1F58H

Igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
228
structure length
228
Chain Sequence
DVQLQQSGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMGYIHYSAGTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAREEAMPYGNQAYYYAMDCWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing fabs.
pubmed doi rcsb
molecule tags Viral protein/immune system
molecule keywords PROTEIN (IGG1 ANTIBODY 58.2 (LIGHT CHAIN))
total genus 42
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 1998-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f58H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f58H01
3CX5J 1JPTL 4YWGL 4HH8A 3WV0A 2R8SL 1CFVH 3W11D 3FN3A 3LRHA 2BRRL 4QRUB 4OLYL 3WD5L 2L7UA 4G8IA 4K94L 15C8H 3TN0A 2J5LB 1QA9A 1NGWA 1JZ3A 1EAPA 4MA3A 1IFHL 4HXAL 3VXRE 1QYGL 1WV7T 1YECH 5ILTL 1F6AB 3RTQA 1PG7X 3L3DB 4XVTH 5A2IH 1DVFD 4ZPTA 3WO4C 1RVFH 4TVSa 2J4WL 5FYKL 2MQ3A 4LAQH 4PLOB 2HWZH 3VWKD 4IOSD 1S8DA 2DLFH 2Z31B 2ADIA 1MCWM 3HNTL 1INEH 3HHRB 1VDGA 4EN3C 4NUJA 2FHFA 2DQUL 1MAML 4KDWA 5JW5A 5B39A 5EB9A 4P4RA 5IEKB 1FJ1B 4RRPG 3FQXA 1SHMA 5D2LA 3D0VA 4IRJA 1Q9LB 2PCPA 1FQ9C 1UYWL 1WC7A 2VSCA 4WDIB 3E3QC 1QRNE 4WUKH 3IU3A 5F7UA 4GQ9L 5J12C 1RZKH 5HHME 3D39D 3DX9B 5I9QC 4FNLH 4WI7A 4XBEL 5EA0L 4EN3A 2QHRL 3PABB 2FL5B 1LO2L 3SE9H 2VXSL 3MRHA 2OYPA 4U3CA 1QFUL 3CUPA 1R3HB 5KANG 2OR8A 3S96B 3VXNA 1F6FB 1CDBA 1F4YL 5EUKB 4ODWA 4L9LA 1U0QA 4KHTH 1PG7W 2Q8BH 4QNPF 5E8NA 3EOBA 4LF3A 5HI4C 5DJ6B 3RHWK 3NCBB 5GGRA 4UIKH 1HHGA 3GIVB 4R90L 1A02N 4EBQH 3QFJD 4LSTL 4PRIA 4KPHH 3RA7H 5IP4A 4ZUTB 3IAQA 1QSFA 4X6CB 3IB4A 3X12B 1CLOL 1JP5A 3RUGE 3G5ZB 1OTUD 4TVPD 2W1NA 4K2UH 3CFEB 1I9JH 1NFDE 4ELKA 3MYJA 3T3MF 5C86A 4DZBB 3KPOA 2DBLL 5I1GL 4YFDB 5I1HH 3KLAA 4M93C 1MFDL 5FYLE 1DN0B 4MD4B 4KROB 4ODTL 3H7BB 4OUOA 1QRNB 4PJEA 5DT1L 3X11B 2OQJA 1IGJB 3TV3L 3AU1A 3VXUB 2OZ4L 3WIHA 5ILTH 2G5RA 4K2UL 5KAQG 1AKJA 3DI2B 5IMMB 5KS9A 5HHPB 