1F56A

Spinach plantacyanin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'AVYNIGWSFNVNGARGKSFRAGDVLVFKYIKGQHNVVAVNGRGYASCSAPRGARTYSSGQDRIKLTRGQNYFICSFPGHCGGGMKIAINAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLANTACYANIN
publication title Crystal structure of plantacyanin, a basic blue cupredoxin from spinach.
pubmed doi rcsb
molecule tags Plant protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02298 Cu_bind_like Plastocyanin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1f56A00
2GHZA 5AFAA 1J9QA 2XXFA 4YSAA 2FTAA 1OCOB 1CYXA 1PNDA 2X88A 1JERA 2Y69B 5I5MA 4WTQA 2IDUA 2MTAA 1RZQA 4F7KA 1BQKA 3FS9A 2WO2B 4NAJA 4HCFA 2XV2A 1WAEA 1ET5A 2OJ1A 3OM3B 2PP8A 1OE3A 3H56A 2VM3A 1NWOA 2HLEB 4UAHA 1L9RA 1HAUA 2X87A 3DIVA 4A68A 4BDVA 2IWFA 1NTDA 4E9YA 1J5CA 1AACA 5EHFA 1ZIBA 1F56A 4HHWA 4DP2X 3N55A 3WI9A 1OCCB 1A4BA 4G72B 3PCYA 1CUOA 2DY2A 4TXVB 1KCWA 4A66A 4DPCX 4ENZA 2YAPA 4RH4A 2GIMA 2J55A 1BXAA 2IDFA 1WS7A 1TEGA 1V10A 2DYRB 1ZV2A 2PPAA 2IDTA 2BP8A 4W9ZA 2XX1A 7PAZA 1X9RA 4GYBA 1HAWA 1AOZA 1RZPA 3EH4B 1ASPA 5F7AA 4AKOA 1AG6A 3X1GA 5F7BA 2J5WA 1JZJA 5D4JA 1PLCA 4KNSA 1DYZA 1B3IA 2VW6A 4YL4A 1SDDA 3IBOA 3QPKA 4AKQA 3HEIB 2OCCB 3QJQB 4YSRA 1BQRA 1OE1A 4YSDA 5D4IA 3FPXA 5PCYA 2UXFA 4DPAX 4E9VA 4E9TA 3QJSB 3SQRA 1E5YA 1MG2C 1R1CA 3X1EA 4HZ1A 1SF3A 4KNTA 1KBWA 3NP4A 3X2QB 2DWSA 2DV6A 1KCBA 4E9RA 2NRDA 4JHVA 3FYEB 3NJNA 2IH8A 5B3SB 1A4AA 2WSDA 3ERXA 5I26A 1AAJA 3AG1B 4BK5C 1PZBA 2PP9A 3U25A 3FU9A 3FQYA 3S3CB 1E67A 2FJSA 4M4RB 3ASNB 5TK2A 3RYMA 2AANA 4P5SA 2GC4C 1ASQA 2ZXWB 3IEAA 2AVFA 2MRYA 3FPYA 3AW5A 5IY5B 3TA4D 5I6MA 3FT0A 4KO6A 4HIPA 1NICA 2N0MA 1A4CA 2EIKB 8PAZA 2XV0A 2VW4A 2YAOA 3FQ2A 3TASA 1PF3A 2GC7C 1OCZB 3QJTB 1EZLA 2QDVA 2W88A 4PCYA 2IH9A 1WA2X 3EHBB 3TBCA 4GY4A 2VMJA 4KNUA 2R7EA 2P80D 3ABKB 3FU8A 3NSDA 3FU7A 2FT7A 2VM4A 3DTUB 4GP5B 4E9XA 3IE9A 4YVNA 1IC0A 3NJMA 2CBPA 1SFDA 3CVDA 1GYCA 2JXMA 3PAVA 1FWXA 1A8ZA 1JZEA 1AANA 1QNIA 3ASOB 2HX7A 3CVCA 2H3XC 4GP8B 2FQDA 1NPNA 3NT0A 1BQ5A 1CYWA 1BYOA 4N4YB 4MFHA 3FSWA 4AI7A 5I28A 4KO7A 1PLBA 1ADWA 1V55B 4DP8X 2W8CA 1JVOA 1ASOA 5E9NA 3FSVA 2AZUA 2GBAA 2XVBA 4HAKA 3GYRA 4NERA 1IBYA 3OQRA 1L9QA 4BDVB 5I6NA 4A2GA 2ZWNA 1PZCA 1IUZA 2XUWA 3OD3A 2B3IA 2CAKA 3L45A 1E65A 3ZBMA 4YSSA 3T71A 1MZYA 2CCWA 4A2HA 2OV0A 2BWDA 5A7EA 2J57A 3QJRB 1JZGA 3KW8A 3D12B 3S3BB 2BP8B 4KOCA 3NSYA 1ZDSA 4YSQA 4JHUA 4YSPA 2Q5BA 3WIAA 3FQ1A 1J9SA 2E86A 4E9QA 3T6WA 2EINB 5AZUA 3X1FA 1AZRA 1TEFA 2FWLB 4HCGA 2PCYA 1ETJA 3NSCA 4X4KA 2BZCA 1KDIA 1SDDB 2XX0A 1T5KA 1PLAA 2XXGA 4PAZA 3CDZA 5B1KA 2BHFA 3IN2A 4BWUA 1N68A 1NIAA 2XLLA 1NIFA 4QKTA 5B7EA 1JXFA 4ZK8A 2AFNA 1WS8A 3ABMB 1EHKB 1BEXA 3AY2A 2IAAC 9PCYA 1AZNA 1ILUA 5B7MA 1MZZA 4N8UA 3PAZA 3OMIB 1KGYE 4A2EA 1NINA 2TSBA 3ABGA 3QJVB 2HX8A 1AZCA 1MG3C 3G5WA 4G71B 4F2EA 3FYIB 3S8GB 4M3HA 4G70B 3S3DB 5LDUA 4W1TA 3CG8A 1OCRB 1M57B 1SFHA 1YLBB 2GI0A 4CSPA 2BW5A 1VLXA 5I6LA 4DP7X 2VW7A 1QHQA 1V54B 1FFTB 1E5ZA 5PAZA 2HRGA 4AZUA 2H47C 2HXAA 2IWEA 3IN0A 3PXLA 6PAZA 1W6WA 1J9TA 3TU6A 1GS7A 1AQ8A 4DP0X 2CALA 3CZUB 3WG7B 2YAMA 3GXUB 4FAAB 2BP0A 1L9SA 4WKXA 1NWPA 5B7FA 3NJJA 1UATA 1ET7A 1PZAA 3AG3B 1AZUA 1AR1B 1I53A 1GY2A 1GSKA 2R7EB 3FU7B 1TKWA 3AG2B 2PLTA 2YARA 1AS7A 2XWZA 2GSMB 4YSUA 2PPDA 5B1AB 1OOWA 2J56A 1ZDQA 2PPEA 3EH5B 1BXVA 3H4FA 3PLYA 3QQXA 3H4HA 4AX3A 3X1NA 3ZDWA 1JXDA 4UANA 2BWIA 3V9EA 1J9RA 3HB3B 2EIMB 2UX7A 3AZUA 2VSMB 4A67A 1SHWA 5D4HA 1M56B 1M9WA 1W6LA 1BAWA 1N70A 2Y1AA 1RKRA 4GP4B 3UACA 2UXTA 3ZIYA 1AZBA 1SHXA 4EF3A 2PPFA 1X9UA 2FT8A 6PCYA 1NPJA 2JKWA 4G7RB 3PAUA 3OMAB 3BVDB 1CURA 3V9CA 5I5JA 3FSZA 4JKNA 1ILSA 3X1BA 1J5DA 3NJGA 3SBQA 4AKPA 5I5IA 4DPBX 3JT2A 5B1JC 1PNCA 2YQBA 2ZOOA 2GB2A 2YAFA 2PPCA 2BZ7A 1ET8A 1GS8A 4E9SA 1XMEB 1JVLA 3PPSA 4YSTA 4BXVA 1L9TA 1IBZA 3NSFA 1OF0A 4E9WA 3NJHA 1ZPUA 2A3TA 4YVUA 2VSKB 3GDCA 2UXVA 1L9OA 5B1BB 1NIDA 5B1JA 1AS8A 3JTBA 1NDTA 3C75A 2P80A 3N2JA 2HX9A 1XB6A 4GXFA 2XU9A 1QLEB 1GW0A 3CDZB 1BXUA 2BW4A 1URIA 3TBBA 3UGEA 3NYKA 1HFUA 4BWTA 4YSOA 1L9PA 1A3ZA 5I6KA 3SBRA 3QJUB 2EILB 2IDSA 4HCIA 2FT6A 1E30A 4P5RA 1DZ0A 1NZRA 2QDWA 2UXGA 1WA1X 1SNRA 2I85A 4KOBA 2PCFA 2FQEA 2B08A 4KO5A 2LLNA 3WKPA 2UX6A 1BYPA 1NIBA 4DP1X 2HRHA 2BO0A 4CSZA 4YSCA 1AIZA 2Q9OA 4KO9A 4BXSV 5TK4A 2DYSB 1JZFA 1AS6A 4K9JA 3T6VA 4Q8BA 1OV8A 3NP3A 4YSEA 5ANHA 1AG0A 4HALA 3BQVA 3NJLA 2XV3A 3UAEA 1FA4A 2IWKA 2YXWA 3T6ZA 4A2DA 3CVBA 3AG4B 1ID2A 1CC3A 2BP0B 2CJ3A 4BWWA 3UADA 3SBPA 2AZAA 3EH3B 3ABLB 4HHGA 2YAEA 1ZIAA 2WO3B 1MDAA 2HZHA 4FA7B 4UF7C 1SJMA 1JZIA 2IDQA 4F2FA 1XB8A 1OE2A 4DP9X 7PCYA 3S8FB 4DP6X 3NJIA 3EF4A 4NB7A 1PMYA 4DP5X 2ZONA 1SF5A 1KBVA 3ZX1A 2CUAA 5I6OA 1XB3A 1PY0A 3WNJA 5FC9A 2YAHA 2I7OA 2I7SA 1GY1A 2QT6A 1NIEA 3T9WA 2H5UA 1WA0X 1KDJA 1JZHA 3NJFA 2QPDB 1GS6X 2EIJB 2FQFA 1GR7A 2JFCA 2PP7A 4Q89A 2DWTA 2RACA 1PCSA 3WKQA 4G7SB 2QPEB 3NJKA 2XYBA 2YAQA 1A65A 4G7QB 3WNIA 4DP4X 2VN3A 3MX0B 1IKOP 2FNWA 1PAZA 3T6XA 3UABA 3OMNB 1TU2A 3UAAA 1JOIA 1KV7A 3FSAA 2TSAA 2YXVA 2FQGA 4A2FA 1W8EA 5AKRA 1JXGA 4QLWA 5I6PA 3DKHA 3KW7A 1RCYA 1KYAA 3MBWB 4L0PB
