1F58H

Igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
228
structure length
228
Chain Sequence
DVQLQQSGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMGYIHYSAGTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAREEAMPYGNQAYYYAMDCWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing fabs.
pubmed doi rcsb
molecule tags Viral protein/immune system
molecule keywords PROTEIN (IGG1 ANTIBODY 58.2 (LIGHT CHAIN))
total genus 42
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 1998-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f58H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f58H01
3FZUC 3I75A 4DGIL 4ZO6A 1KLUB 2JJSA 5IHUL 1H3XA 5EUOF 3RWGB 4GUPA 4ZXBA 1RK1A 1NBVH 3A6CH 1XIWC 5EOTB 3G5ZB 4U1JB 1YN6B 2CUMA 3ZO0A 5GJTH 3VXSD 1XR8A 1G9NH 3IDJB 5EU5B 3EYOB 2KKQA 4BSVB 5EOTA 1NDGB 2LTQB 2XN9E 4HIIB 1XGUA 3S36X 1A0QH 2IH1A 4GT7A 4MD4B 5C0FA 2X1OA 1FBIH 4HKJA 5LAXA 1SMOA 4LP4A 3QWQB 3I75B 2NY2B 5D7IF 5EZLA 4TNWK 2YOCA 4NHUB 4NO0D 5KVDL 3IXAB 3ZSTA 2W0FA 3D48R 4RFEB 3ESUF 3O9WD 1PYWB 4Q6IC 2MQCA 1IARB 2X1QA 2VDRL 2VISA 4Y4FB 5LCVH 3VXUB 3CLFH 2YKLL 5F7UA 1DFBH 4MZ3A 5T3XD 4XXCA 4R6UA 1DBBL 3QFJA 3R1GL 3TT1H 1KENL 5I9QB 4G6MH 5BS0E 1YEHH 5FYKH 5A40E 2O5ZL 2XQYG 3EHBC 1QZ1A 4MAUL 2H9GB 2KZ1B 3VD9A 2BVQB 5HYFA 2ZUUA 3NFPB 3WHE0 4JJHA 1FQ9C 4BH7B 4UZGA 2BRRH 1D9KD 1Z2KA 4L4TB 4QRTA 5DMKA 4WO4D 5EH1A 5FO7B 5C92A 4HPOH 4FFWC 4NBYB 3WHXB 5FHBL 3MV9E 1KCVH 1W2KT 1A6ZA 4ZTOH 4LSVL 2APFA 1LD9A 5HDBF 3KPPA 1G0DA 4IJ3B 2IMNA 4JHAH 1RK1B 5D93C 1KULA 1I3GH 5DK3A 3V4VH 3AS1A 5IOPA 4YHLL 4R0LA 3BKMH 4ZSOE 2ADGB 3U1SL 3HG1D 1V5JA 5HPMA 1IL1A 3K46A 4Y4KA 2YSSA 2ZCHL 4FXGB 5E1AB 3LKNA 5DGRA 1DUZB 3FQNA 1NC4B 2QHLA 4GW1B 4M43L 3U6RB 3NMEA 3EIFA 2AGJH 5F6IB 4YEEA 3MPCA 2DTMH 2CH8A 1NGXB 4K94H 1EO8H 3TCLB 3M45A 4PJXE 4ZFFB 3NACL 3TJEH 3BW9A 1F13A 4JCLA 4UT6L 5GSRA 3VGDA 4DW2L 3LN9A 4JRXE 2CLVB 3HNSL 3LQAC 1QQDB 3WFCH 1TQCC 1TVHB 2EH8H 2ZSVA 4GG6B 4G42A 1YC7A 4RZCB 3RZCB 5CINL 5B39G 1CE6B 1GIGL 3T8XA 4TSBL 3HC4L 4NM4H 4GLRI 5GGVL 1XGQB 4H0GA 3O4LE 4LVHC 1OGTA 3R06A 1KG0A 4N1EA 2LQRA 4MAYA 3LHPH 3ARBD 3C5ZC 2CRMA 2O61B 1N7ML 4JO2L 2VLJA 1A4JB 3AAZA 4P5KA 3WXWL 4O00A 2JJWA 4ELMB 2Y06H 4IOIB 3CIQA 3UX9B 2VQUA 3IJYB 2XXCB 4FZ8H 1DVFD 1P6AB 3ALXA 4J3OC 4OFPA 5LQBH 4JR9L 5DQJB 3IAGC 4IRSC 3ZDZE 5EIVA 1FSKB 3IKCA 4P46D 4FQHA 4G6FB 4OZIE 4FZEL 3IDXH 3JWDC 1ZLSL 5F70A 1KPVB 3BRFA 5K9OB 2I24N 4CMMA 3RGVB 3EYFB 1J8HB 1WZ1L 4YHNB 1P2CA 1NAKL 4YQXH 2YUZA 1A7NH 4WDIB 3T0VA 3TCXA 3WNNA 3KYMB 1J1PH 4U1KB 4XCCH 2A83A 3H42H 2DQCH 4Z0XA 4XVTH 3IFLH 1ZLVK 2NNAB 5DVNA 1A4JA 3PV6A 4UQ2A 1UVQB 5E8EB 1EK3A 4MQ7A 5EPMB 5C6WH 3O6FB 4XCNB 4WV1B 1B2WL 2W07A 4U1HB 1CE6A 1DL7H 3DYMA 1OAZH 2BHYA 5E70A 4FRWA 4ZUVB 2XKNA 3TH3T 2L4OA 4PS4H 1F11B 4R4ND 3ULUD 1S8DB 3NCMA 4BQ9A 1RJZA 4RISL 2UWEE 3WXVL 1CF8L 3IFNH 2YPKB 4XWGL 3D3VA 1Q38A 2OZ4H 5DK0A 3TCLA 1CFVH 1DBJL 1UZ8B 3FO0H 4MSWA 4XNYL 4HKZB 4PYHA 3TN0D 1XIWA 2HA1A 2IMMA 4YHYC 3H9SD 1NGWA 1VFBB 5CEXB 5I9QC 2VDOL 3HKFA 5CZVH 1RVFL 2ED7A 4LHUD 3HI5L 4JY5H 3NIDF 1RIHH 3U4BH 1ADQL 4OFKA 1NEZA 2VL4A 3HNVH 3BJLA 4FQHB 1GGBL 3VWJB 2QL1A 4DGVH 1X5IA 2ZOKB 1S7UA 1QLFA 4BQ8A 1IGIH 2GIYA 2R0ZH 3QHZH 3JVGA 2R4RH 1T2QH 5A3IC 1S7TA 5DRWB 3EGSA 4HWBA 3AXLA 3MJ8B 2N7AA 4F7TB 1CFSA 1AR1C 1T80A 3IS1X 1FNLA 4CU6A 1I7TA 1PVHA 3LZFH 2NY3B 1KJVA 4TUJB 5FUOL 4FP8L 3CH1B 1I1RA 4HLZH 2H6PB 3BESR 4HH9B 5DJ0B 5GRZA 4FNLL 4W4OC 1X5HA 1EAPA 3KXFB 5TDNA 1BWMA 3UJTL 1J10A 4R4BA 3EDEA 2BDNL 2BVQA 1INQA 3CFCH 2QHRH 4KGLA 2VDQL 4PRDB 4YK4B 4YXLL 4EKXA 3MGOA 5IFAL 1I7RA 4JFOA 2VABB 2M2DA 3O8XB 3QWOA 4D0BA 1R3JB 1QVOA 4Y16A 3GIZH 4OGZA 4BA8A 3VXUA 2DD8L 4WY7L 1JF1B 1HXMB 5C6TH 2AXJA 2W60B 5DRNA 1U8NB 1Z5LA 1E6JL 1U8NA 3K8LA 3QH3B 3DX8A 3MV01 5C0RH 3ULUE 4UDTA 1C5CH 3S35X 5F1IB 2NR6C 4KWUA 4PJHB 1LK2B 3JV4B 4JANB 3BHBA 3O8XA 5CBEB 1WZLA 2LVCA 1NC4D 2ADIA 4W4NA 2ENSA 4LLUA 3QEQE 4PG2C 4TPRL 3GMPB 2VLJE 5I0DA 3N85H 2QQNL 1BFVL 1J8HE 3AM8C 3HE7B 4M1CD 3ROLA 4LPWA 1MY7A 2X4OB 4PJCB 4X6CE 2IFFL 2VTFA 3KYOB 3LPWA 4U3CA 4GFTB 2CUHA 3SO3C 4WVRA 4HUUA 2Q6WB 1A9BB 4M7JL 1TQBC 3ESVF 5EZIL 3B9KB 4PG9B 4HG4J 1RZIA 2YRZA 1JPTL 4GAJL 4HUWB 3EYQD 2V5TA 4TNWF 3QH3A 4ODSH 5IMMB 4FQ1L 1FL3B 2IPKA 3NFPA 3C9NB 5MEND 3SJVD 1HXMA 5HHXH 1QFWH 2B4CC 3CVHB 1HKLL 2F53D 1ZSDA 4G43B 5F9DC 3I84A 5DRWA 1K85A 4JO1H 3QP3A 1NCUA 4F7MA 1GVIA 4GW4B 4MNQD 3SGJA 2R69L 2BVUA 4RWHA 5TE6H 3NA9H 2DI7A 1JWMA 2R2BB 4LARL 1E4WH 1AHWC 1TFHA 4A2MA 4KRNA 1OD9A 5CJXC 2D2OA 3RFZC 1AO7A 4JFPA 4N8VB 1ORSB 5C07B 1JHLH 2NY6D 1N5YL 4Z7NE 2E9WA 4RFEA 4ELMF 2OL3A 2JJTC 1KIPB 3JTTA 3QIBA 1XGPB 1DBAL 1NAMH 3TZVC 1XIWB 4L3EB 1TCMA 2IGFH 5T1LB 1B4JH 3MNVA 3VFRB 5IT2H 4HIEB 4JRYB 4K3JH 4PLKD 1CI5A 1GHFL 4KTDL 4I5BB 1AGFA 4KY1L 4IHOB 4J3UA 1RJZB 4U6YA 5CZXD 3MRFA 1BBJA 2AS5M 2V17L 3IDJA 1AC0A 3IDUA 2KH2B 4L8DA 1MVUB 1UGNA 1SJHB 1YNLH 3TVMB 4I48A 3VXPA 2BNUA 3GEWB 4TRPL 3MYJA 4L4VA 2IC2A 1GGIL 4FXKB 3JTSB 4G8EB 3VXNB 4U1MB 2OZ4A 3GNMH 4U31A 5LG1A 5IT2L 3SJVB 4BUHA 1SJVA 4IRJC 4EQ2A 2VLKD 2CGRL 5C08D 3PP4H 3K8MA 