2C1OA 2Y06L 1NCWL 1B0GB 5ACMA 2QQLL 3ARVA 3D0LB 1S8DB 2Z31A 2XWTA 4Z7VF 1UJTA 2MQ0A 3B9KD 4LSSH 3O0RL 1X5XA 1DZBA 3T2NH 3GRWH 2X7LB 3BJ91 3BX7C 4Z7QE 3HE7D 4G6ML 1WFNA 4W4OA 3TZVA 4I48B 2BNQB 5CEXB 4X8JA 3V95A 2WV3A 4NNXA 3GHEL 2NY4D 1ZWIB 3VU2A 2CDGB 4Y1AB 1UQSA 5D7JC 4QRUA 3PHOA 1P7QD 3KYMB 2VLKD 4LMQI 5C0FA 1NJ9B 2HMIC 1NCTA 3NGBB 5F6HI 4PJ5B 4WHCA 2Z8RA 4YHIB 1VFBB 5I8OL 4CRPA 1K9TA 3K8MA 4JM2F 2DKUA 4E9LA 3ISWA 3MRQA 4ZQKA 3VI3F 3B5TA 3VG0L 2R29H 4MNGA 1OGAB 4YIQB 2ERJC 2HLAA 2GQHA 3WIHL 1A9EB 5AYUH 1CU4H 3L3OA 1E4KC 5JIKA 1F11A 5EIVA 1XZ0B 2F53D 1MCKA 3VGFA 4OLXL 3HC0A 1DEEA 1ERNA 1NFIB 5F1NA 4OGAC 1G7IB 1G84A 3BI9X 1I1AC 3UBXA 1BFVL 3T0BA 4J6RL 4P48A 2G75B 3RFZC 3V7AG 3CDGB 4TSCH 4V1DE 1BZ7B 4XXCA 1I9RH 4X7FC 4XP6H 4NKDA 5C0ND 2VKWA 4HH9A 3GMLA 4HGWA 1V3MA 2XACC 3LEYH 3CX5K 1KTKE 4YE4H 3VI4F 3IKCA 4Z7OF 1SY6A 5DJCA 3O3BA 1MCDA 4OF7A 5IFJB 3TVMD 2Y7QA 3JTTB 1XH3A 3O6FB 4TPRL 3OKOB 1CFTA 4E5XA 2AXFA 3SEPA 1RV6X 3RIAK 4O9HH 3THMH 3GDBA 2FNBA 3QDGB 3SPVB 4FMKA 1KCRL 1NLBH 4K94C 4NQDB 4QF1A 4ENEC 5LWYH 3EYVB 4CMMB 1VSCA 4GUPA 3D85D 5HD8C 1PQZB 5KANI 3TT1H 2HT3C 4YBLC 1FFNB 3ARBB 3QBTB 4IM8A 3KHQA 3TPUA 2DJSA 1CS6A 2A9ML 1L9NA 1G7QB 2QSTA 2MCPH 1I1FA 3MYZA 1HXMB 3VWJD 5FUCE 2R9HC 3IJYA 1L0XA 4RISL 1VESA 1SM3L 3HLAA 4ZFFB 4N0CC 4PB0L 2NR6C 4YHPA 4KVNL 3BIAX 4V1DB 5I1EH 1HEZA 2BCKB 3ZKSD 2V5TA 1JPFA 3MUHL 3QJFB 4H5SB 4PJ5A 5TE4L 4JO2L 2G9HA 2F54A 3QIBD 4M5ZH 4ELMA 2JJWA 3C60A 1I9IL 4KRLB 1HDMA 1C12A 3IU3B 5BVPH 4XPHL 3QNYA 1QEWB 3L3JB 1AE6H 5IT2H 3NAAH 1KCVL 4LBEB 4MQ7B 3F58H 4KUZH 4PG2C 4L4VA 2L7JA 3DETC 3OV6A 4M48L 1UXSB 1MCOH 1PLGH 4OB5L 5SWZD 4JPVH 1AIFA 3SE8L 1XGYL 4X0KB 4MX7B 4TSAL 2YD2A 5HDBF 4HDIA 2XG5A 5ECJE 1P69B 2ZWLT 4U7MA 4PJEF 2VLJB 4TSBH 2R0KL 4PGDA 4XPFH 4NP4L 2DRUA 4X4ZA 1XF4B 1QLRA 3BQUA 3O3EB 1A7PH 2BVTA 2WINB 5DGRA 1KCUH 1QSEB 1Q72H 1RK1B 4NWTL 2AJZB 4OIBA 3E6HB 5BS0B 3BP6A 5E24E 3VD4A 1YYMH 4JGJA 1D6VL 