chains in the Genus database with same CATH superfamily
2C8NA 3S5YA 1E9QA 2NY1B 2G9KA 2W07A 1JNLL 3KDMA 4F91B 3VDBA 5L2KD 2OQJB 4GS7C 4WTQA 3SKUD 1H3TA 4PJHA 4ICXA 3GI8L 3W0WD 4JRXB 2UZPA 4MYPA 3ZKND 3N43F 3N44B 5FHAH 4PG2C 1RUML 3VCLB 1SY6A 4FN0A 4KV5E 3HZYB 1CD0A 1TTGA 4QXTB 1HVXA 3V6OE 1VFUA 4LF3B 4FXGA 4HXAL 5SWSA 1B0WA 3BEVA 4PRPE 2BY0A 3VI3E 2A77H 2ZUXA 2NNFA 4NCC1 1RIHL 5I1CL 4HK3N 1NBCA 1AHWA 2BIIA 3RILA 3VFVB 2QTVA 4FL4B 5D6DC 3CFTA 2KYIA 1VEPA 2DY2A 3PDDA 5T3XE 3JBG7 4FXTA 2GK0B 1QA9B 3AROA 2GIMA 3QIBC 5FS5A 4DGYH 5BJTA 3BH8A 5D7EA 5I2IB 1P6AB 4HJTA 2O6DA 3TS8A 5HHOE 4RIRA 5A6IA 1BEYH 3UP6A 2NXYB 3MOBH 5FA4B 1LVEA 1VFBA 3MLYL 5E4AA 2WXLA 3SJVB 5K5YA 3D2UD 3KBFA 2WTOA 1ZHKB 4L4TB 3OKEB 4WHTB 5IVZB 2KT6A 1JZ6A 3IBOA 2V5SA 2VXQA 5BZWB 4XCFL 3WS6C 4D9RD 3L3OB 4QYOA 3KM2A 1KB5A 3VXOB 5F7KC 3H7LA 3UJIL 3T0DA 4Y4FD 2MWCA 3QI9A 3MO1A 4YNYA 4QAMB 1AGBB 3EGSB 4GW1A 2WSPA 1A7QL 3B3IA 2AK4D 2Q76A 3OR7B 5EU4B 2VMCA 4QTIH 4XOEA 4FLQA 2DV6A 3GTVA 3L5IA 3TFBA 3V6OC 3HC4L 3L7EB 5L4IA 4E5XA 2LLLA 4LOUC 1Y07A 2D2CC 4NJAH 1MNUH 1QVOB 2Y6SD 5DC4B 3LQAL 2EC8A 1EZVX 2XZCL 4LL9A 3V4PB 5DWPA 2FJSA 4F37K 3WKNA 1JGVL 3V6BR 4YE4H 1ED3A 1G9ML 4KKRA 3V4VB 4Y1AD 2R1WA 3FFCB 4X7FC 5JLZA 4ELKA 5GS2H 1CDCA 1D7BA 2OMXA 3D85A 4LOVA 1A6AB 2DQHH 1KCUH 1XZWA 1PG7X 2RIKA 1NAKH 2H3KA 4HIPA 3CBJB 2AABL 4QOKA 3QEUB 1FNAA 2R1YA 3TZVD 1MIEH 5IB5B 4TLKA 1DSYA 4PCYA 5E8NA 5LGKA 1UB6A 2IH9A 5B39G 2UWEB 1RULL 3BN9D 1HE8A 4FZ8L 3H2PA 2YPKB 3O6KL 4M7ZB 3WN5A 5J89A 4YZWA 1P4BH 3QNYA 3T4AB 2CBPA 4PV9A 4R83A 3C5ZA 1QFWH 1IVLA 3NFNB 3ZT7A 5JA9A 2L04A 4WHYG 2QZ5A 2W60B 5DJ2B 5F0MB 4U3SB 1F4AA 4JY6A 4LLWA 1JZEA 1TENA 4FQLH 3VGBA 5J1AA 2PTTA 2WUBL 4ZNEA 2ADIA 5I73B 1OQOA 4XVSH 3VXRD 4EIGB 3TA3A 2AMUA 4OGYH 1OGPA 5IM7A 3ETSA 1GHFL 1HKLL 2Z91A 2ZZUT 3FSWA 3ZL1A 2WXFA 1PLBA 1ADWA 4XP5L 1IM9B 1LWRA 2Z93A 4HDIA 1NA8A 1W9XA 4XVUD 3S97C 3DJTA 4PW4A 1HSAA 3UJJL 3VXNB 1YMME 2APSA 1E4WL 2VR3A 2VSCA 2Z31C 3O2VL 3TT1L 4U0RC 3SCMA 4FE9A 3OQRA 4OBRA 5A2FA 1A9BA 2ILLA 1PSKL 3LN9A 3KLLA 3GSRB 5IHUL 2CK2A 1OKEA 4HMEA 2DWDB 1INEL 2P52A 1OCWH 2VXSL 4X4ZA 1J1XL 5FYJE 3RVUC 1B6UA 4PW9A 3H54A 4QO1A 2NQ3A 4FRWA 2D7MA 4MJID 2IBZY 4EQ3A 3Q06A 5EN3A 1T7WA 4R4FH 4WKZA 1CE1H 4JZNA 1HCVA 1PZ5B 1M05A 1FV1B 4O9HL 3ZTJH 1U8IA 3M86A 5A6MA 3OSVA 3R1GH 4LK4A 4IBSA 4IIQB 4X50A 3JUZA 1E28B 3G5XB 1JCKA 1VPOL 3U6XS 1MPAL 1F4WL 1TEFA 4RISL 2JKXA 3G5ZA 3VSVA 1WC7A 1K5WA 3EW3B 2AV1B 4UINH 1XIWD 3AXIA 5GPRA 4WW2C 8CGTA 2BZCA 2LFGA 3PDOB 4I3GA 1ZLWH 2X4RA 3MLZL 3QPQD 5KAQG 1T0OA 4K3DL 4I0PC 2VLJE 4S10A 1GZPA 4BWUA 2VABB 1AXIB 1D5XB 2CLVB 5AAWA 1SXBA 3V6ZB 4OLXL 5F88A 2BVPA 3QDMA 2YPLD 3DO7A 3CJJA 3P30L 2LLGA 1WLHA 3QZWA 3RPIB 5AVSB 5CSBA 3O6FA 4F27A 3T6QC 4N0YH 3MLWH 2VDRB 5KJRH 4ODTH 3E1ZA 2CJTA 4M93B 3UGXA 2OJEB 5GRYA 2BSSB 5EO0B 3VQLA 3TO2B 3MRHA 4WO4C 2HX8A 3HOGA 1UXSB 3KXFD 3BVNB 35C8L 4G8FB 4G70B 2OMWB 2AV7B 4EXPX 4ALAL 2C4FU 4WTWA 4KBPA 4WDIA 5ERWB 1WHOA 5IMKA 4AE0A 4NZTL 4FQXC 1CTMA 4M9PA 3GMRB 1E5ZA 5D7LA 5FDWB 2X05A 3VWKD 1XF3A 3SBWA 1MJ7L 4XNUL 1XVSA 3X3FL 1JGEB 4NQCE 2J1XA 5JIHA 1MIMH 1QWNA 1X5KA 4ZQKB 1KIUA 5CJOL 3JV0A 3A6CH 1IC7H 3LNIA 3MRPA 4EIUA 2A6IA 2F15A 3ROOB 1QBML 5AG8A 4MMZA 4YFDB 4KKLD 4HV8A 1H5BA 3MLVH 2ICCA 1XDTT 2F54B 4U6XB 2WC7A 1JYNA 1D3CA 4CUCA 5LCVL 2B5IB 2TRYA 4X98B 1CCZA 2V7HA 3ZDZE 4R5VA 4KMTL 3VXUE 4AM0A 2A1WL 5D70H 2JQZA 1EUUA 5BZZA 3RAJH 2VSDA 2V7NA 1HHGB 1NJ9B 2FJGB 2I25N 4NQED 4QY8B 4J6RL 5HHXH 1CLOL 5TQ0L 3WENA 3RWFB 1IQDA 1FDLL 3HB3B 4G6MH 2EIMB 5E5LA 1UYWL 2WNKA 3PWUB 1M9WA 1QWUA 2EADA 1DSFH 2OTWA 2YMTA 5GS0L 1Z32X 4HWZB 3Q5OA 4B27A 4PRBA 3L4CA 4GRWB 2H45A 1XF5A 2EYRA 2I9TA 4OQTL 2X70A 2FX7H 1AE6L 2VDOH 4GSUA 5GGUB 2ZUQB 3RG1C 2ENYA 5EO1A 1D5BA 1LO3L 3FCTA 1CB4A 4CN4A 4F2MB 2GSGB 2P8MB 2QSCH 2WLLB 4WI9A 4OZIE 1UM4H 1TF4A 3QEQD 4P0DA 4WUKL 4K8RH 2B3RA 4QRUB 1WP6A 2IFGA 3INUL 4TVUA 1T04A 3VGEA 1ZA3B 4RMVA 4OSUH 1I7UB 5B38G 4ANUA 5K59E 4C56E 4ELMF 1MHPL 5E5MB 4F3FB 1SLWA 1JK9B 3P4OA 4PV8A 4KQ0A 1H0DA 4UDTA 2N7BA 1E4KC 2O61B 4XNMB 4ZFFA 2GJ6E 5C0GB 3O3AA 5ILTL 3NSFA 5T5NG 1DQDL 2XKUA 5EFIA 1ZPUA 2QELA 3AAZB 3BHBA 5KJ4A 2R69H 2WO4A 5CAYB 4QXVA 2ZSWA 1F41A 4U49A 3NK4A 5DI8A 4BSJA 4GQZA 4GKSB 4PP1C 5BV7H 2IIJA 4S0TD 2YBRA 1ZHNA 3A24A 3APDA 1GSMA 2WVVB 3DETC 1HQ4A 4FNRA 3NEOA 4L8BB 2V33A 3DTXA 1LE5A 2NUPA 1BBJA 4BSWA 2GFBB 3CHPA 5CLTA 4CW1B 2XQ0A 2ICEA 4P5RA 1JGDA 3AXLA 3PV6A 4TUJB 4P2QB 4IJTA 4KUCF 3QIUC 3MGTB 4WRLA 5KTEH 1QZNA 3FN0H 1MCPL 1XCQB 1Z0MA 3D2TA 3Q6FB 4HUXB 4QI3A 4DP1X 4UOJA 2OMUA 5AVTB 5SWQA 3HZKB 4QHLA 5KVGL 4GI6A 1FL5B 1ERNA 3AQYA 1N8OE 2GJRA 2WZPD 2DYSB 1NEZB 2EYSA 3T6VA 1ZGLB 4OUUA 4NUJB 1P4LA 1CR9H 5EBMB 3HG1D 2B1OA 4YSEA 2WLIA 2WXJA 1WVZA 4NIYE 3F7VB 4R2GD 4MBRA 4NQDB 2IQ9L 2B15A 3CMOL 4GRLC 1TT6A 1KIQB 4YHYC 1XR9B 4EI0A 5TE7H 4JRYA 2WO3B 4XCCH 2YD6A 4HK0A 1C5DB 4HGMA 3UTSE 4CU8A 5ITFA 1FYTD 2OW7A 1BMGA 4Z7QB 4KVNL 2A99A 2BS71 2QPSA 3PGCA 4PH8A 3CAFA 2R0ZL 2Z64C 1KBVA 1QD0A 2YRLA 4YIQB 3HBPA 4S1DC 5CM1A 3PWPB 3VJ6A 2RCSL 3T2OA 1YEIH 4LU5L 5LLIC 2OZ4H 4PJBE 1CU4L 1XX9C 