1F51E

A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in signal transduction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords SPORULATION INITIATION PHOSPHOTRANSFERASE B
total genus 31
structure length 119
sequence length 119
chains with identical sequence F, G, H
ec nomenclature ec 2.7.-.-:
pdb deposition date 2000-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f51E00
1PUXA 2MYPA 3OLWA 3A0RB 4MR8B 4MLCA 3BRSA 5C5EA 4NV3A 5FWYA 5JS1A 1NXOA 1Z16A 2M1ZA 3Q15C 4MGEA 3I5AA 4H3KB 4RKQA 1K66A 4L85A 3DLBA 1JL3A 2GWRA 3VNAA 1ZY2A 1XHFA 4EYKA 3QEMA 1YS6A 1P2FA 2HSGA 2M98A 4W5QA 3O21A 2MYNA 1QP0A 1USGA 4KPYA 3CG4A 4PE5B 5KWSA 4G0YA 4N41A 1NY5A 1MAVA 1C4WA 3KLNA 1I3CA 3O2SB 1PNRA 4LE2A 1KRXA 3OMXA 4JP1A 4ETIA 2X7XA 1DJMA 4RK5A 1BDIA 3EDCA 5FBKA 5TQJA 3IDOA 2HJ9A 3MQ4A 5B3JC 4HNRA 5IBQA 1A04A 3QLTA 4EGSA 1NXPA 3JTEA 3KS9A 1D2AA 3QLVC 5TQ2A 1NXVA 1RXEA 4Z4HA 3T6KA 2FW0A 4DQDA 5FWXB 3LUJA 5KQPA 3O2JA 2XDYA 1DRKA 3DZDA 1ZGGA 3EAFA 3GL9A 3RVJA 3P9YA 5IUJC 3IP6A 3IPCA 4MR9A 2L2QA 3HDGA 4PYRA 2B1JA 2DRIA 1Z2EA 3CFYA 1MIHA 4YP9A 1QNLA 1ZITA 4QYMA 1SD5A 4KRFA 5BRJA 2WB4A 4KMRA 5JNTA 3HZHA 5C5CA 3Q9SA 3TB6A 1HEYA 2E4VA 1GCAA 1JDPA 3H75A 3LFTA 4LZLA 4PEVA 4LRQA 4YGXB 4QICA 3EQZA 3OLXA 3R0JA 5KI6A 2IKSA 1SXGA 4IMJB 1YTUA 1DBWA 2ID9A 4MAAA 1W25A 2GI4A 3EGCA 5TQ2B 2FN9A 3JY6A 1RZRD 4KNYA 3H5OA 1FQWA 4GNRA 5IULC 1DCFA 4KQCA 4HNQA 4RV5A 3O1HB 3Q7RA 4ZPJA 4RK1A 2FMFA 3KCNA 4OLAA 1P6UA 4ZYLA 2GKGA 6ABPA 3GBPA 1Z26A 3OQNA 4W5TA 3GWGA 2FSPA 3H5WA 4O1IA 5E3JA 2PAFA 2ID7A 1A0OA 1Z18A 2JVKA 2AYXA 1K68A 3MMNA 1TVMA 1H9CA 3RVPA 2R4QA 4RK6A 5DGCA 3ROFA 2PUAA 2N9UA 1QO0A 3KYIB 3FFTA 2H3HA 2R47A 1E6KA 4KZKA 2WJWA 2NT3A 2HQRA 5IEJA 1YK0A 4OLBA 5JNSA 3IP9A 4RY9A 4EYQA 3LMKA 2RJNA 3B2NA 3KG2A 4YCSA 1W9HA 4MR7A 3S99A 2PUCA 1XWWA 3F6CA 3CZ5A 3OLZA 3T8YA 2IPMA 3LOPA 1M2EA 3O75A 1MVOA 4PZ0A 2PUBA 3NNSA 5TPWB 1YVUA 4F11A 2BGGA 3N0WA 3QEMB 3OM0A 4YO7A 7ABPA 2QZJA 2FEPA 2GX6A 3RVSA 1C0EA 4Z4GA 5D2CA 5BR1A 1LJLA 1USKA 2PUEA 1M5TA 1VLZA 2QW1A 2MYTA 3OLVA 5EWJA 1QQAA 3M9XA 2FQXA 2PUFA 4LE1A 1EAYA 1L5ZA 3C3MA 4XXHA 1ZH4A 1A2OA 3FMVA 4UHKA 4YR7A 1OXKB 2QVCA 2YHAA 3EQ2A 2QR3A 4MS4A 3MIZA 2MSWA 3KKEA 4L4UA 2IPAB 4ML3A 2NT4A 1LJUA 3NNDA 1VKRA 1P6QA 3C6QA 3D8UA 3H1GA 5EWLA 5EWMA 2PLNA 1RNLA 3W9SA 4ETMA 1PEAA 3JPWA 2HPHA 3QK7A 4MQFB 1YMVA 5F64A 1APBA 4S04A 2PE5A 2IDMA 1BVHA 4MQEA 4MRMB 4JB2A 3RVKA 5TPZA 1KRWA 1NXXA 4TLMB 1TLFA 4RY0A 1MB3A 3L6UA 4RK4A 3SAJA 3OQMA 3HDVA 4Z4IA 4PICA 4MR8A 4G0PA 1FSPA 5KC8A 4Z4CA 3N53A 4OTZA 2OENG 1DCKA 3HM9A 1E2BA 3TX6A 4IILA 3HJFA 5IUNC 3G1WA 1WETA 2L18A 4HNSA 1EWTA 4JA2A 4N76A 4RK0A 3BRQA 2IOYA 4RS3A 2JVJA 2CWDA 3RVQA 1ABEA 2E4YA 4DN6A 3CRNA 1BDJA 1DP4A 1U2QA 5KQGA 1PNTA 2WRZA 3CG0A 3EJWA 1QQBA 5ED4A 3HS3A 3JPYA 4ETNA 3QLVA 1M2FA 3QEKA 3H6HA 3VNBA 5KQLA 4YV7A 1QMPA 4FB4A 2FTKE 1JFSA 1JFVA 3Q7TA 3KSMA 1JDNA 3H1FA 5JNVA 5JS2A 4KV7A 1TJYA 4TN5A 3NBMA 4D74A 2WWVD 3QLUC 1B00A 1YMUA 4TLLB 4KQ9A 3QX8A 2ZAYA 3LUGA 4NQRA 5IEBA 2P4UA 3HEBA 5HSGA 1GCGA 2CHEA 4EYGA 2E4WA 1Z2DA 4W5RA 2IPLA 4B09A 3GT7A 1JYEA 1ISRA 1D4ZA 1SRRA 3H5VA 3O1IC 6CHYA 1S8NA 3F7NA 5TE9A 4EY3A 9ABPA 3NHZA 3I45A 4WUTA 3O74A 2WJAA 3C3KA 3Q41A 3QLUA 5TPWA 3EODA 4EVSA 2A9OA 2QV0A 3LTEA 4G0MA 2QU7A 4F12A 1JYFA 1D5WA 3MA0A 5DTEA 4LDAA 4IGAA 4Q6BA 1MB0A 1LBHA 2KYRA 3LUCA 3O1JC 1Z13A 1E6MA 1PHRA 1UDRA 2E4ZA 3FFWA 4MQEB 2QXYA 4O1HA 4UHJA 2V0NA 2MSLA 3H6GA 4XASA 2RGYA 1BA2A 1IIBA 2L19A 4O5AA 4MR7B 5GQSA 2P9HA 4E7OA 3C97A 5BQ3A 3FFXA 3N75A 1Z15A 1Y1LA 2R48A 1JHZA 4RXUA 1PEYA 2FQYA 4H60A 1RPJA 4JASB 5KQMA 4EVRA 2F8TA 2PL1A 4XAQA 1KMIY 4MR9B 4YS6A 5CNIA 3H5LA 5I4CA 1USIA 2LP4Y 4G0ZA 1Z12A 3H1EA 4N03A 1NTRA 1TM2A 4KVFA 1ISSA 2JRLA 3GA5A 5CNKA 1DRJA 3A0UA 1QPZA 3DLHA 3A10A 3URMA 3K9CA 3F6PA 3KLOA 2VK2A 3T95A 1R8JA 4LX8A 1BAPA 4MLDA 4XARA 3GBVA 1JH9A 3LKVA 8ABPA 4HYEA 3KHTA 3RVLA 1URPA 3RVNA 1U2PA 1LK0A 3RH0A 3KYJB 2PKXA 2VUIB 5IC5A 5T7BA 1SXHA 1XHEA 3HV2A 4M88A 4Z4EA 2GBPA 4WWHA 3JVDA 1RZRA 3I42A 1YK1A 1ZHHA 4F3TA 2OQRA 5HM6A 2WMYA 3K4HA 1EWKA 3HVRA 3OM1A 3F73A 1YIOA 3OLYA 3Q7SA 3LKBA 4W5OA 3CS3A 3GYBA 1DC8A 3FGZA 2RJOA 3E3MA 4RK7A 2E4UA 1E6LA 3GRCA 3H5TA 3N0XA 2PMCA 1VRVA 1DBPA 2FLKA 1D1QA 3LUKA 4RDCA 1EFAA 2F8SA 3NNNA 1YS7A 3IP7A 4YLEA 5HKOA 2L17A 3A3KA 3IPAA 4MQFA 4YWHA 1NATA 2QVGA 3HSYA 5TQ0A 1ABFA 4N0PA 4N47A 4WT7A 3BREA 4D6YA 4OBBA 1U8TA 2WY2D 2A9PA 3SY8A 2NUBA 4RXMA 1ZAYA 4XLTA 3OO0A 3M6MD 3ROTA 4Z9AA 4W5NA 1Z25A 2O20A 3OMWA 3RQIA 4QPJC 3RVRA 4OG2A 1L5YA 2IYNA 4G0OA 1J56A 3RVOA 4CBVA 4MS1A 4WZZA 1CHNA 5BRAA 1KGSA 2YHBA 4LDZA 2A9RA 4JAVC 1JFTA 4JOQA 2FMIA 2IPNA 1SXIA 3N6VA 4YRZA 2MYUA 5JNWA 2FEKA 2FXIA 3JS5A 1CYEA 5HQJA 3LUAA 4G86A 2LIVA 2PUDA 2JB9A 2PJUA 3LUFA 4RZSA 3I09A 2RDMA 3TO5A 1JWLA 3DGEC 5ABPA 1M5UA 5FWYB 3SQNA 3G85A 4E7PA 3LUDA 4NICA 4ZJPA 2VUHB 5FBHA 2FMHA 3ILYA 4DADA 1QO0D 4ZMRA 1FFWA 4G97A 5EWLB 5FWXA 4RY8A 4MS1B 1QKKA 1FFGA 4FE4A 5EWJB 2LPMA 5GOTA 3JVIA 3N8IA 4WXEA 4F06A 4MRMA 4G0QA 4H3HB 4RU1A 5CNMA 4NCBA 4KREA 4F8JA 4QYWA 1ZDMA 2JVIA 3DBIA 4ZMSA 2PL9A 2PUGA 