1F56A

Spinach plantacyanin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
AVYNIGWSFNVNGARGKSFRAGDVLVFKYIKGQHNVVAVNGRGYASCSAPRGARTYSSGQDRIKLTRGQNYFICSFPGHCGGGMKIAINAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLANTACYANIN
publication title Crystal structure of plantacyanin, a basic blue cupredoxin from spinach.
pubmed doi rcsb
molecule tags Plant protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02298 Cu_bind_like Plastocyanin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1f56A00
4DP6X 1JVOA 2UX6A 4DP9X 1XB3A 3BVDB 2BP0A 3X2QB 3ABMB 4AZUA 3X1NA 2IDSA 3IE9A 4UANA 5F7BA 2I7SA 1KV7A 4Q8BA 2XUWA 4NAJA 5PCYA 4KOBA 4YL4A 1L9SA 2I85A 1NIEA 5B3SB 4BK5C 2JXMA 5ANHA 3AZUA 4YSDA 2TSBA 2UX7A 4HIPA 3WNJA 1BEXA 1ZIAA 1ET8A 5I6LA 1ILUA 2P80D 2W88A 2EILB 3AW5A 4HCGA 4A68A 3CVCA 2HZHA 1E65A 1QHQA 3OD3A 4YVUA 4DP5X 3NJJA 1L9PA 5F7AA 2PPEA 3WKPA 2PPAA 3ERXA 2Q9OA 2FT8A 4DP1X 3HEIB 1MZYA 2PLTA 3C75A 3NSFA 1SJMA 4HHGA 2J57A 1MG3C 1JXDA 2TSAA 3GXUB 3PAZA 1KYAA 1TEGA 4E9YA 1JZJA 2XWZA 2CJ3A 2GC7C 1JZFA 2VM4A 3EH4B 2Q5BA 1OOWA 4DP0X 3ASOB 1PLAA 1NIAA 2R7EA 1CUOA 3S3BB 3PPSA 1XB8A 3FU7B 1SHWA 2NRDA 2FNWA 2PCFA 1RZQA 2IDTA 3SQRA 4A66A 2YAEA 2QDVA 1OE2A 4BWTA 4YSSA 3V9CA 2BZ7A 2WO2B 1M9WA 3RYMA 2DYSB 1L9TA 1R1CA 3DIVA 1OE1A 1TKWA 3WIAA 3FPYA 1QLEB 2EINB 4YSCA 2WSDA 2IAAC 2BWIA 3JTBA 3NSCA 1NTDA 2GI0A 2JKWA 3CVBA 2YAMA 4WTQA 2DYRB 6PCYA 5I5JA 2BP8A 2MRYA 2VN3A 1A3ZA 4BDVA 2UXVA 1JZHA 3EF4A 2AZAA 3FQ1A 1ASQA 3MX0B 3CZUB 1I53A 1NDTA 5D4HA 2BHFA 3ZX1A 2H5UA 1NPNA 2IDUA 1E5YA 1CURA 1MZZA 2VSKB 2EIJB 3PLYA 3TU6A 2YAQA 5AKRA 2PPCA 4CSZA 1AG0A 4A2DA 1L9OA 2E86A 2XXGA 4YSRA 4YSEA 5EHFA 5I6MA 5B7EA 1KBWA 2Y69B 4JHVA 1BAWA 1AZBA 2UXGA 5TK4A 1CYXA 1J5CA 1N70A 1VLXA 4DPAX 3SBPA 3MBWB 4GY4A 5AZUA 2J56A 1NWOA 3NJLA 5PAZA 5I6NA 1OCZB 2AANA 4G7QB 2XV2A 1JZIA 2HX7A 2ZXWB 1BQRA 3EH3B 2XU9A 4A2GA 2UXFA 2EIKB 1AR1B 3X1FA 3WG7B 4P5RA 1SFHA 4MFHA 5I6PA 4YSPA 5I5MA 5I5IA 1X9RA 1MG2C 2P80A 2FQFA 1ZDSA 2XV3A 3AY2A 2YAHA 1IBYA 5D4IA 1AOZA 4EF3A 1TU2A 2HLEB 3NJGA 4HALA 2VMJA 2VSMB 3WI9A 1AZUA 3CDZB 3UADA 1GS6X 2CUAA 4KO5A 4PAZA 2HXAA 2B08A 3UGEA 2GSMB 5I26A 5IY5B 3DTUB 3S8GB 1E67A 2OJ1A 4GYBA 1V54B 3SBQA 1CC3A 5D4JA 1NINA 3IN0A 4E9XA 3D12B 1BXAA 2VW4A 4QKTA 1NICA 1RCYA 3N55A 4GXFA 4BXSV 1OF0A 4KOCA 4E9VA 5B7FA 3QPKA 1RKRA 1WS7A 1SNRA 1KCWA 2A3TA 3H4FA 4HCIA 3JT2A 2FWLB 2VW6A 1HAWA 1MDAA 3FQYA 3FSAA 1M57B 3PAVA 4W1TA 3L45A 7PAZA 2PPFA 1ET7A 5FC9A 4W9ZA 3ABKB 1A4AA 1NZRA 3UAAA 1SDDA 1YLBB 4AI7A 1XMEB 3HB3B 1B3IA 4HZ1A 4E9RA 4BWWA 5TK2A 2PP8A 1WS8A 1QNIA 2BP8B 1PNCA 3QJUB 4GP8B 3WNIA 4CSPA 1JZEA 1PLCA 2IWEA 4G71B 4N8UA 5LDUA 1PZBA 4DP4X 1A4CA 4E9TA 1V10A 1AG6A 1KBVA 1W6WA 3EH5B 1A8ZA 3FU9A 3TBCA 1E5ZA 1J9TA 4NERA 1GR7A 2EIMB 4FA7B 1AIZA 4DP2X 2DV6A 2BW5A 1WA2X 1OCCB 4RH4A 1SFDA 2FJSA 1JERA 1J9SA 2OV0A 4G7SB 4L0PB 4UF7C 1BYPA 1PMYA 4AKQA 2ZOOA 4AX3A 1X9UA 2N0MA 3TBBA 3NJKA 1PAZA 1ZPUA 2CAKA 1AS6A 1NIDA 7PCYA 1PLBA 1JOIA 3GYRA 2H3XC 9PCYA 2J55A 4N4YB 2XYBA 5B7MA 1AZCA 1GY1A 3CG8A 4G7RB 4AKOA 1T5KA 3KW8A 2IWFA 2DWSA 5E9NA 2CBPA 4Q89A 6PAZA 1A65A 3BQVA 4M4RB 4ZK8A 2YAPA 2YXVA 3NSDA 3NJHA 4HCFA 2FT7A 1W6LA 2BP0B 3OMIB 1ASOA 2FQEA 1AACA 2FT6A 1PCSA 3FQ2A 2VW7A 2MTAA 4A2FA 2B3IA 3NSYA 2LLNA 1FFTB 2X87A 4YSUA 1SF3A 2XX1A 1ILSA 1ZV2A 3FSZA 4JHUA 3FU7A 4YSQA 1PZCA 4KNTA 1AS8A 4DP7X 3QJVB 1GW0A 5I28A 1JZGA 1PNDA 2YXWA 3AG1B 3OMAB 2YQBA 3OMNB 4HAKA 1WA0X 1GSKA 2GHZA 4E9WA 2UXTA 2QPDB 1DYZA 3IBOA 1N68A 2IDQA 1ASPA 1IKOP 1BXVA 1DZ0A 4A2HA 4ENZA 8PAZA 1L9RA 3FU8A 1BQKA 3G5WA 4A2EA 1J9QA 3AG2B 1BXUA 1GY2A 3AG4B 3U25A 2CALA 3T6VA 4E9QA 2GB2A 3H4HA 1ET5A 3H56A 2BWDA 2BW4A 4JKNA 1AZRA 1KDIA 1SHXA 2Y1AA 3FS9A 5A7EA 2XVBA 2YAFA 1GS7A 2H47C 2FQGA 2BO0A 2R7EB 1OV8A 2XXFA 3NJMA 1HFUA 3FPXA 3FT0A 1IBZA 1L9QA 3QJQB 4G70B 3ZDWA 1IC0A 1HAUA 3GDCA 3NT0A 3ABLB 5AFAA 1BYOA 3FYIB 4F7KA 2GIMA 1RZPA 3OQRA 2ZONA 3ZIYA 1PF3A 2PCYA 2IH8A 2RACA 4A67A 2ZWNA 4F2EA 1UATA 4BDVB 3T6ZA 1WA1X 3DKHA 1ZIBA 1BQ5A 4QLWA 1ADWA 1IUZA 1EHKB 4KO9A 3X1GA 2IWKA 3QJTB 1JVLA 3CDZA 4P5SA 3QQXA 3IEAA 1JXFA 2HRGA 1NWPA 2W8CA 1GYCA 1TEFA 2AFNA 3ZBMA 2QPEB 4WKXA 4UAHA 4BXVA 4YVNA 1KDJA 1FA4A 2VM3A 3T6XA 2I7OA 1URIA 2J5WA 4KO7A 5B1AB 4PCYA 3ABGA 1PZAA 4YSOA 3CVDA 3S8FB 3QJSB 4M3HA 2DWTA 2DY2A 3NJNA 3FSWA 1NIFA 4KNSA 2XLLA 4X4KA 1NIBA 2XV0A 1FWXA 2YAOA 3PCYA 5B1KA 3T71A 2AVFA 5B1BB 2JFCA 3NJIA 4YSTA 1SF5A 2HX8A 3FSVA 3KW7A 1WAEA 3FYEB 1XB6A 3SBRA 1AS7A 3S3CB 4FAAB 1KGYE 3S3DB 1AANA 2XX0A 3AG3B 1OCOB 2BZCA 1PY0A 3OM3B 3N2JA 1OCRB 3IN2A 1ID2A 3X1BA 2IDFA 2CCWA 2GBAA 5I6OA 1OE3A 1ZDQA 4HHWA 4G72B 3EHBB 3UABA 3NJFA 1ETJA 2PP9A 3X1EA 1M56B 4YSAA 1AAJA 2GC4C 1W8EA 1J9RA 3NP4A 4F2FA 2QT6A 1F56A 4DPBX 2X88A 2QDWA 1AQ8A 1E30A 1V55B 4GP5B 1AZNA 1NPJA 3PAUA 3PXLA 2IH9A 2OCCB 5I6KA 4DPCX 2AZUA 3T9WA 4GP4B 5B1JA 4AKPA 1J5DA 4NB7A 4E9SA 3T6WA 3UACA 2HRHA 5B1JC 4DP8X 3UAEA 1SDDB 3V9EA 3NP3A 2FTAA 1JXGA 4TXVB 2FQDA 4K9JA 2PPDA 3WKQA 2PP7A 3TA4D 2WO3B 1GS8A 1A4BA 1CYWA 2YARA 2HX9A 4KO6A 4BWUA 3QJRB 3TASA 3ASNB 3NYKA 4KNUA 1EZLA 1KCBA