4FHBD 4X6DE 3S2CA 4Y2NA 1G6RB 5E8EB 5AOKA 2GJZA 3DX7A 4Y1SA 3OJDB 2VE6A 2G60L 2XWXA 4BRVA 1NGXA 1UEYA 2FQFA 4D8PB 3BZEB 2VXUH 1D5ZA 4HLZG 1UKQA 5CU5A 1XSJA 2CNZA 1MFBH 2UZYB 3QYNA 4TNEA 1KZYA 1RQ5A 1OP5K 3LPPA 3IFLH 4E5XG 5TJWK 1A21A 4LKCB 2FO4B 5DJAB 3QUMA 3K7UA 1PKOA 3FQUA 3ZXAC 2VR6A 3O4LB 1R5VA 5KVEL 2B4CC 2EDHA 3LRKA 3D0AA 2F74B 3K46A 1KYAA 1KZQA 4PRDB 1R0AL 4NCDA 2ADJB 1NGPL 5EOTB 1J9QA 2AAAA 1NCCL 4MB5A 1OCOB 5F1NB 2YS4A 4OU3A 4E42B 3LB6D 1UURA 4L2LA 4TUKL 3WFEH 1J8HA 1DN2A 2CRMA 4I18B 1QKZL 4S1RL 4F7KA 5IOPA 2OYMA 1UKTA 4TVSa 4X7TA 1WAEA 3N0AA 3SKNB 1IBGL 1KCKA 2ENJA 3H56A 1J18A 3DX3A 3GTNA 4TL4A 4GAYB 4P04A 1RP8A 4UNVA 3BP5B 1E9PB 3L3KA 2ITFA 1I1FA 1TZGL 4NP4L 1NFDF 4BDVA 1V3JA 4LVEA 4XWOC 4KUZL 3HPJA 5KJ7E 3N55A 4FKKA 1BQHB 4I87A 5ETUB 4KRPB 3TVMB 5FGSA 2Z9TA 4LVNC 4PJXA 4DPCX 2PYFA 2PW1B 3S36H 3GKZA 4KRNA 3VXSA 4HPOL 3WJJA 3DX6A 1JPGA 5DUPH 1FZJA 1LK2A 4PRID 4H8WL 4QRPA 2FYYA 4N2NA 1TQUA 3MV11 3LIUA 4Q9CA 4LCWD 1HAWA 3GSNA 5KSVA 2DS4A 5FB8B 3P0VL 3S35L 2BMKB 4RZKA 3X1GA 4ELDA 1JZJA 3ECUA 3TLRA 1Y0LA 3C8KA 3CU7A 3VX1A 3WJLA 3AY4C 1B3IA 1MFDL 4DAGL 4BYHA 2CJUH 4XCEA 3HEIB 3VU2A 1SBSL 3RDTD 4NRXB 3CIAA 5BRZA 2BSBA 1DP0A 4ZUUA 3LEVL 4L1HA 4NM4H 4TVPD 3OPZL 1NCAL 4FNLH 2I9LA 2Z7UA 4U1IB 2UXFA 3AQDA 3C60D 1QSFD 2HMIC 1TTAA 3ALPA 1LL1A 1ZTMA 3U6RB 3X1EA 3HE6D 3L3DA 1OF2B 1SOSA 1F8TL 2GTZB 4H40A 4JHVA 3QUYB 1UOKA 2A9BA 2AVGA 1JD9A 3SKMB 3CE1A 5F3FA 4HSQA 1DBKL 3EOBA 3IDNB 5F70A 2BNRD 5H2BA 4XP4L 3SDXB 3UYPB 1PAMA 2K9FB 3E1F1 3ETTA 5FYJU 1JYVA 1MCOH 3KYAA 3U25A 2XWDA 5D1QB 5EEWA 4Z3HA 4IYKA 1PU0A 5CSGA 3K6IA 3ATAA 3QJOA 3PP3H 4CSSA 2ZXWB 4YBQD 2ZX5A 1OZTG 4Z7OB 4F15C 2XKNB 2DD8L 1AR1C 2BC4B 3L6FA 4YO0B 3QZWG 5IY5B 3TBYB 1CICC 1WAAE 3QORC 4TL5A 4J3OD 4O02B 1J0JA 5AW3B 5KYWB 4CADA 4FLHA 3BUIA 1WEJL 2BY2A 3FOLA 4KKBD 1K4DB 1KCRL 4PJ8D 1I8UA 3U4BL 3W38A 1X7QB 4AQAA 4P46B 4TV3A 2F5AH 3T0AA 2W80C 1G6VK 3UG3A 4ODUA 1ZLSH 1N7MH 4IGBA 5ICXA 5F7WC 2OI9B 4E9XA 3IE9A 4P4KB 1SEQL 3GI8H 4JN2B 4ZMYA 3GSWA 3DDGA 3QDGB 4ABUA 4K5NA 3PAVA 1A8ZA 5HXMA 5ALCH 4AC2A 4NWUL 4EDWL 2VQ1B 3VD0A 2PO6C 4U6TA 2H3XC 3OKMB 2G2PA 1IZJA 1BQ5A 1NC2B 2O4EA 1BYOA 4FTVE 3L7FA 1REIA 2E4TA 1BVNT 1DBML 4Y19E 1OD9A 5BOJA 4B53A 4JREB 1LO2L 1QQDB 1MLCA 4GG8B 3LIZA 4IJ3C 4QNPF 4XNBA 1RIHH 4JM2D 3FSVA 3L3IB 2XVBA 2WZ0A 3ZRSA 3U9PH 3EO9L 1IBYA 4Z7VA 3P9MA 4CN1A 2NW2B 4MBOA 2NR6D 4H44C 1T1YB 1QLEH 3EYVA 4W9KC 3UBXI 4RAVB 1Y18A 3L3GB 3TNMB 4KH9A 2R0LH 4AG4L 5HGAA 3FQNA 5ID0B 4LVOB 1S3KL 1P1VA 5D1ZD 4ZPTB 3CVHB 3VFSA 3IU3A 1FP5A 1O7DE 2AEWA 5J3HC 2X2HA 4X5RA 3S4SG 1DE4B 3MLYH 3QFDB 4XH2B 4HJGB 2Q87A 1N0XL 2WINA 3FUMA 2MNUA 5HJDA 3UC2A 4U4IA 2QHRL 2DQGH 4IS6B 4PUBH 5DUJA 3O45B 1HHKB 3QFJE 2GT9B 4HXBH 4UZUA 3UJIH 4E0RB 5EU5A 1ZLWK 4FABL 2ZOWA 3H3PL 2OL3A 4HU2A 4QHNB 5AVWB 5JHMA 2VXVL 3O8XA 3VACA 3Q2CA 1NFIA 1TQCB 1S78D 1OAKH 3VUAA 5IMMB 3WO4B 1CWVA 3HC4H 3N9GL 4UV4H 3WUZA 2FSEA 5B7EA 4AYID 1LWJA 1JXFA 3CFNA 3OXSB 3LQAH 3DWTA 3U2IA 3C6LC 1FZMB 3QA3B 1YPZA 3UC0L 2NLJA 1YA5A 1MJJB 2A0LC 3JV6A 1JGVH 4J3BA 1PY4A 2A74A 1G9MH 2XACC 3R06B 1QPXA 1M7DA 4OCNC 3WAJA 3SODB 5CLXA 5LDUA 5L8JB 5JPNB 3D07A 1B4RA 4OJDH 3P2BA 1CT8B 4XNAA 2JB5L 3PL6C 1O7DC 1L7TL 4HFWB 4HKXA 4WUUA 5CGYC 2AABH 1TVBA 1I4FA 3ISWA 4XHJC 3ZDYB 1OAZH 3UPRA 2J5LC 2JLPA 2J12B 2PWGA 4Q4IA 4JK0D 1XEDA 2XTJB 5MENB 3M88A 4YX2H 1KJMA 1BF8A 2EC9T 1P7BA 1MFEL 5A6LA 3VYPA 5LGHL 1F4XH 1RULH 4FZ8H 3IKKA 4MZ3A 5EEXA 3MRLA 3FSOA 4LLDB 4M7JL 1C16B 3O6KH 2XSKA 5LBGA 2AJSH 3G04A 4EDXB 5GRUH 1RZJL 1CD1A 4H5SA 1UD5A 2OKMA 4ONOA 3SGDH 2VXTH 2DYPA 1NCOA 4WU5A 4AVIA 1HEZA 4X4XB 2JJWA 2AXGB 2ZF9A 2BERA 3OLGA 4MVBC 1MWAH 2WSKA 1A9VA 1KIPA 1BVLA 3FTXA 3MFFA 4Q6IC 3NGBB 1CK0L 3D69B 1TTBA 4IRZL 3UJJH 1WD8A 3X1NA 4UM9D 4DEPC 4U33A 5J12B 3ZYZA 4D0DB 1YEFH 2XZQH 4L9DA 2BJMH 4QHPA 5IB4B 5M7QA 3IMVA 5C86A 3LAFA 2DEYX 1AGEB 5K9OA 2MQ3A 5IHUH 3H9SB 4KTYA 5IW6B 4L0YA 3ORJA 3IMSA 4GP4B 4UT9L 5AVXB 1IILE 2VXSH 3SYQA 4R90L 5CWSA 1SHXA 5ACZB 5KBDA 2LW3A 4LRNL 4Y0GA 4OGQC 3DROB 2FT8A 4KVPA 3U48A 2JKWA 5JIKA 1GIGL 2R1XA 3E38A 2BH0A 3FRPB 2J72A 4X8GA 3MUZ1 3U1SH 5KBPA 2QKIA 4JFEB 3P2TA 1D9KD 2ATKA 5D5MA 3LXCA 5IHZB 1LE9B 5E4OA 2VO5A 1IT9L 4OCRL 5B8CB 1NGQL 3IF1B 5ESVA 1QO3B 3UPAA 3VQ2C 3HN3A 1MPAH 4RISH 1B6DA 4ZYKB 3B43A 5ENWA 2UV3A 1JVLA 4I2XA 1GJIA 3MLZH 3EOAB 4P23B 3CC5B 2DIAA 2DQMA 5L9DL 2D3NA 4PM1A 4K8RC 2JCCF 1AS8A 4HEPA 4DK5A 3QZPA 1NDTA 4LLMB 4Z7NF 4MQXC 1IAOB 2HX9A 5T1LB 3DYPA 4M6ML 2PW2A 5IROC 5I19L 1DL7L 3ZVVA 4CL7A 4G83A 5F0JB 5EOCL 4AEEA 5F89B 4D0CB 4DVBB 3K2UL 2A9AA 2QQLL 4XPBL 5DD6B 3TN0B 4J1UB 1IGCH 3RFZA 1FE8H 2XTSA 2HPOA 2HT3D 5AYQA 1Q4NX 4L4VB 2J25A 4LEBA 1IEAB 3BQUB 3UO8B 5EU6D 5GZOD 1UKSA 3RNKA 1NZRA 2CDFB 2X4QB 4JNXA 35C8H 1OPGL 3NABL 5IB3A 1HHHA 1A4JA 4Y4KA 5JW4N 5L88L 5BV7C 2H32A 3MJ6A 5GRWA 5DS8A 4HOWA 2ZD0A 1UUNA 1DQLH 4E41E 4NZTH 2FDBP 3D3VB 3KAAA 1P7KA 2HRHA 5JPMC 1A3LH 4XNUH 4EUPB 2EIZB 1OTSD 4PRAB 2H1PL 2IH3B 4XNZC 4WGVB 3WO3B 4QT5A 1U91B 1CFTA 2APBA 2BNQA 2VM9A 1QBMH 3ISYA 4JANA 3ZQXA 1ZANL 2FVNA 2NX5D 1SM3H 4HZLB 3GSXB 2LOEA 3CXDH 