1JN6A 2UVFA 4WWKA 1BZ9A 1J1OL 3L7FA 3O8XA 4OCSH 4YGVB 2A1WH 2YA0A 5E9DD 1IT9H 3RP1A 4LCCC 1MCRA 5C6WH 1FHGA 1KCUL 2IJ0C 4PTTA 5DZLA 3SY0A 1I1AB 1MFAH 4LVNC 3QXDB 2GSIB 1FNHA 3DECA 4NGHH 4WV1C 2MHAB 3ARGB 4JFEE 1EEQA 1WWAX 1RIVL 5IF0B 2WBJC 5DUBA 3REVB 1QBAA 4KI5E 1R24A 5GSRB 5HDLA 4GRWF 4OLUH 1GCFA 1LO2H 4DGIL 4EI6A 1S9XB 5MEOA 1SEQL 4MGXA 1G7LB 1ETZA 4UTAH 2XY1A 4JRXD 1HHJA 3L5JA 3R06A 5DD1L 5LQBH 3MNWA 3WLWD 5TDNA 5HVWA 2BZDA 2D03H 2E9WA 2Y23A 4QY8A 3U9PH 4R8WH 3NA9H 4HX1B 4NQED 5B38A 1NBVH 3TNMA 3OKDA 1PQZA 1BBDL 3BDYH 4JFFA 3WD5H 4WU7B 3IGAA 2VDPH 5KVDL 5I71C 1IAOB 1WWBX 4OLEA 4HW6A 5H35A 1FFRA 2E27H 2VN7A 4FP8H 1MVFA 3AXLA 3QDAA 5D8JL 5L2JB 3OKOA 5BCAA 1ORSA 2D4DA 4FG6C 3IKCB 4XBPA 3JV6A 2ICWA 2QADB 3IDJB 2P46B 2BVYA 3OB8A 3DIFB 4XVUC 4NRZB 3AS2A 5I1HL 1IGIL 4XNYH 2E8ZA 2R0KH 5IJKA 3S37L 1TZGH 3OAZH 5D6CB 1WT5C 1B0GA 4V1DD 1IVLA 3AFLA 3VA6A 3QUZC 4LKCB 1NANI 5EFIB 4DQOL 1UJ3C 1ES0B 1FZMA 4PJ9D 4MA1B 5HDQH 4LIQH 2XNAA 4E41E 2P48B 4B7IA 1BJ1J 1R5IB 4GAJH 3GBNH 5FHBH 2OQJB 3HR6A 4WUUD 1UVQB 5IV2A 5IJKC 1ZVYA 5TPWH 2R69L 4I3RL 3VFWB 1N8ZA 1S9YB 4L4JA 3V0VB 5IVXA 4DZBA 3M1BB 4PGJA 1QFOA 3HMXL 5F7DB 1YEGH 5IB4B 1X4XA 3U7WH 2PXYD 2PYEA 3EYUL 5C3LD 4ZD3L 1GGUA 3B6SA 5JUEL 4ZQKB 1IQWL 1Q0XH 4M7LH 3GSXA 1LO3L 1KIQB 2OL3H 3D2UA 1CFQA 2M26A 3UXFA 3HPJB 2YSSA 2JTDA 4H5SA 2ARJA 4C83A 3TBWA 2QR0B 4P57B 2K7PA 2YPLA 3VWKC 4HMDA 1MCFA 1Q0YL 2ATKB 4KMTH 3LKRA 5HGHB 1KLUA 2AV1B 1ZLSH 2R2BA 1CLZL 4YBQC 3SO3B 5I18H 4KK5D 5KBNC 2IF7A 4BZYA 3RHWF 5JORA 5DD3L 5JOFB 3F58L 4MHHG 1C1EH 1K4DB 1U93B 4LRIC 3CFJB 5IHUL 1NMAL 3MJ6A 2E9IA 1CL7H 4JHWL 2F8OA 4ONHB 1JGDB 3QI9C 2CQVA 5C07D 1ACYH 1OSZA 3ZHKA 1FZKA 5DD6B 1KF9B 1MFDH 4LVOC 4BH7B 3SPVA 5ELIA 1P84K 1UCBL 4Z7QF 1LNUB 1CFBA 1M05B 3BT2L 3FFCB 1H8SA 1CQKA 4EXPX 3C09C 3X17A 3RDTB 4ZG1A 3QCUH 3RY5A 1AGEA 1FLTX 1IGIH 5IMLB 4J6RH 2IBBA 3WS3B 4AEHL 4JN1H 3G6AA 1SVCP 2E9JA 3WHXB 3MMEA 2V2WB 3BKJL 4WFGD 