4Y8AA 2CRIA 4X99B 2AK4A 3HLAA 4OF6A 1UM6H 1D5MA 3ARDC 2ADJB 2EDJA 5HGAA 4JFXA 3SKUD 4FQ1H 3UTPD 1P84J 2RCSL 3T0EE 4Z7UE 4FQIL 4AH2B 2CLRA 4P5TB 3SE9H 4WV1A 1IM3B 1MIEH 2A74A 4XHJC 3VGGA 3L3JA 4MQ7B 2OTPA 3PDGA 1Q1JH 3H0TB 3MRLA 4ELMA 2DBLL 5HTSA 3U9UB 5I71B 2NNAA 15C8H 2MHAA 2X4UA 1GAFL 2ZUQC 4P3DB 1VA9A 5JR1H 4TTDD 5ACZA 2CO7B 1WIUA 2E6JA 4N0CC 5E95B 2P5WE 4OZGF 4UNTA 5HHOB 2ERJB 1OOAA 1DQLL 2V6HA 5IW3A 5FYKU 5MP6H 4RWYL 4RMRA 1AJ7L 5IMOB 2VLKB 4GXUN 3IKCB 4TOYL 3DXAA 2UUDK 4UTAL 1MCLA 4PLJC 5INCA 3WFEL 2NY5L 3NH7L 3AS0A 2MPAL 4CVZB 5J9PB 1F58L 3B9AA 1ZXQA 4MCZB 3T0AA 3UROR 5KS9B 4J23A 4NBZB 1L7IH 5E94B 3VFOA 3VXRD 2AEQH 3GJEB 4Z95H 5E08L 4JDVB 1HQRA 3U7YH 1PLGL 1LEGB 5T1KA 3WV0A 1ERNA 1CL7I 4Y2DD 4G8EA 3G08B 3B5TA 3P73B 1B0RB 5HHMB 3MRQB 2HJKB 4NQVA 1Q1JL 1RSFA 5BO1H 1TJIH 2P42B 1X44A 1QSEB 2ARJB 5FK9B 2F5BH 4D9LH 3IDIB 4GRMA 2OR8A 4P4KD 1B6UA 2CLVA 3SO5A 3VFSA 3ARUA 2E7MA 5D72H 4P4KC 3IDNB 4HZLA 2FO1A 2VR9A 3FRUB 4PR5A 3A6BH 5EUOA 5ICXB 3DMMA 5C7XL 3V0VA 5FHAL 3FQRA 4JN2B 4JZOA 4LLYB 4PD4J 5DHYA 4CN1A 2EICA 4QRTB 2BSTA 3KPMA 4X6DF 3MACH 1FNEA 1DANT 1A6VL 4QHUA 2GK0B 4PGCB 5D2LB 2J8UE 4JFPB 4N8VA 2XZQH 4Y4KC 3EO1A 1T2QL 1GOFA 1SY6H 4XC1L 3I9GH 4LVOC 1IM9B 5HPMB 5DLMH 4FN0A 5GRUL 5LKNA 3W81A 1WCBA 3F62A 4MA1C 3DUSA 1MY5A 3P0YH 3QIBC 2FEEL 3GSQA 3GSUB 2BHZA 2NY4C 3H9SB 4GKNB 4YO0A 3ETBF 1RIHL 1T3FA 4O5LH 4PYGA 4AEFA 5KN5A 4L29A 2YZ1A 3B8SA 1UZ6F 3C9NA 4M03A 4RISH 3MZTA 4W81A 3SDXA 3F6IA 25C8H 2UZYB 1AQDA 1HKFA 1NCAH 2JIXB 3P40A 1VSCA 1V7ML 2W38A 5TPWL 2BVOB 1OAZL 1CIUA 3FHQA 1J05A 5IR1A 2PW1A 3MYJB 3VDBA 3HPJA 5DMKB 3I3EA 3D18B 3DTXB 3PGFH 1XGUB 1S78C 2DWEA 1OP3K 4D0CB 1XR8B 4WW2B 4P46A 4X6DA 3BRGC 2VXUH 4Q2ZB 2HT4D 2YD9A 3T65A 5J12B 4LLUB 4RGND 2A73B 1MUJA 4YDIH 5CBEA 4R7DB 3IDYC 3O9WC 5H2BB 2VISB 3ILQD 4K23L 3LEYH 3PQYA 3GRWH 3RIAF 1TJHH 1YEIL 4K7PY 1EZVY 1OTSC 1PYWA 1J1PL 4NSKB 1HXYA 1BP3B 3CK0L 5K9KB 4J12A 4M1DH 3ZKXB 1A64A 4Y16B 1JPTH 4GAJH 1IQDA 1U91A 2JB6B 4XZUA 4MD4A 1LP9A 1JNLH 2NLJA 4BZ2H 4KRLB 4X9HA 2YPVL 3RKDC 3WL9B 4K71C 4WW2A 3IFPA 5JPMB 2OM5A 2OR9H 2GUOA 3LQAH 2NXYB 5LXGH 1G6RH 2VQ1B 4U6XB 2A6IB 2CUIA 1FZOB 2XIDA 3VDAA 3B9KA 2XICA 1K3ZA 1NJ9B 3Q3GA 3WXWH 5CJ8A 4XVTL 3KDMB 1MQKH 1CGSH 2JIXA 4JPWH 3GK8H 3LS4L 1F6AB 4X8JA 3P0VH 2WUBL 4ORGA 2CQVA 4PJCA 3QI9C 3HNSH 5IK3B 4R97C 4LSSH 4QXUL 3STLA 2VLRB 1JZ2A 2R1WB 2WUCL 3Q2CA 2AKRB 4U7KA 5A2LH 5I8EA 4WY7H 3W9DA 1NBYB 4K3HA 3WN5B 2GT9B 5C0AD 3PXJA 2ZOKA 1SJEB 2B1AL 4QYOB 4GXUM 5IGXL 1A6TB 4J8RA 2F8XC 5DJAA 1GGCL 4L4TE 4CMHC 1T6VN 1MREH 1F8TH 4JFEE 1JHTA 4XPTL 5MENB 2ITDA 1TNNA 1FNGB 4J3TA 4G9FB 4N90D 3TH2T 2RHEA 1HYRC 2EIZB 2FL5B 4JN2A 4D0DA 4I0PC 3A0OA 2CRYA 2XY1A 1CXHA 1K8DA 1D9KA 1TZGH 2LABA 3IDNA 4HZLB 3RUGA 3MRJA 1CR9L 2FJFB 2QR0B 4M5YL 4Y4FD 1DBML 3BMWA 1INQB 5IBLC 1QR4A 3QUYB 4Z7UF 3K4DA 2PYFA 3NIGF 4APQC 4ZUVA 1INEH 4JFDB 1D5IH 1U58B 4QRUB 2W9DH 3U48A 5I66B 3CU7A 2E9BA 4XNZB 4XXDB 3UTSA 4APQB 5I1EL 3ULUF 4LSRH 4QRQA 4HIHA 4LDOB 4K8RH 1CD9B 3DETD 4ZOBA 1GGBH 1BM3H 5E4EB 1HNFA 5GS2D 4I0CC 5EN2A 3SDAB 4P4RA 1FFPA 4P9HC 5M94B 2Q76B 3GUTA 2CDEA 2W9EH 3P77B 4ISVB 5IMKA 1RJYB 4YEFA 3G04A 4LLDA 1XGRB 3GJFA 1RUQL 1BVLB 2X4NB 4TULH 3VXME 2OXHA 3RZWA 4OLZL 3MLVL 2XRAL 4ZPTA 1NDMB 4JPIA 1VB9A 5DTFB 4GKOA 3MJ9A 5CSZB 5KVEL 4Y16C 3NZHL 2ADFH 1WTGT 4QLRA 5IW6B 5LCVL 4LBEB 1DZBA 4LSVH 2NY4D 2VZ1A 2Q76A 3GUTB 3CNKA 4BSJA 4C56D 4L9DA 4HBCH 5ADPL 4GBXA 1HHHA 1RD6A 3H9HA 5C0EB 3U9PL 1DQTA 2DLFL 4MX7B 3O2DL 5JNYB 2AJYL 3GSOA 4XAKE 3IGAA 4POZD 5EOQH 1I7ZB 5MERB 3CLEH 2BMKB 2X9WA 3C6SA 5SWZD 3UEZA 4TTDC 3SDCA 5C9KA 1SY6A 3RZCC 3RTQA 1I1AC 2KQMA 5L6YH 1BWWA 1YPZB 8FABB 4KKBC 1EVTC 3TBYA 1IC4H 3ARRA 3AREB 3ZE0E 2H2PD 1RULH 4JJ5B 2FJFA 2DM4A 5KW9H 2X4QA 4U1LA 1KOAA 1D9KB 4M6NL 2A83B 2AK4B 1EZVX 2DIBA 5I8KH 5I16B 1W0WA 3KHOA 4PJBE 4H88H 5ISZB 4Z8FH 1Q9LA 3MRBA 5C0AA 4OQTH 4YX2H 1MCWW 2PW2B 5ETUA 3SPVB 2BERA 3PIQB 5I1CH 1AGCA 4G8GE 3O11B 3CDGA 2Z35B 1C12A 1U8IB 5FUCE 1IL1B 1XT5A 4HX1B 4RIRA 1IGML 5EIQA 1BZ9B 4JG1H 3OKKB 5EO9B 4MJIA 1QUNA 2R0LH 4HS6B 2Z31D 3WFHA 4WI5A 3KPRE 4TSBH 1E4XI 1BM3L 2DN7A 2VRAA 4PJCE 5C0CD 5FYLH 2J6EA 5I0ZA 3BOVA 2FYYA 2D0FA 4ZFGH 1R3HB 4DCQA 4IBLT 4LPXA 3V5KA 3WSQL 1T1WA 3TP4A 2V5YA 3P30L 3NACH 3TJEL 2L0DA 3LKOA 1ZMYA 4ZSOA 3OAZK 4I9WD 5F21B 3KPQB 3TBVA 1XCQA 4NP4L 4DZ8A 4KHTL 5DFTA 1URLA 4OZIF 3VA2C 1IC5H 1OLLA 3FT2B 4L8CB 3LD8B 1RPQA 1XF2B 4LCWE 1NEUA 3LD8C 5DC0A 1IQDB 4U0QB 4F3FA 5GZNC 2C1OA 1RIUL 1ZLUH 1KTLB 5HGBA 2N56A 3VRLE 3R0MA 3ZTNH 2CSPA 2FH6A 4YNYB 1S9VA 2NXZD 4TSAL 4C59B 3SKJH 5JOFA 1OWRM 4F8QA 3LEYL 4HS3A 1UKQA 5BZWB 3BUYA 3HMXL 4QOKE 4RFOL 4GRWE 4NQDA 3GK8L 1AR1D 4U7MA 5IVZB 1WIPA 1KJ2A 5D8JL 2FD6H 4KVNH 1IGMH 5E1HB 3OAYK 1C08A 4N9GA 2ZUQB 3D18A 3UO1L 4R0LC 1YY9D 1YEGL 4JFQB 4KJWC 4JPKL 1ROWA 1T22A 2X4SA 5K59E 5D9SA 1KENH 5JO5A 4LSDA 6CGTA 1N3NA 3WFDH 2DLIA 1CK0L 5CSBA 4PJEF 4QCIB 3V8OA 1CE1H 1QR1B 1YPZF 1OY3B 5TGBB 4ERSL 4NQSB 3A67L 1NCBL 1S7SB 1B0WA 1JGDA 1MHHB 3I6KA 3GSQB 4LFHD 1I7RB 1P7HL 1QRNE 4IOFD 5DA0B 5K9JH 3MV7A 5TDPB 2V2XA 1BIIB 1HIMH 4NZDA 3IU4L 