1DCMA 4RKRA 2MSKA 4EUKA 4EYOA 2JK1A 3GV0A 2R25B 3KTOA 3M9WA 5B3JA 2I6FA 1ZESA 3TMYA 1AB5A 3EULA 4MYRA 3N0RA 3RVMA 3QX9A 2FN8A 5CNJA 2H0AA 3C3WA 2CD7A 4NCAA 3LUHA 4Y9TA 2FEWB 5DKFA 1QP7A 2JCGA 5EWMB 4Z4FA 1P8AA 4XFKA 4EVQA 3MF4A 2NZUG 2HQBA 3DGFC 4N0QA 2W42A 4RSMA 2A9QA 2QSJA 3HUTA 2JBAB 3HXMA 1Z17A 1ZN2A 3E61A 3HCWA 2FVYA 1U04A 2CHFA 4Z9BA 2JBAA 4MS3A 1NXSA 3NHMA 1NXWA 3MYYA 3T38A 3OQOA 3KJXA 4WXMA 5T3YA 1JLKA 1GUDA 4P1ZA 1GLGA 1ZVVA 4MS3B 1BDHA 4MPTA 5JNUA 4JB0A 5CHYA 1T34A 2ZWMA 3D02A 1JBEA 2FLWA 3MM4A 3CKMA 3QELA 4Z99A 4KK3A 3TD9A 1F51E 4S05A 1ZGZA 1EWVA 3OO1A 3HUUA 4Z0NA 4IRXA 3FDFA 1OXBB 2LBPA 3QELB 1U0SY 4P98A 4Q6WA 5DCLA 3HK2A 3UUGA 2J48A 2VYCA 4IMIB 1DC7A 3SG0A 1F4VA 2LUOA 1DBQA 3L49A 4RWEA 3UK0A 3CZCA 2Q5CA 3UKJA 3ILHA 1AB6A 2HQOA 4IF4A 1RXIA 1TMYA 5PNTA 3CHYA 2E4XA 4GPAA 1EHCA 1DZ3A 1GUBA 1ZH2A 3CNBA 1FFSA 4OATA 2AYZA 3HO1A 3H5IA 1DG9A 5KC9A 1NXTA 5IUKC 4TMYA 1QP4A 2B4AA 4KK4A 2FMKA 2NZVG 2FQWA 4MS4B 4D6XA 1VPWA 3O2QB 1JF8A 1JX6A 5TPZD 5DLEA 3CTPA 5JNRA 1CEYA 1LBIA 2TMYA 3IP5A 2FKAA 3SM9A 3CU5A 4G0XA 3BILA 4Q7EA 3SNKA 5TQ0B 3BBLA 5IX8A 4FE7A 4LE0A 4KFCA 4RXTA 3CLKA 1D1PA
chains in the Genus database with same CATH superfamily
2D1TA 3KFXA 2E7ZA 3ORHA 1KPIA 4MP8A 1A4RA 1R0ZA 2Y93A 4KSBA 4YHHB 4ODIA 3PIDA 1JR6A 5TMPA 1Z6GA 1Z4NA 3B1VA 1KI2A 1U8EA 1QGED 5I45A 5IVKA 4UUAA 2PAAA 3I5AA 1G3RA 1NNLA 2NUPA 3JATA 1EYZA 1HE2A 2O2CA 1D04A 2X42A 1TQ8A 3FVQA 1TDJA 4CQMD 3RC8A 1GTJ1 3R41A 1DKRA 3OT1B 2J67A 4L2IB 3GYGA 4DSNA 1WDWB 1OAOA 2M6LA 1PGQA 3HJRA 5DYNA 4FSDA 1QDEA 1IMJA 4BWYA 2MYNA 2ZVPX 3VZRA 1QP0A 3LOQA 4HVCA 1NASA 3E1KA 3IQFA 1EZ4A 1TMOA 4WIAA 5IVPA 3GLIB 3LI2A 2GZ3A 2P9TA 2QSZA 3USCS 2H11A 3JASA 1IC6A 3D5EA 5JEEA 2F4VB 3DXXA 3HJBA 4Y98A 1NX9A 1AF4A 2GNAA 1SUIA 3WNDA 5G53C 3V1YA 3QLTA 3ZQ4A 5FOTA 2MMCA 1X0VA 3QUCA 5T5QA 3V8NA 4C2UA 5JJBA 1JPUA 2HB6A 4LW8A 1HX7A 1BMTA 1FDUA 3HEMA 1RAAA 2PY6A 2XDYA 1QZUA 1S0UA 1QIEA 1NMYA 4M4SA 1QH0A 3RYCA 2BHTA 1Y1QA 2R2AA 4CPDA 2BSAA 3ZH2A 2ODAA 2W0MA 2H8KA 3CFYA 4LHSA 4H27A 2JF0A 4TROA 3VNRA 3FB1A 3TE7A 2YBEA 3HNRA 1TMGE 2WB4A 5AKHA 2LDBA 1XDWA 1Z6XA 4ZI7B 1AQIA 3OMLA 2A4KA 4K6GA 4W1PA 2Q7DA 3WGKA 5JRDS 5K5EA 1T8SA 1MH1A 1SXGA 4R51A 4NXNB 4A8HA 2NV0A 4FXOA 4CETA 4L07A 2Z8YA 2D3TA 2ZR8A 4LBZA 5E1OA 1FQWA 3CQ9A 3IA7A 1KEEB 2JH9A 2CZCA 2RHLA 4GNRA 3UHOA 2VDPB 3U39A 1L4EA 2C88A 1GKKA 3GLTA 2B21A 1RPNA 1PO7A 2WTNA 2PRIA 1XKQA 2O05A 1J1UA 1VGQA 3MUOA 1MHPA 3GGSA 4KMMA 4DC1A 3K4PA 3NAQA 1YULA 1NWHA 3P2KA 1BXGA 3TK1A 4F3CA 3QTBA 1QMGA 2JVKA 2ZRBA 2I2WA 3CTMA 3QYFA 4KXXA 3ZWDA 5B30A 3JRWA 2CFCA 2WE7A 2QQEA 3QNWA 4ENRA 1DAEA 3AFOA 4BVGA 1E6UA 3IL2A 3DP7A 3K0BA 4PLGA 2Y67A 4ALJA 1QO0A 3FRJA 4CGZA 3AONB 3HN7A 3EG9A 5CCEA 1L7PA 3QHPA 4L8LA 4PG7A 4FEAA 3VDNB 4NC9A 4Q4CA 4CEIA 3D8HA 4UKDA 3PDJA 2CUKA 4EYQA 3KV3O 5BSVA 2FEOA 4OQXA 3TLXA 4F21A 2CBZA 3H6KA 4U7GA 4M1TA 1A9XB 2DHCA 3AV3A 3EC2A 1H8EA 3V2IA 3FJYA 1STOA 3B8HA 2DLDA 3O75A 4H3SA 3T3MB 3K8YA 2P5TB 3I1YA 3UATA 1C7ZA 1MC4A 1XTKA 4NEHB 3JYNA 5BSEA 2XT0A 3TOSA 1CS4C 3OTOB 2GX6A 2FEAA 1GA1A 2RHCA 3ZWOA 2GPJA 3TIGA 3WY9A 1B0PA 3RAEC 3X3HA 2C4KA 2NUTB 3FPJA 3ZNNA 3NIFB 1SHTX 2ZRDA 2E1PA 4IOKA 3PGXA 4DYDA 1P1CA 1XRRA 3A1VA 4ZV4A 1PT9A 1Z34A 3FFBA 3ANMA 2VTKA 1QONA 2IQIA 1NYLA 3DFFA 4GLBA 4Y1RA 1CC1S 4IHJA 5BYJA 4RA6A 1E7QA 1U0TA 2YHIA 4DSTA 5K9ZA 2I76A 5K3OA 3I1IA 3E8MA 4HDRA 1Z62A 3U4HA 3LCUA 4CQMA 5LP6F 1RZ3A 3K92A 1DG3A 3O3MB 4MWCA 4QXQA 2K5UA 4JP5A 1EH5A 4A27A 1KJIA 1UBGA 1SC3A 4Y6RA 1D2HA 2OB2A 2ZYRA 3NNDA 4HQRA 1FJ2A 4MYUA 3CLRC 2J5XA 1UJBA 2CNWD 4RD1A 3VTFA 3B6EA 4DXDA 1YMVA 3KSDO 1T0HB 3VSAA 2F43B 3JWGA 1UMDA 1RCUA 2EDAA 4EW1A 3H2YA 1TC1A 5AIBA 2DB3A 3SX0A 3LUBA 2QRNA 3R0XA 5GJBA 1R50A 4BLTA 4X61A 5CD9A 2AVDA 3I52A 4YX9A 3KELA 2GRJA 3IKVA 5JASA 5LYJF 1LZKA 4HNGA 2PLRA 4UCWA 1FFBA 3K2BA 4IILA 5LLSA 4OBEA 3U3JA 1Q14A 3FNHA 1ZIXA 4KIGA 3WS7A 5JDIC 1DRWA 5EJ7A 3A1EA 2IRWA 3MWGA 4M54A 5EINA 3VU3A 1A5SB 2QR5A 5KTKA 2PSDA 5KQGA 2RHHA 2ZYUX 5KNDD 2YWXA 3WQSB 1CS0A 3DF7A 3QKSA 3WIBA 2I7VA 2W9XA 1I6MA 2ODPA 4KLCA 1KAMA 1COWA 1BD3A 1T0UA 1Z83A 5BUZA 2EFHB 4BCBA 5JXIA 5D85A 1UKEA 3D5TA 2FEMA 2E5FA 3TVTA 1UIMA 2AZMA 4AN4A 3E5HA 3ZUGA 4MUNA 1SH7A 3UJCA 1K8RA 3F9CA 3R77A 4PIVA 5CW2A 1X1QA 3HRIA 4S35A 1LA2A 5FFNA 3G3EA 3KR1A 3HU5A 4BZQA 4EG4A 1ECFA 4MUKA 4KQ9A 1SCIA 4BGUA 1QWSA 4FB5A 1VCIA 4TXNA 3SBOA 1TF5A 2EWVA 1EHIA 4G0NA 3PYMA 4YMHA 1CRWG 2D5CA 1KO1A 1OLUA 2AW5A 1J4AA 2XVZA 3IDZA 3O31A 4MJLA 3RFUA 1HNWB 3TKAA 4KBGA 3PQFA 2B92A 1ISRA 3K9QO 1VJTA 3HSSA 4MW6A 3DMFA 1DAPA 2Q4RA 2VJBA 2XUKA 2RGWA 3HE3A 4GQIA 3RU2A 4WLOA 1BTOA 5I7SA 2CT8A 2VT3A 3O74A 3EEYA 1ZNYA 1PTJA 3Q41A 2V96A 4JDPA 1QGUA 3WGYA 3BA1A 3GZNA 1EUCA 4X92A 1BHJA 3MA0A 4X7PA 3NVKI 5F4ZA 2V7QD 5IF3A 2G1UA 3OT1A 5C8XA 3CWCA 4P3KA 4BGVA 1C0KA 5J4HA 1GZVA 2X1VA 2QTTA 3K31A 2Q6TA 5G0TA 5C53B 3JQAA 3IMGA 3NHAA 3K5IA 1M1NB 4HQLA 4RORA 3IQZA 1R16A 2E4ZA 4COKA 1ZFNA 3ZZMA 4NMMA 3M1LA 1RZUA 5JZ9A 3BAFA 5E9AA 4H08A 4BNFA 2MSLA 3NJ8A 5L95A 1TLTA 4WKOA 5TGDA 3MGGA 1CUDA 1I8TA 1LXCA 1OYYA 1SCDA 1SBZA 2AW3A 