4NN7B 4PJIB 3VFPA 3CLEL 4G9FD 4XRCB 4YZFE 1A4JB 2RBLA 3P9MA 4L4VB 5IR1B 1UEMA 3KDMB 4OBSA 4J3VA 5T3XD 1CZ8L 1Y0LB 4CGTA 2WUCL 1GJIA 4G9DB 4KZDL 3I3BA 1XZ0A 3HNTH 2YD6A 1F42A 1K3ZA 5B3NA 3EGSA 4MAYB 5D7LE 1M6OA 2X05A 1ETZB 2F54B 2VXQH 5I1DA 1F8TL 1XF1A 1G9MH 4FXLA 2XN9E 1QSED 3UYPA 3MV11 4P2RD 1DBAL 5EBMB 1KIQA 3QA3B 1ROWA 3RVTD 3TIEB 2YSSB 5A1AA 4QTHB 3BP4B 3ZTNH 2DQTL 4JKLA 4WEBH 2WBWB 2YPVH 3CMGA 1JF5A 2AI0L 5IESL 3VFNB 1DLFL 1CLZH 2OXGA 4N0YL 3LV3A 3PNWB 5HY9B 4KZEH 2H2SC 4K7PL 1S5IH 3D69B 1PZUB 2CDEA 1TPXB 4JO1L 2Y5TA 4M7LT 3RIFF 5SWSB 2P24B 1CDGA 2R0ZL 2FEEI 4KGLA 1A1OA 4PRPE 5C0BB 4J12A 1PEWA 1HYSC 4MQXD 4N0YH 2ADJB 3W5MA 4QTIH 2EDYA 3OG4B 1YEIH 5FYJE 1N6UA 4HIXH 3BSZL 4LLYB 4CVZA 2HMID 3S35X 3VXTB 4TULH 4AEEA 2Z9TA 2VZSA 4GG6E 3MRDA 4M61A 3SGEH 3OAYH 3QFJA 3RWIA 1RZIB 3T2QA 2DBLH 5I1GH 5SWQA 3LRSB 3ME0A 5J3HC 3IAPA 4PJ7E 4ODHL 2EYRB 4U1JA 3VFTB 2XXMB 5H35B 3LSOB 5DQDH 4JJ5A 2MJWA 3QULA 3QI9B 1U6AH 3UZVB 1FIGL 4X8XA 4OZHA 5I9QB 2A83A 4TNVK 1NC4A 2C5DC 3V4VL 3VXME 5SWSE 3X3FL 1UH2A 1CR9L 1BFTA 2H41A 4XCNB 1TETL 3MXWH 3QPXH 4G7VL 5B3JF 3U0WH 4U7SA 4K8RC 5D1XB 2AV1A 2WWKO 1FG2B 2FATL 3L3IB 3VFSB 1G7LA 4LCUB 4OZFB 4WHTB 2DBJA 2VXSH 2Z31D 2V5YA 3EJJX 4XGZA 5E8OA 2YN3A 1RIVH 1FVDA 2NY4C 2X2YA 3HPJA 2DQGH 1WCQA 5T1MA 2Z92A 1NAKH 1N3NB 1FH5H 3H9YA 4N0FB 3UDWA 3EZ8A 4OQTH 4HF5H 4U1KB 5E6IB 2W65B 5C0RH 2W60B 3O4OB 3C5JB 3QEQE 3MLXL 4H25A 3R1GH 3IDYB 4A6YB 2X4RB 1IM3A 1CVRA 3TZVD 1X4YA 2WLZA 4WWKB 4G8GB 3PP3K 5BMFH 1HI6B 4JKWA 1MFCL 3N9GH 5DWUH 4WTZA 1CLOH 3WS3A 2XT1B 1KIPA 2E6JA 2J7LA 4U1MA 3R1GL 1CD1A 4GKNA 3V52H 5AD0A 3QH3A 5GRJL 5ADPH 4K23L 5JNYB 4HWNA 4JDVA 5I73C 3WNKA 2PW1B 4JPKL 1I8LC 3PGCB 3FB6A 2YS4A 3WL9A 3CFKB 3V6FB 5IKCA 1JI2A 1NCBL 4ODUB 5L2JA 1ZHLA 2V2XB 3HG1A 5DA4A 3MLRL 2VH5H 1YZZA 4JFZL 5E2UH 3LV3B 3BKYL 1FORH 4YH6A 4M8VA 3MRNA 4BELD 4NCC1 2ID5A 4TVPL 5B38B 3QEHA 5MEPB 1IEBB 2VC2L 4APQB 3DETD 3OKMA 1CGVA 5T1LD 