chains in the Genus database with same CATH superfamily
1C8QA 2CA4A 1TJHH 2OR9L 1DE4B 1NCTA 4NUGL 4NKMA 4G43B 1XV8A 3FQTA 1MF2H 3ATBA 2EIBA 2GW5A 2EEDA 3AITA 1MCWM 1TEYA 4X7SL 3VRJA 2YA1A 3LRSA 4WO4C 3GMLA 3QEUB 3VWKA 3GUFA 2W5PA 3AAZB 3ROLA 4UB0H 5K9JH 3OKYA 3UZQA 2TSBA 3GFUA 3TT3H 1KLFA 2ICWI 1CDCA 4PVNA 1F6AB 2QV4A 2YPLE 2Z7ZA 1IM3B 2W0PA 4DP5X 5L9DH 5DJDA 2APVA 1B0WA 1EDQA 1GCYA 3B2UC 3KYNB 2I07A 5ANMB 3RX7A 4FGMA 4MB3A 3WIIL 4APXB 4EKXA 3T3MB 1QLRA 1B4RA 1DQJA 1DQQB 1NEUA 2F74A 4R4NC 3S5LG 1PLGL 4JJOA 5IESL 1I9IL 3V5DA 3BQUA 2D7QA 3MV9B 3O4OB 2JJUA 4LPTA 1KYAA 1P6AB 4R8WL 3GXFA 4D0DB 1DQMH 2EEBA 2WLIA 3T0AA 3EW3B 3FCSA 3VI4E 3P40A 2DEWX 1WSST 4NUGH 5ABZA 2OK0H 3DRQA 4BQCA 3FRUA 3SGJC 3KAAA 3T1FB 4LQFH 3KPPB 3MRRB 3UTPD 1FH5H 1AFVH 3S97C 1NIAA 2EXSA 3IDJA 1WV7T 4TLKA 2NY2D 3LH9A 3CXFA 3LKOA 1YC8A 5EC2A 3O4LD 2OSLB 4FQXA 4LL1A 4QF1A 5ESAB 2R2EB 6FABL 1V3LA 1IAIH 1FBIH 2FR4A 2YUZA 5BZWA 3M7FB 5EO1A 4JL1A 2YD6A 3ILPA 5HHVL 3IU3A 4YJZL 1M9WA 4K5PA 2CLVB 5EBWA 5DD0H 5I1CL 5LWYH 5M7QA 4Y5YC 4R7DB 3ARGB 1HI6B 1LK3L 1M42A 5K9KA 1IO4C 1PIFA 2QELA 3GLEA 4NZRL 4Q7DA 3IJSB 4R0LC 1YMMD 4Y4KC 3QWRA 1D6VH 2HKFH 1LWJA 3OAWA 4HBCH 5I5JA 3SPHA 1BAFL 1CFMA 4JFYB 4HUMB 4UQCA 3KJ6L 2XOTA 1NBCA 4I7ZC 5I66A 1G1CA 1H3WM 2WBJA 4UZUA 2VLJA 5LB1A 4NNPL 5MP6H 4ZUSA 3CSTA 3PL6B 2CUMA 5EU6D 3QULA 4K4KA 5BUPA 4U05A 1EEUA 4LLWA 3T8XB 2B4CH 1MRDL 4RX4D 3UO1L 4PJCA 5KVEL 4DTGL 3VQMA 4A2DA 2WTRA 3HG0A 4XO4A 3ZE1E 5T33L 3VFSB 4AQAB 2CUIA 2CGZA 2Z34A 3CPUA 5LHDA 2Y69B 4GS7C 4HFUH 3V4VA 4M4PA 1T6VN 4AL8H 1CYXA 4LLYA 1IZKA 1UXLA 5D1ZA 1C7SA 4XWGL 1GTFA 1HS6A 3W0WB 4OZGB 4PM1A 3K8KA 4TUJA 3TJHC 2AANA 2NXZC 4LCUA 4NAMA 2XWTB 2UXFA 5I0YA 1XZ0A 2K45A 4MX7B 1RH8A 5I6PA 1W0WB 2V5SA 4YBLB 4I0KA 3BVUA 4ZZFA 2VXVL 2IF7A 5DMGD 3BGFB 4IBQA 3DTDA 2C7UB 5L4JA 3ZZ1A 5IIEB 2HT3D 1DVUA 1QW9A 2EH8L 1E42A 1O6TA 4D9LH 4J2XA 1SHSA 2X40A 4IMKC 4OCRH 1HIMH 2ESVB 5SX4H 4UTBA 2B1HH 5B39G 2P28B 4LHQB 3HKFA 4HIHB 5DRZB 3EYSL 1E7UA 1V54B 3ESPA 3MLZL 1W72L 5FWQA 3CX5J 4XP9L 2PMZA 3ZYZA 4EEEA 1ZLWK 4ZODA 1TQSA 3SCMC 1QMUA 3CU1A 2CKBH 2E7DA 5C0BE 3QIUD 5D8JL 3DYMA 4KKCC 1ZE3C 3KWTA 1RIUL 3NFSL 4NM8H 5KJRH 3VNYA 3ARZA 3M46A 4MS8D 4ELME 1RL1A 5EC1B 1A25A 1V05A 4EQ2A 3FZUD 5J6GB 3KCWA 4UQAA 2Q3XA 3MJ9H 2FWLB 1S78D 2VW6A 3HHSB 2X6AA 3CVIH 3AMKA 3TNMB 4U6HB 4W9ZA 1DBJL 2BNQA 3TA3C 3IDMA 1NH6A 1ZHLB 4XN4A 5T5FA 4JFDD 2DEYX 2HJKB 3HN5A 2P47B 1RIHL 5I82A 2BJMH 4JS7A 2DLFL 5K1NA 4XHJC 2D3LA 1VGKA 2F54A 4F7CA 4KX8A 5BV7C 5K5YA 2IIJA 5LDUA 1RHHB 3GXNA 1ETA1 3MOAH 2OQJB 1WVZA 5C0AE 2F5BH 4KPHH 3VSQA 4ZXBA 3H9HA 1XD0A 3I50H 1KNOB 4MA1B 2A74A 2GITA 1I85C 5JHAA 2HVBA 3CLEH 1MAKA 5ACLA 3HC3L 3WTTA 3CFCL 3PJSB 5GRJL 4FQIH 4Q4IA 3RFZB 4XWOC 4HJIA 2N0MA 2XNAB 2DI9A 4U1SB 1EGJA 1G1KA 1URZA 4XCCH 4BD4A 3QS3A 1H3UA 1N7MH 2EKJA 2YN3A 4WUUB 7PCYA 2MTPA 2MWCA 4NM4H 3UBHA 1KIQA 4KC3B 1GY1A 3F58H 5ID0B 3V6OE 4JRYE 3PHSA 1FFRA 4JRFA 4I48B 4Z7NB 2GSGA 4RDBA 4XB8A 1FVEA 3CVHA 2C3GA 4U1IB 4TTDD 2V3DA 2BNUA 3RTQD 4FCAA 4PJ5B 2OMZA 2A4EA 3JT0A 5DJ2B 2Y3NA 2N7AA 1OWRM 4PG2C 2J1XA 2QZQA 1ASOA 4ABWA 1AACA 1IKNA 2ENPA 2FT6A 4NJ9L 4HPYL 2JI1A 5KSBB 3V0FA 2DWDB 5JW5A 4PRAA 2PYFA 4Z7WF 4E41B 3HS0C 4Z9KB 3BEVA 1DVFB 5DHVB 5EU5A 4NQDD 2JXMB 4GO6B 1MAML 3VRIA 5JLZA 3GDBA 3LEVL 3CTTA 3KPRA 2Z31D 1F6LL 5DZAA 2H7WA 4YN3A 4P59L 3LH8A 4X7TB 4HCRH 2RIKA 2ZNXA 5DJYA 3WEXA 2E74C 3MMEB 3ARXA 3RGVD 1XD1A 4TN9A 1SOKA 4XXDB 4ALAH 3GXTA 2X6CA 3MNZA 1FHGA 3P2BA 2Y6TE 3ESOA 1CFSA 1BQKA 4P2RD 4X8XA 5FM5M 2QVKA 1HYSC 4YHMH 4AIZB 4XT1C 2V6HA 1UG9A 5KZCB 4N0FA 4O2CA 5FWRA 3P77A 4J3OC 1ET5A 5CNHA 5F7FA 3C6LA 2BWDA 4OFVA 3L5WA 4JGNA 1HXKA 1KT2B 3QG7H 2Y1AA 2MHAA 2CHWA 2XWBB 2YAFA 2H47C 3WV0A 4K5NA 4KXZI 4QTHB 3RWFB 1L3NA 5IJCC 4Z7UF 1CGSH 1U8HB 1XCTB 2PCPB 2EIEA 1F58H 1HFUA 3NJMA 2PYEB 5HHOA 5IQNA 3TIEA 3DETD 3OTTA 5FYKU 1K8IA 5GGRY 1D5IH 4H0GA 4RMSA 2BC4A 4A1RA 4FG6C 3KBFA 4X5PA 2OKMA 1BBDL 4JK0D 4N2IA 2C1OA 3R1GH 4RMQA 5DURD 3AT0A 1DSYA 3BSZL 1U8QA 3I6GA 4TRPH 3X14A 3KVQA 1F3RB 5IROD 1P9MA 4JFZL 2R1XB 4RIRB 3SOTA 2CNZA 2PO6D 2B5IC 4PGZA 5DRNB 2P5WD 1CLYH 1JN6A 4OCYL 3ZIYA 2AQ2A 2BVPA 3C5XA 1UXMA 3ATEA 4WUKH 3STLA 3ZIMA 1DCEA 3INOA 2NZ9C 3BAYA 4JO5A 5TF1L 4JG1L 1E8ZA 1RUKL 2QTEA 2VNCA 1B0GB 4JQVA 4M6OL 4PJAA 3NSJA 4W81A 4V1DA 3FBQA 1FV1B 4APQD 1E40A 3U4EB 5B3JF 3T0VA 3EH2A 3V10A 4CADB 3RG1C 1DSFL 1XL6A 2BY3A 3FQWA 4PLKC 4P5SA 4POUB 1OHQA 4G5ZL 4LLMB 3AREB 3IJHA 4NC2B 5KG9A 4WKXA 4MMZA 1EPFA 2FHBA 5AKVA 1P7QD 1KTKE 4LPCA 3FHQA 4EVNB 2ZG3A 1YEKL 1SXNA 3PHQB 4C55A 3BE1H 3WNMA 3ILQC 5ISZE 4PTTA 3IF1A 1MFAL 1NIFA 2EC9U 2H2SD 2OJZL 3FSWA 1CO1A 1J1PL 3TV3L 4NN6B 4ACTA 1FFOA 3PWVA 2R1YB 5DFVC 3O41A 3CU7A 4ATWA 1XGYL 4XXWA 2CJTA 3BP7A 3PWPB 1WFMA 2VMCA 3MJ8B 5AZ2H 4GQ9H 1UVQA 3Q8EA 5BVPL 1BX2B 3MLTB 5DUMH 5BW7A 4Y2LA 4WI5A 3SDAA 2CBMA 3KYMB 1AQDB 2AQSA 4XMTA 4ZFOL 4JGJA 4TUOA 4AW7A 3BZDA 2FLRT 4PHZA 3SSGA 3REWB 4OJDH 3KVDD 3LIUA 4WHYG 3D85A 1U42A 5I6OA 5TFSH 1HCFX 3L1OH 3VG9C 2DBLL 3C5JA 1X5HA 2WBWB 3KXFE 2K8QA 4MJIE 4RBPH 5T1DH 3LV3B 3TP4A 1OK0A 3VXRA 2J44A 1NJ9B 