2FZVA 2QI9F 2YMLA 1HETA 4MV3A 5IAGA 1N5JA 1ZHFA 5AW7A 4DV0B 2BMVA 1RADA 4RXUA 2FQYA 4JASB 1R15A 1MO4A 1A8HA 2X5OA 4KE6A 4FP9A 3IHLA 2WWYA 1N7JA 1WSAA 4EJSA 3H5LA 5LCXA 1VE6A 4G0ZA 3ENQA 1N8SA 3ETEA 4IQGA 1NTRA 4IJVA 4FYMA 4UUPA 4KXLA 4EUHA 2WK1A 3C0KA 1H0HA 4HB4A 1IE3A 4G1EB 1FTSA 1P2DA 4PAMA 1OH6A 3S7TA 2GKOA 2G72A 1B93A 1MORA 3KOZA 2VK2A 1TRHA 1BAPA 5E2IA 1BYUA 1XYVA 1Z4IA 3PNQA 3M4JA 1JJ7A 3TQOA 4KSCA 3K6SA 5DW3A 4HYEA 3FAKA 4FWTA 3EXHA 5L6MB 1W5FA 1IQRA 4JVMA 3VAYA 5B36A 3SGLA 2O2JA 2VRCA 2WNIA 5EPUA 4AJJA 3A2NA 4MWDA 1V47A 2YWBA 4FT4A 4CF5A 5KYNA 3G6WA 5CB4A 1LS1A 3GUHA 1RZRA 2XXAA 1R5NA 2H2DA 1ISPA 2XNDA 3CB2A 4U2KA 4ZQFA 2A94A 4C29A 3OHMA 5IXJA 2I7TA 1C1HA 1SM4A 4J2TA 3ABIA 4U3JB 1O0CA 2AG5A 3Q7SA 1UWCA 3PPVA 2ZUSA 5LDGA 4DT1A 3T3OA 3U7GA 5JO9A 2RHTA 1RU3A 2YYSA 1W7AA 1RI4A 1I2DA 4IG9A 1QIJA 4R2JA 4TZ0A 4GKAA 4LECA 3VHLB 2J3KA 4BUZA 1X94A 4JI8B 1H0RA 1DEOA 1RMQA 2BE9A 2C3UA 3K0FB 5IFLA 2QIOA 3IDQA 3SHOA 1L5WA 4B85A 1Z9BA 2VZ9A 2RMKA 5HKOA 1GRRA 2CLOB 2Z5LA 5EZQA 1T6XA 2WUFA 2OFFA 5BR8B 4P9NA 3JQFA 4L75A 5IJXA 2CHVA 3GPBA 3OC0A 5DT2A 3IE1A 1ABFA 5EZYA 1ISHA 1IQPA 1PDOA 4G6ZA 4OJKA 4J91A 2DGDA 5EZ5A 4BJHB 4URZR 2RAUA 4CTNA 1XZMA 3WB1A 1MGPA 2NYVA 4KQIA 2PXCA 1ZM9A 4QBTA 4E22A 1EVQA 1FK8A 4IHQA 5M34A 3O93A 5GZ1A 3KSRA 1NP3A 4OG2A 5FRDA 3KOMA 3WLEA 1J56A 2LE0A 5D7NA 1FRZA 5J2TA 1N1MA 1R00A 2BMWA 1Z3IX 2ZJ3A 1GNPA 3M9LA 1LWOA 4GNKA 4KYVA 4CN8A 1Q0RA 1R1DA 5K09A 2ZJFA 1OFVA 2KB0A 1W1UA 2YW9A 1MB9A 1ZD3A 1M6NA 2PWAA 2W6ZA 2OBFA 2YASA 4GXTA 3UWSA 2BVNA 4N7BA 4EX6A 5AQ1A 4A0GA 4I9FA 3VC1A 5DNYB 1PR5A 4HSGA 5DVZA 1DAKA 1YL5A 4L8WB 1KAEA 2FGJA 1P7VA 1L7VC 1NG9A 3LF1A 1LSOA 2XTNA 1KY4A 1ORVA 2G1JA 4L4XA 2XVAA 3LT5A 2G40A 2QRZA 3UAGA 5LMUB 1EGMB 2WIFA 5AUPB 1FFWA 2ZUCA 4FI3F 3N2KA 5JD6A 1LCIA 1M10A 2G8NA 4J43A 5FHRA 4MYDA 5C1IA 1ES9A 4CW7A 2BELA 2GK6A 5HQTA 1LPBB 1ULAA 2Z4RA 4NCKA 5EWJB 2X2FA 3BIWA 4DWWA 2GJAA 1KKUA 3DCNA 4CLHA 1ONNA 3GLFB 4WEQA 3EXFB 4N65A 3RF7A 2R84A 3QW4B 4IUBS 3S1LA 1O54A 4F06A 5CBPA 5BW5A 1F3LA 3S2IA 4FGWA 4MVJM 3U9TA 1D09A 4PSAA 4TTTS 5K0EA 5KTPA 1BNCA 2EV9A 5C8DA 1NURA 3PEUA 2V7XA 3RREA 3LQRA 1T5DX 4I6JA 5C0OE 2WWTA 2Q2VA 4D8VA 3AYXB 1GSIA 1UL1X 2YHIB 3TMYA 2BFEB 5ISMA 3IXQA 1NQAO 5CD1A 4YREA 3LPDA 4ARCA 1Q50A 2C9MA 4PIPA 3V55A 3C3WA 4B2LA 2HKIA 3DAOA 2QL9A 1UWLA 5ALOA 5EFOA 5LYYA 4NCAA 3M4NA 3VBEA 2OXEA 4X1KB 4RGQA 3WHLA 1TCUA 1XDZA 1NI4A 3CNHA 1C5KA 1JA9A 3B1FA 3STYA 1RFLA 3E0XA 3QBDA 2YRWA 3TPFA 2ZJ8A 1H6DA 5HZHA 2QRUA 5CCXA 1UMDB 1WCWA 2QSJA 3SSNA 3A6HA 1KEUA 3NETA 4KXQA 1P7YA 3N2GA 1NQTA 4E30A 5BV8A 4C21A 3DFIA 5JO0A 5AKIA 1NVAA 3IOMA 1TQHA 4EFLA 5KVSA 1JPVA 1E1YA 2O5CA 3KJXA 1W8DA 2VRBA 1HZZA 3BSYA 3GGCA 3W8NA 2BC9A 3B3GA 3VDMA 4TMVA 1DFHA 4QGAA 3WL5A 2VDWA 4GSYA 1Y6JA 5FLEX 1RBZA 4N5DA 5T8KA 5C8YF 2DY0A 1P91A 2QUZA 1N2OA 3QELA 2J32A 3QKTA 3HKCB 2CMDA 4YJFA 1P1IA 3QIAA 4PPFA 2OV1A 5HFAA 4BJ3A 3U7JA 2FW1A 2EHJA 1M2VB 2QR2A 3A3NA 4LTDA 2VF5X 1W87A 4EZEA 4AQYB 1H6CA 2WYVA 1QCYA 3EMBA 2OC4A 1E9DA 4IMIB 4MKZA 1JHXA 1SUEA 2QRKA 5GWXA 3L8MA 3JQ8A 1LV8A 3UK0A 3WXBA 4RQAA 3EG9B 3N8GA 3OZ7A 4ZAFA 3ZWNA 2OV2A 2YMQA 2VR1A 1CEXA 3I53A 2OHOA 4RIEA 5CB4F 5K0BA 5KBYA 4PG8A 2VXCA 1KQFA 2Z6AA 3HL0A 4H0NA 4TWJA 1ZJWA 1DZ3A 2ORYA 3MOIA 3KQWA 1EDDA 1R5BA 3GK3A 3AK4A 4UMDA 1OZGA 1KR2A 1YB5A 3E1SA 3T1NA 4A16A 5JI2E 3ASUA 4TWBA 1QIMA 3CPEA 3T35A 3E8XA 3QKRB 2RG7A 4E5PA 3ACCA 3GPDG 2D1FA 4LRXA 5KC9A 2I4LA 5G0SA 5IUKC 4EA8A 1WPGA 3PNMA 4D4KA 2B1QA 4I5FA 1GU0A 3RGWS 4TS4A 1OVMA 1RYFA 2ZREA 1BQEA 5I3CA 5JFGA 3GF4A 3OJLA 2J3DA 3OTWA 1VLVA 4OQNA 5LBTA 2WUVA 3T3EA 1VM6A 1L4BA 2FK7A 5CA1B 3G2JA 4B3DA 2OCAA 1ZOLA 5J5CA 1UBHS 1OKKD 1BX3A 3P0JA 4HX5A 3FJ1A 3RSCA 3K35A 2VPQA 3OHSX 3CLKA 4LNAA 2JLQA 3EQ8A 4NYMQ 4TL7A 3AKYA 2Z8XA 3OPQA 1TK9A 1M6VB 1OQAA 4MR8B 4H1VA 5KSOA 2JFXA 5HKAA 2HBRA 5DM0A 4LJRA 5AJUA 4IOJA 5JALA 1K7SN 1NXOA 2PT9A 2YWCA 2WC1A 2ZYHA 3ITNA 5IWAB 3PB3A 3F5QA 1FBNA 4G56A 4P36A 1E1RA 3HNOA 2GNPA 1NMSA 1YRYE 3U9LA 1R0LA 4DLNA 4UUMA 4G07A 3QFHA 3GJTA 4AVYA 4R7ZA 1V96A 2WTXA 3HJHA 1I7NA 3KWMA 4PHGA 5F7ZA 1LTKA 1GG2A 1Y0BA 2V74B 3MWYW 4BN0A 1ICIA 1YQUA 1FTYA 1C9JA 1I3CA 1UR5A 1YVEI 5LWHA 3ZXSA 1KYZA 3L01A 3KPUA 4RHTA 1NV9A 1KEZA 4GU5A 4XKJA 2VAMA 2W00A 2GERA 3SD7A 1LDEA 3W7AA 3ZEAA 2RKWA 3L92A 4U0KA 2WILA 5ICFA 1IXKA 1K7FB 3ZI0A 3J81k 4A0QA 3R3SA 4HJXA 4Y18A 5KHOC 2CXNA 3NHPA 4CF3A 4FYWA 2CXHA 3DZDA 4NNOA 2QVLA 2R6JA 5K8JB 5EIBC 4CDMA 2EU8A 1IFXA 1AS2A 3EXIA 3H8WA 3IUQA 4C04A 1O03A 2D1RA 4IKPA 4INJA 4WUVA 4CV0A 3Q8WA 2EW8A 2JKZA 4PYOA 1Z6QA 5LYJB 1SEVA 2EZUA 4UVHA 5KYWA 4U7HA 4UQPA 4GECA 3DKRA 5HR5A 3TKLA 3W05A 2HSDA 2IYPA 1M0EA 2ZS9A 3D7KA 3I9V1 1OWPA 3KZ1E 2XCUA 4OKNA 2G88A 2GM4A 1EFUA 3AR5A 2NLOA 2FZEA 4EJ2A 4QXOA 1QC5A 5CVEA 3F96A 4IBOA 3G8AA 3K0FA 4I9UA 4N49A 4YMIA 1Y5NA 3CEMA 3K0CA 5TNXA 5IULC 4JL5A 1Z73A 3A9RA 1DQSA 2AX3A 3ZV3A 2AEFA 1G5IA 3WAKA 1WKCA 2EYUA 2X5JO 3A9SA 5K8UA 4TYNA 1Q0TA 3LC7O 1J1IA 2W6ID 5AUQA 5JY1A 2ZITA 5CR9A 4BVJA 4CKYA 3IIJA 2LXNA 2PGDA 621PA 2NU9A 2G9VA 2AOWA 2XEDA 3O38A 1XMOB 1O58A 3GQBB 