3EYFB 4M62H 2OJEA 5JQHC 1T2JA 4HUVA 1ZT1A 3AM8C 1KG0A 4L3EE 3FZUC 4JCLA 3QWOB 5DF0A 1LEKB 5HYSG 4MA8L 4XWGL 4P2OC 1M6OB 5EU6A 2QEJA 1F58L 2Z91A 3N1MC 4IS6B 5D1XA 4ETQA 4OQTA 4PJAF 2M1KA 5T1KD 4K7PX 3TWCH 5F7DA 3BOVA 4K7PH 1ZT4A 3H0TA 3QUML 3D85A 4PGCA 4Z7VB 1JNNH 4EVNA 4Z77A 4H26A 3W39B 1FC1A 5HSFA 5C8JB 4J4PD 1F02I 4LFHG 1C5CH 1AGDA 2HG5B 4XX1G 3VG0H 4UTBL 4OM0L 2JJSC 3IFOB 5I18L 4EUPB 1KEML 5ID1A 4G42A 1QFWI 5EZOL 4X4YA 2CGRH 1AGBB 2DQEH 3TV3H 4UV4H 2G2RB 1ZV5A 2JJTA 3NCFB 2R4RL 1QP1A 2VL5A 5HHPA 3KPRE 2YWZA 3DV6A 4U1MB 1UXWB 3EFDH 1QNZL 4KHXH 1EX0A 3S3PA 4WW1B 3VG9B 4CU8A 3QUYB 4UV7H 5J12B 1X5YA 3S4SG 4JQIL 4YHKL 3O6FC 3C60D 1MPAH 4KH2A 5JXAL 2BY3A 4NO0B 3MNVA 5F7YC 1OAQL 4QWWD 2AJ3B 3GJEB 3N85L 4JFQA 1EV2E 3F12B 3T2NL 4Z5RB 4OJFH 1J0JA 5FK9B 4TPRH 4WV1A 3X12A 4NP4H 2IGFH 2X4OB 1U58A 3KWWB 1QSFB 3DO7A 3IAGC 1BIIB 5TF1H 1BBJA 3GSUA 5DHVH 2X4NA 1F3JB 1YEJH 5CJXC 5SWZA 4Z7NF 3BKMH 4OZIF 3L5WA 4KKCD 2Y25A 3VE0B 1DQQB 1IGYB 1LD9A 5IROC 5DJ6A 4KRMB 1RJYA 2J6EH 2JB5H 4N9GB 4F7EB 5JIIA 4PGEB 5I75C 4I3SL 4JY4A 5IBLC 5IW1B 4HBCH 2R0LL 4B0MM 3TH3T 2VABA 4RIRA 4R26L 3GIZH 1J05A 1OD9A 2FLRT 2XN9D 1A9BB 3LH2L 5T5NG 4NNXB 4WWKD 4PS4L 5EBWA 1IEAB 4UMGA 1HH6A 5E9DA 4LASH 3QXTA 5H2BA 2VAJA 3QDJE 4G6AD 3K7UA 4LLUA 5F9AC 4HV8B 4Y5XA 1LILA 5C9KA 1ZHLB 4HMEA 2R1XA 2V2XA 3HG1B 3KVQA 5HYQB 5A16A 4M1DL 4OSUH 4APQC 4KU1A 4P46C 1EFXD 1DUYA 4M7KH 5CD5C 3B43A 2YA2A 1KPRA 2BNRD 4R3SA 5DRXA 3TO4C 1EVTC 4CU7A 2GAZA 3S36L 1D5MA 2NTFA 3IFPA 1DTUA 4MNQA 5J9PB 5L7XH 3QDGA 2PW1A 1OGAD 3VD7A 1I1CA 3TA3B 5E00B 3NOIA 3WFBH 4BSVB 4JVPA 3MRCB 2B2XL 5FGCE 4O2EA 4HS8H 2HJFB 1GC1C 5JZ7D 3WFEL 1Q94A 2P8LB 3BPNB 3JBG7 4JRXA 2AXGB 4HGWB 1N64H 3C9NB 2OI9B 1J1XH 4Z78A 3HUJB 3ULVC 4AIZB 5KOVC 4JM2D 2BSTA 3I6GB 5GSVA 2CR3A 4NKOB 2EDTA 3EYOA 3IRZA 3MJ9A 3PJSB 3UBXB 3TBVB 3QIUC 5BV7H 4NQEA 4X7EC 4ZODA 4NO3B 4DKFH 5C9JB 3NFNB 5IB2B 2PO6C 3IYLW 5TQ0L 2BOBA 5J4MA 4JFFD 1E4JA 