1B3JA 4FA8A 2AJYH 2NY6C 2I5YH 4YDZA 1YEGL 4HUWB 3QXAA 4HXBH 2QBWA 4EN3B 4ANKA 4TPRL 3ZHKA 2QDWA 4XNYH 2N59A 4A7QA 2EC8A 4HKZA 3CDGB 1MCHA 3RVTD 4PJXA 3U46B 1JHTA 4NQCA 2HJLA 3UPRA 1M9SA 2GJZA 4OY9A 3HB3D 4MDJA 1VFBB 3T4YB 4JDTH 2P48B 3V6BR 5GSRA 1TYJA 3BW9B 1I8LC 2Y5TB 4E9SA 3IDGB 5F1IB 3I9GL 3PXHA 4JPSA 5INCA 4IEFA 5DZLA 2G3MA 4TSBL 5E5MA 2WQRA 5FYJH 1SEQH 4KAQL 4UOW1 2NUPB 3HNSL 4DIXA 2ZXGA 3UTSE 5DS8B 1X4YA 4JLRA 2PP7A 2A6JA 4MWFA 3HC2A 3TTSA 3UTQA 2HKHL 5DHVH 2P7TA 1NOAA 2EO1A 4HDIA 4O00A 1A02N 2UX6A 1EMTL 1XB3A 3BVDB 4P3CL 4TNWF 4H8WC 3ZKMC 2QLVB 2WLMA 3MLSL 4N9OB 1CXLA 1KV7A 1QVOB 1QASA 3SKNB 4FX5A 3WU1A 2YEZA 3CZFA 3KPSB 1NIEA 5FDWB 5AZEH 4JY4A 5I8KH 2WWNA 3PUUA 3UTTE 3GHBH 2BVOA 3ES6A 2OMWB 5I74B 4PY7A 3EJJX 4W6XB 1EO8H 1RPQA 4ZDHB 3VD2A 1YQVH 5JHLH 3IFLL 4I85A 3V0EA 5DEGB 3VH8A 4G8FA 1CDYA 2WN3A 5I2IB 1QHQA 5FAAA 5SV3A 4TQEH 2TRYA 1EFQA 2OXGB 5AAWA 5J11C 4BM7A 5FECA 1DBML 2FWOA 2QSCL 5D7IE 1TTRA 2AMGA 5JO5A 2H6OA 1O9ZA 3KGUA 3SDDB 3TO2B 5IEHA 4GG6E 2EZ0D 4Q6IC 3ULUL 2DQMA 2Y2TA 2MJWA 1DEEA 2XG4A 2H26B 4YIQA 3T65A 5ILTH 4KX9A 1TVBA 2E27H 3BX7C 4RAHA 1HL4A 3DGGA 4JZJB 1LEKA 1I1FA 1MCEA 3T0DA 4EN2A 4CVUA 3RWDA 2WQSA 4JFFE 3M88A 5DHXB 1N4XL 4DP0X 3ASOB 3GC3A 3Q13A 4F92B 1TQBB 5ALBL 3S0PA 3WDJA 1YJDH 4X42A 5EUOB 1XB8A 3B9KB 2IFFL 4PJ9C 1W0YT 2ZSWA 3O6FA 2B7DT 4K3EL 4B0MM 1JMXA 3PJLA 4ZG1A 3LQAL 4A66A 1A9BA 5ID1B 3HE7C 3I02B 1FO0B 2ICWJ 1A0QH 1T21A 2DTSA 1CDIA 2WQWA 1KPRA 3WHXB 4KK9C 3MRHB 2PN5A 2Z7YA 1XR8B 2WP3T 2UZIH 4X9GA 4GRLD 3FMGL 4GG8A 1XAUA 5E8NB 1NTDA 2DQDL 2GI0A 3U30C 4ERSL 3N42F 2HVKA 5EULV 1GH7A 3DHJA 5DRWB 1MHCA 1WZAA 3RVXD 1A2YA 5JDJA 4ZSOE 3O45A 3OX8B 1KB9K 1YY8A 3U36B 5F7HA 1Y6MR 4I18C 2D03H 3CFKA 2WXKA 4L3FA 3HVNA 3D3VE 4PHXA 3ZE2E 1ID5I 1OAQH 1J0ZA 2W95A 1L9OA 1OT2A 4YSRA 2MNUA 2W9DL 2AV7A 3QJHB 3T77A 2YZ8A 4KJPD 1AZBA 4KZDH 4OQTH 4GBXA 2D7PA 5CCHE 3KNBA 4W9IC 3ZQ9A 1JFHA 3CFBA 1I4FB 4OVVA 1YNTF 4H8PA 3N1GC 1P6WA 2OYMA 5I5RA 2X89D 4G9DB 4RMVA 1ZVSA 4MVBC 3S98A 1FYTB 3BH8A 4A2GA 1DLFL 4KQ4L 4KNQA 4NP4H 3FNKA 1XR9A 2ZE0A 1MRFL 1FORH 2W81C 4TULL 5IQ7H 4L4TB 4IGBD 4HD9A 2FQFA 2XV3A 2CDEB 1MCIA 3LNDA 4QHKI 5JR1L 2BXZA 4DGIL 5JPNC 1DQIA 1BQHG 5CN3A 3ETBF 4HSCX 4UQBA 5JDSA 5I1LA 1Q9LA 3IDXL 2FUTA 4CU7A 3DJ9A 5I26A 2P5PA 2WWKT 1AD9B 2R1WB 3LRLA 2ZUQB 5HYQA 3LPWA 3OZLA 5C6TH 3SBQA 3RZCA 4MD5B 5EUKB 2H32B 3QQ4A 5IT2L 4NC1E 1JYVA 5C6PB 2Y72A 1ZGLP 4Y5VB 5SX4I 3WIFB 2D2OA 3O6KH 4NKIH 3VD0A 2VW4A 5E6IB 5MEOA 4ZO8A 1AE6L 1E4WH 5FPIA 4FQLL 3RVWC 2PCFB 3A6CH 1P1VA 3VACA 3TFKD 4Z7WB 4P4KC 3WSQH 4KKAC 3H4FA 4H8HA 5DD1L 2IBZX 3PAVA 5KYUA 5D93C 2NYKA 5FC9A 2FO1A 1FAKT 2BSDA 3HE6D 3V0DA 2H1LM 5EF0A 4LPUA 4MZ3A 3DXAB 1B3IA 5C0EB 4XN1A 2ERJB 1TCRB 3QI9C 3P3YA 3VDBA 5JHBA 1PNCA 2V9UA 3CK0H 4M43L 5CJOH 5JQIB 3KLAA 3B6SB 5C0JA 1U93A 4G8GB 4BFIA 4AQ1A 3K2IA 4EZMA 4FJ6A 3RVUC 4G9FB 3AT9A 4JFHD 3MXVL 4R7VA 4X5QA 5DZJA 2WV3A 1HU8A 2ZXCA 4WHTB 5DO8A 8FABB 3JTTA 5MENE 1ZA3B 5I8CB 3T2LA 2Y7LA 4HKBA 2A9NH 2JQZA 3LAFA 4F8TA 4NP9A 3Q48A 3MV8A 1K4CA 2CRIA 3DX3A 4JM4H 1IRAY 2XZAL 3U4AA 3IJYB 1DVQA 4B9PA 5HGAA 5E4EB 1NCDL 4WW2C 4XN9A 1AR1D 5KSUB 4XI5C 4NXKA 4LEOA 4UTBL 5IB5B 3NJKA 4JEGB 5IFJA 1EHAA 2OBGA 4PB9H 4OZFG 1KY7A 4MHHI 5IVOA 1M4KA 1UURA 2ILLA 3DTXB 4N0UA 2RGSA 2QHRH 1CU4L 3P0VL 4ZMAT 3FJTA 1J0IA 3RURA 1OAXL 6PAZA 3BQVA 4NCDA 5DWPA 1OARL 2YQ3A 2FCBA 4UM9B 4HJ0C 1EWHA 2YXVA 4EI5A 5IMLB 4NKOA 2FT7A 4Y4FD 3FFCD 3WLWD 2DDQL 1MJ8H 3N1PC 3O8XD 2XZQL 4KI5E 4L37B 1FO0H 4OV6F 3S37X 5CGBA 3TVMC 2R83A 1V27A 3GBLA 4TV3A 5EF1A 1KBPA 3Q7JA 5LGJA 3F7KA 2QQLH 3GSVA 1C08A 5T5FL 1XQ4A 3LKRB 3FSZA 1KTBA 1PZCA 4LLUA 2A83B 3NABL 2WWMD 5I1KH 2Y7NA 2YPLA 1LO5A 1WP6A 3OZ9L 3RB5A 4X6EB 3ZYOA 4YR6B 3OMNB 1DVZA 4QPEA 3DX6A 3L4TA 3WFBL 1UEMA 3Q2CA 4U0RB 3ZPDA 5BOZG 4B9FA 3JV5A 2IDQA 2Y07H 1PZ2A 4G5AA 5GRUL 4RBPK 1MLCB 1U3NA 2Z7UA 3GMPA 4ZQKA 5IQ9B 5C0CB 4MAYA 5EOTA 3WGVB 4CDHA 2CJUH 3DRTB 3BFWA 3G5YB 3VD5A 1KMGA 1B9ZA 3VO0A 2FEEL 1QYGH 4TVPE 4M5SA 5B38G 4A2EA 1CFTB 4I0PA 4XTRC 3X13B 1JJUA 4ZO9A 3H56A 1CFVL 3RY5A 5FB8B 2YJLA 2XSKA 3Q43A 3PNWA 1N8ZA 1EGJL 4HK0A 3VGAB 4PRIE 4L9LC 2WB7A 4H8UA 1RVFL 4QAMB 2R0ZH 3FTGB 3V7MA 4QGYA 1L7TL 4GLRI 4PS4H 4QRUA 1FSKC 4ODTH 3FPXA 2XWJB 1L9QA 1KJMA 4C59B 4WTZA 2W91A 5GGSA 1JVKA 1G9NL 1IC0A 2AK4B 3OR7A 1T1XA 5ICUA 2HRPL 2DM4A 4KTDH 1HTYA 3CVHL 5LG6A 4L8SA 4K5LA 1T22B 3IJ8A 2F1AA 1A1MB 1BYOA 4KVPA 3O0LA 2XY1A 2DYPA 3LN4A 5DQDH 3SGDI 1A9VA 2IANA 3KPOB 2ZCHL 4CC0A 4FADA 2W38A 1JZ4A 4HG4K 1HSAA 1NCUA 2MOVA 4L4JA 5FHBH 1DL7H 3QORD 5I6XC 2HUHA 3CZNA 3K6IA 3LKNA 5G5DB 1AKJA 1JGUL 1J0HA 1BFSA 3RJOA 2VL4A 4CMHB 5D1QC 4F37K 4HS3A 1N5YL 1R5WB 2AXFB 3JWOL 1RK1B 3AU0A 4HZLB 3AC0A 2BOCB 4K8RL 2H32H 4KO9A 5EG6C 3QPQD 3DGCR 4NS0A 1IBGH 5FKPA 1PCXA 1EAOA 3LPOA 4QDGA 1IC7H 3IEAA 3QQXA 4D7PA 2R9HD 4GAJL 5T5NF 2LTQB 5CEXB 2H8PB 4HUNB 3ZHDA 5F7WC 4WK0B 2L4OA 1I8UA 3FTSA 4TUKL 3WFHA 4Y8DC 4MB5A 5DVKA 3QEUA 2DQGL 2G9HB 5TDPA 5FUCC 5L4MA 1Q72L 1WHOA 4UQ2B 5HJ3B 4YHIA 3KWWB 1IM9A 2YD5A 4N0YH 2QHLA 3NZ8A 3NJXA 2OMYA 5TGBA 1I1AA 3K4AA 1N0LA 3IJ7A 2R2BB 4AMKH 