1H9CA 3RT7A 1K0UA 3AUAA 3UJPA 3RJZA 1OA1A 4BAUA 1TYDE 3ZHVA 3DOIA 4M7RA 2XA9A 4XCVA 1KERA 4MPRA 1I2ZA 1XIVA 4CT5A 2ODEA 4X20A 1SVWA 3T7DA 3WYAA 2BMJA 2H3HA 3C1UA 4UZFA 5BWNA 3G0OA 3TD6A 2OESA 3ZJUA 1GUYA 2REBA 5HTKA 2CNBA 3P9IA 4QXRA 3ZDFA 5LZ5A 1G2OA 2IXEA 3JQRA 4IKOA 2FUG6 2P2LA 3LIPA 1EB9A 5LQKA 3PJRA 3AEYA 4AKGA 3LMKA 5HK8A 4B48A 3DMDA 4A1FA 3LWBA 4XWAA 3RKUA 5CK5A 4OQFA 2G71A 1E63A 1WSBA 1F14A 1WPQA 3LFUA 4H9GA 4QBGB 1X8JA 4EW6A 2QENA 2YS7A 3HM9A 4ZTUB 1G8KA 1TQ2A 1VC2A 2ONJA 2PUBA 2GFHA 2RH5A 3NNSA 4C9BA 2QL6A 3WNVA 3ZW8A 3UNXA 2QTVA 3KU4A 1S3FA 4CM8B 2HK6A 2YVKA 4J4BA 4FEEA 5C7LO 2QORA 5LNK1 4P93A 2HU7A 2R00A 2IYUA 3FHOA 3SEFA 2NZJA 2Q4EA 4V0QA 4ZQEA 4QPCA 1JHRA 5EWJA 2F3UA 2CDCA 3G5TA 5EKXA 3ZVLA 3KYDA 1A77A 3P0IA 2WOOA 4BVBA 3FOEC 2PUFA 3K4QA 4PO8A 2JAPA 3EOBI 3EN0A 4CCYA 1V7PC 1TU4A 5J2UB 4TL9A 2JFGA 4Q4LA 3CB4A 2JGDA 3MJVA 2VJNA 5IRCD 1T0PA 4BKQA 2BFCA 4NEQA 4R1SA 3MBIA 4GICA 4LC1A 3KXPA 4BU0A 1LRLA 3SU8A 3G2NA 4MYCA 3CH5A 3P9KA 3W9SA 4ETMA 4TMXA 3ZK9A 2G04A 2C0PA 4X66B 2YS6A 1PFVA 2C5AA 3DMHA 2O5VA 1GUFA 4NESA 3Q8XB 3N9IA 3G79A 5TPZA 3ZWVA 3MD0A 4QPNA 4DG9A 2P77A 4TRNA 2O8EA 3E6AA 3OX2A 1XEWX 4HJRA 3HDVA 3WADA 2CXTA 3DHEA 3SICE 5HKKD 1G8HA 4DMKA 5ETJA 2JDID 2VDOB 3GJ3A 4OTZA 1D2EA 1U7TA 1ISFA 1Z4JA 2VFAA 2VJCA 2WAMA 1TIBA 3F47A 4JLAA 3TX6A 4TZKA 2FG5A 3ZWKA 3OFVA 4Q37A 5JSZA 4EHKA 4JA2A 4Q24A 2JI7A 5BSMA 4N76A 4TKLA 4DHEA 4BU1A 2BGUA 2JVJA 3RO7A 4RM3A 4B71A 3IIEA 2VKTA 3ZDBA 1BDJA 2PSSA 4F93B 1P75A 5AXCA 1QIHA 3CRVA 2WQ6A 4G5RA 5P21A 2GJ4A 3IO5A 2F4NA 4MDHA 3CURA 3PD7A 5K3BA 3QLVA 4X93A 2FSVC 1EUDA 2AOUB 5I7FA 2CXSA 2QNRA 3RWBA 1NOKA 4J90A 2WZQA 2HFJA 1JE0A 3BQ9A 2Y3IA 2IY8A 1REQA 3LDHA 2PN1A 5UKDA 1YAJA 4PNPA 3QFTA 5HCIA 3TWOA 4UPEA 3IOYA 5HDQA 1WDLA 1KWGA 5FFFA 1QLWA 1YC5A 2ZAYA 4PBRA 3AM3A 1WB6A 2FWNA 4DCOA 3WHPA 5FD8A 3LBFA 4IR7A 4B7CA 1T8RA 5TIIA 1L5QA 3IJPA 3U3RA 5A1TA 2Q21A 2IZ7A 1D4ZA 3CIFA 1QNFA 2OGZA 3UCXA 4B8ZA 4DWVA 2VP4A 2ZSDA 5ALRA 4GEKA 4RETA 5AQEA 2Y66A 4DR4B 3WB0A 3VA7A 1DJLA 1ESDA 2I6UA 2QG6A 3KO8A 3UW3A 5LOVA 5DBEX 3RSZA 4MO2A 3WYNA 4AO8A 4F12A 2WSSD 2D54A 5BMVF 3LECA 3KD3A 4ARVA 4JJFA 1IBLB 1THGA 1XAJA 3AHDA 1MB0A 3FSRA 4HDOB 4CG1A 1OX6A 4EZBA 1ODKA 3EUWA 1GU1A 3OJFA 4PM4A 5I7VA 4B3RB 1WXEA 3N05A 1VL1A 1ZCAA 1U3GA 4XUCA 4GL2A 5BV2P 2FW8A 5H81A 1SK9A 2H65A 2JANA 2JCYA 4ZA2A 5CA1A 3FCUB 1W6UA 2PSJA 4R0VA 2F8MA 3CZAA 3W6UA 3LYLA 2CV1A 5JYEA 5B37A 2V0NA 2D2FA 2YXDA 4XD7D 4PC3A 1WP9A 4IIJF 1QHSA 5KX5B 1JAIA 1VJ1A 2PPLA 4MR7B 1EX6A 5EVJA 3SKVA 2VXBA 4BEJA 2IYQA 3UXHA 2IOHA 3KZNA 4CQLB 1A9QA 3MB8A 1NW3A 1VL8A 1NBME 1RMTA 2EZTA 1JLSA 1UBTS 2GKSA 1M0SA 1SHUX 1ZCJA 4RJJA 1FX0A 2A0WA 4PX2A 3U4QB 1Y3BE 4TTQA 1I36A 1MU0A 1I3OA 2ZSBA 3I37X 4ITUA 4IXMA 2C1XA 5JPIA 1DKQA 1FSGA 1LRJA 1Q2UA 4DV7B 1TCCA 3A4NA 2ZUVA 1Q0SA 1XJWA 4LCBA 4XB6B 2ACEA 1Y6QA 3UN1A 4Q82A 2SKEA 4LY9A 4OJYA 3O91A 3NANA 2EBUA 2NO5A 3AO0B 4INZA 2AJTA 4Z2AA 3GCGA 1G66A 1GV0A 1UK8A 2WYOA 5EIAA 5K0CA 1NW5A 1URPA 4LBVA 1FYWA 5JMOA 1QR2A 4BLRA 4G25A 2VSXA 2QZZA 1O9BA 3R9KA 2PZ8A 2NGRA 4CM5A 4G4IA 1I14A 1Z33A 5KNBH 1UANA 3FWYA 4X85A 2GF0A 3A1WA 3CISA 1YIOA 5AVYA 1ZLXA 3H2GA 4C6SA 2P41A 3EZXA 5TT0A 3B38A 1X7ZB 1NI4B 2QN2A 4H7FA 2PVCA 3BIXA 3BTVA 5G2OA 4OHXA 4R3UC 2DKNA 2JEOA 2ZIUB 1Z4LA 2BH9A 2HMWA 2ZJ2A 3FWPA 3RJTA 4A26A 5KCZA 1XNHA 3GYBA 4H6PA 1HYQA 5A4AA 4TMFA 2LV8A 2BI7A 1HEUA 3GRCA 1JIKA 3H5TA 2PVPA 1RYBA 3NAZA 4FHFA 1ZJYA 3JAMA 1K3TA 4WECA 3AIIA 2VYQA 3BMXA 4TTAA 1W5EA 2CFTA 3L7YA 3L7NA 2IZ5A 3OCYA 4F4FA 1VKHA 3KVNA 4HDCA 2FSFA 4DIUA 3C7KA 4D3SA 4YWHA 1E94E 1U0RA 1RHKA 2IY7A 3LIIA 4KI0A 3U4GA 4JN6B 5A1JA 3MS2A 3UEOA 3F9RA 1TU0A 2FV8A 3VR6D 3W2GA 4WT7A 1VJGA 1ZIYA 3R0VA 1H1LB 4D9BA 4EHBA 2BGIA 3H5NA 5LC1A 4EI8A 2BWJA 1QRRA 1YCDA 2NZ8A 3QFRA 2R8XA 5JSUA 3L07A 1WCV1 1G4HA 1PR0A 4OHRA 4G23A 1FS4A 1T1JA 1OFUA 4G0OA 4D8UA 1O95C 3GT4A 2BEVA 3UZUA 4KWHA 2OSVA 2EP8A 4LDZA 4JAVC 2FMIA 3GDOA 3JV7A 4L2IA 4MJ7A 4MVJI 4N3BA 3WYDA 1CY0A 4RVNA 1XTZA 3RIYA 5JCJA 2GEUA 2Q0SA 2Q50A 1NUSA 3GLHA 2XF2A 2HRZA 4IGFA 2JB9A 4MB0A 1M6VA 4RV4A 3LUFA 3JASB 2H1IA 3FYCA 5AWFC 1UIRA 2IFTA 3FJOA 1E2PA 3WIEA 3IUPA 2X0NA 4NEGA 4LF4B 4RBNA 3EIHA 1E5LA 1N5LA 4YP1A 1YB2A 4UC0A 1OILA 2FMHA 2ZBDA 4W5JA 4XIIA 5DYIA 4AT1A 1QO0D 2VZLA 3D6TB 2J6HA 2P5SA 4HUQB 3LA8A 3LX4A 3TBKA 2M9MA 2GXUA 2QUJA 3DW3X 3LPAA 4AYTA 2J5KA 5H5JA 3U4DA 1FFGA 2GM5A 2YJ4A 1XTPA 2XRFA 1V8OA 4WI1A 1UBCA 4LZAA 4RU1A 4GD3Q 3WSVA 1JEQA 1G8PA 3ZGNA 1KQGA 1NN3A 4DANA 4ZMSA 5TR9A 4X1IA 3AU9A 5ALTA 1FFCA 4H0FA 3JZAA 1EUYA 4C4YA 2FPGA 1DINA 3CVOA 3D4NA 3KYDB 4G24A 5H70A 3DC7A 4YV0A 5C7YA 3KBOA 2O8EB 3F4BA 3TIIA 5DHPA 3EVNA 4QX6A 1RZVA 1HORA 5KNBA 3DB1A 4I55B 2X8BA 1VI5A 2COEA 1GN9A 2WU0A 3FI9A 3OI7A 3JYHA 4LYHA 1RP1A 1XF1A 4LZNA 4R84A 2NXCA 4BV3A 2WPDD 4XIJA 4EY4A 4Z4FA 1NDHA 5BWCA 1I33A 3X0DA 4XFKA 3FDZA 3UV7A 2I80A 3FPCA 2O3UA 1HY3A 4KQKA 4OSEA 5FWAA 3DGFC 3PWZA 1PYDA 4I5GA 2ZKLA 4PG6A 4B6QA 4ER6A 1CP3A 2NV2B 1PX2A 3RYIA 2A9QA 1HT1E 3V1KA 4EGFA 4EW3A 4J9UE 3TTVA 1TJ4A 2R5WA 2QPLA 1W30A 2WD9A 1G21B 4L6CA 2EKQA 