3BE1H 4FQPA 1FBIL 3AAZB 5C0DB 3L3OB 3SDCC 3HZMB 1H3PL 2CKBB 3KYKL 3Q6GH 1JPFB 1RZ8A 3TBSB 2BOCB 1D5ZA 4KTYA 4M6AA 4DOHE 1BOYA 1U8OB 1NAML 3H3PH 5HPMA 1I7TB 4X7SL 3G04B 1JL8A 4J2XA 5I1DB 3W0WA 5DVOA 4PRBB 2I07A 4AENB 2YZ1A 4IRZH 4R2GC 1EERB 3KYKH 3S34H 4YHIA 5KSAB 4I0PD 3FO9B 2Q6WA 4QRRA 4JZNB 5C2BH 3CVHA 1YQVH 3EYUH 3W11C 3T1FA 4YHMH 5GS0L 1TVHA 2ZJSH 4WUUA 1K2DB 4PJAA 3DUUA 4GOSA 5ESQB 4IRJC 5FAAA 4P23B 4R6UA 3VMOA 2AXJA 3OKEA 1VACA 4J3WA 1XIWD 4D3CH 1L9MA 1ADQH 4WW2C 1JPGA 3VRLE 1I8MB 1R5IA 4Z8FL 1PLGL 4OB5H 3BZ4A 4FTVD 4RGNC 2VWEC 1YQ2A 4M9PA 2EDOA 2MWCA 3QIWB 1YUHB 5E8PB 4HH9B 3SGEI 4X9BA 4PV9A 3WFBL 5DEFB 3FONA 5DJ0A 1PW3A 1OAUL 4HG4K 2XTJD 3SHSA 5JNYA 1D9KC 4LSPH 3WBDA 3ARGD 3F7PC 4UINL 1YNTA 2ICCA 5DVKA 4N8VB 2ESVD 1DDHA 3MBED 1OP3K 1KCSL 4HGMA 5ANMA 3C8DA 3VXOA 4J3OC 3KYOA 5DJDB 3U46A 2I9TB 1BX2B 5GS2D 4N0UA 3WLBA 5E9DB 2ZUUA 1HN1A 1ZT7B 1AQDB 2J8UE 2FBOJ 1EEYB 3NIDE 1RUQH 1FSKB 2EYSA 2FGWH 4ODXA 2Q8AL 3WN5C 4ERSL 2ATPA 5DQJA 1OPGH 4DAGH 1R3IL 3VXSA 4TN9A 3ZKXB 5FF6A 2J5LC 3BN3B 4PRHA 4Y4HD 3BP7A 1KJ2H 4WTXA 3BD4A 4OZGF 2MTPA 5I8EA 2KBGA 4M9OA 2DD8H 5BXFA 4WGVB 4XX1E 4K3GA 4ZS6C 2HJKA 3WYRA 1M7IA 4N8CH 5F3HB 2EKJA 2ZUQC 2P5EA 2PYEB 4MD0B 5BQ7B 3ARPA 43C9A 1F2QA 5LVEA 1IGFH 2HT4C 1M4KA 2B4CL 2BSRB 2X4OA 4NQVA 4X6DA 2VDLL 2H3NB 3O41B 3O9WA 4X5WB 3QO1B 4WI4A 1RK0A 4PD4J 5HHOB 3GO1L 4LEOA 3EFFB 1IL1B 1JZ2A 3LKOA 2F9BT 3RNQA 3TBYA 3FN0H 1J8HE 3ZT7A 1FGNL 1RU9H 2IFGA 4XCFH 1Q9KA 2XZCL 4OZIA 1CICD 4PJIE 5C0IB 3BP5A 1J1PL 4Q9RH 5CGMA 2DYPB 2BNRE 2I5YL 3BVNB 4AT6A 7CGTA 5K9KB 1F2XK 4JFDA 4PJHA 3U0TB 1QKZL 3QHFL 4XPAL 1Q9OB 4FXGA 1TZHA 4LHQB 4BH7A 1K6QL 1MUJA 4UUJB 3UBXI 3F8UB 3WJLA 1CT8A 4DUVA 4IIQB 3IGAB 4IRSC 2CDFB 1LK2A 4PGBA 5DI8B 5C07E 4H26B 2LVCA 1ZA6B 3W39A 4OI9A 5DD5H 4P5MB 2VQ1B 5HHVH 1DBBH 4W6XB 4KI5C 4PIRF 5TPWL 1EBPA 3QCTL 3O6KH 2NY0C 2EIBA 4MSWB 3JWOC 4PJ7F 5HXMA 4PJ9B 3W82A 3HE6B 4AL8L 1K2DA 1CDJA 5KSBB 5L6YL 