4KU1A 5D71L 3G6JE 1NC2D 4WNQA 1GOGA 4LCUA 3K74B 1DTUA 1HWGB 4PJ8D 3Q5TA 1N4XL 1NBVL 4P4KB 4JZOB 3QEHB 3GSXB 3RP1A 4Y4HA 3EZJB 4RX4D 1LE9A 1U0QA 3IJHA 3X3FH 1DEEA 1ES0A 4PJFB 2FYYB 5HSFA 4HXAL 4PV9A 2W65B 5DUPL 5C0JB 3HG1B 4DKFH 4QHNA 2Q7NA 4ODXB 1QBML 1RZJH 4ALAL 4HG4K 1I1AD 1NMAH 1A02N 3MV11 3HZVB 3UBXI 3HG1E 1DQDL 4MNQA 2ZJSL 4AQOA 5FB8B 1T83A 3H8NA 3WLWC 5CEXA 5BOPA 2FSEA 5BVPH 1JFQH 5JUEL 2DYPA 4OZFA 3U7YL 3CVHL 1DE4A 3MJGX 5E99H 4LLVA 3RPIB 3ZE1E 3HE6B 5C2BH 1ZHKB 1N2RA 4PLOB 1F58H 1X6LA 4JJ5A 3I02A 2M1KA 2AXFB 4GRWH 1WWCA 3VH8A 4HDIB 5F1NA 1TVDA 4M9OA 2IQ9L 5J1AB 4PJFF 1INEL 4ODTH 3ULVH 4ZPVB 5EWIH 1FRGH 4NCDA 5C7XH 3SE8L 1NFDB 2VQTA 2YZ8A 4M61A 4RWYH 5JDJA 3NABL 3P11H 2WNGA 5I71C 5AD0B 4JKKA 4P3DA 5FKPB 2YUXA 4I3RH 1UWGH 5AYUH 2Z8RA 3FB5B 3MBEA 3H9HB 4XMKL 1MVFA 1NBZA 1QOKA 2WLZA 2EYRB 4Y1AB 2D3VA 5BV7H 1G9NC 2YK1H 3S9DB 2HLFC 3LQAL 1BQHB 5IHZB 2ZP0T 4AJ0A 3TH4T 4S1DC 4FS0A 5B8CA 1B88A 5GRXG 1N59A 1AE6H 1S7VA 3QEUB 4UILH 5CBAB 1OTTD 2GJ6A 5DJYB 3FONB 3BQUD 4ZTPH 3SKMB 4K55A 3JV6B 1PEZA 2EDFA 3GMOA 4EUPG 3IDGB 4BQ6A 2VLLA 2DM7A 5DMJB 4JDZB 1CU4L 2DQIH 4ONHA 3LS4H 2GITB 3L6FB 4XVSH 1YZZA 3V4PH 5FM5O 2P43B 1Z9OA 2QLVB 5D1QB 1SEQL 3VXOA 1OP5H 4F7EB 2XN9A 1UH2A 3RWDA 4X7FC 5FO9A 3K4ZA 2WANA 1H8OA 1OGTB 3EFFA 2PN5A 3HPLA 4FQPA 2OTUB 1RV6X 1BQLL 2ICWJ 4QRPA 4L8DB 1AY1L 2E7HA 5D6CA 2MCPH 3DX6A 3C5ZD 3LN5B 3LSOB 3N9GH 4XC3H 3KLAA 2AJSH 5E8DL 2OQJA 3O4OC 3TA3B 1YEDA 1IGJA 4JHZA 3PWVA 4Z7NF 3O2VH 5IJVB 4X8XA 4JRYA 3RRQA 5KSVA 2HWZL 2VC2L 2LU4A 4KTDH 3MV7E 1L0XA 4UI2A 2BVEA 5GGTH 3SGJC 1KIPA 1X5LA 5D7JC 1AD0A 4G6AD 3EDFA 1RJLA 4HQQL 3QG7H 4ELME 3KNBB 5FF6A 1W72L 1EO5A 3U82B 5J3HD 3DIFB 1F45A 1MH5B 4UINL 2Z9TA 4O2FB 4PJ7B 1IKFH 4F15B 4DGYH 4M6OL 1KTDA 1V3JA 4WUKL 1IGCH 4YC2C 4OTXL 4WI8A 2XA8H 3CVHA 4PJDF 3SHSA 3C6LD 5B4MC 2HRPL 3QXTA 4CVXB 1EIBA 2QKIB 4YHYB 4C56E 5HHME 3BPCB 5H37G 4JVPA 3V5HA 1YNKH 1ZS8B 1QFWL 3WEXB 1EX0A 2APTA 4MJ6B 4POZC 3T2NH 3KWWA 3KDMA 5CZXC 3MRRA 3TESA 5FDWA 4WFHD 1T1ZB 5KSBA 1YNLL 3CUPA 3MV9D 1L0YA 3BIKB 1R5WB 4U6XA 4JVWA 4Y5XA 3QPXL 2BY3A 5EFIA 4D9QD 3MLUH 1Z9SA 3BH9B 4P2QD 2Y23A 3HRZA 1T1XB 3VRJA 1TTFA 3HZMA 1ZANH 1RZKC 1DLHB 4KK8D 2JJVA 4X6BA 2H9GA 4NHCL 1EJOH 4K3DH 1KPUB 2YD8A 5EC2A 4ODVH 5CGYC 1HDMB 3QCTH 2JB6A 4XZUB 3UJIL 4BZYA 2XZQL 3KJ6H 3HHRB 3WIHL 5EU6A 2J5LC 1YJDL 4Z7WB 4G6AC 1N5YH 4I0PA 4R3SB 3V6FB 3OR6B 2Q7YA 3U0PA 5DVOA 1BX2B 3S37L 1MEXH 3IXAA 1HI6B 1RZ8B 5GGSB 4EN3A 3DHMA 1WV7T 3MRPA 3QRGH 3Q1SH 4AQ1B 5HGHB 4WFGE 5MEQA 4EIGB 5SX5K 4BZ1H 1AJ7H 1F3JA 2FHCA 3N1GC 3HZYA 3WO3B 3QAZC 3QCVH 1UCBL 2H32H 4KHXH 5CGMA 2DJ4A 4PBWD 4PGBA 4PY8J 3PWJB 4XHQA 5DJ6B 4YDLC 2VN7A 4Z7VF 1PX4A 1I1YB 5F7MC 5C70A 4G8FA 3FAWA 3RWGA 1BQSA 3I6GA 5A2KH 1U92B 1KPRB 5HDQL 1MFNA 4DTGL 4KI5D 1JMXA 4XP9L 3RPKA 1BVKA 3SDCC 4QRPD 3UBXA 5DMGD 2GTZA 4IDLA 3G6JF 3HNTH 3L3IB 1FLRL 3RWIA 4WU5B 3DXAE 1KCUL 3EGSB 3GHBL 4GMTH 4GW5B 5HHMD 2P49B 1CICD 2RQ8A 3OAUH 2RFXA 1EUUA 5DT1L 1F4XL 2Y9RT 1J1OH 1EERB 4X4XB 2YUVA 4IRSB 4MA1B 5TE7L 5C1MB 4NRYA 1GAFH 1RK0B 4PJ5D 5E5RB 4J6RL 5E8NA 1WC7B 2EO1A 4RMTA 5A43C 1XZ0B 3KYKH 1KT2A 5KSBF 1FN4A 4PR5B 4P23D 3O3BB 1IGJB 2B5IB 1A6PA 1ZANL 3MLRH 1H3VA 5JR1L 2EE2A 2G9HA 1IAII 1PZ5B 1S8DA 3WUWA 1FE8L 1MWAH 3NFSH 3LKQB 3S4SA 1A6AA 4X5WA 2WZPD 5SWZE 5A16B 1ZGLA 4A6YL 4ZS6C 1IGYB 4JQXC 2AJVH 3GFUA 2HFEA 4AY0A 1HH6A 3V79C 4GQPH 4RDQF 1NCDH 1YDPA 1CGYA 1PFCA 2BOBB 1VKXA 2APBA 3QO0B 4BZ1L 3BN9C 3OXRB 5IVXF 1D5ZB 3IETB 1WFOA 3TPUB 2R2EA 2FWOA 1KCSL 4M7ZB 5E00B 3PP4L 4PRPB 1U8KA 3FQTB 3PDOA 5IG7B 3ZDYF 4YH6A 4GKZB 5F1KC 3ARSA 5GZOC 5I1GL 4MCZA 3EUUA 4JDZA 3BKYL 2EEAA 1XF1A 2JELL 2ICWI 4LNVA 5IP4A 5DJXB 3PGDA 3G5XB 3M8OH 4F7CB 3BN3B 1M7DA 1P5VA 1RFDH 5BRZA 2CGRH 4PLJD 5SWSB 3ARXA 1UB5B 1KLFA 2VDKL 3OL2A 2NY6C 3AY4C 2R8SL 1X7QB 1N59B 4RCAA 4DFHA 3KJ4C 2BNQB 3EOTL 2GY5A 1P84K 3W39B 3T4YA 1T03H 3CDFA 4S1RL 2Z31B 4MVBC 3S35H 5JIPA 1GYAA 4XWGH 4MNHA 5EOCH 5C0CB 5I1DB 1OQOA 3JSSA 4LOUD 4ZFZA 5DUMH 5FECB 4Y1AA 2EDNA 5B4MD 2A6JA 4KTEH 3ES6A 5DDHB 2ZKHL 4NRXB 4ZUTA 3SDDB 2DMBA 1KB9J 3K1KC 4JG0L 3KPSE 3DURB 3BAEL 2LTQC 5AD0A 4F2MA 1HSBB 3ZSSA 2V7NB 3O3UN 5HYEA 4NC2B 1VENA 5AYQA 3BGFB 3CCHB 1E4WL 1T66C 2CDGB 3NCFB 4RZCA 3QT2A 3SKNB 4CRPA 2X4RA 2QQQA 1AGDB 1UH3A 4H5SA 3P4OA 3V4PL 1L6XA 3PGCA 3N1QC 2FJHA 1EMTL 4NQUA 1EVUA 4N5ED 1EXUA 3SBWC 1UENA 1W72H 2FB4H 5EO0B 3S3PA 5TF0A 1BHGA 2CKBA 1DE4B 4OKVA 1E6JH 4HS8L 3QB7C 3BH8B 3SO3B 3D25A 4M7JH 3OKLA 5KAQF 5B38B 4X6FA 4LU5L 4JQVC 3T77B 3O2VL 5DURD 2F15A 4QHMB 3S96B 5ELIA 1HH9A 1KNOB 4Q7DA 2GJ6D 5HI3C 3EDKA 2QQNH 1NFDF 3D0VA 4O2CB 3MC0A 2CIKA 4RGOL 3OB0H 1R5VB 5INDB 5ESVB 3V4VL 3RGHA 5I1JH 2YD2A 4FTVD 3OTTA 2FLRT 3CFEA 4NIKB 3WFBL 1A6ZB 3EAKA 3ULVD 1LO0H 2VXVL 1WZKA 4TPRH 3CMGA 3GMQA 4JQXA 4GQ9L 4GRLB 1FIEA 2VL5A 3D69A 2HVKA 2ORBH 1KLGA 1OF2A 4I2XB 3U83A 4NJAH 1P7KA 4L4TA 5DJ8A 4M93B 2EH8L 5C09D 3NBNA 4PRHD 3VXUE 1AO7E 4OZ4A 3ZT7A 5T1DH 1AP2B 2OMBA 1WF5A 3ARTA 3F5WA 3RVWD 1IFHL 3DNKA 4X4ME 1HCVA 1BIIA 4QGTA 3RAJH 4KPHH 2BVYA 1X5KA 3OGCB 1CS6A 4NN7C 5C8JA 4UT7H 1AHWA 4X9IA 3ARDA 1ZSDB 