4K6KA 4LWPA 5LQDA 1ENPA 1QC5B 1R3DA 2GFIA 3PKIA 1G4AE 3M4YA 2HRCA 4B6EA 3DVRX 4PAGA 4CI9A 3OQOA 5MF6A 5FULA 5T3YA 1KIFA 1AK1A 5EG5A 5HZGA 4Q5IA 4XCQA 4LRSB 1JU9A 3DHVA 3O3OB 4PSKA 1C7FA 1DJPA 5EXDA 2PX5A 4KG7A 1WHSB 2XKKA 1EXWA 2ZR0A 4FS3A 3BL8A 1A9XA 4TYMA 4JLVA 3L6CA 1OXBB 5LA6F 4DM4A 2YUTA 3BRWD 1E9EA 5CDFA 4DA4A 3PCRB 1DC7A 2FX3A 4P7BA 5ILQA 2HOQA 1DBQA 2BEUA 3MSCA 4JB8A 4RWEA 2DUWA 1XQYA 3BIJA 3QBJA 5DM60 3PE6A 5ALVA 5IKMA 3PEYA 3H97A 4HAOA 4POAA 2Q2WA 3LHDA 1C7IA 2V6JA 1B41A 3NPAA 3C4QA 4DJFC 4HH0A 4DQKA 4WKGA 1GUBA 4R81A 3GEGA 2XMRA 3DMNA 3HWX1 3Q6IA 4H4DA 1FSZA 1G19A 1FFSA 2JGJA 3F4KA 3TRIA 1HT3A 1Z8FA 3NBAA 4NPAA 4J0EA 3RS9A 4RH1A 4A82A 1BQ4A 3BHIA 1NVVQ 3VJMA 1NXTA 3ZEIA 2GLUA 1IPEA 4CM9D 5A3RA 4Y67A 3WIOA 1QXSA 1GPLA 1Y37A 3C5CA 4NJMB 3SIRA 4DNOA 4CM8A 5KU1A 2IH5A 2I99A 3T0FA 2ONCA 3BHJA 3SPXA 1P2GA 4FGZA 3W5JA 2DY1A 4DLLA 4BGDA 3UXYA 1OC2A 1XD2A 5DRTA 2PVSA 1PRYA 4HMOA 2JFYA 2GM3A 5TQ0B 3MQ2A 1A9TA 3RC1A 3RUIA 1F60A 2H3EA 1WLYA 5ESRA 1RLUA 3BTOA 3GLKA 1E0KA 3VHXB 3VX4A 4CE6A 1UMCA 2RD2A 1NF2A 2JKVA 2WJZB 2X77A 4NOMA 3K0HA 1G20E 1MC8A 3DBHA 4M89A 2QMYA 1O97D 4IJ6A 3GJ4A 3VOSA 2LZ0A 4RKQA 4MV5A 1ZA2A 1SU6A 4AF7A 4P2GA 5AW2A 3LCCA 3ZWBA 1VCNA 5ALIA 3MMSA 3EIFA 3HCEA 4CDNA 5CX1A 5L7WA 1A88A 4II3A 5JNLA 1X1TA 3AOEC 3M4XA 1FDSA 4B44A 2M98A 1Z7EA 2NTYC 3GH1A 4U7FA 1H6AA 1UQRA 1DQRA 1E98A 1A50B 4AZSA 1R4NA 2DULA 4FEYA 2ZSAA 2C4UA 4UEJA 4HWTA 1Q7BA 4GWLA 3F49S 3JX9A 1Z36A 4LE2A 4KH0A 1ZSNA 3ZH9B 4B5KA 4J1QA 1U0EA 1HRKA 2AN5A 3ZW7A 2KE5A 3MQ4A 4CCYB 4D3XA 1BX1A 1KDPA 1LUAA 3CMCO 1IWBB 4M8NE 2XNKA 1U11A 5DASA 3PQ3A 1ZK1A 5FWXB 4BVLA 5JAZA 4Q12A 4TGLA 2OP1A 3UFBA 3TLYA 4X90A 4U7DA 4YJKA 3TPZA 4A6DA 5TQVA 1ESZA 4MR9A 1C8KA 4MVJG 3DTVB 4MQMA 4C30A 1SHZA 1ZRMA 2VJOA 3ROXA 5ALSA 1SK8A 1XZFA 3KOXA 4EHIA 3OA2A 3T9FA 3HABA 3C6ZA 3DR3A 3DUFB 4Z54A 4V0NA 1MX9A 5DNEA 5IASA 2GGSA 5C5CA 2PBLA 3QVXA 1JDPA 3WQHA 3DKVA 5L3RA 5E3IA 1Y3AA 1T24A 1MT3A 2Y6UA 3D6VA 3Q4GA 4RDHA 3UMJA 5B57C 4MA0A 2IKSA 1GQ2A 1N5MA 4QYTA 2P11A 3TLGA 5FI1B 1E3JA 2DSNA 3C3PA 4P0TA 5BWMA 3KUUA 2FB9A 5KQRA 1OBCA 1ONOA 3N2ZB 1S2GA 4H1TA 3H0CA 2VTVA 5KNCD 2MIIA 1U1FA 4KR0A 2W0SA 4TTSA 4Z53A 1XL0A 4KQMA 1V39A 3JZMA 1MOPA 1QYIA 4IWNA 1DXHA 2E87A 3KLBA 5FLXA 5AW3A 2I55A 1XAHA 1W9MA 4JT2A 2HHJA 4PTZA 3ZBQA 5GINE 4M0LA 5CLIA 4JC4A 1K68A 1Z4QA 2JARA 3EYWA 3BWMA 4QYIA 3L43A 5DGCA 4I3GA 4G0VA 4Z9FA 1H2EA 2N9UA 4X71A 4YRQA 3SKXA 3USES 2D06A 2QJTA 3VDRA 1V9LA 1TAGA 1ZM4A 3A6GA 2BCGY 4YUYA 1VYTA 3CC8A 3TCNA 2I1QA 3NOQA 1WD5A 3GLGE 4IH9A 1JDUA 1GGHA 4O1MA 3UT6A 3JAWA 2B4KA 4HD8A 3H83A 3WKCA 1ECBA 5K8CA 3M6LA 4LCEA 3VSDA 4LY0A 1H2WA 2NQ8A 3LX5A 1M2EA 4PLWA 1U8YA 4XYBA 1W48A 2HU2A 2QTWB 3AL0C 5JTUA 3OM0A 2QT1A 3MILA 1GPH1 1D2GA 2FEPA 1C9KA 4HXYA 4LCJA 3HFRA 5IP5A 5E4JA 2C7GA 1A5TA 1S3GA 1NQWA 1DOZA 4OXNA 2GILA 2NG1A 3JQQA 5KREA 5D5QA 3LCRA 4CZ2A 1ONPA 2J5QA 4IXNA 1H4TA 1MABB 2FQXA 2PDAA 3T5AA 5KNDH 5KZMB 2P90A 2CC2A 2GFQA 4MARA 2OG2A 1ZH4A 4LVUA 3QMWA 1NVDA 4EL0A 1AS3A 1DIRA 3I8XA 4OGKA 4EF4A 2J3IA 3OBBA 1NFFA 2A1TS 1KBZA 1T9BA 2W2OA 3LNCA 3ND9A 4NYIQ 2PANA 1CDEA 3IHWA 1C9YA 2FWAA 3HBJA 3X2FA 1Z7WA 2I33A 2I3DA 2W2KB 3G23A 3KZVA 4G5QA 5HE8A 3RS0A 3CT6A 5DNDA 1PUIA 2N0SA 2R7NA 1PR4A 3LX8A 3RFXA 3UWDA 2Q7OE 1C9MA 1TA4A 3RNLA 2RE8A 1OX4B 3C3XA 3IULA 4JWTA 1BVHA 2UXDB 2BY4A 5K8TA 2NSDA 3LZCA 5M3BA 3TZEA 4ZDIA 3HXQA 3MJRA 3ZD7A 3SDBA 1VSUA 1OAOC 3TNYA 2OV4A 3GJSA 2FUCA 1MR3F 2UVPA 5AK0A 2IYSA 3RFFA 2XVMA 2AGVA 4MKFA 4GKJB 2A5YB 1Z47A 3OPVA 4UDNA 5FNZA 9LDTA 2KMLA 5JDIA 5JMPA 3QOYA 2AN4A 4LTNA 3TTSA 2HQ1A 2IHYA 1JKIA 1HDZA 1MO5A 3IEPA 2B4RO 3G88A 4MVXA 4BLQA 4DG5A 1PGJA 3S68A 3QEJA 1GT6A 1JDBC 5FTJA 3BHMA 5IKPA 1L5RA 3E3OA 2ORWA 1FC0A 3CX3A 1E1NA 3HN6A 4H35A 2J3JA 4EKIA 5KQLA 5KYTA 5HVNA 2D1QA 4BFCA 1MGOA 1LF5A 1VCHA 3UQYS 2EKBA 4BVKA 1UADA 2QUHA 1JFVA 4RPLA 1NUTA 1Y7PA 2BEVB 4MCAA 2UXCB 3H1FA 4C3VA 1GDDA 4Q4JB 4IV0A 4UAGA 5LP6C 3L6EA 3PFCA 3OTHA 4RTQA 4CDGA 3R7WB 3HXTA 3ZZUA 2LD4A 1E7SA 4GKVA 3D7MA 4QOSA 2AD1A 1FFXB 4EI9A 2VYVD 4E5KA 5LXTA 4ZYXA 4UVDA 1R88A 3FPHA 1BKSB 1R0YA 5KAMA 2I22A 4KVGA 2HREA 3O1IC 4NDAA 221PA 3AKDA 2VEOA 1FPQA 1N2CE 1BS1A 4PF1A 3I45A 4IUYA 2Q9BA 4L57A 5DULA 5KYXB 4CEHA 3BCRA 1TCVA 1DEXA 2BBSA 3WAGA 1M8PA 1N6LA 4RHYA 5BURA 4YQYA 1JYFA 1AQLA 1N2EA 3FTQA 1K5PA 5B4UA 3MJTA 4GZLA 2Z04A 3H87A 4LRUA 4QL3A 4MIOA 4HXGA 4KE7A 4PX9A 5ECYA 3RABA 4DS3A 1QG6A 2A14A 1I1HA 1P0QA 1Z13A 1E6MA 4RLFA 3PX7A 4M99A 1VI2A 3CR7A 3FFWA 3CLTC 1U7HA 4BC0A 4LJAA 2HHLA 4MPDA 3RT9A 1A76A 4GPTA 4UBNA 2AD5A 4LMPA 4R98A 5HIMA 1B2LA 3DE4X 1NM5A 2YQ5A 4YJDA 4PCLA 1AG9A 2DBVO 4TSKA 3WLPA 4O5AA 5IXSA 1SO8A 1VMIA 4FHCA 5HDBB 3KFVA 5BQ3A 4N39A 1W5BA 3FE2A 3UUFA 2OHXA 1RXSA 4EYEA 3KEQA 3UGJA 1QK3A 1VE3A 2XWPA 4MR9B 1OAAA 3I6MA 4DBZA 2IYRA 2V1XA 2V3CC 4HB0A 1T4CB 4CKCB 2AE2A 3AUSA 3QVGB 1QAMA 2OBXA 2H48A 3I58A 1ORDA 5DHSA 3TF5A 3H9GA 3IDFA 1R6DA 3KLOA 3H16A 3K0CC 1PD0A 2ZE5A 2PH1A 2P6MA 3FKSD 3I9MA 2GETA 2X5KO 3DL4A 4KGZA 4MLDA 4K46A 4ER7A 5F7XA 3AERB 2YOFA 4AUKA 1E1RD 1L4MA 2AK3A 1X1RA 2VTEA 3AWDA 