3S2AA 5JMRA 4AEIL 3P9LA 1KJ2L 3QQ3B 5HHME 1RJZA 3RU8H 4JJ5B 4BFIB 4DUVA 1UJ3C 3VG9C 5GZNA 1KPVB 3APNA 4XCNA 3MN8A 3SBPA 1UWGH 3EH3B 4HHGA 1DVFC 3PV7A 2A1WH 3BGAA 3TCTA 4RGND 3HR5B 2ICWB 3MCLL 5I76B 4RWHA 1FI8C 1JZIA 2IDQA 3HS8A 3OPUA 4TULL 3ARQA 3RDTC 5IFJA 4XO4A 3CH1A 4DP6X 3F2LA 5FYKE 3MRKB 1KXVC 2DEWX 3ULSA 3PFQA 2E9JA 5D9SA 1E9OA 1UYWH 5KYYB 4EI5D 3C87A 4X0KA 3VFUB 1QEWB 1WUZA 2YPVA 3F7KA 3QIWC 4ODWA 4PGCB 4XMPL 1J05B 4CAGA 1I3RB 1XGRA 4APQC 2YAHA 4AMKL 4MXWH 5MI0C 1I8MA 4NKIH 2R2EB 2H5UA 1R3JB 2OMYB 3T2LA 3HC2A 5IZ7A 2DQTL 3ZE2F 3DGCR 2FWUA 2JFCA 1OM3H 4WV1A 4A39A 2E9GA 1LO3H 4RNRA 2RACA 3S34H 4DN4L 2EH8H 2HLAA 2X1QA 3ULVL 1KN2H 2IALA 2VLLA 5F6HJ 2QSTA 2V3FA 3QCTL 4TNWF 5EZJB 2RQ8A 3HN8A 3INUH 5GGQH 1U93A 4LNVA 4L18A 5D72H 4IRJA 4MCMA 2AJZB 4BUGA 4M00A 1JOIA 2BPBA 5A43C 1MHPH 1QYGH 5D2NE 3HAEA 3GPSA 4OCXH 2BVEA 3VFMB 1CTNA 2B1AH 3QXDB 4MA8L 3FFDA 4OIFA 3U9WA 1TFPA 4PRNB 3T3PB 1WFNA 3KW7A 3QO0A 1M6UA 1IGYA 4PP2B 2YGPA 3G6JE 4JO3L 1SN2A 2XXFA 5K39A 1NBVL 2HH0L 1ZOXA 1Z5LA 1WG3A 4L3EA 2PWDA 2X2IA 4OFYD 1YJDL 2K0RA 3MV7B 4W70A 5GSVB 3RI5F 1NMAL 1S9YA 3MV9E 1TO5A 4NLAA 2JJSC 4WENB 5HVFB 3D08A 1R47A 3IKCB 2YXMA 1N64H 2ROYA 2HLEB 3IFPB 4JZJC 1KTDA 1MCEA 4MJHA 5I9QB 3ZDXB 4KI5C 5CD5C 4WNJA 3T3ME 1LK3H 4WFGE 5J4MA 2EZ0C 5ELIA 2N01B 1P5UB 1KMGA 3MDJA 1ZT4A 1AMYA 3NUKA 4TQEL 1A1MA 3LHAA 4YH6A 1I1AA 1MVUB 4KXZI 3NPSC 1S7TB 5LBVA 5AW6B 3DMMB 4X99B 4KZ0A 4WCYL 4PU2A 3P73A 4YR6A 2PCFB 2AEQL 1KCWA 2PXYA 4IOSD 2XN0A 4G3YL 4L37A 5IB1A 2VJ8A 4JQVC 4UQ2A 2XHNA 3CFJB 4ZS6D 5D1ZC 3MA7A 4GKNA 5AL8A 5KANG 2PF6A 4I48A 3UOAB 1RZPA 4DO6A 2DTML 1ASPA 4JKPH 3KWWB 3EADA 3CMOH 3C5SB 5D2LA 1B2WH 5T3XD 2P1YA 5J1SC 4K07A 3P69A 1KNOA 5D4JA 3K2MC 3ASWA 1H3GA 3M17B 3VYNA 1BWWA 3ZE0F 4QGYA 5GIRA 2OZNA 2M83A 2HB0A 3K8MA 4IK6A 1NC4B 5DJXA 5F9OL 5HHOD 5CSZB 5DVPA 5E2UL 3MVSA 4M6NH 5A2CA 3F65A 3GLDA 2XN9A 1N5YL 2X3BA 1F45A 1NCWL 2R0ZH 1X5IA 3FPXA 4YDNA 2X7LB 3RWEA 3MUHL 4B6ZA 4QRQB 1I8KA 3LY6A 3OQ3B 5ID1A 1S78C 2DWSA 2JH2A 3KYOB 2HA1A 1Y1UA 5BS0A 2VKWA 4NKMA 3UTZA 5I75B 5ADOL 1GGIL 1I7RB 2RJMA 3FTYA 3NJNA 3OV6A 3I3EA 2AEPL 2H2SC 3IJ7A 2CBTA 5KBKA 4WWKA 3TFKD 3QFGA 1WE5A 3HPLA 5DZOA 4QHUB 3PP3K 3OG6B 4IM8A 3P02A 4P5SA 4CVXB 4PJIF 4ETYA 1PDKA 4WW1A 2VC2B 4J3TA 1UACL 2AVFA 3V4PL 5KAQF 4JPVH 1XAUA 2XY2A 2CA4A 4B9PA 5K9KA 3TA4D 4RAUB 2CIKB 3WD5L 1AMXA 1KWKA 3O9WB 4P2OA 4HJJL 3VRJB 3AGVA 3ILPA 3V4VL 3SPIA 2FZ3A 1A6TA 2L7EA 3MFGB 1UZ6F 4FFWC 3QJTB 1KOAA 2FECI 5C0AA 3K5SA 4JFOA 4JFDA 3QRFM 1S9XB 4NO0B 3JQOB 4IRSC 4Y89A 1USQA 3SY0B 3LKSB 1UQSB 5C07E 1EFQA 2D9QB 2XPYA 3HHSA 1UZ8B 2F5BH 1QKZH 4S1RH 1YYML 4DETA 1IC0A 3BCFA 1A2YA 4HYTB 2JXMA 1MI5A 1ZWIB 5JQ6L 4ZAKD 1S6NA 2BNUA 1RUAH 5E6SB 2OX5A 3D25A 2FR4B 1OPOA 3IPEA 3PY9A 4EEEA 4GW5B 5DS2A 3DI2B 1BLNA 1H8SA 2B7DT 1TZGH 3IJYA 4KO7A 4DKFL 4L48A 1K6QH 1RPKA 3US0A 3QULA 1XMWA 1E6OH 2BS8A 5DQJA 1RZ7H 3WTUA 4KUZH 2ZYIA 4GS7B 3VD7A 2GBAA 4HAKA 2J44A 1NAMA 2G5BA 1CDGA 3INOA 4OM1L 1L5GB 3QO1B 2ZWNA 3ZMNA 4MXVF 5GGRA 4Z9KB 2J6WA 1D5RA 2PWEA 3P0YH 4JPWL 4MXQC 2HKFL 4JW3A 4PTUB 4H8WH 4U3XA 1CPUA 2R4RL 3NACL 3RVTC 1JI1A 1YMMD 2YA2A 1U8PA 2EJ1A 2CCWA 5INCA 1U2CA 5EUOA 4Z7WF 3O11A 5A7EA 3QJRB 1P4IH 1CGYA 4H13C 3T1FB 3CUPA 3OHXC 2EDYA 5DMKB 1KF9B 3RTQC 2CR6A 2ODHA 5JW4M 3LZFH 1PG7L 4PN6A 3A0OA 1D9KC 1FLTX 5JO5A 4OF7A 5I0WA 2PYEA 5FYJD 1FNLA 2E6JA 1AY1H 4MSWA 3VO0A 1OZUA 2B1HL 2NNAA 5AZUA 3KPSA 3F7PC 5IVNA 1N10A 4PJCA 5ESQA 4EO5A 4UOW0 2EO9A 1D5IL 1UXMA 3QIBB 4GBXA 4BZ2A 1XR8A 3LEVH 2F1AA 5CCKH 1BQLH 2FGWL 3NSCA 4X4KA 1YEDA 4YXLL 2DWYA 3CN2A 1LD9B 3NCXA 5A2LH 3NTCL 1U8HA 1LEIB 3C6SA 1Y6MR 3VW3L 4WHYH 4KTEL 2ICWJ 2ZXGA 1F8TH 1ES0A 1Q94A 1IBHA 1LO5A 4DH2A 1IAMA 2CE6A 3WL9B 1IM3A 1EVUA 3QXTA 2VZUA 4ZK8A 1YNTB 4KJYB 4OF6A 1G43A 1FSKC 4G5ZL 4I85A 1MCWM 3AY2A 3T2NL 4XPAL 3KPOA 3MRRB 3H0TA 5DEGA 3U9UB 4LGPB 4OLEA 3MBEC 3ZTNL 2NCEA 1WCBB 3PQYA 1GYUA 3LKPA 3QG6A 4HEPG 4OJAA 3RX9A 3SDCA 3DECA 3H42L 4MB4A 3NA9L 1JV2A 1BX2A 3LHPL 1QFUL 3OR6B 3N1QC 1M57B 5DJ8A 2VDRL 5I1JL 1YY8A 2NXZC 1JDDA 2EE0A 2IQAB 4PJGB 3EHBD 1V54B 4PRPB 3VI3B 4Z77A 2N4IA 2P28B 1KENL 4LXFA 4OVVA 1QFPA 4ZUSA 2R59A 4JG5A 3U2JA 1EBAA 4QEGA 5LWYH 3IN0A 5HDOA 2XKSA 3SDDC 2EP6A 5GJSL 1G1OA 1UCBL 2IANE 3WEXB 3OHMB 1QHPA 4XX1E 2Q6WA 4DP0X 3ZMEA 3MC0A 1KGXA 3DX2A 3EYFB 4HOXA 4MS8C 3QUZC 3OX8A 1SEQH 1DHKA 4ETQB 1R5IA 3NIGF 3IGFA 4FZEH 1ET7A 1JJUA 1MFMA 2FO1A 3VXMA 2WP3T 4PJHF 2LR4A 4BKSC 3A4AA 1T0MB 2N7AA 4PD4J 4OZGB 4NQCD 4ANXA 4PYHA 3GSQA 4ONHA 3EYQD 4IEFB 5IQ7L 2HT4C 4HP5A 4PREB 4G9FD 3ECBB 4U2YA 3QQNA 1CS6A 1JFHA 3ARDA 4NPYA 3S88L 1CGXA 1H15A 4J6IA 5HYJA 2AXWA 4NXKA 5DYOB 4QHMB 4UT6A 1URZA 3HBGA 3D4ZA 4XB3A 3EO9H 4A67A 1UVQA 4OZHF 3LS5L 5T1DL 1AKJB 3F6JA 5BO1H 1ZHLA 2WXOA 3BPLC 4HAFA 3I85A 3EOTH 1F11B 4PJFA 5E2VH 1AC0A 2XWTA 3SPVB 2IGFL 5JHDE 5JOFA 4K9EL 4IHOA 4NZDA 4AG4H 3NRQA 4QYAA 1E5AA 3QCUL 2GPZA 2KHAA 3SOTA 4LSPH 3D05A 3NJXA 4QCIB 4WI0A 3BVDB 1QSEE 1T5XB 3D0VA 5KYXA 1ZGLP 1ZS8A 3FO2B 3E7JA 4M8QB 1HJCA 3B9KA 4MQSB 3W9EB 3ISRA 3LRHA 4U0RB 2QHRH 5EEZA 4KMLB 1AQMA 4P06A 4OI9A 4M7KH 2JKNA 