4G43A 4TQEL 4ZAKA 3D0LB 1NGZB 4H8WL 5ITBL 1K9TA 1HH6B 5KBNC 4ZO7A 1K4CA 1ZLWH 3NIFF 3UJTH 5JO5B 1IGTA 4G7YL 4LASH 4PJ8C 1DBKH 4K7PL 1T22B 1A7BA 2E7CA 3GB7A 3IVKA 4LQFL 3DRTA 3T4AB 3FO2B 2J4WH 4XPFL 3EYOA 1WITA 1FBIL 3C08L 5CJOH 1ZWIA 4NQDB 4O9HH 2R0ZL 3G5ZA 4PTUA 1FYTE 1PY9A 4U1JA 4U49A 4L8BB 5C3TA 3SDYL 1J88A 1HYSD 3CFBA 4GRWB 1E4XL 4NQXB 5CCKH 1W8NA 4IRSA 4CMHB 5SX4H 3LMJH 2BSRA 5KTEL 1PKQA 5C2BL 2MJWA 3RVUC 1KB5A 2P48B 2JKXA 4OCWL 4R90L 4UDTB 3TNMB 4IDJH 1UWXH 1PD6A 1Z5LB 2ICEB 4HWZA 4DJMA 3U4BL 1OGAD 4JRWA 5EG6C 3MJ6A 4OI7A 3P9LA 1R3KB 3L3IA 4P9HH 4ALAH 5IB5B 3W9EA 5J13B 2CK0L 3RNQA 2EH7L 2BNRE 2F54D 4JFHE 2YMXL 1U8JB 1RUAL 2FBJL 4MS8D 4DKDC 5KOVC 1LO4L 1MNUH 4Y2DC 3GMRA 5C0DB 1N8ZA 1ZVSA 1CICB 1A1MB 5F9JA 4WCYH 3TV3L 3MJ7A 2OJZL 4U7SA 4QF1B 4AT6B 2LAAA 5GS3A 1P7QB 2GK2A 1JHKH 1FG2B 3DVIA 5D1XB 4JPVL 1CLZH 5BMFL 5CIPH 2XWJB 5DD6B 1BOGB 3DOSA 4HKBB 1WZ1H 2DKMA 2RR3A 3RWJA 1DUYB 1ZA6B 1KC5H 1AGEA 2OI9C 4O4YH 3BE1H 2EC8A 3U0PB 4X9FA 3ZHKA 1BZ9A 5HHQA 1HIML 5F71A 2WBJD 43C9B 1KIRB 3INUH 3VWJA 2Y6SC 4OF7A 4PB0L 3ZE0F 4X6CB 3HUJA 3O11A 4JDTH 3LEXB 1GOHA 4L4TD 3L5XL 3H3BC 1X4ZA 1RQ5A 3FT4A 3O9WA 3O8XD 3CVIL 4E0RA 3C6LA 1KIQB 4JO3L 3KPTA 5T3ZL 3WNPA 1HHGB 2VLMD 2DKSA 3P2TA 4RAHA 4Z7UA 5IFHH 4G6KH 2R39A 2X1WL 1YEEL 4KROB 4EVNA 4MXVE 2OTWA 1QEWB 1HNGA 3ILPB 2NY5C 3QDAA 1JGEB 1OB1B 4HJJH 1RUKH 5BV7L 4ZAKD 3HC4H 5D7IE 4YHLH 1CGWA 4KHTH 3UZVB 2YPLB 3VXQA 4WTWA 3SCMC 1ND0B 4JHAL 3MRRB 1S3KH 4AEHH 2D7MA 1VGKA 2A77L 3MNWA 3TC9A 4ZNEE 5F93C 4NFCA 3Q5OA 5EPMA 3SCMB 5HHNA 4MD0B 3MLTA 1V7NL 2ITCB 2GAZB 5J7CC 1H0DA 2EE9A 4JFZH 1CT8A 4TSAH 4X4MA 1HWHB 4LVNC 5D7SH 3FB7B 3BKCL 4OCYH 3VD3A 3ABZA 5AWNH 1MLCA 3FT3B 4XCEB 4HGKC 5FM4A 2DTSA 5E99L 4NN5B 3MRKA 2EDKA 1FVDB 2DTML 4J4PD 4ZFOA 5IW6A 4X9BA 3L5WA 1BQUA 3U79A 1YJDC 3GJFH 3O6KH 4PJBA 4HULB 5K9OA 1I9IL 2VIRB 2FIKA 4URTB 2IAMD 3O8XC 4NZJA 2UVFA 3RJDA 3BSZL 2NY1C 5T3ZD 3TFKD 4JFFA 1BVLA 1X5XA 3KLSA 5HDBE 1TNMA 3V6ZA 3S5LG 4LL9A 1SEBB 3VFVB 1AFVH 2HFGL 1MHEA 3EOAB 4HT1H 4YAQB 4UMGA 3BEVB 1NCWL 4P4RB 3PWLA 5DUPH 4YFLF 2F53E 3GSVA 4S0TD 4X6DE 5T1LD 1K8IA 2OS7A 2VDNL 3ZKND 3K2UH 3KPLA 3PQYD 3R06B 4ZTOL 3BP5B 3T3PE 4LEXL 5B21A 2QQKL 2XWBB 5FA3A 3RL2B 1N64L 4XNMB 4ORZC 1I9RH 2R0WH 4LLMA 5KG9A 1P9MA 2PO6A 4PGEB 3O2DH 1NQBA 2ZSVB 1MI5A 3EOAA 4FQLH 2BRRL 5ALBL 5LGHH 1UQSA 2AK4D 2YBRB 3E6FA 1WK0A 3TIEB 3CVHH 2DM2A 2HFTA 3MRJB 3K81A 3O45B 1FFNA 5DSCB 2F58H 4FFYH 3DBXA 3QG6A 1T7VA 4S1QH 5I17A 3QEQB 4NO2B 2G2RA 4ETQB 1KEML 1YEHL 5FYKL 4QRRD 3FRPA 3VE0A 3UTTA 4J4PC 4LSUH 1ZA3A 5J89A 3IU3B 2ED8A 4NNPL 3FN9A 4XTRC 3LQMA 1T0MB 4GW1A 4PJHE 2EE6A 3WJLA 4LCCB 2X4TB 1YNTB 4FFYL 2KBGA 1KN2L 4P5MA 3V0WL 2Z91A 3BZFB 3QQ3B 5ALBH 1U95B 3WN5A 4L3ED 4OF3A 4I18B 2XZCL 4FQCH 2J3SA 5D2LF 1OAQH 5ILTH 1I9RL 5KZCD 4PRIA 1RMFL 5F88A 3SY0B 3MRMA 4KV5F 2GFBA 2H1PH 3O6MH 3CFJB 5EUKB 1VGKB 4M9PA 2FGWL 3BD5A 4OZIA 1XCTB 3TO2A 4KI5E 3DJ9A 3IF1B 3FCTA 4KRPD 2P8PB 3FO9A 5MI0B 3UPCA 1ZT1A 4OLXL 3VXSB 2H2SD 3PL6D 2ZCKH 1ZHBB 5I1IL 4HMEA 1G7LA 4HT1L 4ZQKA 5IM7B 3TO4A 1LILA 3FOMA 1Q0XH 5DMIH 3GZKA 5C08B 2FSEB 3Q48A 12E8H 2NY2D 3MUY1 4YLQT 3UC0L 4AIXA 4LKXB 4MDIA 5K9QG 5IVXA 2PTUA 3QCUL 2XYCA 4Z7OE 1FL5A 1DVFB 3SQOL 3MXVL 1AKJD 4XCFH 5T3XH 3OV6A 4KGJA 4C57C 1HZHL 2NXZB 1E28A 1U8PA 2NY3D 1NFIB 1T0NB 1P4LA 2BVPA 3MA7B 3Q5YA 4UV7H 2C1PA 5F6HI 4JZJA 2G75B 5K59F 3MROA 5BXFB 1IEHA 1VCAA 1NMBL 4QXTB 1S9XA 4HIXL 5I2IA 5EIIA 1WBYB 4HD9A 4ACPA 2QQKH 2Q1EA 2DWDB 1V8HA 3FQUA 4LSRL 1QNZH 3HS0B 4OZGA 1H5BB 3TZVB 3OKOB 5EU3B 1IEBB 3EYVA 3MV9A 3OJDB 4JFZL 5C0DA 2ICWB 3QNXA 3VXTA 2WINB 4ZUSB 3S37X 1DQML 3FB6B 2FR4B 1UWEH 1MFCH 3C60A 3L5IA 4M5YH 5E24E 5E56A 4QTHA 3EJYC 3HMWH 3PL6B 4LNRA 1P53A 1KIUA 1TZGL 3BP6B 2BC4A 3W9EB 4QXGH 1CXEA 3GSRA 5E2WH 3WDHA 4MD5B 3MCKA 3LDBB 1IQWH 1C7SA 1WAAF 5EA0H 3ZKMC 3P0GB 4OD2B 4C56A 3T0XA 1JZ4A 1UCTA 4YX2L 1JN6B 2ARWA 4NO3B 3CVIH 3CSPA 4RAVB 1CGTA 5FGBC 3OJMB 3VXMD 1T7WA 3VFTA 5I8KL 3ZDZF 1I8IA 4YFLI 1JWUB 4NKMB 1JZ5A 3DUSB 2V2TB 4NOFA 5LWYH 3TN0B 1MFCL 1RUMH 4Q6IB 5E6ID 5KW9L 3QXDB 1D5BB 2PXYA 4OT1L 5KSAC 4LHUB 2OBGA 4FTVA 1IC4L 4B50A 3LS5H 4BJLA 4U6VL 4JM2D 5IBTH 4ODUA 1JPFA 4RNRA 2HYMA 1FV1A 3K8KA 3X11A 1NMBH 1M1SA 1NBQA 1RMFH 4IIQA 3RKDD 1FO0L 4GG6F 3K1DA 1D6EA 5A3ID 3I3DA 1KJ2H 2GI7A 4ZD3H 5JW5A 5DD0L 1A7RL 3VI4E 2WP3T 4FQCL 5I8OH 3MR9B 2I9LB 1QG3A 1I8KB 1G7HB 2OJEB 5GRYA 3U0TB 3C5ZA 5GJSH 4RFNC 4OF0A 1KN2H 3EYUH 1E28B 1U8PB 2GTWA 2PTVA 2Y5EA 4OFIA 3STZA 3UBXG 4OJFH 4OQTL 2X42A 1DANU 4I4WB 3QQ9C 5DXWA 3W0WE 5DZNA 2P24A 1FVCA 5DMIL 1D3CA 2XRAH 3FRPG 1HINH 5HJ3A 1FPTH 3CK0H 3TT3L 5JW4N 4MJ5B 5I1IH 1GZQA 5KS9E 5DHVB 4HLJA 1IT9H 3QUMH 5CD3A 1S7WB 4OM0L 3V52L 1UM4L 2PETA 2X7LA 5IW1B 5ENWB 4K8RL 2FO4B 4D9RE 5KSUA 3BO8B 4RGMC 4M5ZH 3CFEB 1OD7A 3LQZB 4XPGH 4YHPB 2CMRH 5SX5H 1U93B 4NZTH 2DQGH 3ULVE 3BP4A 4WENB 5HD8D 1YEFL 3C5JB 3OHXA 5T1MA 5J4MA 2XY2A 3OKNA 4Z7VE 4WO4C 1AFVL 4Z6AT 3Q0HA 2JF1A 4XVJL 4NYLB 43CAB 4P5MB 25C8L 1UXWB 3S5LA 5ITBH 1UM5H 4I18C 3PIQA 1EHLL 2QADD 4A2LA 4HKXB 1JUFB 4ZFOL 3V5DB 4L4VD 4OD3H 4G7YH 1BD2B 4OLZH 3LRHA 1C1EL 