3PPIA 4QPZA 3PHJA 5F2NA 1IVYA 3RRBA 3K32A 4IAOA 4U2GA 5E4TA 2I91A 3VNVA 1KK3A 2VUIB 4HB2A 3EVEA 5ENVA 4KR9A 2ZJAA 5CVTA 2ECOA 3HKEB 4Z4EA 1PUJA 1EX7A 3C15C 3I28A 3ROQA 1E8NA 1JEDA 1RAGA 1RPAA 2AUNA 3WOVA 5E6UA 2Z5FA 3FMIA 4TUYA 1THMA 1FXWF 1CUBA 3PPXA 4ZQHA 3BYZA 1D8AA 1T29A 2C4VA 4A6XA 4DCMA 1GPMA 1X1BA 3SJAA 4AB1A 1SCKA 4C7MA 2Q7XA 2ZGVA 4UNQA 3GHYA 2YQ4A 4E5UA 5ENZA 2BR3A 2H7VA 2HMVA 3M6UA 2DWCA 5K0SA 3V2UA 1Z0AA 1KDRA 3TLEA 4L4RA 3CO5A 5LR6A 2YZ7A 2UYGA 4FHDA 4YRZA 2DWOA 3EZ7A 3RYHA 2NO0A 1I3LA 4CLOA 2EJCA 2BGJA 2GK4A 3QI2A 5DBGA 2CLFB 5FBWB 4WKPA 4DQLA 3GUVA 2C3OA 1W73A 2B8TA 4UBJA 3C16C 5TGZA 3PRHA 1Q2XA 4LYFA 5CLGA 2VK8A 3HSYA 2HW8A 1BOOA 2CDAA 3M81A 1LLFA 4Y6LA 4N47A 1J33A 1JBQA 4Z51A 4FFRA 1UKVY 3OCJA 2GBCA 1ZAYA 2YYZA 1RHMA 2NYAA 4DRXB 721PA 1ADGA 1Z7YA 4Q9JA 2RGCA 2I8CA 1VJ0A 3INTA 4JODA 4QDKA 5IKXA 1X92A 2O20A 3CGGA 2QJOA 2AF3C 5B7NA 5D84A 2K6GA 5EVCA 2H9AA 2Z0MA 2XHEA 1I4WA 3M5DA 1AY0A 1SIOA 3P26A 3EYAA 4S12A 4A2PA 4F9EA 2X9LA 3E9EA 1E4OA 2ONKA 2RGBA 4ZCSA 1KGSA 3GPCA 4MP6A 5KOHA 2ZSJA 1H4SA 1SXIA 1X86B 3B36A 1ZJJA 3FUTA 3EXFA 1GFIA 3TRFA 1X7HA 4IX1A 3LWZA 5JZVA 2XTMA 2Y0PA 4QLAA 5HA5A 2JRCA 1FZTA 4MWEA 1F48A 5L3QA 4KXFB 4ND1A 5HYVA 5IWCA 3Q3GE 1YUBA 3DLTA 1UJCA 1ZMBA 3B70A 3GCXA 4RMGA 1PJRA 2WAXA 2WF6A 4N5LA 2O8BB 5JANA 5CFOA 1G1AA 1CY8A 2P2SA 1DIAA 1IZ7A 3K0SA 2A2ZA 2VH1A 2VHQA 3A2MA 3D3WA 4Q9DA 3UUEA 2QMZA 4I4CA 1MRZA 4TMWA 3TUZC 3BXHA 3VHQA 4V2IA 3STXA 4I7EA 1ZGHA 3EZGA 4HWSA 4C1NA 4BE9A 1IUNA 4TVOA 3ESQA 3LU1A 3OLQA 5AI4A 1W36D 4NCBA 4R9NA 3SIPA 5JBIA 1X42A 1FNCA 5IDXA 1N2SA 4GVPA 1EBFA 4DKXA 4LXYA 5AJWA 5LVAA 4IIXA 5BVGB 1CQWA 1P1BA 4UE2A 1G38A 4A03A 1TW2A 3KXKA 1OGIA 3AYZB 4TRRA 5T3UA 1F7UA 2IYWA 3P97A 1ZO8A 1XWFA 1J8MF 1U28C 2WSIA 2ZB3A 1XCLA 3BMCB 4L22A 4XJVA 1KVTA 4BMZA 5CLJA 1QVWA 3E2PA 1T1RA 5IJ0A 1NZFA 2BFEA 4JP2A 4D44A 2QB5A 2XNCA 2KLBA 3EF1A 1E2MA 4GH5A 1M66A 2P8JA 4RPGA 2DQSA 1LNQA 1ZKDA 5L6LB 2PR2A 3EIXA 1UBUS 1GCOA 2P40A 3FKSA 1LPNA 4R2KA 4YJFB 4JU8A 5F9FA 1J5EB 3DO5A 5DGIA 1U0OC 4LQCA 1WUHS 2PRSA 1NC3A 5E6RA 3W77A 1VL2A 4PGFA 1U04A 5JR3A 5DX0A 1YTLA 4CU2A 3GNLA 3T38A 3OFSA 2NU8A 1XMVA 2R3SA 4JSYA 3IBFA 4U00A 2IX3A 2HLPA 1RWPA 1Z56C 4W4TA 1TEXA 1ODSA 5F2EA 4WLUA 1GLGA 4CM7A 2COUA 3OAAD 1GADO 2NAFA 3E35A 5JNUA 1PW5A 2P9EA 3Q5GA 2VPTA 3K5WA 2BUAA 4WOCA 3DVAB 3OA0A 4BFUA 3IOBA 4JBYA 1Y1KE 3AOEA 2DJ5A 2UZ3A 4WDQA 5JCJD 3WSWA 3AY0A 3TD9A 1ADYA 4S05A 3MQFA 1UEXC 2QKYA 1D4AA 1BHSA 3FDFA 4ZTZB 3QELB 4AQ7A 1WO8A 1HTBA 1I4DD 2J48A 2RGGA 2XGGA 3B1WA 5EPOA 2C9YA 1GSHA 3O1LA 3L49A 3KQHA 1V37A 2NSLA 1P80A 4TQAA 1WZIA 1FJXA 4KQ6A 1DXQA 4JB3A 4TV9F 4NS4A 1T8TA 2I6GA 2JAWA 5EY5B 4WFJA 1N0VC 4BASA 4Q4AA 3EF3A 1L7MA 3Q5DA 3KPWA 4I46A 4KLAA 1OFIA 1SHKA 1QQ6A 1PT6A 1LX6A 1YNSA 4Y1FA 3LC0A 4PO1A 3TD2A 2OXTA 2A4MA 4UM9D 1NAIA 1ZBDA 4UU7A 3RI3A 4CF6A 3CUYA 4Q9IA 3U7HB 1P77A 1ZOOA 3OZEA 3HUDA 3QU5A 1LDMA 3O8QB 3N3BC 1GQQA 4LNUB 3CLRD 1T5BA 4RZHA 1V4VA 2G17A 1JG4A 1O94A 2P1DA 3D4OA 1WXHA 4M0MA 3LLSA 1M6WA 4MS4B 3KUXA 3PT9A 1ZOSA 1JG3A 1JEJA 4GZ5A 3TLZA 2R96A 4IGEA 5IANA 3QE0A 4DCUA 4XZ3A 1BHO1 2WFAA 1FP4A 1HG1A 1TUGA 3EQ7A 2GUGA 3M1YA 4WFQA 2P35A 2PUTA 2X9GA 5FBLB 1GGEA 4W6ZA 3RVBA 2ZE6A 5E0OA 2VS1A 4O2AF 3JWHA 3SEZA 5KUTA 1Z75A 2EJBA 3NT5A 1W34A 3W5VA 3AC0A 3EGIA 3DEAA 1J0DA 1CFZA 1N7HA 4FYXA 2PEZA 3B1XA 3RC7A 3VXKA 3AJAA 3VZCA 1Y8RA 2GBGA 4F4UA 2PX0A 2Q5LA 3BRSA 4PZZA 2V4MA 2Y1EA 4BMVA 2EF1A 2GCNA 4QRDA 5BYKA 1Y9ZA 3FYSA 3DL0A 1DWOA 5CH8A 4EUSA 1QFXA 3HBLA 3ZZ0A 1CUFA 3TNDA 2GO1A 3PZBA 1YS6A 4GF5A 4B2YA 1P0FA 3G1UA 2BTQA 3TGLA 2LTAA 1ZW6A 1OCEA 3IR7A 4AKSA 1E62A 2XECA 2WTEA 4GKBA 3MUEA 4JVNA 3HA3A 4LMAA 4OPMA 3W8DA 4HS4A 2FUNB 2V98A 1MABA 1KL7A 3FTFA 1QVAA 2ATVA 2XQKA 3HCPA 1CZOA 3BWCA 3HBAA 1EBUA 2FFRA 3LQFA 1Q57A 5TMDA 5JSKA 3SDSA 4AKEA 1FMFA 3S2UA 1D2AA 2EFJA 4AZTA 3I9OA 4DIEA 1PT5A 2A9KA 4PCAA 4R1MA 3UJ9A 3FRHA 3OJXA 2YVUA 5B3AA 4C5CA 4DPKA 4QLBA 1EXNA 1N1DA 1QIIA 4LX0A 2PR7A 2UUAB 3EX7C 2C3PA 1IY0A 1FUEA 3VV2A 3LF2A 1RDFA 2HCFA 2ZTUA 5KOYA 5JSYA 2C59A 2Q4TA 3U60B 4UHDA 5ES3A 4DRXA 2HL6A 2OM2A 3V9AA 5B7GA 4YRLA 5IABA 1BYIA 1SD5A 1U90A 4Q47A 1FQOA 2JGIA 2F00A 4XYEA 3L0DA 1EFRA 5JNTA 1NOJA 1U7DA 3FUCA 3AEUA 3KJZA 3T9DA 1DOAA 4HTAA 4C6TA 2J30A 3OLXA 1K7XB 4LGCA 2PT6A 1PKEA 5IJZA 4KU4A 1AD2A 3OY7A 1YZ3A 1KKMA 3RUDA 3EGCA 4DNPA 5C1DA 1JG1A 1FQKA 1GVNB 3JY6A 3KZMA 1YI8A 1KZGB 4S2UA 2CNWA 3ICVA 3R74A 4DUYB 2H07A 4KQCA 3N70A 4OJNA 4RV5A 2WB2A 4GI7A 1GDTA 4Q3LA 4Y2UA 1RHJA 3L0PA 3WLNA 1H65A 2OECA 1UKBA 3RRZA 2XD4A 3VI3B 5C1BA 1AZTA 3MLEA 4MHOA 5BN5B 1LDNA 2CGEA 3A6ZA 3GRVA 3O4VA 5GM1A 3KRTA 1HBJA 3ZE9A 4R9UC 2G1KA 3HNPA 4FDMA 1JZSA 1LRKA 2GBLC 1F8XA 4O1IA 4YP6A 3OJCA 1GPWB 2BTOA 1CE8A 1OW3B 2GPAA 3N1UA 4NPHA 3BOSA 2A3RA 4LXQA 3VTAA 4IIGA 5KVCA 1GPUA 5DOZA 1Z0SA 5G4KA 1HQDA 2I71A 2PMEA 3UB4A 4CMEA 3T1TA 2WINI 4OFBA 2E82A 4ER0A 1WU8A 3HCCA 2GD0A 4TMKA 1N2XA 3QVOA 1VB3A 2AMFA 1VIDA 3NP7A 5KNDA 3CR8A 1VXRA 2CFSA 1DKLA 1RS0A 1JR3E 3A2LA 4NONA 3MT8A 3ANXA 1T9GS 3RFVA 1Q22A 3KBBA 4J2OA 5JHHB 2OQIA 3ZJYA 4CMBA 1J2RA 3KG2A 