2XOTA 3BC9A 3GSUB 3BAEH 3MSPA 4NKDB 2JE8A 4U1NA 1W72B 1SHMA 5C8JA 3BAXA 4E9SA 2EEBA 3H3PH 3PHSA 4UMGA 4NENA 3QUKB 3CFBB 2GG1A 4Y7OC 4BXVA 1IBZA 2BIQA 4KDVA 5IIEA 5J11B 2A3TA 1P6WA 2VSKB 1WIUA 1JF5A 5FUCE 2UXVA 4G8AC 5KANI 1NIDA 3BYYA 3ARBD 1N3NB 1C8PA 1EIBA 2X53A 1MHCA 3LRMA 1WBYA 5HYIA 4YQXH 2V2TB 3RVWD 3VFTB 3SQOL 3JTSB 1U30A 2GJ6D 1K2DB 4JFXB 4LCCA 4N9OB 3HI5L 2X4OB 1RLBA 1ZVYA 2FWOA 2HJFA 4Z7UA 5F21B 5TF0A 3UC0H 3J8F7 4K5OA 3MHZA 1OSPH 3NZHL 4YHIA 4AE1A 1F4HA 1LO4L 4HCIA 1E30A 4WW2B 4X9FA 5F0LB 2UXGA 1OGAA 2BFVL 4I0PB 2WLJA 3MCG1 3X12B 1L7TH 5JIIA 3CSGA 3DDFA 4JL2A 4N6QA 1WV7T 1FFOA 4OT1H 4Y4HC 4X9IA 1MY5A 2VISB 2E6QA 3FQXB 5G5DB 2R8SL 1AIZA 2ZX7A 4KO9A 4LDCA 3D39A 5IJDC 4JDZB 1AS6A 2EAEA 3JVGA 3LN4A 4JFHE 4LLVB 3UAJC 2AS5M 3EJCA 3MU3A 3NCCB 1XGTB 4M1DH 3WMQA 2ATAA 1G5AA 1HEJC 5ISZA 5JORA 2NSMA 1DJSA 2ZOLA 3FFOA 4DUWA 1RZJH 2V8LA 2G3XA 2MOGA 4WO4B 2XV3A 4F9PC 3UAEA 4JFUA 2HJKB 4MZIA 3BH9A 1VAHA 4G8GB 4HKJA 2VDMB 5CUSH 3ULVF 5HPMA 4FQXB 4O58H 4BRJA 4KROC 3EO1A 3F5WB 5BUGA 1N8ZB 4IRZH 3GO1L 4ORGA 2BSTB 4RX4D 3Q01A 4JKMA 4RFNB 3TJEL 1KTRL 2RFXB 4DP5X 4C58B 3DV4B 2RB8A 2D7TL 1KJVB 4LHUB 4AUYA 4MDJB 5C0FB 3UTSD 1Q8MA 4UT9H 4IBUA 3L1EA 2LV4A 3UYRL 3FCSA 5DK0B 1UH4A 3LSOA 3OLDA 4LP8A 1WA0X 2VLJB 1G7QB 1RIVL 1FNEA 3NJFA 1TDQA 4Q89A 4N0UA 3AS1A 2XVGA 1W0VB 3JVFC 4P2RB 5DUBB 4AYSA 3THMH 1UASA 1SGKA 2A9CA 3MRJB 4P48A 4HOZA 3LS4H 1G6RL 3C9NA 4L8CB 1KTJA 1IT9H 2G4EA 3SE4A 3AC0A 4KDWA 1XWVA 2BSDA 1OW0C 5E4IA 3NDZE 1GJUA 3UABA 3MROA 2VDNB 3EG9B 3SZKC 1VA9A 2DQIL 1QATA 2BSEA 5JW5A 2AKRB 4C54A 4J8QA 1O75A 4OF0A 4CVZA 3MRFB 4QRRA 2YKLH 2AJ3B 1W8EA 3DJRA 1JXGA 3HMWH 1A1NB 1QI4A 1YYCA 2UY7A 3MLSH 4HJ0D 4NX0A 5I6PA 4RQQA 5KVGE 1R3KB 2HRPL 3OAZK 1IL1B 2JCCE 1EEZA 3QZLA 5LG1A 5L9DH 3V0WL 1GGBL 1TZIA 4K7PH 1BGXH 3LOWA 5DHEA 5FGCE 4Z7NE 2EDKA 5T5FL 2WQUA 4E2OA 4FYRA 1DJHA 4M6MH 5I19H 2XXMB 5E1AB 1T2XA 2PCPB 3JXAA 1KTKE 4PJ7A 3IXTB 5CBAA 5EOCH 1U92A 3MPCA 2H2PD 2L7QA 3K0WA 4M6AA 3GJFA 1KLFB 3Q2NA 4FFYL 4GSRA 1JXKA 1ECZA 1H3UA 4ZSOA 3L4ZA 4JRXA 1J5OH 1HJBC 1ACZA 2F19H 1HYSC 3DIVA 1OPGH 5F7NC 4BFFA 3HNSL 3SOBL 3VXUB 2VXQH 4XPFL 1U3HC 2J43A 3QEGL 4HC1A 3TYGL 4NM8H 4W9EC 1ZIBA 2P49B 2C9RA 5SX5K 4K5LA 4DP2X 3RIAF 1MCHA 5JQHC 4HG4J 4XE0A 4W9FC 3FRUB 1BVZA 3BMVA 1QNZH 4HKBA 4XTRD 3UDWA 4TXVB 2K6WA 3B5GA 5IK3B 1V7NL 4AH2B 3CK0L 1HOCB 3MXVH 2MCMA 2HFFB 2ZE0A 4FDWA 4ZMXA 3R18A 3TH4T 1U8QB 4OAWA 2IV8A 4IOIB 3B2MA 2DEXX 3QIUB 1CQKA 1KJ2H 5EWIL 4AKOA 3BEWB 1PQZA 4I9XA 4UZGA 3NCJH 1KYOK 1HQRB 4KNSA 5E4EC 3DPBA 3B3BA 2VW6A 3MCLH 2J6EA 4FQIH 4PGZA 4R3SA 4OZIB 1QTSA 3U2SA 3QPKA 3WS3B 1QLRA 4A6YB 5MEOA 1D7FA 4AJ0A 3LVTA 3QJQB 4ZMQA 2K6YA 4Y2DD 4NYLB 5KVEE 3SO3B 3RY4A 4GUQA 4YSDA 4UNIA 2DQEH 2EEXA 4C56B 1CL7L 1ORSA 4LKXB 4CDHA 3OAUH 4N2KA 1S7UA 2F58L 2VIRB 3HG5A 1MG2C 4EN3D 2ZUTA 3VFPB 2F18A 4KJWC 4MMYB 1SMOA 4M8VA 2VL5B 4FEMA 2YJQA 3RZCA 4Q6KA 4ZDHB 4GRLB 3ZE2E 2DQTH 3V0EA 2ZOKA 5DVOA 1MCQA 4YHYB 2HVJA 3AG1B 2EO7A 4N2LA 3RGVD 4X0NA 4F7TA 2MPAH 4I5BA 3ATFA 1MRDH 2WVTA 5TF1L 3ZHFA 4O2FA 2X89A 3ULVH 2DN7A 4LOFA 2OTUA 3QCTH 3O3BA 3UTTB 3Q8FA 4F7MA 3EDJA 5BPPA 1XF2B 5T1KB 2HJLB 4J8RB 3ARGC 4JHAL 1YCSA 3TTSA 4NZUH 4K71B 4UV7L 4V11A 2NY0C 4ZS7H 1ZJBA 2BRQA 1RZKH 4Z78A 1X4YA 4XPGH 1AKPA 1FYHB 4XXCA 4JMXA 3LEYL 2QDVA 3U46B 1IQWH 2CPUA 5LXVA 2F8IA 3HNTH 4WGWB 2VLRE 5HDRA 2AQ2A 4TSCL 3IM1A 5CF3A 4H2CA 4O02L 1NMAH 4WFHE 3BWAB 4QRBA 2O6FA 2I60H 3I9PA 2BOCA 3BKMH 4YVNA 1W80A 2GBUA 1KXQA 5TFSL 4M61A 4EVNB 3ME0B 1M1XB 1MLBA 4KHXL 5IHBA 3C08L 3JTTA 3SDAD 3F64A 4GXVH 4P9HH 2EKSA 2A6DB 2FUQA 1RVFL 2WBJB 2ZOUA 3RY6A 5FUZL 4Y2OA 3K6OA 5I18L 4GPVA 5F7YC 3TV3L 3TF4A 5E56A 4YDIH 4TQEH 1MCWW 3HI6L 5BQDA 3ZQWA 3M7FB 4LQ1A 2ZT9C 3K1KC 3K91A 5E95B 1VEOA 5IF0A 3FQTA 4ES9A 2P5WA 1CIUA 2QADD 3B6SB 2AF2A 3DGGB 2HAZA 4DK6A 5FA3A 2CAKA 4ZW6A 4Y19D 1HXMA 3NCYS 3S37X 1E27B 4ACTA 1B0GA 2VZVA 5JZ7C 3ZBMA 1S9WA 3VI4A 2KPWA 1RZ8A 3U4AA 1EK3A 5B3NA 2ITDA 4Y16D 2AGJH 2WN2A 3HI1B 4V1DB 5FF6A 1KGWA 3EDDA 3RURA 4IIZA 4XO8A 2C9VA 3KYKH 5FO8A 2V6HA 2ZUSA 4HA1A 5IFAH 1JPST 1XZ0A 3LN5B 3SE3A 4LVNB 3ZUNC 3ARPA 4XOAA 1AP2B 3QQDA 4PBXA 3WNOA 1OL0A 1S5HB 5EEVA 4FQHA 2VDLH 2AQ1A 1SDDB 3MLXL 4MAYC 1FL6B 1AQDB 1OTTC 1R3LA 3NCBB 4JFPB 4QTHA 3I6LD 1U95A 5ESAB 5L2KA 4XPHL 3P11H 5IBTH 5AUMB 3EDEA 3FHEA 3T0EE 2D7OA 5CJ8A 1NLDH 3QFJD 2DLHA 5EIIB 1SJEB 4NHUA 1I8LC 5DO8A 2CLVA 2P26A 3BISA 2IAAC 2W0PA 1D5MA 2CD0A 4OW6A 4XXWA 2VAAA 5IEKB 1VFMA 4PJIE 4LPTA 4KK9D 5IV2A 1JWUA 4RLDA 4W9CC 1KTBA 3PHQB 4H8UA 4YDLC 1UACH 4AIZB 4LPYA 4ZXBC 1FNGB 2YSSB 4YHPA 5LGJA 5AAMC 1KXTA 1HT6A 4X8CA 3WD5H 1JCVA 5MHSE 3S0PA 3BVNA 4R96B 5FCUL 2AV7A 1IAKB 1PEWA 3MLTB 3N06B 5AW8B 3F7LA 5HSFA 5G55A 4MNGE 4R0LA 5JIQA 1NCBL 4QD2E 4IKJA 5HI5D 3EFFB 3GMRA 4NN6C 2BOBA 3CZUB 2Q8BL 4DFHA 1YYMH 4N26A 5FGBC 2HG0A 3P3YA 4Q9QL 1T89C 1TZAA 1TQSA 2KLTA 1OAYL 1A7RH 5IESL 5JHLA 3WYRA 5JQ6H 1AR1B 4H20L 3D2UA 4RMBA 3OF6D 4L5FL 2X40A 1CICB 3QORB 3IMRA 4PG9B 3QUXC 3H7BB 3MRCB 4ENEC 2YARA 3NN8B 1THCA 4G43A 2PPDA 2DBLH 4HUUA 4BGLA 2V9QA 2BLFA 4G1MA 5I1GH 2BWIA 1QBAA 4KHTL 