4X7SH 3QDGB 3DSFH 5HY9A 5KTEH 3GSWA 3B6SA 3GMNB 4DVRL 2X4RB 4YBHA 3SN6N 5CAYB 4DOHE 4PJXB 1FZJB 1TZHA 4LLMB 2D31B 1T20A 1Q9OB 1IILE 2WUCH 4ONFL 3ZDXE 4RGNE 1YUHB 3TEUA 1QSZA 1JWSB 4H1LB 2W9DL 4FABH 3EBAA 3PP3H 4NYLA 1I7ZA 5MERA 7CGTA 1B4RA 3L95B 4N68A 3WIFB 2JCCA 5E8PA 4C83B 4NJAL 4O2EB 4X98B 3F65A 2FX9L 3L9RB 3VI3F 4KZEL 1RHHB 3RL1A 4MVBD 4RMWA 5E8OA 1PGRB 4JZNB 5I73C 3HFMH 3EHBD 1PY4A 1T04A 3TA3D 2DQEH 4HPYH 4I3SH 3AY4A 1LE5B 2IPUG 4JB9L 1Y0LB 5GQBA 4O02H 4LBEA 3ZYJA 5BRZE 3F58L 1JPGB 3B2UC 3V6ZB 5F89A 3ZT6A 2YPVH 4CAGA 3SKOB 3VRIA 5F44A 1FSKC 5T1LA 3P4NB 4OQTA 1UYWH 3JWNC 3SE3A 4WTZG 3BT2L 3ARBC 3U4EB 4QRRE 5JLZA 1L7IL 4PJ9C 1MCPH 5DEZA 3BPNB 4UDUA 2VAJA 5E2JA 2H26A 1M6OA 2VXSL 1P5UA 2YWZA 4Y1AE 1GZQB 1JVKA 1OLZA 2A9NH 3TF7C 5IF0B 2PO6D 2NY1D 3GMLA 3TFKC 3W0WB 2F8VA 4HS8H 2X5PA 1W8OA 5AZEL 3REVB 5JHDD 2VE6A 1XEDA 3ECBA 3SOBH 4JPVH 4AIZB 4F7PB 4YDIL 2P46B 3WO4C 1VADA 1OSPH 4PJIB 4PG2A 5HI5C 5EO1B 3KS0H 2E7LC 2F54B 1HHKA 2I5YL 3H6JA 5GHWL 1IGYA 2B7DT 3HCVA 4GH7B 1TQCB 3U0TA 5IROA 2RB8A 3DGGB 4HV8B 4UNVA 3FFDA 4HHAA 3ZKQD 1G7MB 4APQD 5KANI 1UEYA 5DZLA 4DK6A 2MCG1 5LGKA 4G6JL 4BSWB 1D5XB 2HFFB 3QI9A 3BZEB 4GMSH 4LU5H 2FLBT 4LCCC 5EZOH 5T3ZH 3EOTH 4DN3L 1WC7A 2EDRA 4JLRB 5L2KD 3MUGA 1ETZA 1S5IL 3ZLQC 3M1BA 4GKSB 5EDXA 2VJXA 4FTVB 2AJZA 5F7NC 2V7HA 4M1DL 3VD5A 2BP3A 1ULVA 3V7AG 3SGDI 1RUPL 3FQXB 5DO2D 2EEDA 4XTRD 3JWDH 2ZUTA 3KGRA 1IE5A 1IJ9A 3UZEA 4JFYA 4PJ9A 5DO2C 4ZS7L 4LSPH 1MQ8A 1G9ML 3LMJL 3BPOB 1VACB 3PABA 1WBZB 3AU1A 4MMXC 3OX8B 5D1XA 2Z8WC 3FTGB 35C8H 3RWHB 1MF2L 5E6IC 3MRIA 3VD7A 4DKEH 3O3DA 4HIJB 5I1KH 5JDSA 1JMZA 4X80H 1BF8A 2X4PB 5E5MA 5F9AC 2C3VA 3JVGC 3GSNH 3MOAL 3BEWA 1MI5D 1AKJA 5F3HA 4NDMA 4S1SH 1MWAL 3L3KB 4KUCF 4LCYB 2WINA 4GG8A 1IAIL 2AJXL 2QQLH 2VZ3A 2X6MA 1I9EA 1I7TB 1MCWM 3N1FC 1G7PA 1KGCE 3KLHC 1QACA 3VI4F 3DWTA 4YPJA 3H7LA 1JNNL 2FZ3B 2IH3B 3QDJD 3ZL4H 4NRZA 2IADB 5FYKD 3C87A 2H26B 5DLML 5GRUH 4WWKB 3MLWH 3MXWL 3NA9L 4NC1C 3L3GB 1IGFH 1A1OA 2DB8A 4UNUA 1PEWA 4YPGA 1KB5L 3KS0J 5CJQL 4G80A 3UAJD 3BQUC 4YE4H 4WI4A 3T0ED 4P59H 1KCRH 3RHWF 2VXQL 1C8PA 1TVBA 4JLRA 4Q2ZA 4MWFA 1LO0L 2VXVH 4BELD 3GIVA 5ID1A 2MWCA 2IAND 4YBQC 2WBWB 3ALWA 5DK0B 3UYOD 4MMZC 4KJQD 4JGMA 5ITFB 1CL7L 4LRIA 5DD3L 5DK2B 3WIFA 3BWAA 5GPRA 1S5HB 4MAYD 1CD1B 1ZE3C 3WJJC 3FCTB 2J12B 1AXSB 1CBVH 4X5LA 5GS0D 3VMPA 5FGRA 4Q9RH 3G6JB 3V4UL 4NKIL 2P5WA 3UPRB 5TE7H 1EEZB 5FYJU 5TF1L 1BJ1H 3C5SB 1CLYH 2EECA 2X1PA 3NN8B 3MO1A 4L3EE 3L7FA 4U1NA 4U1SB 3DLQR 2BRQA 1OVZA 4TOYH 1I4FA 4S2SA 4Z5RA 1UM6L 4LCCA 3RU8H 4BFIA 4OZ4B 4QHUB 2R56H 3RDTA 3OR7A 5EBMA 1QSFD 3WIIL 5CHNA 3DVFA 4DVBA 3DO3A 4TVSa 4K3DL 3WKMH 4X7EC 2Y4SA 1O5DT 2GKIA 1FCGA 1FIGL 4YHMH 3QPQD 2B2XL 4D9RD 1DBJH 3FO0L 4OD3L 15C8L 4WGWB 4R7NA 4EI5B 3IFNL 1CF8H 2PYEA 1A4KA 2VUYA 4NHCH 2JLLA 3RNKB 2W0KA 5TFSL 5EORH 4LGSB 3IAPA 5I73B 3MYZA 3RWFB 3T08A 2UZXB 4MAYB 1E27B 3WLBA 3BGMA 3QPXH 1QFWI 1OPGL 3LH2H 3LRSB 4LEOA 2YD7A 4JRYE 2DQGL 4HUVB 3QRGL 4FQXC 5JZ7D 5CIPA 4MXWL 4HJ0D 4PJXA 1XIWD 3GJEA 4HK0A 2MMXA 4MQTB 4TNVK 5ID0A 1IKFL 1MF2H 4ZS6D 2DYPD 4J4PA 2VAAB 4HWEH 3Q6FB 3ZDXF 1PQZA 2CKBL 3GSWB 4KK8C 4OM0H 3V52H 4PD4K 1EPFA 3BDXA 2P5EE 5D2NB 1J7VR 4P57A 1WT5A 3OMZA 4PB9L 1S5IH 4TYUA 3WD5L 4PJDB 3BD4A 3LH2L 1F2XK 4JM2A 1OPGH 2HLAB 2BNRA 4Q9BA 2OSLA 4GMSL 1UXWA 3S5LB 4FXLA 4E41B 1Z9MA 1ZT4B 5HVWA 4PJGE 1S9WA 2AJSL 3L7FB 4ODHH 3RWEB 2EYRA 4RMVA 2MQ3A 5HI4C 3ULSB 3B4NA 4KK9D 3ROOA 5IEHB 1NMCB 4LSQH 3L3JB 2PR4L 5IB1B 1ZOXA 3WKML 2VB5A 2HVJA 4G9DB 3CAFA 5D70H 3VW3H 5E4IA 1J0KA 3DYPA 4Q6IA 2I5YH 3VFMB 5FO8B 1K4DA 4PGDB 4MHHG 5GGSY 4ZOCA 3SDCD 3CPLA 4XCCL 1ITBB 3OXSA 4U6VH 5JOPD 1T83C 2WQ8A 3VMOA 1OSPL 2D7PA 3SEPA 1F00I 2VZOA 5IB2A 1MLBA 2QADC 4L8SC 2YD4A 5F7EL 3IDXL 4H25B 1RUML 5TF1H 3SGDH 2IG2L 2CR6A 1CG9B 1T1YA 5JXEA 4Q0XL 3LEXA 4N5UA 4YPGB 3V4UH 5BS0B 4KUZL 4HSQA 3NCCB 4LPCA 5C9JA 2D4FA 1KIRA 1T5WB 3GHEL 4UOJA 1VKXB 2V2WB 4J1UB 1LGVA 4XC3L 1IAMA 2MCPL 4G5ZL 4KRMB 2DIJA 1L4IA 3RWJB 3LY6A 2Q87A 1M05A 5J6GB 1IAKA 4Y4HC 4JM2F 1FNSH 1J0JA 1U3HC 4WFHE 1OP3H 1D6EB 4NJ9H 5I74C 4ZMAT 1QBAA 5CEZD 1R0AL 1ZT7B 2FX8H 2WWKT 4WEUD 2WMPA 2K9UA 4NQEB 4RQQA 1AXTH 5F7LB 2Y36L 2YRPA 4OGXL 4QTIH 2H45A 4GAGH 5C07E 1TVBB 2B5IC 1T2JA 2RGSA 4P2OB 1AD9A 2BVPB 4JKMA 2B8OT 2HG5B 1IGFL 1Q9WB 3LKPA 2YR3A 1IKNC 5F6HJ 4ONFH 3DSFL 2HJFA 5KSAB 1MAML 1C5DA 1JWMB 2R2BA 5AEAA 4DVRH 3VI3E 3RVTC 1YMHB 1WBZA 2E5EA 3MA9H 4HMCA 4MCYB 5D2NC 4XWOC 3FN3A 2GSIA 3VXRE 5JTWA 2GSIB 2DJSA 3ARED 2ZJSH 1OGAE 3BGFC 5DZOA 5T33L 4LSTH 4M7ZC 5C0BE 5IMMA 2VR5A 4OZHF 4XBEH 4O58H 2AJXH 1BREA 1DR9A 1QBMH 4G9FD 3GSNA 4FQ2H 3HZKA 3RUGE 3HAEH 4OUUB 2X4SB 5AYUL 3LKRA 3PHOB 1S7XB 4LVOB 5JW3L 5DD1L 2HN7B 4N0UA 3TO2B 1MWAA 4PS4L 3TBWB 4K8RD 2X4OA 3IRZA 5GS1B 3KYNB 1ZV5A 4OSUL 2AV7B 5FA4A 1SYSB 1B2WH 1IEBA 3O4LD 1FAKT 1G9NL 4YDLB 1GRWA 4JO4H 3DO7B 3KPSD 5D1XD 1FVEA 4HS3B 4WHYG 3GB7B 2J6EH 5MEQB 3BZFA 1MEXL 5GIRB 4L9LB 2KL6A 3S37H 1CTOA 1IGIL 4N8CL 2P5EA 3MROB 4QNPF 1YNTA 3MBEC 1YJDH 1CFTB 2LE9A 3X14A 1NMCC 4DGIH 1T0MA 5ERWA 1FPTL 4B0MM 5AG9A 5C0AE 1SM3L 2VDMH 2GSGA 2XZCH 