1RSYA 4JREB 1G9ML 2ZCHH 2HUEA 3C60B 5B1KA 3Q3GA 3HKZA 1U8OB 1KGXA 1QQDB 3MV7E 3OG6B 4OFPA 3SDYH 3TIDB 2IH3A 4MLIA 3BQUD 3KW7A 1WAEA 1UXSB 3AS0A 1XB6A 3EOBA 3GGWB 4WNJA 5AWNL 3KLKA 4JY5L 3L3JA 2ZP0T 4ZX3A 2VDPB 4P2YA 3S3CB 5DI8A 1JZDC 1TQCB 5IQLA 3L3DA 3GMOB 1S9WA 3QCVH 4MKMA 7CGTA 1DQLH 4H5SA 1AD0B 4OJEH 4AEIL 2DTMH 4GAGH 5FYLH 3KLHC 5DMJB 3HG1D 2E75C 4UINL 1MUJB 2AQQA 1LTXA 1QPPA 4C56E 2JCCA 1MCWW 4ENED 3REVB 5GGUB 3QO1B 4N2CA 4YC2B 5IHLB 4FQXD 5D1XB 5G4NA 5T1LB 2JLLA 4B7IA 3MRIA 5HYJE 5C0BA 3E8VA 2ITDA 1G7PB 3QDAA 1AKPA 2XQBH 3I3BA 4GXUM 2BIHA 1RJZB 2ENSA 2X88A 1T03L 2CBQA 5AB2A 5CWSA 4H1LB 1S7QB 3SZ6A 2D7OA 1H5BB 3HZKA 2PW2A 4OGQC 3ZDXB 5AVTB 2Y2YA 4UNTA 2VZ3A 4FYSA 1B6DA 5FUOH 3W11D 3QZBA 4XNQB 3OWEA 1C9SA 1Z6JT 3HCVB 1BF2A 1T1WB 1Z9PA 4AXWA 3FU3A 4FG4A 3L3OA 1QEXA 3MGOB 4HPOH 2F1EA 4NO3A 2WBJD 1XTLA 2VLJD 1D5MB 3TBVB 2EECA 2EXWD 2X4RB 3FB6B 1I9JL 4DGVH 5GISL 2F8XC 4LLDA 1NGPH 3AS1A 2D3NA 1DO5A 3AJ7A 2P42B 4HS8H 3RUGF 3BOVA 3Q6GL 4M02A 1TJGL 3E8UL 5FF6B 1JWMB 1GIGH 1ZEAH 1H0DB 3MCYA 4KO6A 5HHME 4AYDC 2IBBA 3TASA 1MQ8A 2CLRA 5C0AA 1PFOA 2JJWA 2VLKA 1A47A 3MBEA 4M8QB 1M05A 1GGBH 5KBLA 3GSRB 1E27A 2C8NA 3GKWL 1FE8L 3BCDA 5AVUB 4BYHA 5FYKD 3QQNA 4U6XB 4LFHG 3ME0A 3ECBB 3K7UA 2IGFH 3N85L 4O9HH 2OMXB 3Q06A 3C8KA 4IYKA 4FYRA 3W37A 4P5TB 4DKTA 1NFAA 2ZYHA 4J3VA 4ZUTA 2DB8A 5E4IA 4YHZL 3QIWB 5E2WL 2WLNA 5HPOA 5EZJB 3J07A 1JWSA 2AJUH 5CM1A 1WBYB 2CMRH 4HC1H 1W16A 3V6OA 2AGJH 1ECZA 4IBSA 5FKAB 3WNNA 1N6QL 4JRYA 1JZ7A 5T1MB 1FJ1B 3KHQA 1R5VB 1YNTB 3IGAB 3S2CA 2KKQA 1J5OH 3BP5A 5IFAH 4HWNA 4XOBA 3NSFA 1VAHA 3SN6N 5CP3A 1I82A 4WY7L 3NZHL 1XVSA 4QIRA 4W68A 4QOKD 3QRBA 4FCHA 3VGGA 5D2NC 1KZQA 2W0LA 4ADGA 1AGFB 2MKWA 3LNFA 1ODUA 4NQEA 4QRSB 1RZJC 1CXHA 4JE4B 3U0PB 1M6OA 4ZFFB 3AUVA 1KXHA 3AGWA 4B9GA 4JZNB 2VT0A 1INQA 5IHBA 3TBWB 2CCVA 3GMMA 3ISRA 4UCFA 3GM8A 1J11A 2VR3A 4ZNCD 1MW2A 5A2BA 3CE1A 1VKXA 2ATPB 3H9SB 1AGEA 2EE0A 4YH6A 3TO4A 4NWTH 1KTRL 2IDTA 4L4VB 4N2AA 5DWUL 5IEKB 4LCVA 2VCOA 2QR0A 5J6GA 4RFOL 4PJHB 3U6RB 2BLFA 4QRPD 4ZW3A 3HHSA 1RZKH 4OJFL 4YE4H 1RZGA 2NY1D 1DJYA 2E47A 4ODXB 1CL7L 2B2XL 5IBTH 2EINB 4OGYL 2I26N 3FAWA 2F54D 4ODHL 4R5TA 4KXDA 4RSYA 3VG0H 1FHNA 2C3HA 4WTQA 2DJUA 5H94B 1E5AA 4PLNC 5DSCA 3BN9C 3QK0A 4WK4B 2P8MB 1NCCH 4NHUB 3UROR 4KWUA 2Q86B 3SE3A 3D9AL 4ZXBD 4QYAA 4S2SB 1NLBL 1CZ8L 3QA3A 3F6IA 4YNYB 1OGAE 4HIQA 3T2PA 2E6JA 3SZKC 3ETTA 3WJJC 1IIIA 3MR9A 1MVUA 2FBRA 5MEPB 1HXMA 1UCBL 4GMTH 1TPXC 5I6MA 3QG6A 3VD1A 5D7JB 1BJ1J 3Q2WA 3INUL 5I17A 4AVHA 4PRDB 4QHLA 5E6YA 5CJ5A 1B2WL 2ADIB 1UENA 3ARDA 2MMXA 4OLVL 2MNJB 4XMVA 5AZUA 3ULVH 3DHMA 4P2OB 4I2XE 2VDPH 4MRCA 3SY0A 4Z76A 1OTSD 2JKXA 1R47A 5GS0H 2BNRB 4G7QB 4OI9A 2HSIA 3QDJE 2VR6A 3Q5TA 1NAKL 4L3CB 4CMMA 3GBNL 4MNHA 4OGYH 3L1EA 2ICEC 2Z93B 5LVEA 4F7TB 4KKLC 3SPVB 3C9NA 4IHOA 1OM9A 5B8CB 2QL1A 4RDQF 3RY4A 4DVRH 2BY0A 5IM7A 1FZOB 4U1IA 1PZ3A 3E6HB 4PY8I 3KR3L 4HJJL 3PQYE 4LASL 3OBAA 4OT1L 3EZ8A 3ZE0F 1COBA 5HY9A 2O1AA 1BZOA 5DJ2A 3GSNB 5EB9A 5CCKL 2WLYA 4H1LH 4L29B 2A6DA 2ED7A 3KPRD 4TLUA 4Y19B 5FO7A 1OT4A 1VFMA 4K8RD 2DQJL 4R96A 1G7LB 3A4EA 2LU3A 3NIFB 4GEJA 1ZLUH 5ISZA 4AEEA 1JIBA 3I3EA 2E8ZA 2ZCZA 1P4IL 4M6NH 4YDIL 2KERA 1UD5A 4LBAA 3IU4L 1M1SA 3WS3A 2AEQH 1CQYA 2PTUA 4FEMA 3RX5A 5GZOA 4J3OF 2FGZA 4OGXH 4XBGB 5IFHL 4KTYA 3VDCA 3MNVB 4R4FL 3VXPA 4XP6H 4HS6B 4FS0A 4YBHA 5FXCH 3CLFH 1QI4A 5I1EL 5HDQH 5EEZA 2O26U 2RA1A 2M1KA 2CM5A 1NBZB 1P84J 2NQCA 5D7SL 1GOHA 4QHKJ 3VXTA 3B9DA 3GI8L 2IBZY 5D7EA 5IVXF 3H7LA 4F8NA 2X3CA 4LKCA 4FFVD 5IBLD 3QJUB 4QTIH 4MJIA 1SBBA 5HHOD 2C4FU 1JZEA 1YYLH 4DKDC 2UZYA 1A4KB 3ZZLA 4YHKL 2VJXA 4UILH 4N28A 4D9QE 2R0WL 5JW4M 3CFEB 2JI2A 3K6SA 4ZFGL 4NLHA 4Z7QE 4X9IA 5FGBC 3DYOA 1KYDA 1LP9B 5KVFH 3QIBA 5KYXA 2R1XA 5I71B 4O02A 4TSCL 4G3YH 4IK6A 1T5XB 4I1RA 4M29A 4FZEL 4X7CC 5TDOA 3STZA 3VXMA 2CD0A 3GSUA 1B4TA 2Z9TA 1TNNA 3IGKA 3C2AH 3O2WH 3V8OA 5I24A 1YEWA 2E6PA 5T3ZH 3VI4B 1I7ZB 4V1DD 1MCJA 3UTSA 3P4OB 3RFRA 3SGEI 4LVNC 3CHXA 1U8MB 1T5KA 4LB8A 2Q3ZA 4K2UH 1CB4A 1D5RA 4HKXA 1H6EA 1UUNA 2DLHA 4LXFA 4M4RB 1NUFA 1NFIB 1DBBL 4XNMB 1U8JB 5KOVC 2BSBA 2P8LB 1XEDA 2FRGP 1QNZH 3GBMH 3RWCA 3MGTA 2EEAA 4RVBA 5ICZA 1EXHA 2EYSA 4WO4B 2WZ5A 4PLJC 4ZFGH 5D1ZI 5DTFA 3CMOH 3UTTA 5AUMB 4YDLB 4ES9A 5CN2A 1JF1B 4JZOB 1X5ZA 3GXPA 4N6RB 4OZ4B 1WFOA 4U1MA 2FL5A 3QDHA 1KN4H 2APWA 3UJIL 5F9JA 4FXKA 2ISDA 4L3ED 3GSWB 5D7IA 4AYBA 2JKJA 3SDAD 1NMCB 4GKNB 4HUUB 3VFUB 2VERN 3MLTA 1QFOA 4HUVA 1J5HA 2AJZB 1EJ6A 2EDJA 4JPVH 1YUKB 4F7EA 3D85D 2CO7A 2H0JA 4TSAL 1JTOA 1BV8A 2EDMA 2ZG1A 3U1SH 3ZE1B 4WVRA 2I25N 2F19H 5EN2A 5DJZA 3VXRD 4JFFA 4KFMA 1AYRA 4QJ4B 3NCEB 4JKLA 3LS4L 4J3XA 2HMID 4KX7A 3DSFL 4ODUA 3D30A 3WXWL 1O7SA 2R7EB 3DC0A 1LWRA 4QHUB 1OAZL 1RFDL 3CHQA 4WNSA 4U3SA 1EHXA 4NQCD 5EF3A 4IRJA 3QJQB 4NJAH 3BH4A 3D0LB 1GHFL 2Q3AA 4YHOL 2VDNB 3RX8A 4G6KH 1HAUA 3EDEA 2XQYA 2MQ3A 3T0EC 2EDKA 4JPWL 5I8EA 3BW9A 4NPKA 4Y4KB 4XGZA 1A7PH 1RUPH 3DJTA 3NPZB 2ZUUA 1AGCA 4K7PH 4PVMA 1B4LA 3GSNH 5JOPD 4IRSA 4GMSH 2YGNA 2ZWNA 1A6VL 5L7XH 4HF5L 3JWNE 4MBRA 5FGRA 1F3JB 3FUDA 2B1OA 3PUCA 2WCSA 3VXSE 