4UI2A 2H9GA 3B37A 4Y4FA 4NN5C 2QHLA 1YUHA 5D1XE 1XH3B 1WT5A 1X5AA 1XF1A 3QG7H 2AK4A 3WV0A 1N70A 3GHEL 3RWFA 3KNBA 2Z4QB 4G80A 2ESVD 1NFKA 2HKFH 3GKWL 1DVUA 1G7PB 3QBTB 2SEBA 3PWUA 2EDTA 2PO6B 3BUTA 4Z7WE 5CEZL 4G7VL 4QHKJ 4F58L 1BMWA 3MUGA 4HUMB 3OMAB 4NBYB 3QWOB 3SGJA 4DKAA 1WUNT 1S7WB 1FBIH 4TSBL 4IJ3B 3TO4C 1LO0L 2ZP8A 1XH2A 3PGFL 3PHOB 1HXYB 4Y1AA 4ESKA 2BVQB 1EGJL 1IC5H 5CHNB 5B1JC 4EZLA 3I6KB 1WHPA 4Q97A 1CI3M 1YEHH 2KERA 3AT9A 4GEIA 3U0PB 3WXVH 1FQ9C 4ABWA 3LZRA 1JHTB 3KCWA 4LBEB 4KRMB 43C9B 1JZDC 4YXLH 3TESA 2OMZA 3GSVA 2MNJB 2UUDH 4UIMB 3RVVD 3F12B 3TZVA 1K72A 2WLNA 1TQVA 4TOYH 1JZ4A 2VZ1A 3LCYA 3CDGB 4IDJL 5LGYA 2HG5B 4JVUA 3KJ4C 1CLYH 2VR9A 1I3GL 2FAUA 2OMVB 5FO9B 5KS9A 3TJHD 1DUZB 1GW0A 1DN0B 4UQAA 2BW4A 1OGTA 5L4FA 2JTYA 4XPAH 4K73A 1A6UL 4LE8A 3ZZ1A 1RJCA 3WE6A 2XZAL 1DO6A 4PGEB 3N43B 2ISDA 2EILB 4AXWB 1F0LA 4MJ6B 1S7RA 2YXFA 1YYLH 4J4PD 3KWTA 3LHPH 1EJ8A 1QFUH 3VFOB 4JBSA 4ADIA 1YHPA 4AQ1C 1SMAA 1HHIB 3EJZC 5SV3A 1T7XA 1A0QH 3LNHA 4OGXL 4CW1A 4FTVB 3MRDA 3TIDA 5JA8B 2BO0A 3FZUD 3HN5A 3MNZA 3RB5A 3RKDD 1TETH 4CSZA 1OEZW 3BKCH 4JO2H 1UB5B 5C2BH 4FLRA 2VB5A 3FU5A 3IMTA 4BXSV 3Q6FA 5KSAD 2ZKWA 1UCBH 3BP6A 3ABZA 4K9JA 4A2MA 3HZKA 2VRQA 4L1SA 3A23A 4E41D 3NP3A 2HWZL 2CDEB 4NIKB 4MJIA 4BK4A 3GBLA 3I50H 4ODHL 4PJHE 5CIPA 1TYRA 2XZZA 1NDMB 4TTDD 5K33A 3PL6B 2HCZX 5GGSY 3W5MA 3WUWB 3UADA 1JZ3A 5B3JF 3POCA 4XP9L 3ABLB 4M43L 2RD0A 2R2HB 3BRFA 1MDAA 2J5LB 4KJQC 3T4YB 3MLRL 4DCQB 4B3EA 1INQB 3TXAA 4DGVH 3QUMH 3S88H 2RAMA 4CILA 3L4UA 1OE2A 1UCTA 3LYRA 3QJFA 1ZLUH 1XR9A 4QJ5B 1JUFB 1XIWA 2NY2C 4MD4A 4OZHE 3RWGB 4UQCA 2JB6B 1T5WB 5T1DH 5I0ZA 4J7RA 1OK8A 2C34A 1HZKA 1CF8H 3QAQA 3OGCA 3SZ6A 3U36B 7FABH 4Z7VF 4K9EH 3HE7D 5C0CB 3F7YB 5H37A 2X2JA 3PJSA 5FYKD 4ZMAT 2EIJB 4LEOA 2YGNA 4ZFZA 4APXB 3OZ9L 3KD4A 4U1JB 4Q6IB 2R4SL 3IETB 3WKQA 4PGJA 3BRDA 1B4JH 3KR3L 4DEPB 3LKNB 4GB9A 4K23H 3BZEA 2F2HA 4M8UA 3REVB 3K6FA 3BPCA 4NUPA 2BWQA 2NY5H 3KXFA 4KAQL 4UQ3B 4PJAB 5IVXF 5DRZB 3DSNB 2UZYA 4A7VA 3UMTA 1FN4B 4UM8A 2YLKA 3BMWA 4EAEA 4O51B 3VWKA 2OYKA 3FKUS 2IMMA 5JUEH 3MCYA 1YECH 5AFAA 5JHAA 3EFOB 3DVGB 3D4GA 1AD9B 1JERA 1H8NA 1T4KA 5FX3A 3LQZB 1ETZB 5AZEH 5E94A 4FXGC 5DYFA 2AQ3A 4E42A 5I0YA 1N0LB 2J3SA 4BH7A 1B88A 4Q6YA 3FS9A 4ODVH 3MGOA 4D7PA 3WKMH 2I26N 4R7NB 5HJ3A 3GSNH 2OYPA 2VAJA 1AHWC 3WBDA 2VDOB 3E6FA 2WIIB 2F08A 2V5YA 1YPZF 1NWOA 4NQSB 2R29A 4JRLA 2Z92B 4MKTA 2EACA 4PVNA 1JZ5A 2BFVH 4FGMA 2OULB 5DHYB 3MV9D 2WWKO 3FB8A 1BZ7A 3HTLX 1G9NH 5ABAA 3GMLA 1F1DA 3T1WA 5L6YL 4YDJB 5GSRB 4QOKE 4JFFB 3HHMA 4H1LA 4RGMC 3VXPA 3RL1A 3P3TA 3EO0A 4WFGD 5AB1A 4F7CB 5D7IA 1BQHA 2CO1A 1BAGA 2IDTA 2BP8A 1FH5H 3PGDB 5DZPA 5M95B 2VJ0A 4M3KB 1Y6KR 2AQNA 2DQCH 2UZXB 5FOBA 4ZFGH 2ETWA 3KGSA 5BV7B 3OJVC 5I16B 2CLRB 4YHOH 4XGZA 5A2KH 3QI9C 3AMLA 1DQVA 3CSYA 4Z95L 3QEQA 5FYLH 4YS4A 3FUNA 5F3HB 3ULVE 1LNUB 3TM6A 3W81A 2HLFD 4EOWL 3KE0A 1OB1A 5JPMB 1NGZB 2V17L 4UILL 3SDXF 5HHPB 1NCDL 2VT0A 4AKQA 3GO1H 3GMOA 5DFVC 3J7HA 3H85A 1NM9A 4UQ9A 4XNZB 5KN5B 1CLZL 3ARWA 3ROLA 1BZ9B 1J88A 1OE1A 5HI4D 3MV8B 3QJHB 3CCHB 5PCYA 3EBAA 1LP9A 5AW2B 2WKOF 4N2FA 4NRXA 4DNLA 4XBGA 4M1CC 4XMKH 3NP4A 3QXUA 4JO1H 5E9DE 4PLOB 3V2AR 1UJ3B 3VG9B 4KY1L 1N4XL 5DJ6B 1KJ3H 4X6CA 3U6RA 1DVFB 1G1KA 2WVSA 4FQ2H 4X6BB 4UIKL 3N1MC 1U41A 3QZBA 4JY4B 1AD0A 1ADQL 1PZBA 4F1SA 3R8QA 3LZQA 3BZDA 4X6FB 3IDNA 4KQ4L 1WJ3A 3VM7A 4NJ9H 2CRZA 2VH5L 3VU1A 1WZLA 2MHAA 3IEAA 5AKTA 5D5MF 4HS6A 5C0DB 2DQIH 2BDNL 3QIWB 4U1SB 2BVOA 2BXYA 4APQB 2BHZA 3FT0A 3LIZH 3DVIA 4XT1C 5MI0B 5GGTL 3WN5C 4DZ8B 3SE8H 3WU1A 2VNCA 2XKNA 3C5ZC 2KBGA 2NUTB 4YO0A 5E00A 1XXFC 2C3WA 2HRPH 3KLAB 2OS7A 2WZPA 1CG9B 1ZS2A 5IQMA 1J8SA 1GGBH 1I8IB 32C2A 5D6CA 4B9FA 1MNNA 2QVKA 1FZKB 2ZNXA 1IKNC 3OKDB 1B9KA 3TA3C 2Z35B 1WBXA 1U33A 1DSWA 2P80D 2R7EA 3FU8A 1GMEA 3SY6A 3HG1A 1MUJA 3WLBB 3BGMB 2JKIS 4POZC 2WOYA 3TEZA 4AYEC 1JAEA 5F97E 2PR9A 2EEFA 2BVUA 1RZKC 3UJTL 2B2XH 4DPRA 1DZBA 3DLQR 4TUOB 2CHZA 3SCMC 1BPVA 4JDTL 1DEEA 1XF4A 5C07D 4QRFA 5HHMB 1VKXA 1CYWA 2F8XC 1GJWA 5FM4A 5CEXA 2JNZA 1FYTA 2ADGB 1RU9L 1BJMA 2BFGA 2HVKB 2Y72A 3HNSH 3J2PA 4JY5L 4MA7H 1FAIH 1KN4H 3SJVE 3QEGH 4X5WB 5CN1A 2WB7A 3TYGH 4L4TE 1IGJB 2HN7A 2A5UA 5FK9A 3T08A 3QQ4B 4GG8A 3FTGA 3Q48A 3FT3B 3HS9A 4MASA 4BHUA 1PZCA 2KUTA 1YQ2A 2ZCZA 3KPNB 4P5KB 3WIIH 3L45A 5F9JA 4P9HC 3DV6B 2PR4H 4E36A 4D94A 4JZJB 5IMOA 1U3NA 5EG6C 1T1YA 4RAVA 2H0FA 3QRBA 3D12B 5ID0A 4PJ5B 3CVHA 2YD9A 2HTKD 2XFXA 1AGDB 1NCIA 1EXUA 3J27A 3NPSB 1DE4A 2QSQA 2DTSA 4K5MA 4NO2B 4XH2A 2K4AA 3L16A 3T6WA 3B7YA 3TNNB 3RIAK 3X1FA 1TR7A 5AAWC 1PKQA 4HCGA 2O93L 3Q0HA 4ELMB 3ESUF 4GRMA 1OP9A 1OHQA 3GT6A 4PJEA 3FFCE 2F53E 3O6FC 4I0KA 2QSVA 4CJ1A 2JQMA 3UCRA 1KBGL 3H1ZA 3LH2L 1FJ1A 3VH8B 1MJUH 1O7SA 4NRYA 3A6BL 1I9RL 5EC1A 5L2JA 1S5IL 4PWFA 2JWYA 3LH9A 2EIBA 4O2CB 5FFGA 1RK1B 3IJSB 4A2LA 4NRZA 3VNZA 3OKLB 3HZMA 3M6DA 4K3JL 4GIOA 1I9JH 2OJZH 3KPTA 4FQJH 1SYVA 4Z7AA 4PTTB 5HYFA 2W9EL 4XP6H 2JK5A 1MZZA 2UWEE 2OAAA 3SBWC 1P1ZB 1CMOA 1NM4A 4HCRL 3II3A 2OSYA 1AO7B 3QA3A 4K3HA 3ABGA 1U8MB 4YHZH 1RHHB 1LEKA 4L29A 2X12A 3WFDL 2OSLB 3V0DA 