4NJAH 2AGJL 5JR1H 5HGHA 5J89A 3FRPG 4MLSA 3SE4C 5EU7E 2H6PA 3V6OC 5BO1L 5AWNH 1B6UA 2EDDA 1TZIA 1CG9B 2O5YL 4IRZL 1JCKA 5IW1A 1P6FA 1BD2B 1W0WA 1D5IL 3O2VH 2CLZB 1YNLH 1LP9E 4XZUB 1TTGA 4N9GA 5DRWB 3MLTA 1MHHA 4DW2L 4O02H 5MP6L 4GQ9H 4OLWL 3KXFE 4WY7L 5SX5H 5T3XL 4WI3A 1OSPL 3LKNB 3FFCD 3U1SH 1MQKL 3SDDA 4C58B 5E2VL 3QHZL 1XR9A 3FMGH 1ADQA 4HMCA 1N6QL 5DRNB 1EZVY 1WZKA 3PWLA 4NDMA 1DANU 2B1AL 3VXOB 1WBXA 5DGQA 1J0HA 2VE6B 1E27B 3JV5A 3U79A 4GBXD 1FJ1A 4Q9QL 3W9EA 1J0KA 1N6QH 1SBBA 2VOTA 3D39E 2EDBA 3LEVH 1ACYL 4XNXH 2BFVL 5E8DH 2CR6A 2AJSL 5E2TL 5FKAA 1OOAA 4M7KL 1G7HA 1GOHA 3EIFA 4ZOBA 2XIDA 4I0CC 4RX4A 2EIZA 3INUL 2YN5A 1OGAE 1JZ8A 4TTGA 4W70A 1CLCA 3OXRB 1NAMB 4HBQA 5CSZB 4J3UA 1T0MB 4Y1AD 1I7UB 1BVZA 3SKJH 2VJXA 3UTTB 1UM6L 3NCJL 5K9QG 4FABL 4XB7A 1A6PA 3VXMB 1JGEB 5ACZA 1NCAL 5BZDB 2Q7YA 4HC1L 4ERSH 4ZAKC 3LS4H 5HI3C 3VI3E 4GW5B 1A0QL 1E28B 1R3JA 5JOFA 4U2ZA 2BVEA 4R4FL 5T1MB 2YD9A 3LN4A 4PTUB 3BWAA 1M7XA 2GJJA 4NQCA 1RZFL 4MS8C 3ARXA 3CK0H 2EYTB 1R3KB 3BN9C 2BSSA 2AGJH 4MXQC 5E99L 2AEPH 1G6RB 4QRTB 5D1XC 5EZIL 2UYLB 3SGDH 5EUOE 3IVKB 2R69H 4I3RH 2YRZA 2BXZA 3BGMB 4GLRI 5CJ5A 1RHFA 3MOQA 1QRND 2HT3D 3TJEH 3BQUC 4R9HA 1UB5A 4DW2H 2GITA 1INDL 2HT2C 5EZLA 2BC4B 3GSXB 5J11C 1B0RA 2DQUH 1QLFA 2P43B 3CLFL 4RAHA 4XCYB 3NABH 1XCQA 1UQSB 2F19L 3LMJL 1F4AA 4XP9H 4PS4H 5KSAC 2ZOKB 3QQNA 1Q9LA 1G7JB 2PCPB 4YBHA 3TJEL 2XPGB 5B39B 1AXTL 3PXHA 2NY7H 3FQNA 5IKCB 3QFJB 3RWIB 1YMMA 5F1OB 1G6VK 1I1YA 3FQUB 4UUJA 4GJTB 2WAHA 1RZGB 1W8NA 3L7EA 2DQHL 4LLYA 1T4KA 5KOMC 5EU6D 4Y88A 5EORH 3QEQD 4TYUA 3BZFA 5A3IC 1FFPA 2WMPA 4EBQL 1AO7B 5BVPL 2R1YB 4GKZA 1EMTH 4MAYC 2JJSA 2VRAA 2QSVA 1NEUA 1X5KA 2ICES 4PJXA 3VMNA 3IRPX 3LKOB 1IFHH 5DRNA 4G6JH 1JNHB 1DQLL 1NCCL 1A9EA 3NCYS 4YHYB 5GZNC 3DX7B 5L0QC 2ZUXA 3IFLH 5A2FA 3MC0A 2DLEA 4BZ2L 2YKLL 3G5ZA 4PJAB 3TIDB 3O6FD 3KLSA 5J56B 2ITDB 1EVUA 3F65A 3I84A 4NOBA 3S5LA 4LLDA 5CEZD 3SJVB 4LNRB 4TTDD 1RUQL 