4LK4A 2DH3A 5L8KB 3SKUD 1IAOA 2X2HA 1BPVA 1ZLSH 5D6CA 3FN0L 2KLTA 2XC8A 3LDBB 1U3HA 4Z23A 2FEEI 1OK8A 3BD4A 3FHAA 4GS7B 1SJHA 3OHXA 3SKNA 4OV5B 1TQUA 2F08A 3I75B 3RUGB 4BXVA 1G7MA 4PJFF 4ELMB 5EZLB 1RLBA 1NEZB 4DUXA 1FA4A 4OM0L 4N85A 2VM3A 1M7XA 4JNXA 1Z0MA 5B1AB 2WXFA 4PCYA 1ZMYA 5LAXA 3V4PB 2BSSB 3NCMA 4Y2NA 1MRCL 1IE5A 3QJSB 3R8BB 4K9EL 2HFTA 5IBUB 1LK2A 2DWTA 2DY2A 4JPWH 2QADD 2O5XL 4MHHG 3B83A 1HDMA 3V0HA 4D7BA 5KVDE 2AJVL 5AOJA 1PJ9A 5B22A 4PP2A 4E2OA 5J6HB 2B3RA 2NCMA 1U8CA 2HRLA 5C09A 1KB5A 4NO2B 2AJSL 1IGCL 4IJ3B 4C4KT 3TN0C 5CBAB 1FVCB 4GUPA 3C08H 1OW0C 3DX8B 3EOTH 1WZLA 3DX0A 1M7IB 2WLKA 1E2VA 4EDWL 4IOSD 1R0AL 4Y2OB 5FOJA 3HR6A 1S7UB 1OE3A 3L3KB 1WC7B 4JM2D 3F64A 3ZTDC 3TM6A 1G7JB 4RGNC 3IYLW 1PY4A 4MCYB 4HGKC 3SDCD 1FNFA 3HNVL 1S5HB 1J9RA 4O5LL 4F2FA 3ZGIA 4ZUVB 1E30A 3QQ3A 1IGYA 1CF8H 3ZDYE 3KYOA 2WY3B 4JRWA 1VZIA 3DPBA 1RIVH 2A6IA 4KK6D 1Y0LB 2J2ZA 1YEJL 3HMXH 2XPGB 3PJNA 3VD4A 2DQUL 1R3HB 1PG7X 2E3VA 3OSKA 2VQUA 3VXUE 4AYFA 1HC1A 1XF5B 2IOMA 4KZEH 3CFUA 4TNWK 1CFQB 4UMGA 1VFAB 2R4SH 1SXSA 3E6FB 2FJGA 1WCBA 4PV9A 2OPCA 3NCYP 3GRGA 4X4ME 5BV7B 4ISVA 1UKTA 1NKOA 1SMDA 4G8EB 1GS8A 4OZIF 1HILA 1L3WA 2KZ1B 5GHWH 1AHKA 4F3FA 4UM8B 4O4YL 5M95B 2GJ6B 2FATH 2UY6B 2QLYA 4NENB 5MENA 1F4WL 2ZD0A 4GBXD 5E1QA 3DV6B 4CGTA 1YNKH 2D7TH 3UDWA 4PG9A 5CSBA 4MAZA 3IE9A 5CJ8A 2OYLA 1MW1A 2HLFC 3UTOA 2XUWA 1JK8B 5IHUL 3T09A 5FOBA 3Q1SL 4KUZH 4UIMB 4NO5A 2AXGA 1CG9B 3EO9H 4PJ8B 5L2JB 3IETA 4DUVA 4GKSA 3RGHA 1QBML 2JB5H 1N64L 4OKVB 4PMEA 4JG0H 5DFTA 2UX7A 4J3TA 3WNJA 3RIAK 1ET8A 1JGDA 2JCWA 1FYTA 4WWKA 5DHYA 1NUNB 4GW1A 4YFLI 5F1NA 3LRKA 3DROB 1OTUC 5A6MA 2BHUA 5CSZA 1XDTT 4V2BA 2AQ1A 4GAFB 1X5JA 1KTLB 1T1YA 2DIBA 4PFEA 4Z3TA 2EYRA 5GGSY 1ZLUK 5HDRA 3MKKA 3H0TB 3QUZA 3UIYA 1F8TH 3GIZL 3ZY7A 3M6DA 5HD8D 5JA9A 3RZCD 2XFXA 1SXBA 2VDNH 2R1WA 5E0QA 4WU7A 4G8IA 4YDVB 3VXOB 1OOWA 4MA8H 4OLYL 1I3GH 3HS0B 4I9WD 1UYWL 1CD9B 3KYKL 1HL5A 3EOAA 2FIKB 4WFFE 5ECGA 5C3LD 5E8OA 4C54A 5EOCL 2XQ0A 4KJWD 3IXAB 5FIEA 3WIFA 4FTDA 1SXZA 1YN7B 2W9EL 4P9HH 1A66A 3FB8A 3QXDB 4NRYA 4TVSa 1LHZA 1A6WH 2PCFA 3D0VA 1QEWB 1ES0B 2NXYD 5D5ME 2QDVA 5ABDE 1WTGT 2VUYA 1OGPA 2OX5B 4NO0B 4Z7WA 3VFPB 4F8QA 2VLMD 4QD2E 3IGLA 1MCKA 3CDCA 4Q97A 3VFVA 4P23A 2GT9B 3QXWA 2QSVA 1U92B 4Y16A 3MA9L 5FHAL 2FX8H 1RK0B 1NMAH 2YAMA 3IKCA 4Y7OC 4HIXL 1Z5LA 1A3ZA 4BDVA 1V3JA 4Z0XB 4DFHA 3A21A 2OXHB 1GGIL 3GIZH 4NSKA 4PRIA 4PREB 4XPFH 5BRQA 1NC4D 3COOA 5B4MC 4MJHA 1GTNA 2JELH 2HFGH 4H0HB 4LKXA 4WW2F 5JXEC 3CFTA 4XPBL 3DUSA 3LZFH 4J4PA 3L6FB 4P9MH 3V4PH 5IKCB 4XVOA 4OLYH 1G4RA 4RNRA 1SOQA 2VSKB 3JV6A 3LNIA 3MV8D 3O2DA 3PLYA 1KGCD 4FYTA 5I0WA 5TQ0L 2DQCL 2Z91A 2WUCH 4FULA 2XTJD 1SYSA 1U8LA 3MCLL 4XP1L 5F70A 1YUHA 3HC4H 2VAAA 1LO3H 1KJVA 4IKLA 5CGYC 2M2DA 4LAJH 1XIWC 4Z7UA 5DCCA 2CCLA 3J2PA 2EO9A 2B5IB 4L8DA 4MB1A 1SXAA 4Y5XC 3TH3T 5E9DD 4L1LA 4IKJA 3HAEB 4RA0C 1A3LH 4OLWL 2ZUVA 1KXTA 3MLRL 3O3DB 1PW3A 4N2OA 5DK0B 4AIOA 1YYMH 2IAMC 5I6NA 4ZAKA 5DZNA 3PWLB 3UBXA 2ZXWB 3H9YA 4KUCD 1BM3L 3EH3B 3X1FA 3KBPA 3FT4B 1QLFB 2J8HA 1RURL 1NANH 2D31B 4D0BA 4KVNH 3LEXB 3KXFB 1A3QA 3WAJA 4EI5D 4N90D 1IQWH 1YEHL 1YVLA 1W80A 3V8CA 1CL7I 1IAKB 1QBAA 1T3FA 4PAZA 4W9KC 1FLTX 1IEAA 3N41F 6CGTA 1F13A 2FD6H 1BFOB 2DL2A 2IQAA 1EJOH 3D51A 4GYBA 4LL4A 5DZOA 3BLPX 2YPLD 1KCSH 5E99L 2WLHA 3ZE0E 1X4XA 1DANT 4HH9B 3L9EA 1GPOH 1LDPH 1JPEA 2AP2A 3D69B 1ZSHA 4LCWE 3TJPA 4BINA 4UQ3A 4MAYD 1R46A 3L2NA 4XB3A 5BV7H 1WIPA 3QPKA 2CSPA 1RKRA 2G0LA 3EYVB 3BYTA 3OC8A 2YBRB 1RUML 2NY2C 3CJJA 3JWDL 3ZMRA 5BO0D 1HHIB 4M7ZC 1P4LA 1UFGA 3TZVA 3FSAA 4I0PD 4G6AC 1YPZF 3G5YA 2ENJA 32C2A 2ATKA 4U1LB 1SDDA 4NDMB 4AI7A 4PY8J 3FN9A 1IEHA 4X80H 1KEGL 3M8OH 5TK2A 1PDKA 3WFCH 4X4YB 4X0NA 2N7SA 4Z5RB 4D8PB 2A4CA 3E2HC 5F6HI 2V3EA 4DP4X 5HYJA 2BK8A 2DD8L 4P3DA 1GXEA 2BERA 1SHMA 2XWJA 5E8PB 2DWEB 1B4JL 2CHNA 3L4CA 4ZFQA 1SMAA 5IG7B 5IVXE 1AJ7H 2M83A 4W9CC 4ELKB 3QUHA 5I1AA 3B5TA 1GOGA 2DQFA 3EH1A 4LSTL 2LAAA 2IAND 4JJ5B 3MRFA 4DKEH 2ZZUT 2HG5B 4X5WA 1FPTH 1J9SA 3OZKA 3RL2A 1GCFA 1I1RA 1AC0A 1OPGL 2E7BA 5ICXB 3UP6A 2L3BA 1AKJD 4X8JA 1NUGA 1X9UA 4HZAA 2F58H 1F90H 5DJAB 1U8KB 1GKOA 3SKOA 5CF3A 1S7TB 4XVTL 3D33A 1IGIH 3UTPE 5HVHC 1LILA 1WIOA 5B7MA 2Q1EA 1HH9A 1WD9A 1OWWA 1G6RB 4YO0B 3OVUB 3RWIB 5I76A 3CCHB 1TETH 3O4LE 3OV6A 3QFJB 4K3DL 5DHDA 2APBA 1A6TB 3WL9B 4BKLB 1T1ZA 3RY6A 1FGNH 3S48A 2GFBB 1X9LA 5BPPA 4NQSB 4YQXL 1JD9A 1W6LA 3II3A 3NCBB 5K33A 5L4IA 5DMGC 3FONB 4N2DA 1IM9D 3OMIB 5C08A 2O5YL 5C71A 4ZS6D 4TF4A 1A6UL 1I1AD 3DMMA 3NSYA 1YMME 3BKMH 3QUYB 5D55A 3RI5K 1IM3D 2OCFD 2XX1A 3V7AE 5JNYA 2Z35B 1Q9KA 4Z3JA 1C5CH 4ZUWA 3UC0H 4PTUA 3H7BA 1JGIA 4Q6KA 3MJWA 4AM0B 1GW0A 3WJMB 4B7LA 3L13A 3KCPB 4Z8FH 3EBAA 2XKUA 3L4UA 3LJ3A 4J3OH 4PJFB 2Q6WA 5J11B 2ZUXA 2JJTC 2PWDA 2Q2LA 5EU6E 4E9WA 1K5NB 1HK6A 2MOQA 4ZSOB 4LSPL 1QHOA 4JRXB 3UOAB 3MLVL 1I9RH 2ZTBA 4IBZA 3ARRA 3NZUA 3VFGL 4WFEE 3D3VB 3CZEA 3GMQA 3ZE2B 3HFMH 5LQBL 3NFNB 5K1JA 4MNGE 4O02L 2EABA 1MUJA 3FZUC 1USQA 5MHSD 4C8XA 2HP4A 3N9GL 5BXFA 3G6JF 4XRCB 3X11B 3GPEA 5ERWB 2EXYC 4ZT1A 4FI7A 4FLSA 3HAEH 3VVWA 