1TNMA 3V55A 4L1DA 4DO5A 2EVJA 1SFHA 5C9JB 4GG6A 5CMAA 3V6FB 4DOHE 3AM8A 3K8KA 3GEFA 4MMZC 3D50A 4TF4A 1RP9A 1E6JL 2X44D 5JDJA 1GAFL 1H5BC 1XTLA 3TT3H 3GDBA 2WYTA 3FL7A 2DB8A 3LEYH 3W82A 2V2XB 1OOAA 2P8LB 4YLCA 2WXIA 4I3SL 4HW6A 4NHCL 5SWZE 3KLHC 1AQ8A 4BBWA 1EZUA 4X7CC 2A6JB 2VQ4A 4YUEL 4YDVA 1J5HA 5MENA 1EJOL 3BW9A 3D8MA 1DBAL 5ANMB 5AAPA 4LCWA 1N67A 2VWEE 3MREB 4ANVA 3I02A 4I77L 5BZXA 1G94A 3GSOB 4NZJA 1N2RA 4A7UA 1KPRA 4A04A 3BXNB 4KHXH 1C16A 1DVXA 1FFPA 3FU7B 5H4YA 1TZHA 2ZXCA 3IDXH 4AUUA 3UERA 5TE6L 1I7ZB 1RVFH 3UTOA 3CV5A 4J2XA 2XNAB 1S7QA 2APFA 1BXVA 2P9RA 1GKEA 3DX1A 2P5ED 3H4HA 3B7RL 3K80A 4IRSB 1LHZA 1MCSA 1OTUD 2DQUL 4UANA 3VD3A 3ZDWA 3HI6H 2R9HC 1ZKAA 5GXBB 3QEHA 4GIPD 4MLIA 2BVYA 3C60A 3CDCA 1QSFA 3DXAB 5E2JA 2BM3A 2FIKB 3DBXA 3HE6A 2D7PA 1XGZA 3AB0C 4WEBH 2O26U 3WHXA 5KSBB 3NG5A 4F57L 1G7MA 1OAJA 3KPRB 2VDPH 3VFGL 5DLLA 4MNQD 1L6PA 3QAZC 1HZHL 3CZNA 4JN1L 4N8VA 4B5ZA 2EXWD 3FH7A 3HHRB 4PRHD 1P84K 1QSVA 3DRQB 4G7RB 3E8UL 1ZHBA 4K3EL 4MNHA 4U7SA 1G7JA 5F96H 4F8PA 2Q3XA 1JMXA 5AOLA 1Q0XH 1ZK5A 1EAPB 2AEOA 5JHDD 2FBJL 1YC7A 4ZUTA 5EN2B 5D2LF 3BD4A 3BDXA 2YUZA 3JT2A 3QHFL 4HPYL 5H37G 4A7GA 3IDUA 5FO7A 5ICYA 2CKNA 3QPXL 4DKEL 2GB2A 4G1EA 2H32H 1C7TA 3IF1A 2VWEC 3I3DA 4F7PB 5LBSA 1FUNA 4N86A 4YSTA 1HZLA 3C5XA 1FGVL 5IEHB 5MP6L 1VGEH 4PJ8A 3QDJB 4OI8A 5IQOA 4XC3H 4ZFQA 1M71B 3DOHA 1J8RA 4B0MM 4Q14A 4OLYH 1JV5B 4FJYA 2Y2TA 4XPHH 3OHXB 4JCWA 1HHJA 1W72L 4M5YL 2ICEC 3RTQB 3IU4H 4H25B 4NQQA 1S9VB 1K4CA 2J4WL 1J1PL 1QLEB 3CDZB 3U82B 1UWYA 4LARL 1ZT1A 3ESPA 2WYHA 4PHXA 2WJ7A 4NZ8A 3BO8A 4RETB 2NY3C 3W2DH 4DFIA 4YSOA 3U6XA 4U1MB 4PJDA 3L2LA 1E4HA 3HG2A 2JIXB 4UDUB 4J1UA 3BDYL 2Y1YA 4HUWB 2C7UA 2H26B 4AQEB 2F54E 5ES4B 3HG3A 2X4SB 3ILQC 3CX5J 4JM2A 3S96A 4NC0B 2ZWLT 1MCJA 3IWUA 2X9YA 3FF8A 1NFDB 2CNYA 3G9VA 3MRQA 3DYMA 1KUMA 1L7IL 3ZY7A 2FJFA 1GTFA 1FSKB 3C2SA 2NR6A 1NCBH 2J20A 2YPVH 1FVDB 3MBEB 4X7SL 1MW0A 1QPKA 2GUOA 1J8HE 1M6OB 4OM0H 4Q9QH 1K8IB 1ONQA 2X1XR 3DJ9A 4BQBA 1OAYH 2H8PA 2DQJL 5IESH 1KGCE 3ZYOA 2YXWA 2EYTA 4L5FH 1Z9PA 2Y7LA 3ECWA 1FNHA 1UGKA 1RURL 2NXZB 4GRWE 4C47A 5DTFA 2E27H 4BWWA 5GS0D 4JFHD 1MFUA 1BQHG 2NQCA 2Y5TB 3FB6B 4OV6F 1P7QB 2CRIA 2CLZB 1QABA 5EUKB 5I1HH 4X6EA 1TSRA 3CVIL 3SDDB 4F2ME 5TTRA 4NLHA 1A7PL 2X4TA 3HAEH 3QNXA 1RMFL 5B4MD 3HS0A 4NB7A 2WMPB 3GBML 3FB7B 4M3JA 3DOSA 3QUZB 4GUPB 3QH3A 4Q9BA 4V33A 3PREA 5I6OA 3RGHA 3GHEH 3KPQA 5F9DC 5C0RL 4GFTB 2YK1L 1YDPB 3T0WA 4X5QA 4POUB 3V95A 2J8UA 4BCXA 4PR5B 1HI6B 2W38A 4PSRA 4PGCA 2QPDB 3NZSA 3O3DA 2P3YA 1M53A 5DJCB 2IG2H 5JW3L 3ZGHA 5DD5H 3D18A 1JHKL 1R3JA 4TSBH 5EUOF 3BUDA 4MD0B 5C09B 5BW7A 1CBVL 4UQIM 1EGJH 2IOIA 4X7EC 1BFVL 2PNDA 5FW8A 3UAAA 4S1QH 4JB9L 3SN6N 3C5JA 2GEQA 2ENPA 1MH5A 3BPLB 2GVYA 1VACA 5EZJA 3LNGA 1BA9A 4LCYB 1MWAB 1T66C 3IDJB 1FG2A 4N2IA 2AJZA 2CR3A 5BRZE 3NRPA 5C0IB 1EFXB 4PJCF 5DZNA 3RHWF 3SD5A 4J3VA 2KLSA 3BVUA 2GI7A 3DX8A 2YBGA 2VDNL 1K3ZA 3TBVA 4QMEA 3QYCA 4AMXA 3L4WA 3A5VA 2DJUA 2NY5C 4IBQA 4YGVA 5JNYB 1ZPLA 1JWMB 2MTAA 1I3GH 1I9IH 4Q0XL 2G9HB 4OCWL 2EKJA 2IANB 3GUTB 5DO2C 1IX2A 3ECVA 4YHKL 4ZOEA 4DO4A 4OJFL 2X6CA 3L3HB 4XX5A 4U6HB 2QGEA 3FB5B 5DXWA 4HKZB 4OGAC 1EUTA 3IPFA 4AVKA 3V0AC 3V52L 3MNVA 1HAUA 4LFHD 4N22A 2YQ3A 3WJJC 4IU3A 4NQDE 1NOAA 1NUFA 1SDYA 3N42B 2DMBA 4OGXH 3L3JB 4UM9A 4XI5C 2ZP9A 5DHDA 5CBEA 4FFVD 2QQQA 5DMGC 3O4OC 1YAZA 4HX1B 5E6ID 1LEGA 2Q7YB 4H4NA 4Z7QE 5GZND 2YAPA 3AS3A 3K74B 1T0NA 1C12B 2J55A 1BXAA 3DMMA 4W9LC 3WJLC 3AGWA 5AW5B 2WWOA 3MRNA 1JPEA 2LABA 4MDRA 3UZVA 5ABZA 3BSZL 3CQQA 5DURD 3PRZA 1IGTA 5C92A 4EUPH 5HGHB 1M4KA 2XA8L 4D0BB 1G9NC 2GW5A 1KLUA 5H35B 3PWPE 4HH9B 5IJCC 3VQMA 3B2XA 1FFNB 4BELD 5ICZB 1YC8A 2WQ8A 4XCYB 4U3HA 1ZVSB 3AU1A 2ZCLL 3MRBA 1JXJA 4XP9H 4QRTA 4Y4HB 3MUY1 3ZTDC 1QSEB 2CZNA 2IPKA 2XFGB 3TV8A 5IMLA 4YL4A 4CVUA 3C5SA 1CD8A 1W0WA 4HU8A 1HILB 4S2SB 1C5BL 1DVZA 2Y07L 2FATL 3K0YA 4N0FA 5J56B 4NKOB 2IEPA 3VRLF 4ZMNA 3MUUA 2W9DH 4MWFB 4MKMA 3BRGC 1DLFL 1ROCA 4E9TA 2LAAA 2LU3A 2COVD 3D87B 3ZT6A 1RUKH 4A6YL 3EH1A 2NRDA 5AOMA 4MB1A 5DSCA 2V2WA 1R3HA 4QRQA 5FUOL 4PJFF 4BE5A 5EU7C 4KROB 1H6UA 4LHQB 5D96C 1LXMA 4AGNA 3FU9A 1CDIA 3PUUA 3KR3H 4OZ4B 3UTQA 1SEBB 2X4PB 5IVXE 4NSKB 5EU6A 5BCAA 5GZOA 1U3JA 4ZFOL 5J06A 3NFSL 5C70A 1RSYA 4K94C 3CPLA 1GYWA 3FCBA 4FQ1L 3AW5A 4QXWA 4M8RA 4IGBC 4RMTA 1H6EA 2Y36H 1RJYB 3EDFA 2EIKB 3SPHA 1TU2B 1O6TA 3BWUF 2LU5A 2CO2A 1A64A 2ERJC 2XV6B 3IMUA 3DUUA 1W15A 4OZFA 3OMZA 3TBCA 3GB7A 4TQ8A 3V10A 4LHJB 2Q1EA 4AK1A 2NX5A 2AP2A 1KGUA 3A4DA 2QLVB 2WLYA 4JPIB 5DD1H 1BM3L 1E4JA 4G43B 1DQQB 4KKAC 5TQ2H 4KTGA 4TSAL 1VESA 4AIXA 4XO3A 4ISVA 2WCGA 1D6EA 1GCYA 1ZA6B 2HX7A 3CZKA 3GRBA 2FQDA 2VLRD 3O2DL 4Z7UF 3VWJD 5GS1A 3NT0A 4OFQA 1SQ2N 4UTAA 3FT4B 4WFHD 1LLAA 3SGKA 1WITA 4H8PA 4M5SA 5D7JD 1CIDA 3B2UC 4RZCB 5E9NA 2C1PB 4JLRB 1NKGA 5DK3A 2AZUA 4AGMA 3NFPB 2B4CL 1NSNL 3NZUA 3GNMH 3BLKA 2G2NA 4PWKA 1AQKH 1XT5A 3GMNA 4EI5A 1LDPL 1HL5A 4ANWA 5I6NA 3IS0X 2NY6C 3WY4A 2NY4C 1UWXK 2XUWA 2CXKA 3ZHLA 5BRPA 5KZCD 4G8IA 3TEWA 4LSQL 4WU7B 1E65A 4ZTPL 3MOAL 5DJZB 1IEBB 4K7FA 4GJTB 4ZMZA 1FC2D 1IV8A 1TFHA 