SL 4ZOBA 3BUTA 3G5XB 4YFLF 4PP1C 2C1PB 3QDMA 4LHUD 3MV8D 3FN9A 3UTZB 1QBLH 3PGDB 4XBPA 4YX2H 1EHAA 1QLRB 3U46B 1RZGB 2C4XA 3U0WH 2MTPA 4G8GD 4HULB 2AW2A 2ITCA 3FQTA 4PFEA 1AXSA 3EYSH 4JFXB 2KDGA 4PJXF 1OOAA 3GI8L 2C3XA 3MLZL 4WU5A 1HI6B 4PV9A 2YD8A 5FYKE 1JZ5A 2G60L 4NN6B 4HC1A 1RUPH 4KRPD 1G7MB 5IB1A 4M6NL 2BNUA 1GIGH 4HC1L 4Z78B 3DX9B 4MQXD 4CN1A 4PTTB 3K4DA 3S4SG 3HE6C 2LU7A 3ARWA 1MPAL 2YXFA 1KTDA 5FDYA 3WIHA 3O11B 1ZLVH 1CFVH 3KYMA 1NC2D 3ZKXC 4U1IB 5E56A 4F9LC 3M8OL 4PYHA 4HKZB 4YHIA 5A2JH 3T2OA 1G9MH 3T0XA 5CJOL 2O5ZH 4JRYD 1MIMH 1I4FB 5IHUH 4GAGH 4KRNA 3VXSA 5EU5B 3QJHB 1YMMA 4JRYE 1YNTA 2KH2B 3ECBA 3ZTNL 4I0PD 1BIHA 3LVEA 2ERJB 2A74B 4LVEA 4RFEB 1MIEH 5DJZB 4G6JH 2ZG1A 3MCKA 4R7DA 4XXDB 3FQWB 3EBAA 1CU4H 5FA3B 1BD2A 2VH5L 3BD4A 2E7LA 4AEHH 1XH3B 3VWJD 1I85C 1T0PB 4PGEA 3HRZA 1H8SA 2XICA 1MQKH 2B1AH 1YNTB 2HLFD 3RWGA 2H2SC 3P0YH 1G7QA 2EDOA 4WO4D 2AEIT 3BIAX 3IVKB 2WV3A 1L9MA 3ARFB 1LO5A 2HWZH 2G5BB 5IR1A 4ZO8A 5E5RB 3MJ8A 2H3NA 2IBZY 4J8RB 1MH5A 2R8SL 4IMKA 5H35A 4MHHI 4X6DA 1NUGA 1E4WH 1LEKB 4PJ5A 4JG0L 4DW2L 2VC2L 3BJ91 1UJ3A 4UU9A 1CT8A 5GGTH 1P7KB 4GRWH 2AV7A 1YPZE 3SE9L 4ONOA 4HT1L 4Q0XL 1LEGB 4ZOEA 2GJ6D 5K59E 1U2HA 2X4PA 3QEQD 2XNAB 4Y5VC 1INDH 2Q7NA 1FZMB 1EO7A 1E6OH 4XAWL 4NZUL 3MLWL 4WCYL 1XR9A 2AI0H 3WL9B 5J6HA 2V5YA 3AB0C 4A6YA 4HFWA 4GRLB 5SWQA 4L3EA 5DMIL 2CIIA 1L0XA 3I75A 2FX8L 5D7IB 2BOCB 4OZGA 4JFFB 4ZS6D 4ZPVB 2YN3A 4XMLH 1MEXH 1T20B 4XNQA 3UO1L 3PWNB 1NPUA 3K4ZA 3OWEA 3K3QA 2EC9T 3VH8B 1WCBB 4OCXL 5J11C 4OCRL 4P2QD 5J6HB 1TCRA 5BOZG 4LSQL 5F9OL 2UVEA 1XF5A 2ZPKL 5KVFL 4LLWB 4GKZA 3BKCH 1GVIA 4MA7H 3BFOA 3R4DA 3ESUF 1F11B 4KZDH 1HYRC 1X5GA 2APXA 1AP2B 1ODAA 3KPNB 3VFRB 1W0WA 4BK4A 5T33L 3JV0A 3FHQA 5EZLA 1ZGLA 2DI8A 4EVNA 2NY1B 3MXWL 4HLJA 3P40A 4L9LA 1JWMA 5A2KH 4PJDE 3QQ3A 3WO4B 2D3VA 1ORQB 2YD2A 1QSEB 1EO8L 4D0DB 4XT1C 3VXUA 4Q9QH 4MCYA 3HC0A 3HZVA 4CMHC 1FIGH 1MRCL 1KLUB 2VQUA 5CILL 2OSLA 5F3BB 5DJ8B 4MNHA 2VDQL 1MI5E 2R0ZH 2P5WB 3VXQB 2BHZA 2FB4H 2BOCA 1WV7T 5I2IB 2CGRH 5EO0A 3CSYA 5H8DA 2E5EA 2UWEA 3DUSB 1LDSA 1JPFA 4MNQB 2XYCA 1F4HA 2EE3A 4R26H 3MUJA 2MMXA 2VDLL 2EDDA 3TJEH 2JE8A 3GMNB 4OSUH 1F97A 2BSTA 2OX5A 1BVKA 1VGKA 4U6HA 4D9LL 1X44A 4HAFA 1HXYB 4L29B 1WTLA 2VUOA 4PTUA 1INDL 5F1OB 4GAJH 3MRBB 3PWUA 4OD2A 1KENL 4Y4FD 1AO7A 2AK4A 2VXUL 4FTVE 3QA3A 4OLVL 4KKCD 3RL1B 1ZHNB 1G9NC 4XVTL 3BMWA 2B5IB 4ZXBB 1JHTB 4M1DH 5TDOB 5EO1B 2OJEA 1NLDH 4FZ8L 1LO5B 2BVQB 5J1TC 5IP4A 1FNHA 3FQXB 5ESAB 1FJ1A 4GO6B 2DQGL 5K9KB 2GIYA 2Q8BL 4HD9A 4H20H 4CMHB 3U0WL 3WNLA 3JWDH 4CGTA 1BFTA 3JWOC 1UM6L 1OB1A 3IFLH 5GS1B 2PO6C 1ND0A 1CXLA 1TXKA 1UG9A 3ARRA 3C60C 1MWAA 1HKLL 4PJFB 3UTSD 5DWUL 1NDMB 3TWCL 4D0CB 4KKAD 3B3IA 2RBLA 3FB5B 5B3NA 4HWBH 5I8CB 1XIWB 3WIHL