4O51B 1OAYH 5JHDA 3F7YB 3V0WH 1XCWA 3RPIA 3WKMH 4PJBF 3ZKSD 1U8IB 3HE7B 2FX7L 4WWPA 1BLNB 2X1XR 4KV5F 1I8IA 3NDYE 3WO4B 4DVBA 3EBIA 1GL4B 2XA8H 3MBWA 1BPLB 3SDXF 2XBDA 4F7KA 3EJUA 2BDNH 3LH2L 1T1WA 3O0RL 5JW4Q 4GJTB 3FQUA 3WNKA 2G2RB 3D48R 4GQRA 4GW5A 4UBDD 3U30B 3HS8A 2NZIA 1INDH 1VEOA 1WAAF 2PCYA 2X4RA 3MLVH 1X5FA 1VDGA 2WZPD 3GLZA 3PL6D 1PG7L 3IE4A 4A7UA 1UOWA 1PKQE 2RALA 4J6IA 4RRPA 2VLKD 4N8CH 4OCNC 1U8PB 1T04B 3MBED 5LKNA 3EXJA 4I18B 5ICYA 3VM5A 1PX4A 1OGAA 3TEYA 1YY9C 3ZTNL 5LGHH 1OCWH 2ZCLH 3CDZA 3NPSC 3JTSB 1NL0L 1S7RA 2C9AA 2IQ9L 2PTTB 4FP8L 4R2GD 2PR4L 3V0GA 4ZMZA 4KK5D 5F3BA 4UT6A 3U4BH 1QLEL 2X0WA 4ACPA 1KDJA 2AEOA 5CD5D 1H8LA 3T6XA 4I2XA 4BSJA 2OR7A 1CYGA 4OCLC 4Y1TA 3WKNA 5D2LF 4WGVB 1OGTA 4JFDE 4JPKH 4OF5A 1KPUA 4UTAH 4JRYD 4KNSA 4ZTPL 2YK1H 4LLVA 3B2DC 4JB9L 4P05A 1FZKB 4R7NB 3O9WA 2E7LC 4DH2A 1MIML 1U3ZA 4EO5A 1QI5A 3BUIA 5JQ6H 3EGXA 4AW4A 2R69H 3K91A 1S8DB 1KPVB 1YECH 5DFAA 2EDYA 1K5WA 3KDMB 5JPNB 4JO1H 5F1KC 3RWHB 4YHLL 1EJ8A 2R51A 4NQED 3S9DB 5GGVL 3PQYA 4NQQA 1XCXA 2XX0A 3CBJB 4Y2DB 2HCZX 3HZMB 4I5BB 3L54A 4ODVH 4EI6B 2ZCKH 1M71B 3EYFA 3N2JA 5TH2B 4PJGF 4XC1L 5KANI 1LO4H 4NYLB 2FZ3A 1NBVL 5ENWB 1OLLA 4CBZA 3L3IA 1NL0H 3V9FA 1JG9A 2EKSA 4WIQA 7TAAA 4XNUL 3AQDA 3TO4D 3QEQB 1SEBA 3EFOA 4QLRA 4YK4C 4MD0A 5AL0A 3FTUA 4NUJA 2R56L 3CFNA 2NY5L 1A3RL 4OAWB 4B0MB 2HJFA 4P4KB 2WUBH 3EDDA 4P46C 1G6RH 1NPJA 1JAEA 1EK3A 1WZKA 3ASWA 2DMKA 1IFHH 1UZ8B 4MQSB 4GRMA 2C34A 3V52H 5G4MA 2EUZA 4W9DC 1E5CA 5AVVB 2FEDC 2EAEA 2WTPA 4PIBA 4H8WH 5B1JC 1U91B 4URKA 1XH1A 2X0UA 3BIKA 2ZUYA 4PUBL 3P4MA 1PAMA 2A1WL 3B8YA 5F9WC 4NQDE 4BZ2A 4NHUA 4Q2ZB 2PO6C 3E9TA 1N59B 4POZD 1CFBA 2E4FA 2YRLA 4GOSA 2QKSA 1IGMH 4DKAA 1KCVL 2J7LA 1VF5C 1L6XA 3IAQA 3Q1EA 1KB5L 4YWGL 3IRCA 1KLUB 1SRDA 4G7VL 2BP0A 1BVLB 1X4ZA 3ARDD 3P30H 5CEZH 2R0KL 5F7BA 4XOCA 4Q8BA 4BRVA 1I3UA 3ARBA 4APQC 4FQHA 4LSRL 2FVNA 4GSXA 4WUUD 4H13C 4P2RE 4RISH 4WW2B 4LZKA 3LB6C 4FQ2L 3EYOB 2P45B 4IU3B 5ANHA 1MFBL 2AI0H 2HWZH 4TNFA 3VD3A 1MW0A 1UHVA 4MD4B 1MIEH 3BZFB 5KOMC 3RZWA 1U4FA 2C26A 2W88A 4G6ML 2X53A 4YHPB 5EBMA 4HQQL 4HLZG 4Y4HB 2FYVA 1T80A 5F7AA 4K71C 4QRRB 3MODL 1F5WA 3PFQA 3CDYA 5HHQA 3SPVA 3STBA 3DX2A 3O3AB 4HWZA 2DQIH 5BRZE 4PJ5D 1FL3B 1IX2A 2AITA 3P69A 2EH7H 5TPWL 3ARVA 2WJ7A 2WQ8A 5GGVY 1DN2A 5EZOH 3CUPB 1ZAGA 2CH8A 4HHGA 5JYLA 4J12A 1H3GA 2GBVA 4ODWB 4J5VA 1K3IA 3DSNA 4E41D 1JF5A 4DUWA 4FTVA 3MA7B 3GO1L 2GC7C 2NX5E 1MFCH 2FJHB 2P5WE 3D18A 3NH7H 4YS4A 3MBXH 3O6LL 4M1DH 5DO2C 3WE6A 2R29H 3CH8A 4WEUD 3CZSA 3S3BB 5GZOD 1I1YB 3PGCB 3PPSA 1LEIB 4OFKA 2EVIA 3LIZH 3ULSB 2J21A 3QEGL 5LBSA 5DRXB 4U2ZA 3T3PB 2FNWA 3SQRA 4HMDA 3BH9B 3O3UN 4WW1B 2AEIT 1BWWA 1OE2A 3T0XA 1D6EA 4U1JA 1XSOA 2QQNH 2BZ7A 4PB0L 4Q52A 5E1GA 1LWHA 1E8XA 1GGCH 3AXLB 3MO1B 2BMKA 3OAUH 4JGUA 5KZCD 4AITA 3QNZA 3BWSA 3DOSA 5BMFH 5F7UA 1Q0EA 4Z95H 1QWUA 2AV1A 3QJFB 2BWIA 1WF5A 3JTBA 3M1CA 1UD2A 1SGKA 3MRBA 5FA3A 3F8UB 5INDB 5D96C 2DYRB 1M3JA 2MRYA 4QXTA 4LU5L 1HE8A 3FCBA 2EDEA 1UM4H 4MQXD 2QMJA 2NUTA 4B9KC 4L9LB 4JO3H 3PNRB 3EZJB 3FQ1A 5KVEE 3CZUB 2DJMA 5ES4B 1YPZB 2IEPA 3DX9B 4HT1H 4M7JH 3RIKA 1E28A 4MTMA 3RAJH 2JTDA 1FSKB 4KHXH 3SEPA 3ZDZB 5I1DA 1KTDB 4QO1A 4KJYA 4NRZB 4WRLA 2ETWA 1AG0A 3WMSA 3O4OC 2QGDA 5DT1H 5EHFA 5T3XE 4MA3B 1BQLL 4FFZH 5C0GB 4GXUN 3ZRFC 4PWKA 3IFNL 3VXMD 2VXTH 5TJWK 2GTWA 3I6KA 4O2EA 1OSZB 3NQKA 3TBTB 3RDTA 2DIEA 2YD1A 3MFFB 1CR9L 3G5ZB 2Q7YB 5B39B 5AG9A 1HEZB 2XV2A 2A9CA 1EFXB 1LMIA 2HPOA 2HLAB 3CN1A 4ABUA 5D1QB 1M1XB 1ROCA 2E9JA 1DBKL 4C56B 2EACA 2EDDA 1ZWIA 3RGBA 4LSQH 3VFMB 3VXSA 1KFGA 3FTWA 2YAHA 1AOZA 4XH2A 1TYRA 3G5VB 1LNUB 3GMNB 1JCVA 1QHPA 2VMJA 3KGSA 4EOWL 2DI7A 2VWEC 2JIXA 2F68X 3WY1A 2FAUA 2VDRB 3I6SA 2ADYA 1G43A 2HXAA 3UTTD 3HJ0A 1O7VA 2KI6A 5EBLA 4OF8A 5CLYA 1EJFA 3BSHA 4OJYA 3S8GB 1O0VA 1S6NA 2X4PB 4M56A 2DL9A 2EVJA 5IMMB 4FF9A 3PV6A 1K4DB 3U2JA 4A63A 1BQLH 2DWXA 4ALAC 5IV2B 4AQEB 3TL5A 1RU9L 2YGQA 5IW6A 4OGZA 3IN0A 1GGYA 4V2CB 2V7HB 3W9DB 4HYTB 1AXSA 2Y0SA 3V6FB 3RWJB 3HMWH 4OLZH 2NTFA 3KM1A 4RGOH 4PJ7F 4J3BA 1MNNA 3O2DL 4YX2H 1T0PB 2X4TA 1R3IL 1TFHA 1EQWA 2BSEA 1RP9A 3JV0A 5FO9A 3MJ7A 2JQAA 2SEBA 5D6DC 1T0MB 2PPFA 2WSKA 3H2PA 4UIKL 3ABKB 3GKZA 3IFPB 1O7DE 4D0CA 4YXLL 2NNAA 4QWWD 1KIRB 5JW3L 3N1MC 1KGUA 2Z1PA 2X4OA 4U1GC 4EN3D 15C8L 2G9KA 2BFVH 1FI8C 3NIDE 4IRJD 2OI9C 4IU2B 1PZBA 1GVIA 4YBLC 3HI1A 3TFBA 5EEVA 1TR7A 4PP1D 1K6QH 1X5GA 2YD4A 4TVPH 4Q58C 4IS6B 4UOW0 5DYOB 3RVXC 4XX1G 1XGTA 4JDVA 1I7UB 3EYQD 3BKYL 1RU9H 1Y07A 2PKDA 3F7VA 2YKLL 3IXTB 3OKNA 5DJ8A 4Y5YA 4H88L 4JKPL 2ZKWA 2A77H 4PGDA 4S0SD 3QCUH 4R0LA 4UDUB 1IGTB 1GW6A 3VXUA 1DBAL 4IRSD 4E9LA 5GSVB 1E6JL 1NBYA 1ZPUA 1HINH 4M62L 5J3HD 2ZX9A 1PLBA 2LU5A 3GYRA 1TXKA 4X4MA 1T66C 2G60H 5E51A 5FGCB 4B9IA 3SDXB 1U3HD 4LSUH 3UMTA 4JO4L 1MNUL 2VXUH 43C9B 3KLQA 1PU0A 2DPKA 1HQ4B 2VH5L 4AZ8A 3BPCB 4FMKA 1IL1A 3GWJA 4A7TA 4P3WA 3OJDB 3VFOA 1FAIH 1WFNA 1M3IA 1GGTA 3NN8A 3RWGA 1PX3A 2JI3A 4CW1B 3DI2B 3Q2VA 3TNNB 1JNJA 3LHPL 2Z4QB 5KBKA 1BHGA 4AT6B 5F89B 3P0GB 2MOGA 1FFTB 2QQKL 4R5VA 4WV1A 5ACZA 4GFXA 2J8UF 2CR0A 3FBKA 3F85A 2H1XA 