5CZVL 2BOCA 4F3FB 4OZHA 1XGTA 3HA0A 2V7HB 3T3MF 5CFHA 3PWPA 4UTBL 5IB3A 4YDVB 3MUGB 3VG0L 4PRDA 5E6IA 3MV8B 1NKOA 3C8DA 4P2QE 4CW1A 3KYAA 2HTLD 4F57H 5IJKA 5E8DH 3WXVH 5BQ7B 5DJZB 5FIEA 4M4PA 3QWRA 5GRVK 1YQVL 2PYEE 3BXNB 3U4EA 1BJMA 4E5XA 1IQWL 1DN0A 2FBOJ 3QXAA 1KJVB 3T09A 4EUPH 3MV7D 4G6FD 4U33A 1UT9A 3MLSH 4PJ8A 1HSAB 3DUUA 3VGEA 3FKUS 3O41A 5F88B 1WISA 3UO1H 4N1HB 2LFGA 3MRHA 1LO3H 1N64H 1R5VA 2D03L 3QAZB 4F9LA 5AZEH 1IZKA 1FAIL 1ZAGA 4RDQG 2ENYA 3TLRA 1INDH 4OT1H 4E42B 2VLRE 4KK6D 1RHHA 1ED3B 1RURL 1Z9LA 2A9NL 5D1ZC 4UIMB 1HH9B 1FZMA 1NCTA 2ZSWB 5JZ7C 2FIKB 2C3XA 4OD1H 2WIIA 4F15C 3KNBA 5FF6B 2XG5A 4XI5C 1M6OB 3AB0B 1EHNA 3KVQA 4GLRH 1LP9F 2AGJL 2NTFA 4S2SB 4Z5RB 4KVCL 3B2VL 3B6SB 4JFDE 3QUZD 5HYQB 1MJUH 2FATL 5CWSB 2OYPA 2F19L 3CU1A 3MO1B 1MHCA 3E6FB 3HFML 1BZQK 5D7LD 4X6EB 3AREA 3BDBA 4ZDHA 2A9MH 4BK4A 4F37K 1AGDA 2O5YH 3UC0H 3WS6A 1QKZL 4YHIB 2W0PA 1C5BH 1KJ3L 3B5HA 3HAEA 4PJ5B 4PRIE 4U0RB 3VXRB 4NKOB 3C6SB 4NM4L 2DLHA 3EFFB 4D8PA 1CD1A 3L95A 3PUCA 3WS6C 2DQUH 1KELH 3D39D 4HCRL 1FAIH 3OKEB 1U3HD 5BW7A 2DRUA 4MLIA 5ITFA 2HKFL 4NT6A 3QXUA 4N0FB 5C0NC 5J56B 4LF3B 1J0YA 2M26A 1JRHL 4ZNCD 4Y2OA 4ONHB 5E6IB 2SEBB 5I1LB 2EDEA 2W0LA 4ZTPL 3V6BR 1A9EA 1OW0A 1CDBA 4HWBH 3SQBA 1JFQL 5I18L 5JUEH 3AB0C 3MTRA 4W70A 1G9EA 2D0GA 1AE6L 5ILTL 1NUFA 5HYQA 5DJYA 1XR9B 5AUMB 5FUZH 2B1HL 4DVBB 4H26A 3DX9A 1JYNA 4ZPTB 2BX5A 4H88L 3IJSB 1CTNA 5F7HA 3MV8E 3ZYIA 4WWKA 1F3DJ 2NXYD 4A6YA 1YMMA 2YD3A 3WNMA 2DQFB 1BQHA 1T7XA 5DRZA 3PWUA 1YYLH 5E2TH 3PHSA 4DKFL 5HYJB 4PFEA 1FVCB 3GM8A 4KH2A 4R4FL 3RVWC 1YYMH 5C6PB 5DFVD 3ZE2E 3H3KA 3HB3D 3NPSC 1KGCD 4M5ZL 1G7QB 1U93A 5GISH 1KCVL 1MCDA 1T21B 1KC5L 2R2CA 4QOKD 3PDDA 3QWRD 5E2UL 3T3ME 3UPRA 1A2YA 1G6RA 3UTZB 2IQ9H 5L88H 1MWAB 3CLEL 3D2UB 4PY7B 3AVEA 3TGXA 2W1NA 1ND0A 4GAYA 5F7DB 1CZ8L 3SE4C 3BWAB 1JYVA 2EYSA 3MLSL 4TUOA 3MLXH 1T4KA 1Q8MA 1LO2H 5E2UH 5DJCB 1OB1A 4WEBL 1V3LA 3S88L 1WT5C 1ZHKA 3S6CA 1I1FA 4ELKA 1JRHI 3NCJH 4N1CA 2OTWB 4GSDH 4MAUH 3AU1B 1OAQL 3PHQA 4MWFB 3LV3A 5C0IA 1MJ8L 3HE6C 4POYA 4Z78B 3DX7B 4B41A 4LSUL 3TBTB 1IZJA 3L3OA 4AK1A 4ZUWA 2P24B 3X12A 4IM8A 2G60L 4G80B 4RBPH 4I4WA 1D5BA 2PXYB 4G3YH 4M6NH 5AZ2L 2BOCB 4O51B 5TE4H 2HJFB 2PXYC 1LWRA 2APXA 5DF0A 5KSAA 5LVEA 4KJYA 5GRJH 3NCBB 1XF3A 1ORQA 4WI7A 4GXVL 2B1HH 4NQED 5HHPA 3CMOH 4HXAH 5I8EB 1KJ2L 4G8GB 4P46C 5J1SC 1I8KA 5J11B 1CDHA 3DYOA 3PE9A 1L0QA 1YN7A 2GCYB 2CIIB 4PUBH 3UBXB 5H35A 1Y18B 1JNHB 3W0WD 3T4AA 3HC0A 1N4XH 5ALCL 3A6CL 2C7UA 5D1QC 3U9PH 3VFPB 2BSED 4F58L 1MRCH 4W4OA 2BHUA 3OQ3B 1Q0YL 1R3IH 4OM1H 2FECL 5I1AA 5D1QD 4N0UB 1FJ1B 3R4DA 5IIEB 5I75C 4PRHA 2G5BA 2IAMA 1A6WH 3N1MC 2X1XR 4ZAKB 4PJIA 2VR4A 1UZ6E 4K7PH 3L7EB 1YYLL 4NKMA 5E2TL 4N0YH 4FQ2L 2HFGH 1JV5B 3I6KB 4KKNA 3U2SB 3B9EA 3HR5B 5I2IB 2BNRD 1NFDE 2B4CL 1FFQA 4NN6C 2WAHA 1EEUA 4K94C 4XPTH 5TQ2H 1SQ2N 4FQQA 2Y5TA 1MREL 1ZHLB 2ZUYA 3X3GL 3S7GA 3BX7C 4NOBA 4PGDA 4R2GC 5DVKA 4LKCB 4I0PB 2XTJE 4NHUA 2JK5A 3LEVH 4IRJD 1WIOA 1NLDH 2BSSB 4LIQE 4UIKH 4OCSH 1G7IB 1OAUH 5FYJD 3VRIB 4J3WA 1C08B 4N9GB 1EGJA 5I1AB 5LGJB 1YMMD 3CFBB 3JV0A 1ETZB 2Y7QA 4QWWD 2I27N 3T65B 4CL7A 1DLHA 4X6BB 3WSQH 1OAKH 1EA9C 3OJDA 1T1XA 5FFLA 4L5FH 3RX8A 1MCKA 4LLWB 2EYTA 5JMOC 5H35B 4O2EA 4TUOB 1YN7B 5DUBA 1SVCP 3ZTNL 1C5BL 1KJ3H 1YEEH 2VDLH 5LBSH 1A7PL 3N50A 4X6FB 4EI6B 3QCUH 3UTTE 2A9ML 1TTGA 1ORQB 5HGBB 2D0HA 3QO1A 5I76B 1T5WA 4G5ZH 5EZJB 5JXED 3QIUA 2CKBB 4Z8FL 1MRFL 1T1YB 4FG6D 4HGMA 1A3LL 5F3BA 2EH7H 5FCUH 2VE6B 3B2VH 3TBTA 3Q6FA 4XPHL 5L0QC 1ZVHA 2FEDC 4Z0BL 1JNLL 3E1F1 1AI1H 1ACYH 2ATPB 2ATKA 4K7FA 3NOIA 3CDYA 3TO4B 5IQ9B 3WJLC 3QUXA 1PG7W 1CDIA 2DI8A 5HGGS 4Z7QF 2WIIB 4G9FE 3P4NA 4ZFGL 1U8LA 2FGWH 1MFAL 1I8MA 3M07A 1XAUA 5DJ2A 1OTTC 3VFNA 4DCQB 2VLJD 1H3PH 2JCCE 5SWQA 2AJYH 1JHKL 1GCFA 4OI9A 4HXBH 1T21A 2J7LA 5CILH 2JJTA 5BV7C 3ROOB 5IEHA 6FABL 4NWTL 3D0VB 2XFXB 1X7QA 2JCCB 5E8PB 4C83A 1MIML 3AROA 4JFEA 3MRQA 1SMAA 5D7KE 5DRZB 4E5XB 1JWSA 3QNZB 4ODHL 5D1QA 5EOCL 1DQJA 3LRGA 5I74B 5HDLA 1BAFH 1X9QA 5TDOB 2B20A 4MJ5A 2VDPL 3MV8A 5I8CB 1SEBA 4NO2A 1MHCB 3HE6D 3QZWG 5CP3H 5HGDA 3T1WA 5I6XB 2HLFD 3LIZH 2R0WL 3M8OL 4MA3B 2O26U 1TJGH 3MRDA 3LDBC 5CBAA 2E8YA 4OAWB 4WJ5B 2DAVA 5CIPB 2OP4H 4MDJA 3C08H 5T1DL 3K2UL 5D2NE 2BZDA 4LCWD 1RZFH 1GL4B 2A0LD 4TVPL 4JFEB 1D5IL 1E4XH 3BP5A 3DURA 1RZJC 3WUWB 1B9ZA 2ARJQ 1TETL 4ZUTB 2Y36H 3OKNB 2B0SH 4O9HL 2CO6B 1HHHB 4XPAH 4DAGH 2R1XA 3VG9B 3VXMA 4LQFH 2AEPH 5D7LA 5DD1H 1I8LA 4NJ9L 2HAZA 4CDGC 4P2CG 1NLBH 3CFIC 1HSAA 3DUUB 3U36B 4JAMA 4P49A 5KSUB 5F9OH 4LHUA 2AP2A 4YHML 2AEWA 4LIQH 4XVUD 2AQ3A 2L7UA 3RAJL 5BRZB 2H3NB 3T04D 3OR7B 5CD5D 4PV8A 4F33B 4J6RH 1VPOH 2MPAH 3ZTJG 3MNZA 3U46A 2FZ3A 4EQ3A 4FMFA 4M7LL 5DD5H 1YEKL 2VO5A 4EOWL 1KCLA 5B3JF 3UDWA 3RQ3A 4TVPE 3D85A 1CFQA 3CXDL 2IWGA 4RGNB 4Y5VC 2W59A 3DI2B 1OAXL 5HYSG 3QDJE 4YFEA 4BFGA 5I1JL 1CLYL 2IANA 3WBDA 1A14H 2PTTB 4G8FB 1JNNH 4AMKH 1DUYA 4XT1C 5A16A 5DJ6A 3QNXB 3VFPA 2YEZB 1I9JH 1KF9B 1LEIB 4NNYA 2J88H 2DIAA 5ACMA 2CRZA 3G6AA 2QQLL 2YD6A 2FRGP 4OI8A 1QLEH 5EBGA 3MODH 4Y4HB 1S7QA 4ODUB 5DHVH 1N8ZB 2E8ZA 4X7TB 1LEKA 1PLGH 