2D2VA 4UAVA 3H2IA 4E70A 5A6SA 3UQZA 4EA9A 5C8VA 2R5NA 4RC9A 3U6BA 1P17A 4GPBA 2AXNA 2BDEA 1ZGAA 2OCYC 1MZVA 3DDOA 3DEJA 3NBZC 3ZHOA 1AXRA 4E31A 1C8BA 1KXZA 1LFDB 5ALGA 5AI0A 5J1SB 3QEMB 4UZEA 3NT4A 3PDWA 1J2YA 4A10A 2X3YA 5BR7A 4MO9A 3OPYI 2PX3A 4Z4GA 2CXUA 1V4NA 1GLVA 2I2FA 3EGEA 2X7JA 4N8SA 5KTYA 1S8OA 4RTRA 4OI0A 4YA6A 5HUJA 3KKMA 1D6MA 1L7AA 4OB6A 2AA3A 4JI6B 2QW1A 3UMRA 3VKWA 4EUNA 1USUA 4RSGA 4JGBA 4KFTA 1HMPA 3H18A 3W04A 1K8XB 1VOTA 1P4JA 4BZWA 4KPGA 3PP8A 1AXEA 2YWFA 4MQBA 1J5PA 1EFHA 3U4MA 3EGDA 1PZGA 3QZUA 4U7PB 2IE8A 2C54A 1RW4A 1ZBQA 2HMSA 2I6TA 3LO8A 3QA3E 4KO2S 1JIUA 1VL0A 3H1GA 2HA3A 3AGPA 2P3SA 4OMFG 1EFVA 4BO9A 1V6AA 4S1TA 3NUQA 4QJ3A 5AK5A 5CXSA 2MJLA 5AKGA 3UYLA 1APBA 3A4IA 2EQ5A 3P27A 1CY1A 4RNCA 4E08A 4HDMA 2GS9A 5EL0A 1V7ZA 3NIBA 3R23A 3WE7A 2BFDA 2QP9X 1ZW1A 5A9TA 2RFLA 4NBTA 4IQ4A 5IT9A 1F12A 4ETWA 3KWFA 5T7BA 4A8JA 3VPFA 3L05A 2FH5B 2FN7A 4FR5A 1NBOA 4NBRA 5I01A 1JR4A 3GLUA 4KAAA 1D3AA 4M60A 2ZT8A 3OTGA 2A5JA 4WOBA 2HMTA 3NJ4A 1RMYA 2OO5A 3VR3A 1HR0B 1NJ1A 1NQOA 1UT6A 4IVQA 2VHEA 3VPCA 2JATA 2R6R1 1W2HA 1N2HA 2H08A 4FGLA 2ZUUA 4D8WA 1DP4A 2A86A 5EKDA 3GB9A 3IR5A 4OU5A 3RU3A 5ED4A 2R1TA 3OU2A 4LYDA 1FP6A 1OWOA 1BCRA 1W46A 4X54A 4N7JA 3SDZA 3DO6A 2BAGA 4FLMA 3IHKA 4FB4A 5JRZA 1V8ZA 3V48A 1BWSA 3B48A 3PRKE 4US2R 4R68A 1E96A 2QMEA 4R6XA 1MDBA 3F98A 1JB1A 4DIBA 2SICE 3L0YA 4OGLA 5LD2B 3GFRA 1T4GA 3FLAA 3RIEA 3MELA 1DAHA 1JHOA 1XQVA 2YY6A 3V4OA 5B12A 2D2IA 4WL0A 3DZKA 1GCGA 4E6PA 1Z7GA 4B33A 4IGIA 5AKYA 3QSYA 4OHKA 2Y99A 1OBHA 4Q4DA 4TVKA 4OHOA 1C7JA 4NPCA 3E7PA 5CFMA 2OCPA 9ABPA 4XE5A 2X58A 4GZ6A 4OHCA 3ZTTA 1N6IA 5AVQA 4RDIA 3LTEA 2GBIA 4QSHA 2WVHA 4YCMA 2C95A 2VBCA 1T0JB 1UC5B 2XB9A 1K6EA 2Q9CA 3IP8A 1A2BA 3OIFA 5CA1F 1SXJD 3QF4A 2G08A 2P5YA 3V1TC 2OV6A 1Q3TA 2GASA 3O1JC 5JATA 1YDGA 3BTSA 1N2JA 1Y42X 2BJWA 2FY8A 3NEAA 2V9PA 1W47A 5ALZA 4Z49A 2NU7A 2W6QA 3OHPA 2IIBA 2V6MA 4WADA 3GRKA 5ALFA 2OHGA 4UHJA 2TSYB 5F5NA 3TQIA 5LU9A 3N7AA 5BXQC 4B81A 1KY5A 4PZAA 2RGYA 1Q84A 1BA2A 1IIBA 2SCUB 2HJRA 2XMDA 3C3DA 4KNVA 4BTLA 4EB6B 1PSDA 4Y30A 4DNFA 1NLFA 3FFXA 4GGOA 4KO1S 1GYQA 1YJQA 3S40A 5ITZB 5KX5A 1WUIS 3BX1A 4ER5A 4IIVA 1P0IA 2P9QA 3S7ZA 3ONWA 2IYEA 4OFWA 4B6JA 3B78A 4O6VA 3VPXA 4KMOA 4YT5A 2YQZA 4E07A 1AN9A 4KVFA 2OMKA 4WA7A 4RJLA 1DRJA 3CXUA 4NMLA 1QPZA 7GPBA 1HNXB 1VQ1A 3LC1O 1U0NA 4DIDA 1OHHD 1AGRA 2EFDB 4KZPA 1VTKA 4UDOA 5DU2A 1DELA 3OIVA 4O5OA 4C6TB 1W36C 4CKZA 2O2XA 4YJHA 4QDZA 1RAFA 1RCFA 4LFAB 4JWKA 3KTAB 1HKUA 2DWUA 1K98A 3P4YA 3QOXA 2V6GA 2BSQA 4M0UA 3I2YX 4D4GA 4R8MA 4FE3A 4IJMA 4ZGBA 1MRNA 1P4RA 1GNSA 3UWPA 3VU0A 4BNXA 4YJ3A 1SCUA 5CVVA 3SZ3A 1T5LA 2DPGA 3AIMA 3SQXA 1PG2A 4OYYA 1I2AA 1TKCA 4WNCA 2EX4A 3WWCA 2GCGA 4S3MA 4YAUA 5JY6A 4L4ZA 1K4MA 4MUIA 1TB4A 2WWIA 1QRSA 1EP1B 3P45A 1ZH6A 4DLWA 3DZCA 4RMHA 1NVVR 4B4UA 3FPAA 3LUKA 3PBKA 3JAKB 1RQXA 3L7DA 4R1QA 3AIKA 4DA6A 1HDCA 1I4OA 2J3HA 1C2TA 1Q1AA 5EJ8A 2O52A 1CTQA 4YALA 1Z4KA 4PZUA 4OOEA 1P3Y1 2XKBA 3G2IA 4M9XA 4MQFA 4RF3A 1I32A 4HMQA 4P5EA 1GZ7A 2OQVA 4N0PA 3FZEA 1U7OA 1GZ4A 2CF5A 1EFCA 2AG8A 5KTRA 1S01A 2C57A 1ZLYA 3QUAA 2X19A 4QIHA 4S1NA 4AXXA 4ZPXA 2JI4A 5KSZA 4ZTBA 4YCDA 4R01A 1C14A 4UOZA 4GX2A 3HPQA 4WBNA 2C0QA 1L5YA 1KBOA 2HJGA 3M3HA 4U2CA 5AKJA 3WL7A 3CE9A 3IELA 1K3FA 4WZZA 3W34A 3S2ZA 3M34A 1PK9A 4E1BA 2UYCA 2C2OA 1R0SA 1T91A 3F8WA 4YP0A 5TVKA 4U6NA 2AWNA 1EB8A 2IODA 3QVSA 1UBKS 1Z6TA 3LUAA 1R8SA 5DI9A 3LDGA 1Z88A 1A27A 2FFAA 4X8MA 5JIBA 3B5JA 5ICGA 2IU3A 1Q1ZA 4EKEA 1UBEA 3K7EA 2J33A 5ABPA 1SWWA 5FBQB 1W94A 3TL2A 3UANA 3KQKA 2H7XA 2JFBA 3V7UA 1UZLA 3SWWA 1GL7A 4WLNA 1K9SA 4S0ZA 3CJRA 2OT3B 4QPDA 2IK8A 1KOGA 1VCMA 2H4FA 2Q28A 3P0FA 2RIPA 2YXEA 2BIFA 3WVNA 2AMJA 3KUDA 3N2IA 1NN0A 2BFOA 3FDZB 4HGRA 5CMLA 5JADA 4HDMB 4OV6B 3X1JA 2AV6A 2X0IA 3IV6A 5JDCC 2JH3A 4EY6A 4QYWA 3ROMA 4FOTA 4TV8A 5JVDA 2MSKA 1N0HA 4RIGA 4FSXA 1I24A 4P4LA 3CW8X 1P9NA 4D2IA 3C1AA 1RPZA 3Q7EA 4OQLA 3CRMA 3T0IA 1BMFA 2VNKA 2VSFA 1S7GA 2IWRA 5DLPA 2QRPA 3C6XA 4BNDA 4OL0A 4C0XA 1LQ2A 2IHBA 3LY8A 4L51A 1LPOA 2OBYA 1KZ1A 4PC7A 2G9NA 4CV3A 1RQ7A 1FU7A 1USWA 4FYJA 5C32A 2I4TA 3RADC 2P6NA 4Y9TA 3B82A 3JYOA 2AC7A 3LC2O 1R8QA 1YZLA 3M70A 2G83A 2PZKA 1ZH0A 3ZE6A 2P8SA 2MOKA 5I7EA 4CM4A 4NSNA 4E21A 1QQ5A 1C29B 3QFCA 1I0LA 1Q83A 3BVPA 3RE1A 1DEKA 1J2EA 3JQAD 4HAUA 4CHGA 1U7XA 4N6OA 1E1MA 1T9GR 1ZQ9A 4O2LA 4N0EA 4BWVA 2NMVA 4DIKA 2JNWA 1WWKA 1ST2A 3M5WA 3NHMA 4L27A 5D00A 4HNUA 3OU7A 3K1TA 4WXMA 3F2IA 4IKEA 1VBFA 4P1ZA 1QS0B 4QELA 2CVHA 5EJAA 4B31A 1V5GA 1EDBA 1PHPA 3Q87B 4MXDA 4ASUA 1NSTA 2D74A 4JB0A 4CMGA 1KC1A 3AVPA 3F5DA 5FXMA 5KQSA 5G02A 1P31A 1EX9A 2PHZA 3SMVA 5KNLA 3WJ7A 1CX9B 1MBZA 2FVXA 1CUVA 4PN7A 3Q1KA 3HDJA 5AKLA 2IXFA 1C4XA 2XYVA 1Z08A 2CY0A 1TTTA 5DBFA 1UBRS 2EEZA 2PXHA 2NV6A 2WKSA 4RW0A 4TTJA 2R79A 2VNIA 3QU2A 3C5EA 5A2QA 3DBLA 4QXAA 1RVV1 3ND7A 2JD2A 2XWQA 5HBRA 4UEOA 3ILHA 1HKHA 1IHDA 1RXIA 1B6GA 1SOAA 1FDVA 1U2SA 3CJTA 1X8LA 3DFKA 5AI8A 4F7WA 2E4XA 4GPAA 1EHCA 5I9LA 1XSEA 3MTQA 1W36B 2UZ1B 3KB2A 2NU7B 1OC4A 2B78A 4GMFA 2VHYA 4JLDA 4JP3A 3EISA 1SCBA 2B30A 2HSZA 1JQ3A 