3UX9B 4EBQH 4OKDA 5BNXD 1HOCB 5C09D 3BDXA 3CH1A 1BZDA 4HJEA 3SO3B 3P54A 3OMAB 1KTJA 3JVGC 1SJXA 1WA0X 5E1HB 3W2DH 4QNPE 5D7LE 2ARJA 3MRJA 1MCCA 5GJSL 5E6SB 2GKIA 3RBSA 4MA1C 1N68A 2H3NA 3BDYH 5AAMC 4G6FB 2O61B 1IKOP 1DZ0A 3SGKC 2GEEA 1UH3A 4FABL 3HLKA 3P4NA 1FIGL 3V4UH 5DR5H 1OAKH 1HE7A 1ORSB 1BEYH 3RFZC 1CI5A 3GLAA 1Q94A 1W91A 5D2NB 1OM3L 1NGWB 4FG2A 1J9QA 1FFNA 1FG9C 1RUQL 1Y6NR 3PRZA 3N3EA 2QZ5A 5T1KB 5I30L 1A6AB 3UZVB 3VH8G 1BD2B 1YEFL 3SCMA 5E23A 5DHMC 3HE6C 4M5ZL 1MCRA 1MQKH 1T20A 2ALAA 2AW2A 4RZCB 5A7BA 3WKYA 1T89A 4L3AA 4OLXH 2XXFA 4KVCH 5C2BL 3QDJB 1BFVL 3QAQA 1AXTL 4UT9A 2Z64C 2BHYA 3SE8L 5TE7H 5DJCA 3F6LA 1HXYB 3GDCA 4OBSA 3OWRA 1RPKA 2OYKA 1ZS8A 2YQ2A 3HNTL 4UNUA 1MH5B 1MDTA 3OKEA 5J8OA 3T4AB 3TA3A 1WJ3A 4DKFL 5E4AA 2GTZB 4FFYH 3GRWA 5KYYB 3BI9X 2VDRH 4PJBE 4KQ3H 4X9FA 1MWAA 1NMBL 2FSEA 3L5XH 5E0FA 2XIBA 4Z3HA 5I16B 4HWEL 2DQEL 5KBDA 4MXWL 2Q8AH 4Y9EA 1AR1C 5KYWB 1E6OH 1SBSL 1K2DA 3POHA 1PZ5B 4JFWA 4BSVA 5BJTB 4QLWA 1RZIB 5DLML 5MEND 4YDKL 1EHKB 2VDQB 5AEAA 2G75A 2IADB 4LGRB 3QJTB 5F9OL 3S88H 2W0FA 1JNNH 2E7CA 1QR1A 3DV6A 4HP5A 1R3KB 1YA5A 4N68A 1TPXB 3MZTA 1BFTA 4KH2A 4XNXL 1HNYA 3GEFA 3P9MB 4UV4L 3WAKA 2YWZA 4EUPB 5I1JL 1UWGL 4MASA 1JFQL 5JW4N 2JK5B 5L2JA 2NY3C 4Z77B 3US9A 1FYTD 3OGCB 4WWKD 3WJLA 3UTZB 1ZVYA 1UQSB 5AD0A 1NA8A 1BW8A 3X12B 2Y5QA 3WLWC 1Q1JH 2BM3A 4IKNA 1RXLA 2HAZA 3PXJA 4OUUB 5BQ7A 5CINH 5LO7A 5HYSA 1GYAA 2ZKXA 5SWSA 3B2XA 1U21A 1TZGH 1QSFB 3O3BB 1BOYA 5B1BB 4YSTA 4HA1A 1KLGB 1NMBH 3NCFB 5E00B 3HRZA 3AROA 2YD9A 1ZHKB 5D2LE 3SODB 1QO3A 1FZMB 1RJYA 4WJKB 2X2UA 4PBDA 5DJXB 1FUNA 1ANUA 3FO1A 5HDBE 4P5MB 2YMTA 3S3DB 2XIDA 2WKOF 3M1BB 5IP4A 2GK0A 4PG2A 5DJ6B 3H3PH 1SJVA 1S3KH 2WXMA 1MCOL 4JL2A 1ID2A 2LE9A 1N0XL 4YXKL 3X1BA 4G1EA 5G55A 4Z7OF 3TYGL 1ZDQA 3MREB 3RKPA 4JFOB 1JHKL 2ODHA 5I0VA 3UABA 1WYJA 1JFQH 3QO0A 4KDTA 3QUXA 4XBEL 5EU3A 1OQXA 1I9EA 3PABA 1C12A 1A4JA 4V11A 3FO9B 5F7DA 3KPQA 1UC6A 4WI2A 2RMNA 4LCWA 4AGQA 5SWZE 1KXVC 3MHZA 3AREC 2Y22A 5C0IA 4NO0A 4P23D 2Q0ZX 3HC0B 5EOQH 5I1HL 4X98B 3ULUC 2WXOA 4FLOA 1SLUA 5KUMA 3KDPB 2VZOA 2EYTA 3DXAD 2AKRA 1GRWA 4EAEA 1MFMA 1FLRH 3FFCE 3T9WA 4UT6L 2M8XA 3O11B 1XEUA 4S1QL 1QPKA 3AVEA 5FLVA 3FU0A 4PRID 2DQHL 1A5FH 2LAGB 1U6AH 3BWUC 3QAZB 1T0NA 4JKWA 1PD1A 3PHOA 5TQ2H 1IQDB 3NIGF 4Y88A 4KKNA 1NOFA 2UY7A 4X5XB 1NGYA 4NGHL 2ZXBA 3QZMA 2VXSL 3EG9B 3P1VA 4KRMB 1UA3A 4ZD3L 3QJRB 2VDKL 5IMOA 4CILA 2IV8A 3LQAC 5BVJA 3FO0H 2UWEF 5IVXA 4ADIA 2BFGA 3W9EA 4IIQB 1CBJA 3VXQA 4DP9X 1YNLH 3NCJL 1BG1A 2ZYRA 3DLQR 3MNWA 4ICXA 2LABA 3QPQC 3A0OA 3QNYB 5EWIH 5L8JB 1JYWA 4ZAKD 4R5XA 4AIXA 1WBXB 4PWGA 1HZHH 2R9HC 3VWKC 1DQDL 1TFPA 1BYNA 4JJHA 4EIZC 4FXGB 3BXNA 5GGTH 4CSTA 5CGTA 2P24A 1Z9LA 1JUFA 2KDYA 1E65A 4BKTC 4FC3E 4YVUA 4EIBA 4LVNB 1CLZH 1LYQA 3CSBA 4OZHF 5HHPB 4S1QH 2L8AA 1V3MA 2DQHH 3O4LA 1GSMA 2V9TA 2OZNA 5BO1H 3UXFA 2PLTA 3BUQA 5C07B 1UADC 3IPFA 2X4UB 3KPMA 3H3KA 3WXVH 4JR9H 4U4BA 1NSNL 3SE6A 1OSEA 1F4XH 4AG4L 3GXUB 3PAZA 2NYYD 1G9EA 3A5VA 4ZD3H 3EHBD 5C1MB 2OSXA 3Q6FB 1BFOA 4WI7A 5D71H 4MDRA 2QKIC 2VM4A 1AQKH 4PJDE 4ES8A 3CX2A 1BVNT 3BAEH 1YAZA 2C3VA 3ALPA 1AI1H 4HXAL 3ECWA 4B9CA 1ZY9A 4BZ2L 1NFDE 3DDFA 3WCYA 2R0LL 3M45A 1J8RA 3P73B 5EU6A 3RWEA 1JDDA 4OUOA 4YSSA 1MFVA 1J0JA 3QJXA 4QJ5B 2NMSA 3QUMB 1F4AA 3IWUA 3KM2A 2VC2B 1RULL 5A2JH 2B1AL 2VDQH 3W38A 5HGHA 4BHUI 1JL8A 3NACH 4HIIB 5KW9L 4YSCA 1ZOXA 1DQKA 2IAAC 3LXBA 5KANG 1MREL 4LE8A 1T6BX 3CVBA 3ZRSA 3AUWB 3WUWA 1JPSL 4EUPH 3IFOA 2EDWA 2EE9A 1CICB 3SOBL 5H2BB 1DQVA 1YEIL 2WNWA 2JJVA 3K6FA 5FO8A 4HKJA 1OO2A 1Z32X 3U9WA 4GH7B 3T6QC 5GRVL 5GQBA 2DWEA 5CD3B 3DK2A 3SDDC 3IPBA 2HH0L 2IDUA 2X4QB 5CLXA 5FCUH 2EIJB 2YAQA 4XNZC 3V6ZB 2NY4D 1IKFH 2V5MA 2BOBB 4D9RE 4L8BB 4YSEA 5MERB 2NQ3A 1G7IB 4WJ5A 5E2VL 3T0EB 2UXGA 2W60A 2CGRH 3ML9A 5AW0B 1J5CA 3EIFA 2H0PA 1I8LA 1RZ7H 3D25B 5DUPH 1HWWA 2VLRB 3B9AA 3BT0A 1K8DA 4AVJA 3HG1E 3EJZD 4N9GA 2IPKB 3FB7B 4NKDA 1FRGL 4MJ5B 4LOUD 2OZ4A 1TQBC 3ARFA 5D1ZC 1TO5A 2HX7A 5C7ZA 1JK9A 2K3TA 3B9KC 1LO2H 1KN2H 1PKQA 5H37A 3UP1A 2CR6A 3WD5H 1MJ7H 2K9FB 5I5IA 3QIUA 2ICWB 4ZS7L 2IXQB 3ROOA 2ED6A 1EXUA 5E2TH 5LBSL 1A7OH 2H1PH 4ZRGA 1S9YB 1XGRB 2YGOA 3GJFB 4BKLA 4XCYB 5HGBB 1YEIH 4YDJA 5C08D 2ZXEB 1GS6X 1EUTA 1XGPA 4NAQA 1IT9L 1KGJA 3WMPA 3DMMD 5HPMA 4MDIB 5KSAB 3LKPB 5CILL 1B0RB 3L9RA 2YGVA 3FH7A 3F5WB 2JWYA 4X6CF 3ZDYB 4ODSH 3K72B 3K5SA 3VA6A 3ET9F 3OSVA 3TT1H 1TVHA 3G6AA 2CM6A 2VLJE 3C60D 4HH8A 4JFDA 4HISA 3CSYA 3HI5H 4LSSH 5BS0B 1RZ8B 1KSRA 3TTYA 1UZ6F 4PJCE 5EOCJ 5DVMA 3ARTA 1A7RH 2VL5A 2NT1A 4G8AC 1ZSDA 3KBEA 4FI6A 4KOCA 1J48A 4KQ0A 3B7RL 5GS0D 4Q6IA 2MPVA 1GC1L 2AABH 4N1CA 2BRRL 3BESR 4C57C 1F2XK 3S3JA 1GYWA 4LESA 1I7TA 1R4XA 4ETQB 3L45A 5FYKE 1IGJB 2VR7A 3NFNA 1A21A 2VRAA 1QKZL 2PW1A 2Z0BA 3PFUA 5T1LD 2V37A 2VIRB 2J6EL 4EXKA 1BDYA 2BP8B 2XN9E 1F4HA 3CPLB 3BVVA 5C0DB 2A0LC 4GP8B 3WNIA 4AYID 2G3NA 2ZX7A 4ZTEA 3MRGB 2XWCA 3FCTB 5JHDD 3ILDA 1V8HA 2DKSA 2YUVA 4PJ9A 1CLOH 4OZFB 2MNWA 5D9SA 3VM7A 1VJSA 1T7WA 1S3RA 2VDLB 3H85A 1DJWA 1E5ZA 4CUCA 3HE7A 3VFRA 4OM1L 2R23B 2FLMA 4X0KA 1RMFL 3ZN6A 4FA7B 1EZSA 1P1ZA 