4FFVD 3HR6A 4CW1B 5GS1A 2QSQA 2ZNXA 3F7RA 2MNUA 4G8GA 4YGVB 3M17B 3EOBB 2HH0L 3MUHL 5GS0H 1MFEH 5A1AA 3INUL 1S9YA 4X4XA 3KPNA 1DLFL 1AO7B 2LVEA 4KJYB 5DMGC 1QBLH 3BE1L 4YE4L 4M3KB 1QFUH 3ARWA 4KAQL 2VERN 2GJZA 3MGTB 5EU4B 2VDKH 3AREC 2BXYA 2QSTA 1F2QA 4YGVA 3E6HB 2FB4L 4NQSA 2NY7H 5IB2B 3MNZB 1KN4L 1DN2A 5E6YA 4D94A 4PTTA 4WCYL 3TV3H 3VRJB 5I30H 1MQKL 1DVFC 5E4EC 1JNJA 1F3RB 1PAMA 4MYWB 4AT6A 5EFIB 3DMMD 3MCKB 2AK4E 5GZND 1MFDH 5F8RC 4YDKH 1LO4H 1MNUL 5F9JB 4XB8A 4P2YA 4MXWH 3QCTL 2ZKHH 3PWNA 4GAYB 5F7DA 5C0GA 5JHLL 1FJ1A 2X05A 5KZCB 1KTRL 1BECA 1U8QB 1CD0A 4JKWA 4OQ1A 1I3RA 4KTEL 3EYVB 5JHLH 3D85B 3GSNL 4UB0L 4I0PD 3ULSA 5HDOA 5GRVL 4XPBH 1VFAA 4Z7WF 2NCMA 4WWKD 3W0WA 4FMKA 1YNKL 3DIFA 5BXFA 1YMMB 4C54A 4RRPA 4OCWH 1AO7D 4PJIF 4NWUL 3GMMA 3CC5A 4UDUB 1QSVA 4OAWA 1F4AA 1QA9A 2R69H 4LSPL 5SX4I 3TNMA 3UTTB 3D6GA 3SOBL 5C9JB 1AGBB 1A6VH 3GNML 1R3JA 1RZKL 3QEQA 5D2NA 1LMKA 5B8CC 3KPNB 4PRPD 2I26N 2P7TA 4S11A 4QOKA 1IMHC 3TA3A 4R2GB 3Q6GL 2R0KH 3DX7A 1OL0A 1NCDL 5DQ9A 2VITA 3VGBA 1RIVL 1J87A 5D7LB 1YA5A 5ID0B 1BD2D 1FNFA 2RBLA 5MENE 4L8CA 4X83A 1ZWIB 4U2ZA 1TITA 5TH2B 3ZT5A 4JZNA 5EZIH 1FCCA 2MQ0A 2R4SH 1UYWL 1V3MA 2HWZH 1ZHBA 3BVNA 2ZWLT 4QEGA 5DS8A 3VFMA 4OLEA 4ODSL 3D39E 1KLGB 4TUJA 2IFFH 3QJFB 1QPXA 1BJ1J 3FFDB 1TJIL 3WLBB 4K9EL 5I15L 4IRJA 4A6YH 3T1FA 4D9QE 4LAJH 2HVJB 4TQEH 2DL9A 2AW2A 4WJ5A 2V2WA 5EO1A 3QUMB 4EDXB 3RGVD 3OZ9L 3SDDD 4X6CF 3WDJA 3BWUC 3QNYB 5DI8B 1WFUA 1KN4H 1I7UB 1UCBH 3BGAA 4KHXL 2D9QB 2XT1B 5IB4B 3WIIH 1KCRL 4Z7VB 1XH3A 3ARBA 2X89D 1MCCA 4A6YB 4PJBB 1HOCA 5ETUB 4F33A 5DT1H 5AAMA 5FHAH 1DQJB 1QBLL 3FB8B 1QFWM 3O6LL 1JBJA 5ISZA 1HE7A 3S97C 5GS0L 1B0GA 2APVA 3WFBH 4HUKB 4UV4H 5I17B 3OZ9H 3ZL4L 5ICYB 3RA7L 2A6KB 3PJSB 4RGOH 1KUMA 4ZXBC 2DQDH 2H8PB 32C2A 3P4OB 3T0WA 3DX6B 3LN5A 3LSOA 5BO1L 1LVEA 5EB9A 4O02L 3IDIA 2JJUA 5CLTA 4L4VE 5SWQB 4JE4B 3RVXD 4X98A 4MNQE 1YECH 4OF8A 3F12B 4YBLB 1NCNA 3IXTA 5EU7E 1P1ZA 5DK2A 4X4ZA 2AEQL 4MDJB 5FGBA 3RWFA 3HAEB 1Z6JT 5DHVA 4NQEE 1EH9A 1QSEE 3NH7H 4DK3A 4P59L 4U1KA 1OM3H 2GW5A 4UT9H 2DYPB 4ZYKA 3B8YA 4LLQB 3STBA 3OF6D 5IEKA 4M1CC 1UM4H 5HJ3B 3RY5A 3PWPB 4JREC 5ICYA 4IS6B 3QDGA 4KQ4H 3O9WB 4XBGA 1IGCL 3RVTD 3PGCB 1S78D 2Q8AH 4NWUH 5DTFA 8CGTA 1QA9B 4QXWA 1C1EH 4NPYA 4E41D 4HMDA 1BBDL 2VZTA 5E9DE 3N06B 5B8CB 1U8HB 1JI1A 2X10A 3MRKB 3KPSB 3QQ4B 4YHOH 3G04B 2IADA 3E3QC 2DS4A 5F9OL 1RHFA 1GZPB 1PG7H 1NLBL 1U9KA 4PRPA 2ERJC 2NW2A 1UM5L 3IS0X 4V1DD 2OK0L 4QF1A 3L7EA 1PG7X 2WM0A 4CNIB 3H7BA 1A1MA 3LKSA 4HIHB 3SE9L 4RNRB 2AV7A 1ZLVH 2R4SL 1FZKB 4GG8B 3TYGL 1J86A 4UUJA 1A3RH 5IIEA 4KXZI 3N9GL 1JGUL 1B4JL 5LGJA 3HC3L 1NL0L 1G1CA 4P2RE 4WUKH 1DL7L 3QXDA 2BSSA 2C7UB 2NX5A 1FC2D 2AXFA 2XNAA 1JYWA 2BNQD 3GBNL 2VN4A 5JDSB 3VU2A 3ILPA 1TCRB 1BZ7A 2UWEF 5C09E 1D5MB 4LLVB 3HTLX 4OLWH 3LIZL 3HI5H 2R9HC 4JY5L 4X99A 5CKAA 3K2MC 1KTKE 3ARGC 3E6HA 5JORB 3PDOB 4OUOA 3ARGB 4NQCA 3RVUD 3BDYH 2XWTB 3DV6A 4RFNB 2A1WH 5BS0D 3F7PC 1CQKA 2AJVL 4K2UL 4QRPE 1J5OL 2EC9T 5DA4A 2MKLC 2RFXB 1A1NA 3BT2H 1CFTA 4JFHD 4YXKL 4OJFL 3ZYZA 5FYJL 4P2OA 1DCLA 4UAOC 3V9FA 3UTTD 1A7OH 4L3CB 2P5EB 4L8BA 3WNLA 4XB7A 4JO2H 4XGZA 3TVMC 3HRPA 5E2VL 1QPPA 4FZ8L 4IRZH 1A7RH 2DWDA 4XP5H 5GGUA 1YEGH 4AMKL 1NCCL 4XMKH 4IOFC 1IAKB 3WJJA 4L3EA 4P4KA 4L3CA 2FD6L 2VQ1A 2G75A 3HCVB 1OAXH 5I30L 1MAKA 1QSFA 1MCEA 3VGHA 2IANB 3CSGA 2E27H 4UU9B 3QDME 1ZKAA 4H0HB 5E5MB 3GSNB 5C0BB 4K94L 3IFOB 4RGMB 3D2UD 4JO1L 2DD8H 1LP9B 4XCYB 1QHPA 5AG8A 3OX8A 1EAJA 3GGWB 4UV7L 3ZMRA 1A8JH 4GW5A 3PWUB 3LV3B 4RGNC 2VZUA 3PL6C 4JCMA 3BFOA 2VDQH 5KJRL 3MXVH 3HUJF 5KSBE 4PV8B 5IM7A 1XGYL 4JFYB 4PJ9B 5BJTA 3SGEI 1G7PB 4BH8A 1P7KB 1QLEL 2F53A 4Z77A 2BC4B 3E2HC 1X5JA 2EYSB 1X5ZA 3UTQB 2BNQE 3P9MB 4HFUH 1I85A 3T3PF 3LKPB 4I8DA 5C08E 3B9KC 1CLOL 5DJDA 1WFTA 1RZJL 2SEBA 2COQA 4IRSD 3MCLH 4PTUB 4KJQC 4W68A 1S7QB 4MB5A 5FHBH 4V1DA 2CIKB 1Q0YH 1R3IL 1WWAX 2YWYA 4OM1L 5CEYA 4ZNEA 1H5BA 3BZEA 1NEZG 5EU6E 1FORH 1JNHA 4OV5A 3K7UA 2DMCA 2ADIB 2Z31C 2WLYA 5HYJA 1S9WB 2YEZA 4QXTA 4D3CH 5E7BA 1VACA 3O0RL 4MXQC 3LPFA 2AJUH 3CDGB 1HI6A 4L4JA 4OCSL 2YUWA 1BX2A 5MEOA 1A1NB 3QUML 1Q9LB 1OWWA 4KKLD 4B7IA 5DURB 3D85D 5IFAH 3F7YA 3IB4A 5F97E 5IVXB 2VDOH 1P4BL 4LPUA 3BZ4B 4D2NA 3SQOH 5DQDL 2YKLH 3O45A 1LQSR 1NPUA 1A9EB 3M1BB 3TT3H 4WTZA 5ADOH 5IEKB 4NQDD 5D2LE 1MLBB 3F5WB 3HZMB 3SKNA 3EO1B 4R4BB 1EHLH 5CEZH 1WAAE 1DFBL 1TCRA 4F9PA 1BGXH 1RU9L 2BSTB 3KPMB 3LRSA 4LEOB 2NX5B 4F2MB 1G7MA 43CAA 3D9AH 4CU7A 1T1ZA 2ZCKL 2Q8BL 1RJCA 4NFBA 2EDBA 3BPCA 2HT3C 5C3LD 1CFSB 3RBGA 1G7QA 3IFLL 2L7JA 3H7BB 2DKUA 1MSPA 2A6KA 2JIXD 4X5XB 2NW2B 5BV7B 5IW1A 2LU7A 1NAKH 1W0VA 3OB8A 4YQXL 4EBQH 4QY8A 5K9JL 1FGVL 1GZPA 5CSZA 3HI6H 4NN6B 4PJAE 1KB9K 4Q58C 5B38A 1Q94B 4NPYB 1B3JA 1B90A 5E94A 1ZA3B 1U8OA 3RWCA 4FQXD 4MA3A 1F6FB 1MJJB 1W0VB 1X4XA 2BY1A 1Q9KB 3PWVB 4ENEC 4ERSH 1YEDB 4JM4L 1P7QD 1A7QH 5KVGL 1RIUH 1H0DB 3E0GA 2JCCF 1WQVT 4PJEA 5CLWA 3TBYB 4JRYD 5E2WL 4BFBD 3DXAD 5I76A 2XQBH 1LO2L 3O41B 5FYLE 1PBYA 5LGHL 3G5YB 4Y88A 4EI6A 4LDLB 1I85C 4RFOH 4OV6F 4HKXA 3ZTJH 2JE8A 1P1ZB 3RI5F 3QZWA 1UWEL 1A6AB 2V5SA 5L88L 