1J9CT 1OLLA 4JQIA 2XT1B 8FABB 2VLKB 2ZYHA 5A2AA 2OV0A 1DQJA 1S8DB 2BWDA 2EICA 5GQBA 3DHPA 3EBHA 5HP5A 4PLJD 1A5FH 3FHQA 3T8XB 3QRGL 3TCLA 4Z95H 3V5DB 4AIOA 4IU2A 1U3HB 3IVKB 4P59H 4QF1B 4RVBA 4IOFD 3Q7JA 4F33A 4R4BA 3O8XC 4MJ5B 3SDXE 3F3HA 1J9SA 3CDYA 2V17H 4N8VG 1YNTF 3BUYA 5DMKA 5BS0D 1J1OH 4LPCA 4FQQA 2HT2D 5D1QE 4NFCA 1EAJA 3MXWH 3QXAA 3BPOC 3L5XL 5INDB 1ETJA 5FKPA 4EZJA 3E9TA 3LEXA 3WTSA 5FHAL 3KYMB 1WK0A 5GS3A 2XJKA 4O2EA 5B1KA 3EXLA 1N68A 1NIAA 1Y7VA 5E8OB 3DO3A 2JI1A 1F6AA 1S7VB 2DKMA 3RUGB 4BUQA 2X6BA 3Q2LA 1LEIA 4OFIA 4KY1H 1SUHA 2JCCB 4IBTA 1DLHB 2A77L 4J3OG 4PJGF 1WS8A 1PJWA 4I9WE 4YPJA 2Y1ZA 4Z7NB 1EERB 1ADQH 2FH8A 4U0QB 4DUXA 3PWVA 4I13B 1RZGA 2C26A 4N8UA 2JCWA 3PAZA 1SJHB 3OMIB 4CDGC 2OK0L 1QTPA 2VH5H 2F7RA 3U9UA 4P2AA 4XMWA 3T0ED 1ZK9A 3FYIB 2A4CA 3ARED 3QDGE 5E0QA 3BZ4A 4QLRA 4DGYL 5LHDA 4M5ZL 4N2CA 4CSPA 5C6PB 2CUHA 4GQRA 4F7EB 4N87A 4UT6H 1FFTB 1CL7I 3MOBL 2WW8A 3TBSB 3JWNG 1BD2B 1B4LA 4IOSA 3CFDA 2QGDA 4PRPA 4JQXA 4NNXA 4NFBA 4KPHH 3U7WH 2E46A 5E08H 4M48H 2CDGB 4L3CB 2WHVA 1HCFX 2CCVA 2WV3A 2B59A 3EGXB 5DA0B 3UJTH 3A21A 1KGJA 3ARGB 5T1MB 2ZKYA 1C5CL 4M9OA 1TKWA 2NY0B 3EYUH 2AERT 2WAQA 4JDTH 4UZSA 1R6VA 5E03A 5DJ0B 4QTIL 1NMBL 5HHOA 1N5AA 5CEYB 4NJAL 1MNUL 4XPTH 5JIDA 4HIIB 1F90H 3ECBA 2CUMA 4BA0A 2WY3B 1XH0A 1L0PA 3STZA 1TQWA 3V9FA 2QKIC 3L4VA 5D7SL 5C3IA 4IHBA 4X8JA 2J73A 3ZIYA 3L2MA 1QUPA 1DVSA 2BNQE 2XWBA 5F7HA 3D6GA 3MX0A 2ENSA 4B60A 3ZE2B 5DRWA 2IPUG 4JKNA 3WDIA 4JFWA 3X1BA 4Z18A 1GGTA 1MIEL 4DPBX 3IXAB 3FT2A 2V3DA 1ACYH 4Y5XA 4YWGH 43CAB 3WFHA 1E8YA 4BM7A 2DDQL 5E7FA 5DT1L 1ET8A 3U1PA 3FBQA 2I07B 4FQLL 2DAVA 3GBDA 1KBGH 2IXQB 2X4NB 3RFZC 4W9HC 3V0JA 3B8YA 1S2EA 1E90A 1BAFL 2W1NA 4PIRF 3CC1A 4XMZA 5IBUG 5A2IH 4R26H 4PCTA 4Y4KC 1MELA 3REWB 4WGKA 4C83B 5CZVH 5IP4A 1URIA 3EDKA 2XTJE 4EI6A 4AQ8A 1GVIA 1M7IB 2X6MA 4ZAKA 1HFUA 4L5FE 2HFEB 5F6HI 5J6HA 1A3ZA 4KQ3L 5I1EH 4JFQA 4IMLA 2Y2WA 5ICUA 1UWFA 1I7TB 4MAYB 1NCUA 3HMXA 5IB2B 4B9ZA 4UYQA 4KWUA 2EVHA 1JGIA 3LZLA 5AG9A 5EO9B 4EXKA 1A7OH 3QQ9D 3PIQB 1NGYA 4L9LA 1GAFH 4CBZA 3VXQA 4R4FL 5B39B 2ZPKH 4OLWH 5DZJA 1MRFH 4XRCB 4QR7A 5F1KC 12E8L 2YRPA 5GZNC 1RSFA 5DRNA 3R1GL 1OVZA 3PABA 1D2PA 1YMMA 1OV8A 1EJOH 3WCYA 2ITCA 2G4GA 2LFEA 3ARDD 5EZIH 4JDZA 4D7BA 4YDLB 3H9SE 4I77H 1XGTA 4ZXBB 2FBRA 4UINL 3ZSTA 4AYBA 2A4ZA 2G2RA 1ID2A 5MEPB 4ZO7A 5EPMB 1ND0A 4W9GC 2RH0A 3FONA 1R24B 1ORQB 2ITEA 1BIIA 3ZE0B 3DNKA 3NESA 4F2FA 3Q5TA 4H26A 4NN6B 1AC6A 5TDPA 3ATBA 4JFEE 3F5WA 3D52A 2DH2A 3E3QE 3FU6A 1PMYA 4JUTA 4WV1C 5HGDA 4N0YL 3OAWA 2ADYA 4KX8A 5KJRL 4ODTL 5H94A 2BSTA 5IR1B 2WKGA 5A3ID 4BFOA 3H55A 4EQ2A 5HYSA 1GRWA 1SHSA 2I7OA 3VFGH 1XGUA 4HGWB 3X14A 2H6PB 4JN1H 2WWNA 4IRJC 3DRTB 3QUXB 4LHUA 2Y24A 1Q9OB 3D0LB 3ZHDA 5LJYH 2E7LA 2PP7A 5CR1A 4P4RB 4K3EH 3IPBA 3ARFD 3VI4F 1IGIL 3BUBA 2AQQA 4ZMLA 2XYBA 1IGFL 3RNQB 2VGLM 5D2LE 4NN5B 2E8YA 1SZNA 1IKOP 1U8OA 2O30A 2O5XL 2WXMA 1AFVH 3IDIB 4HPYH 1XD0A 3KPMA 3A6CL 1IC7L 1KV7A 1FNSH 1J86A 4U1LB 4HD9A 4JCMA 4LLUA 4WVRA 2YXVA 4YK4C 4P99A 3DA0A 2APTA 2GCYB 3DJZA 4L4VE 3WNKA 1BVKB 1ROWA 1ZVHA 2P7TA 5KWYC 5F2FA 1M42A 1NBQA 1IKFH 3UTPE 1E7VA 3EZJB 1X7SA 3QRLA 1CYXA 1ACCA 3EJSA 3BD5A 3TO4B 3B1UA 3QNZB 5LN8A 5D70L 4MNGB 4XBMA 1EHXA 5BXFB 3RAJL 3HZVA 3MNWA 3GRWA 5HHXL 2MCPL 5IQ9B 5AWNH 4P5TD 1SRDA 2B16A 1I1AC 1ET5A 2EECA 3GK8L 3GMPA 4NQCA 1QFWM 3LZPA 4ZRGA 5E1AA 5C08E 4YHNB 2Y7QB 4OZFG 5HJBA 1QRNB 4ZPVA 1C08A 2FB4H 5T3ZL 1H6TA 2HTLD 2PXYC 1DSFL 1KLFA 4K3GA 4P2YA 3QSKB 4X5XA 3FCUB 3STBA 1KY6A 3IT8D 3LRSA 4MA3A 2FX7L 4PJ9D 2VDOL 4NS0A 1WFUA 3KJ4B 3RTLA 2NOYA 5AVUB 3KLDA 5I5RA 3L95A 4Y88A 5DU7A 2QSCL 4XOBA 4RDQF 1UM4L 3OKOA 5F71A 1DJGA 1EPFA 4K8RL 1BW8A 4JFDE 5D1XB 1MFVA 2PPAA 2JELH 2W59A 3LXUX 4EPSA 4OSUL 1OD7A 3E2HC 3CFCL 4BFGA 4N9GB 4AQ1B 1HK6A 2CHNA 4N6RB 3GUFA 1FL3B 1U8QA 2LQRA 2K3TA 2APVA 5FKAA 4KZCA 4BQ9A 3FOMB 4NDMB 3KYNA 2ZSVA 2WIMA 5ACMA 1BYNA 5BV7L 3BSGA 3VE0A 3WEAA 3BJLA 1Q0YH 3ULVD 2QQNH 4HWUA 1T1WA 2M26A 4WWKC 3EJTA 4OLUL 1S7SA 2R15A 2YK1H 3U4KA 3HRZA 1KBWA 3O2WH 2IAMD 3ARBA 5DFWH 4ADJA 5HHQB 5C0BB 5BVJA 4Z5RB 1H8LA 5B3SB 3T3PE 2WKLA 2GJ6A 5KTEL 1M2VA 2B8OT 3FN0L 4QRSB 4XODA 4ZUVB 4G42B 4M4PA 5EUOE 4C8XA 4U2ZA 1JWSB 2BCMA 1PZ3A 4P2OC 3VVWA 3MJGX 2DM3A 3DX9B 3MV7E 5IJKA 2ZCHL 4JDEB 2NY2B 5E9DD 5B38B 2GC4C 4W9JC 3FO1A 3MAWA 1KLGA 4QWWC 1T6BX 2H6UA 1BFVH 4ZO9A 1YNKH 1P9MA 4HS3A 3V0HA 1CR9L 3KPSE 4EJ1C 4WWNA 1RZIB 1ZT7B 1PYWB 2NY1D 4LPXA 2WLZA 3CMGA 2YD5A 3ZDXE 1OGSA 3TASA 2YAOA 1C7SA 1A4KB 1EZLA 2AI0H 2DLFH 3L9RA 1CI5A 1A6VH 2XWJB 4OFKA 4NOFA 4KJPD 3D9AL 5TE7L 4XCCL 5HHNA 1WWAX 2FT7A 1JI2A 4FNTA 5DZVA 1Z3RA 2KZWA 2GJJA 1E9QB 2ZUUA 2ED6A 2W07B 3KDMB 4OKDA 5KS9F 5FFLA 5BRQA 7CGTA 4ODBD 1XGPA 4XHQA 2OW6A 3NIGB 1AANA 1PD0A 2VRKA 4ZO6A 4PJHB 5F6IC 4AYDC 2JKSA 4IW4C 1YEIL 1OWRM 3GTTA 4MDIA 4AI7A 5AW0B 3LTVA 5HHVL 1IAII 3CLFH 2VRAA 4RX4A 2YUXA 3QUGA 2NTFA 3L17A 2WBJA 4JE0A 1FIGL 2GK2A 2VXUL 1NANH 4RDBA 4FXGB 2Q86A 5SWSB 3BEVB 3IDGA 1L9QA 2YOCA 1MFBL 1IUZA 3UTSA 4OZHB 3C12A 1AHWB 2NXYD 1QFOA 2BY3A 5I8KL 1N59B 3B6SA 3SJVD 5JYLA 3ETBF 3OJMB 1WFMA 2J1KA