2HKAA 4PR5A 4LLQB 4A2LA 4GKLA 1WICA 4XP5L 2F5AL 1L5GB 2VLLA 3TWCL 5F88A 2A74C 1SLWA 4Z7VF 3ARQA 3QQ9D 4QOKE 2ZUQC 3SJVA 2HFFB 3GTVA 5DGRA 1H15B 1MN4A 1KENH 1PAZA 2ZOLA 4L5FL 2V2TA 3VUAA 1NCBH 3K71A 1D5BA 5EPMB 4FE9A 1OSPH 1WWBX 4OSUH 1KWGA 4E5XA 1L0YA 3MOBL 2OMVB 4JQIH 1G87A 1OGAD 4I87A 4NQDA 5E6IC 4Z3GA 4ZQTA 3IVKA 4JANB 4M1GL 3SQOH 3CC5A 3EFDH 4AKOA 2F18A 1J1OL 4AUJA 3FF8A 1KCLA 3MCG1 5DQJB 4NNXA 2DKMA 5HVGB 4FEIA 3BIBX 4N5EC 2GQHA 4PD4J 2IPTL 3RGVA 3BISA 1YAIA 3E3QE 5CMAB 2MIZA 4BGDA 2CDGB 5HJDA 1Z3GL 4WFGD 4QRPE 3HA0A 4WDIB 5D5MB 4WI4A 4OZIA 1F97A 3NRFA 3JWNH 3IAPA 4P5TD 3BP6A 4P2RA 3QUMH 2AAAA 2GUOA 2JMRA 4A2FA 2ZYSA 2VC2H 2B3IA 3OKMA 2I9TA 5B38B 1G6VK 2F54E 1SF3A 3UBXI 3W5NA 1S5IL 1DJXA 1PD0A 2GCYB 3O9WD 4JHUA 4OGAD 1NDMA 4KNTA 1BREA 3LKQB 2YPVH 1HQRA 4JHWL 1O6SB 4XP4L 1XGQB 5TF0A 3AG1B 1UOKA 4JHAL 3JWOC 4LCCB 4K8RC 4OD1L 1IV8A 3PWNA 2EXTA 4Q4EA 1BQSA 1ND0B 3BUTA 1Y6KR 3OLIA 4LPYA 4X6FB 5BRZA 5I15H 1ASPA 3K3QA 4IKKA 4FFTA 2UZPA 5F7YC 2B0SH 3VWJA 4A2HA 1X5YA 4ZTOL 3FU8A 4XOAA 5E4EC 2OULB 3HZMA 2J1WA 2VITA 3VGFA 3NA4A 2VKXA 3TBSA 5KVDH 1MLBA 3CIQA 1M7DB 5DUBB 3AG4B 4K3JL 3TONA 2NX5A 3ESMA 4WU5B 3MJGX 5ADPL 3DURB 2CALA 4E9QA 1MW3A 1YC7A 2DLGA 2GB2A 1CD8A 1JPGA 3P02A 2LLGA 2V7NA 3GSXA 3R19A 4A7GA 3H9SD 4NKQB 1JI2A 5E1AA 3SYCA 2IH1B 3C6LC 3MXWL 5EH1A 2VSCA 1LD9B 4XMKL 5JPMB 2KC0A 2IGLA 4H4NA 4WKZA 2C3XA 3EO0B 4CA4A 3H54A 4FFVC 4JO8A 5JOFA 1I3RA 2CZNA 1XF1A 4CL7A 1RERA 4DEPC 2YWYA 4LIQE 4JFXB 5JOEA 3QFDA 4XMLL 3ZJAA 3RA7L 1KYFA 3FYIB 3GJFH 3F65A 3IJEA 3NA9H 3HZYA 4S1RH 5IJBC 4JN2B 4BSWA 1P9MC 4N8PA 2GBUA 2LV4A 3L48A 3M86A 3QI9A 4HGMA 3HUJF 2HFEB 5BZZA 1BIIA 2CG9X 4I88A 1Q4NX 1SYVB 4DHLA 4AGMA 2VZTA 1CK0L 1R3JB 3QWQB 4J7RA 1YDPB 3U0WL 2CR3A 4AGOA 5ADPH 1VGEL 4JQVC 4YGVA 1HH6B 3LNEA 5BZDB 3ARBD 4N8VB 1JPFA 2I60L 2MQCA 1R24A 1PD6A 1UA6L 2X44D 2QPEB 3NIGB 3S5LA 4HEPA 2Y1YA 3D8MA 4HEME 1XIWB 1PQZA 4WW2A 2CK2A 3L8QA 3EYOA 1OB1A 2AEPH 4Y1AB 2J5WA 1TLMA 4S0TD 2IAMB 4YSOA 3BZFA 2GJRA 3UAJC 4YMPA 3O2VL 3QZWB 4K23H 3CFJA 5HHOE 1FWXA 5F9DC 3FUNA 1BZQK 3BVTA 5KN5A 1L9MA 3ML8A 4J23A 1QACA 1VESA 4RQQA 1IEBB 3WN5A 1DDHA 2ZJSH 4UT9L 4PRBA 4OZFH 1XWVA 4FTVD 3CUPA 5GIRB 1J1XH 2DKUA 1WLHA 5IMKB 2IOIA 2VDLH 1P5UB 1F1GA 1IIKA 1J05A 1MJJB 2WXGA 5BW7C 4HWBH 3MA7A 3SDAC 4OZHB 1UM5H 2Y1ZA 1PZSA 3TVMA 5MEQA 2OTWB 2ITCA 5AB9A 3NCCB 2FHCA 2DQTL 3Q8BA 3GRWL 4PRPB 2G4GA 4M7KL 4G72B 1MWAL 1UXWA 1KCUH 1YCSA 3X3GL 1ETJA 4PJAE 1Z7JA 1E50A 5TE4H 3P0YH 1EBPA 4IW4C 1AO7B 4Q9QH 3A67L 3D39A 3VI3F 1FH2A 1G7HA 1RD6A 4CN4A 3BT2H 1DLHA 4DPBX 5IB1B 1EBAA 1G7QB 5CP7B 1JXJA 4Z7OE 1F86A 2V0AA 4DNLA 1KELL 2NY2B 2OTUA 4JVUA 1SJEB 2LLLA 5I75C 4BZ1A 3V4LA 2X7LB 1U58A 4LCYB 3FU5A 3U7YL 1I7RA 4LOFA 3QYCA 5ECJE 4JDZA 2OMTA 2B15A 4ZMTA 2WXQA 3TLRA 3R7RA 5EA0H 1MI5A 3EYUH 3I2CH 3QUKA 3CXHK 2YSTA 5D72H 5C7XH 1V7NL 5TE6L 2GAZB 4L8CB 2ZPKL 4JY6B 1F11A 3A4DA 2HTKD 4CDGC 3F2LA 4JREC 4OLUL 3E2HB 4JFTA 4FERA 3QR1A 5DD3H 5ALCH 3SE9H 1YMMB 1RZFL 1GZPA 1HHHB 3OKOA 4J8RB 4U1KA 4OIIL 5LG1A 3NCYS 1A1NA 1GAFH 3ULVC 2DQTH 3BZEA 3BWAB 4PJIB 2EEXA 4ZNEE 4L3EE 4UTCA 2R8SL 1WWCA 2H6PB 4AGPA 1TQCC 4F2ME 3HAEG 2AS5M 3ZL4H 2BS71 4TM9A 3RDTD 3DV4A 4KOBA 1L9SA 4MGXA 5DJ0A 4XPTH 4BK5C 4IOIA 3ESNA 3D7PA 4FQQA 4LBEB 5TDNA 3TEWA 4HIPA 5B39A 3VTMA 2E0PA 1EFXA 3LKSB 4X6BA 5HJBA 3T0BA 3VXSD 2APFA 4MNGB 4G7YH 1A9EA 4ZPTA 1AP2B 1OAUL 4XAWL 1I1CA 3MUUA 4YHYB 1ZCRA 3CQPA 3M1OA 3MU3A 5TTRA 1UZGA 1HNGA 1GOFA 4BKSC 2JIXD 2P5EB 1P2CB 3HZVB 4KDWA 4NQCE 3GRBA 4KMTL 3HEIB 3Q9QA 5HHXL 4CNIB 2QADC 4FFYA 4A38A 3LMJL 4WO4D 1Q9OB 3HPLB 3V5KB 5E24E 4YXHL 5JIQA 3EF7A 3MLWL 2VR5A 3NRPA 2XVKA 1JE6A 2CO6A 2XWZA 3EFFA 2JJSA 4MMYB 3SQBB 5L2KB 3K1KC 2Q5BA 3DUUB 3OKLB 4HPHA 4U6VL 3B2UD 4DQAA 3BUYB 2Y25A 5DA4A 2EUXA 4NFBA 5CLZA 2QMKA 4FMFA 3SKMB 1UWEH 2YRBA 2A99A 4R4ND 4QHNB 1TOXA 1MFEL 5DMYA 4MAUL 4OZGF 5I1GL 1ZT1B 4PRNB 1D5XB 1DUYA 3O6FC 3R0NA 5D7LA 2BSED 3DOIA 3KPNB 3V2AR 2X9WA 3KLDA 3LEYH 5E94B 2BSTA 3B7TA 3N50A 5I19L 3D2TA 1FL5B 4DO5A 1YN6A 1CBVL 2NW3A 4P2QE 1UM6L 4M7LT 4UOQA 5JMOC 2I9LB 1UB5A 2AJ3B 1O5PA 1QA9B 4HOWA 4C4UA 5LXGL 4IRZH 5J1AB 1ZLVK 4XX5A 1CXKA 1FDLH 2KPWA 3QIWC 1BJMA 3GNML 3EF4A 1EAPB 3IMSA 1ASQA 3MX0B 3OLGA 1NDTA 1W8NA 2YA2A 4A2MA 4EDXB 4OD3L 3ZX1A 1SM3L 4F33A 35C8H 3AU1A 1CURA 3D0AA 2C5DC 5EIIG 3ZYIA 4QHPA 1JPTH 1CDGA 1MHHA 3BHBA 3TC9A 4Y4KD 2XBTA 3G6JA 4GSDL 2LQRA 3U2SB 4WGWB 4GIAA 1YMHA 3SPGA 4DK6A 1D5ZA 5IWLA 1N70A 2RBLA 4MAUH 2BIMA 1IGTA 3NCXA 4GBXC 1ZGLA 2J56A 1WFJA 2C1PB 4R90L 2FYYA 4E0RA 4PJBA 3DHPA 2WMPA 2D0HA 12E8H 1EDYA 4X6DB 4CU8A 1HL8A 4F5CA 4TNVK 4LGSB 2A6KA 1FZJB 1XF4B 2KDGA 4U1HB 2WLJA 4TL4A 2CIIB 1BZ9A 1NAMB 3MRMB 1JBJA 2Q76A 3OKDA 2Y36H 2FNBA 2F7PA 5AYTA 1HQ4A 5CUSL 3HI6L 4MXVF 3NPSB 1X7QB 2VSMB 3ZUNC 4PWFA 2CJSA 2XQYG 4BFFA 1FNEA 3H3BC 3CBKB 1WTLA 3FT2A 3PY9A 3QW9A 4KJQD 1HKLL 2WGXA 4KO5A 4PV8A 2JE8A 3PIQB 1P7KA 2UZXB 1R3LB 4OFYD 4OR1A 1JHLL 3TJHD 5KSVA 2NXZD 3FQXB 2BVQA 5IY5B 3L2MA 4OFIA 3P9LA 3RTQB 4DAGL 1NGXB 5D4JA 5F3HA 4L48A 4N25A 5HD8C 2AQTA 3RZCC 3J7HA 3WIHL 2VOTA 4F80A 1FVDB 1DJHA 4I3RL 1NCNA