1WWBX 3PG2A 5A2FA 5J11C 2DQCL 3TVMD 1WSST 1JGEA 2A0LC 5C0EA 5KVFH 2AJ3A 4Y19A 5MHSD 4X0KB 3ULUH 1FZJA 2A77H 2XKSA 3GIVB 5DWUH 1FORL 5H37H 1NFDA 2Y7QB 4G9FA 1KIQA 1S7XA 5BVJA 1CIDA 3JV6A 1U41A 3E8UH 2P1YA 2K3TA 4M43H 3HZKB 2JK5B 2IPUK 2F53B 4Z77B 1BD2A 5ERWB 3FB8A 4Q6YA 2AAVA 5L8JB 3LB6C 1JUFA 1IC5L 5FGCE 4DFIA 1XGRA 5JXAL 1M71B 4QHLB 1FYTD 4XCEA 4N0UE 4JO3H 1VFOA 1OARH 2C5DC 2ZSWA 4LVEA 4MCYA 5C0BD 3PV7A 4QXGL 1C16A 2AEIT 3I2CL 4OD1L 4Y7MA 3ARFB 2R2EB 1QRKA 3VXNA 3SE8H 1C5DB 1DQMH 3SCMA 4O4YL 4N5EC 3UTSB 4YBQD 4L1DA 1ZHNB 3C8HA 3G6JA 2PNDA 3NIFE 2WW8A 3FB6A 2FR4A 2GUOB 4WV1C 2XA3A 4ZAKC 2R0LL 2AQ2A 1GGUA 4PV9B 2XZZA 5HI3D 5FCSH 4Y16D 3O6ML 3LOWA 4U6YB 3DARA 3HC0B 2NLJB 1FO0B 4HF5L 1F3JB 3VA6A 5BVPL 4LLWA 1A5FH 1FV1B 2K1MA 4XGZB 1KEGH 1S7RB 1JF6A 4CJ0A 2FL5A 4D0DB 4YFDB 3IKKA 3P3YA 4LOUC 5IB3B 3ELAT 4HC1L 3FMGH 5GSVA 2OLDA 5HHPB 5EC1A 4PJXF 3MGTA 4BZ2L 1J8KA 4WNQB 2DQJL 3UJJH 5DYOB 2AABL 1GSMA 2NZ9C 4LKCA 1MCIA 4OZFG 3DV6B 4P9ML 4ZUWB 4OCLC 1PDKA 1A6WL 4FQQB 1JPSL 4TULL 1VEPA 3WYRA 4ODBD 3EYSL 3LAFA 1BZ7B 1G7LB 4NN5C 3DTXA 1YPZE 3IVKB 3C09B 2D7OA 4OBSA 1P4IH 5MI0C 5FM5M 1KJMB 4LCYA 2A6IA 1MJ7H 2IALB 1KXVC 1AQDB 4LEXH 2B39A 5EOQL 3WNOA 4J1UA 5JQHC 2AXHA 4K9EC 4XNUL 4HUMB 3NZHH 5GRJL 4P0DA 4AIZA 4NQTA 5HHOD 3CFDB 4JM2C 1MFBL 3RWHA 3ARGA 1U95A 3VG0H 1UA6H 1WCBB 1BQHG 1CDGA 4PTTB 4O58L 2XZAL 1A6UL 4EDWH 5L2KA 1S9VB 1G7JB 5C0CE 5SWZB 1CXKA 1T0NA 3AFLA 1YY8B 4EBQL 3RUGF 4M3JA 2IBZX 2H41A 4LDEB 1HYSC 4P57B 1GPOL 5ICXA 4NKDA 2AJZB 2HTLC 1QO3B 4M6ML 1AD9B 5I1HL 2J6EL 4RMSA 4BQBA 3FFCD 2WWKO 2YXMA 5IB1A 4MHHI 3T0EC 4LRIC 5D7JB 2R1XB 4X0KA 4Q97A 3G6AB 3OGOE 4WGVB 4KI1A 5EU6D 4ZSOB 3HPJB 3KPRB 1RU9H 4M7LT 1PX3A 2CXGA 3UZQA 5ACLA 4HHAB 5D72L 3UYPA 1O7VA 2V5RA 2MFNA 3L5HA 3QQ4A 4PY7A 4HFUL 3HN3A 2CD0A 2PTTA 1CDUA 4HFWA 1UJ3C 3D25B 3BJ91 3SDXB 4AEIH 2DQHL 4ODWB 3NCEB 4OFYA 1II4E 5BS0A 3NPZB 4KUCD 2DF3A 5D5MA 1CFQB 4LSTL 3ARFA 2BY0A 3BIAX 2OCFD 1I9IH 3TZVD 1C16B 5L0QB 4KTYA 2ZZUT 2QADB 4L8SB 2F5AH 1U8OB 2XI9A 3RWCB 2ICES 3BPLC 2IPTL 5E08H 2CDGA 4LCIH 1A47A 5D7SL 3CH8A 2ICCA 1BVZA 3U4AA 4ZOEA 3FB7A 4H20H 4C55A 4RA0C 1IC7H 2WBJC 3S4SG 5MP6L 1BIHA 1G6RL 5HHVH 3J8F7 4IRZL 4XP4L 2C3GA 1R0AH 1G1YA 4DEPC 4JN1H 3TWCL 4MA8L 2ZCLL 4OCXL 3RTQB 1CXFA 1OSZA 2CLRB 5FA3B 3RL2A 3G9VA 1BMGA 2VLRD 3OG4B 1F42A 3ARYA 1B0GB 3QJFA 4AL8H 2YPLA 2XQYK 5EBWA 5T3ZE 2XN9B 3MFFB 2F54E 4JFXB 4PJ5A 3WNKA 4KUZH 5C0AB 4DWHA 5ID1B 1BFSA 4YDJB 2ESVD 3QUXC 1TJHL 1YEIH 1RULL 3HI6L 3ULVF 4YHNA 3WO4B 4OLWL 5F3BB 4KJWD 2QJDA 3Q6GH 5D5MB 3THMH 1TIUA 3JTSA 2R23B 3QUMA 4EDXA 2PO6B 4FFWD 4PGEA 2DLGA 3CC5B 4B7LA 4ZFOB 4HUVA 1SY6L 1MVUA 5IHZA 4YUEL 2DLFH 2IANE 2IH3A 3IDMA 4L9LA 4LHUG 2FEEI 1D7FA 2WK2A 1Y6MR 4HBCL 1FG2A 2AQ1A 3F7VB 5DS8B 2G9HB 4UBDC 1DEEB 3MJ7B 4GOSA 5CEYB 1V7MH 3A6BL 1FLTX 5FKPA 1A4KB 3GSXA 3H9YA 3KR3L 4Y2DB 3ARDD 5E6ZA 3IAQA 5E7FA 2EZ0C 4NRYB 5FGSA 4MA7H 1QO3A 1L9NA 2ZUWA 2D9CA 2IEPA 4YHOL 3V0AC 4GG6A 1DN0B 3QXAB 4OUUA 4HDIA 3IT8D 4JFFE 1GXEA 3P9WB 3QDGD 5BJTB 3L5WB 3GMMB 3QSKB 4BFIB 3D1MC 3H9SE 5L2KB 4OZFB 3ARQA 1CVSC 1J1OL 1FHGA 4WU5A 4KI5F 1MHPL 2IBZY 4LLAA 4IEFB 1H3TA 4OZHB 3GRWA 3HUJB 1KB5B 3F7YB 1ZTXL 2EC9U 3DVGB 3QO1B 1NUDA 2G5BB 2IAMB 5A2IH 3MNWB 2V5MA 1MI5E 4UT9L 2YN5A 1AKJB 5F3HB 1QSFB 1R3LA 4OSUH 3M17A 1DBMH 2M8XA 1DLFH 4XPFH 4Q9RL 1MCOL 1DQLH 3MRCB 3STLB 5HVFB 1QRND 4DOHB 3CXHJ 5D6DA 4AM0B 3RUGB 4HZAA 3MODL 3WHXA 4V1DB 4N0RA 1FDLH 4PJGF 3RA7H 3MRPB 5HGHA 3VMNA 1T89C 3SDDC 5T33H 3GHEH 1U8JA 4WUUE 2OL3L 4GAFB 1MCRA 1UWXK 5K93A 2Z92B 4R3SA 1ONQB 1A1OB 3DUHA 2C1OB 4G7VH 4FQIH 2Q86A 3QDJB 4LP5A 4KJPC 4TTGA 1IFHH 4WHYH 3VFGL 5GSVB 2XV6B 1AGEB 2NY6B 3E3QE 3ZHDA 2R15A 1S7RA 3HR5A 1MELA 3VH8G 4R8WL 4GAGL 2F8OA 4Z7OF 3AMLA 2BJMH 1HXYB 1N6VA 5D4QA 2HT2D 1QHOA 3VW3L 1I1AB 3IRPX 5CJBA 4AIOA 4PRHB 1U92A 3KWWB 3C60B 2VMFA 3A6OA 3SE4A 2ZG1A 4ZUSA 1QFHA 4UUJB 2DJUA 1FYHB 4YXKH 2GJJA 5GGUB 2X4PA 3OKOA 4U0RC 2RAMA 2XG4A 3DHJA 3UYRL 1MCOH 3FQUB 2XTJD 3RWEA 2EXWD 1U91B 3FTGA 2EDOA 5D5ME 3JXAA 4WI3A 1DSFH 1KNOA 3T2NL 4JGUA 1ZK9A 1E6OL 1ZT4A 3T0DA 3JV4A 4JANA 2DQFA 3FQWB 2X4TA 4TSCH 4K07A 4PB9H 3FL7A 4TVPH 5FXCH 1UC6A 5JLZB 1HK6A 3D0LA 4M6OH 3GMNA 4PJ7E 2JELH 4ETQA 3MOBL 2XWTA 2BSRB 3OGCA 2VABA 2VXUL 4JREB 5GGQL 2ZUXA 4P23A 3U36A 2VAAA 4YK4C 5C0IB 4HQQH 4H5SB 3PGFL 5D6CB 1CXIA 1MI5B 1DP0A 4OLYL 5I15H 3CCHA 4DN3H 2BK8A 3KPQA 5DVLA 3TBVB 4LSQL 2IFGA 3HPLB 4JG0H 4Y4KD 4TRPH 4XPBL 3O6FA 3BGMB 3RTQC 5TFSH 3DGGA 2FCBA 5T5NG 4OLYH 5K33A 1YUHA 3WEXA 3ES6B 4HBQA 1OGAB 4K3EL 5DDHA 1GC1L 3C5JA 3OHXB 5T1MB 4S1RH 3S35L 1AY1H 3VJ6B 3I6LE 1NUGA 3OKMA 1FZKA 3G5VB 2GITA 4KY1H 4L29B 3LKSB 4OFVA 1H8NA 2H8PA 32C2B 4DQOL 4OF5A 1QSEA 2ARJA 5FK9A 2R8SH 2C4XA 2AERT 2UY7A 5DJ2B 2BNQA 3VFNB 4YUEH 1Q9KA 1S7UB 4CMMB 3OKYA 4EI5C 4PJCF 4ZS7H 1MFDL 2C3WA 4PGZA 2P5ED 2Z35A 3MACL 2HRLA 5EUOE 4M8VA 1FG9C 1HKLH 2HLAA 4OGYH 5DQJA 5IBLD 2HP4A 3GJFB 3NAAH 1A7NL 3VD4A 4G8IB 3ARBB 1NSNL 2HH0H 4QY8B 3MUZ1 4MSWB 1N5AB 4QKXB 4U4BA 2V9TA 5E00A 1J9CT 5D96C 4NGHH 1NBZB 1FGNH 1I3UA 5CUSL 3D3VB 5EZOL 4E42A 1F4YL 2O61A 3NN8A 4F37F 3ARFD