1QHXA 4ESHA 4NFYA 1XJ5A 3HCRA 3A9VA 4G1MB 1PK7A 2BP7B 2GJ8A 5GPBA 4IZIA 5HIIA 1L1QA 2G36A 2FQWA 3QE3A 2HA7A 3CZPA 2PUWA 1H85A 2J45A 1EGAA 1JF8A 5AJVB 5CX1B 3T5CA 3INYA 4CIDA 1IG3A 1XMIA 1FXSA 2W2KA 5G4KB 4DQ0A 2TMYA 3IP5A 4YWJA 2A59A 1V45E 5CVUA 1Q7GA 1H4QA 2JIBA 4BNWA 4FYIA 1H2AS 3X43A 1N2CA 1Y63A 1GWNA 3HUEA 1JUDA 4M7PA 4J1TC 1XXHE 1ZM3A 1BN6A 3IAAA 4PYMA 5G4LA 2P3QA 4ILKA 3GH3A 5B3LA 4MLCA 3OIWA 2ES4A 2XOXA 2ZS7A 5DSTA 3ZBTA 1Y5IA 4IV8A 4S1WA 2D62A 3JU3A 1O8BA 2VLBA 4Y6OA 3W0LB 4D0SA 2D1SA 4OEHA 3D0OA 2JFVA 3MEQA 3QEMA 4QM6A 2WSLA 3MINA 1Z06A 2C97A 2I9PA 3HC7A 1MD9A 3S70A 3H19A 4JDUA 2EFGA 3AW9A 4ZVRA 5IBPA 3A1UA 1CUHA 3HJCA 3KQQA 1NMEA 5HF8A 4ZHQF 4ZZIA 1P7PA 1A95A 2YXNA 4DLYA 2V7VA 2I1VB 4IDHA 2E55A 3IH5A 4L0QA 2I66A 3FNBA 1E6WA 3R5SA 3T3PB 2GB4A 4KITB 2DUJA 1ZU5A 2DUNA 4E2WA 3GFFA 1M2VA 1PGOA 2HIGA 3AEZA 4ETIA 1IHPA 2R8RA 3L41A 3OFKA 5IK2D 1GKLA 3QPVA 3FF4A 5IBQA 3JAKA 5EQFA 1PL0A 4KQ1A 5LB2A 4ENSA 3KFLA 3PV0A 2XSZD 2WSMA 1RXEA 1MPTA 1UOQA 2GR9A 4OX9B 4R83A 3UJAA 5LMCA 2GJSA 1L1RA 3D8SA 1G291 5IJ9B 4QRIA 4K5QA 4O2BB 3IAS6 1SU4A 2HJVA 2HC9A 3ETHA 5F12A 3IURA 1JALA 5B4VA 1I3MA 1QNLA 1ZITA 2F90A 3F3SA 3OZRA 3Q2KA 4LI0A 4MQ6A 3T99A 3UAYA 1JBKA 3RBAA 3DWIA 4K86A 1D8TA 1KC3A 2CHQA 4Y2GA 2GYUA 3OX3A 4X8LA 2A9JA 4Z7OB 3ONVA 5EKUA 4PLCA 1M73E 2QI9C 4FCTA 3ZD6A 4Y1EA 2W11A 2ZYTX 4D8YA 1ZXXA 1RRKA 1JEEA 1QM5A 3D2BA 4MAAA 3F67A 1OXVA 4QPPA 2V6FA 5EKTA 1WB4A 2Q6OA 3H5OA 4QDTA 3WLHA 3QXCA 1QJ4A 5CW1A 4UNNA 5FH9A 1AKQA 3O84A 4AIIA 3Q7RA 2VJPA 4F6RA 4CIYA 1MO6A 3PQCA 3UWOA 2BFPA 1ZA1A 4URFA 1G60A 3VHRA 4HV4A 5AFSA 5KWVA 1YB6A 2OHVA 1D03A 2PIAA 1ADJA 2GSDA 1ZQ1A 2J4DA 3DKIA 1XLWA 2BKUA 1BCRB 2QNBA 1J0BA 2PAFA 2FCAA 5LZ4A 5JUWA 5GIPE 3K70C 2EGUA 1QQ7A 1R0XA 2GAJA 2Q1WA 1D1SA 3S2EA 3F5MA 1Q6ZA 4Q9NA 3HFGA 4L9RA 5EXXA 4YMGA 3GLSA 3CF4G 2HN9A 3ENVA 1JPNA 1PS0A 1XB2A 2VDLB 2RSLA 4DMLA 1E2LA 5BPFA 3ESCA 2R47A 4DJJA 3K9FC 2BGMA 2WJWA 2WQ7A 2VTBA 3FDIA 3F2VA 2YN4A 2ISCA 5K6AC 2B4YA 2UVDA 1YK0A 5AM4A 1CQPA 1OIVA 1VSBA 1S5PA 4IWXA 3RFCA 2D5IA 1I0ZA 4WAUA 3KQLA 2PKEA 4EUFA 4J8PA 1KY2A 2EKDA 4HX2A 1QF6A 4QZVA 3MT9A 3GIWA 5H59A 4ZIRA 1Z0KA 4H18A 1N4DA 3T8YA 1SVOA 3VPSA 2YY7A 2C3MA 2XMSA 3C24A 5EHIA 5IN5A 3H84A 1EK1A 2IEBA 3N0WA 3AEXA 3PR2B 3OT4A 3H1AA 3E18A 4QUHA 1JA1A 1A8PA 2M6SA 1NVGA 2HIHA 3NHYA 3UCEA 1TI7A 1ZD9A 4YRRA 2C94A 2IHKA 2Z43A 1GA6A 3EGXB 4GI2A 1T1GA 3IVMA 4HAZA 3UBMA 1N5RA 4XDHA 1PTJC 5E38A 2W6JA 2NVWA 3QV2A 5CAEB 3PNVA 3U1BA 1X1DA 2P27A 1XVUA 2Z9CA 3IKLA 3QYAA 4EELA 4QNMA 1ENOA 1FRQA 1WNFA 2FG6C 2XZTA 3PNLA 4JUCA 2ZAGA 3R0IA 2O2DA 4M21A 4G63A 3RARA 4DYHA 1XDDA 2WSSA 1GL9B 3EQ2A 3HDQA 3CZMA 4IDDA 2Z58A 3O9VA 4HDKB 1VKJA 4ML3A 1YQQA 1OZFA 2NT4A 3B7WA 4QBIA 4Q4HA 4C4ZA 4DGQA 1KVQA 1HM5A 1J09A 3CJQA 4FDLA 4I36A 4ZEXA 2YZKA 3TSCA 1MJ5A 2FW6A 4NZ9A 4JJZA 1TVKA 4HGPA 3LZDA 2IHJA 3FD8A 1DFIA 1MIOB 1XLTA 3GAAA 1JT2A 2YHUA 4IXWA 4OYLA 4HWGA 1TLFA 2VIIA 2Z56A 3PT5A 4M49A 3DXYA 4C5AA 1MJGA 5A4FS 1VB5A 3QOFA 4MGIR 3EC1A 4KB5A 1FB5A 3NWBA 5EJ4A 3J7AC 4ZYYA 4ZZ0A 1MV5A 2C07A 2WIJA 1CY7A 4R8VA 4DLRA 3EHDA 1FPMA 2W6NA 1N3BA 4IHAA 3W5DA 3V9PA 1HYHA 1QVVA 2F8LA 2FG7C 2YY5A 3QQPA 4KGDA 1XQXA 5IMBA 2W4MA 5SYAA 1RWVA 2P75A 4JBNA 3WGMA 1JSZA 2ZXUA 1B8NA 1W59A 2HMYB 5CJPA 3RVQA 1M2OB 5I3ZA 1TUBB 1PNTA 3FTNA 3IB6A 3CG0A 3BXPA 1SZDA 2PZGA 3EJWA 4LWQA 4R5MA 3UXMA 5DPMA 2ZWOA 5T67A 2B7CA 2CNDA 1HWYA 3IB3A 5T4HA 3VO8A 3OT5A 3TUJC 3IA2A 4AO6A 2ZP1A 2DPMA 3K20A 4AS1A 3INNA 1XPUA 1EGQA 1FLAA 3D81A 1SOVA 3HKDA 1OASA 2BT4A 4G65A 4HAWA 4PR3A 4UM8B 3TFWA 3Q7TA 1B26A 1SELA 2ZXFA 3CLHA 3MJDA 1T5OA 2FR8C 2CBGA 1JIIA 3Q1LA 5H3CA 4B3XA 5JJCA 1B00A 4TLLB 3CX6A 3ZDAA 1JQLB 2NVBA 1V71A 3OQHA 4XIFA 2O1WA 3BDVA 3I2FA 4DJAA 3T9BA 2GWHA 1S9DA 1CB0A 2Y05A 3IIKA 16PKA 1WU7A 1NPDA 1Z2DA 4MAMA 4ZU1X 2F3PA 3MT0A 3NHBA 4B09A 3IUBA 2E6KA 3Q6NA 1SPBS 3DOJA 1X7YA 5ESDA 5HFJA 1C2YA 5EJEA 4DMCA 1ZHOA 4TT3A 4LQDA 5JQGA 5KWEA 3I83A 4MROA 1XYGA 3I5UA 1A4UA 4DM3A 1NF3A 4DMMA 2IKQA 2G9UA 2W43A 3WRYA 2A9OA 3ZOZA 7AT1A 1JEOA 1E8MA 1EPUA 5K4AA 3GNQA 4ZT6A 2GN1A 4JHXA 4YCNA 5SY9A 1ODLA 3LCMA 1I1OA 3L46A 1ZUNB 1LK7A 1BG6A 1U0HC 1XZPA 4MRSA 4L3WA 3B12A 4ALLA 4N3AA 2W2MA 1B8OA 4YMVA 1TQ4A 3GLIE 3R3UA 2Y9PB 3H2ZA 1K75A 2BV3A 4C2AA 5K6RA 4BUJA 3QHQA 1PV1A 1KJWA 3AHIA 4E94A 4I4TB 1L8XA 2F3RA 2VZ0A 3E7DA 4B82A 1RYDA 3W9YA 1GTMA 2IBMA 3FPBA 3KJHA 3WL8A 4FX5A 1T15A 2F1OA 3AI3A 5E6RB 4RTNA 4KXMA 3I5MA 1QDUA 1PL8A 4YBRA 3TH5A 4B35A 5DCYA 4PG5A 1Z15A 1N8NA 4US0R 3OVMA 2FETA 4HRAA 1G8MA 2F9LA 1DBRA 1JHZA 1ZGJA 2JFUA 5TMEA 3HKEA 3MGKA 4RFVA 4TWZA 1X39A 1K1EA 1ZMTA 2XGMA 3RR2A 4JI2B 3K70B 1W4RA 2VJLA 4J1NA 4LJ4A 2GESA 1KZYC 4WJZA 4FFLA 5DBOA 1HEIA 1TM2A 3FVRA 3W8EA 3QFFA 2P4SA 2P1RA 4IDPA 5EJ5A 5K0FA 3CH7A 1KNXA 1XTJA 3GN2A 2OCKA 3JR3A 1RAIA 1YCFA 1V6SA 4O02B 2WDPA 1HLPA 3IBCA 3BFPA 3OCUA 5JBQA 2ZCJA 1K3UB 3KYBA 4XWWA 3U61B 4XEUA 2F9FA 2ZTLA 1XWIA 4IDCA 4IVPA 3B7PA 4WK4B 4ZK2A 4HP8A 4LJ6A 3A2KA 1A5AB 3FUWA 5JROA 1SUAA 1VCOA 4NE2A 2HJWA 1ZD5A 3T7KA 1YK1A 3IUJA 2DQ4A 5F35A 2DECA 2RCNA 2W83A 2PGOA 4MGZR 5JD3A