5JHDE 3ILQD 1C5BH 1T5XA 4E42B 1I7TA 1N2RA 1HSBA 3KJ4B 1KPUA 1MWAL 4YHNB 3N06B 5C0BD 4KQ4H 2VO5A 3QO0B 2R2CA 2DTML 2L0DA 4WHDA 4AM0B 2NYYD 3QUZA 1V3JA 3O2DA 3V5DA 3TPUB 1CXHA 1P4LB 4RGOL 5FUOL 4XBEH 1T7ZA 4KMTL 4FQCL 4GAGH 2PO6A 2OJZL 2X7LA 5EO9A 4XI5C 1W0VA 5DC0A 1HHHA 5FYJL 2QJDA 4N0UB 2JB5L 3WHXA 2NYYC 3VFTA 4F7PB 3S88H 1FFOA 4JFOB 4MAUH 4F9LC 1NKRA 5CS7A 1ZKAA 2ITCB 4WI9A 3ARTA 2OL3A 5LGKA 2IANB 1JPSH 3MJ8B 4JN2A 5JXEA 3NFSL 2YUWA 3OXRA 2F58H 4PJHB 4S1RH 4UB0L 3D3VA 1J8HD 4U49A 1BOGB 5FKPB 5CEYB 2VLMD 5C1MB 4CBPA 3S3SA 5BJTA 1BWMA 1WZLA 2GJ6A 4XPHH 3WNNA 5ADPL 2FO4A 5CD5D 5GGVH 5FDWB 5ACLA 2X89A 3FKUS 3TO4A 4G8EA 4M6OH 1I9JL 5E2JA 1HI6A 1TQCC 1BAFH 1YPZF 3V6BR 2B2XH 1EFXA 4NNYA 1S7WB 3TPKA 2MSPA 3H8NA 3NH7L 2CD0A 4F7CA 3P4MB 4LLMB 1H8NA 2IFFH 1T7XA 2B39A 5DK3A 1HDMB 1U2HA 4MNQD 4FQLL 4RSVA 3QDGD 4P2CG 1HHGB 2GITB 3CFCH 4WFHD 1GGBL 4ZFOB 3U7YL 1T0NA 3RWCB 4NKIL 5D96C 3GKZA 5D7KE 2NY0B 4HUVB 3E1F1 1YEJL 5I75B 5DHYA 5TFSH 2QADC 4BM7A 2ENSA 5C71A 3FRUB 1EGJH 1EEUA 5TDOB 4XC3L 5AYQA 4P9HH 5AAMA 5DMYA 1R3LA 3GSVB 1Z5LA 1MI5A 2MPAH 1MFBH 1D5BB 1Q9WB 1X5GA 3LPWA 1ZEAH 2V9RA 3ZSTA 1UWXK 1U92B 2CDFA 4U6XB 4V2BA 3V6FA 1U8LB 1BM3L 2WNGA 2H8PA 1YNKH 1SYSA 4UDUB 4IEFB 1GRWA 1S5HA 1NUDA 4BUHA 4ODSL 5IVZA 3VGDA 3UBXG 4JDVB 4K9EC 3BO8B 5DO2C 3ARSA 2J6EA 5AD0B 2A38A 3BXNA 3JV4A 4NJ9H 4OLVL 3KJ4C 1ZHBB 4F58H 2MOVA 4HJ0C 1T20A 1T03H 3ARFA 1RAMA 1OVZA 3OAUL 4OT1H 5ALBH 4QRRD 2A6JB 3K74B 4OZGB 1JRHI 5CWSA 4UV7L 1HHIB 1L0YA 1MLCA 1OWWA 1YYLH 4DKEH 4BSWB 4LDLB 1HXYB 1JNLH 4EUPA 1HK6A 3OKDB 2C4FT 5INDA 2A6IA 4YO0A 1T03L 1RJLB 4MCZB 5J1TC 1CFVL 3V5DB 6FABH 4AM0A 4LGSB 3UPAA 4K23H 1IGTA 4OJFL 3C6LA 2XTJC 5TDNB 1DBBL 1C16A 2CRZA 4XMLL 1HSBB 4EDWL 1IARB 1H9VA 1A9BA 3GNML 3CH1B 4LCWD 5DJ8A 4FTVA 5HDQL 1JYWA 1CGTA 3I3DA 4NC1E 5E8EA 4QRTA 2PNDA 3MROB 3SQBA 1J8HB 4FQ1L 4OCLC 3S3JA 1R0AH 3S4SA 2OLDA 1N59A 4PP1D 4LAQL 3D1MC 3MGOB 2GCYB 1KG0B 3ARGA 3QXAB 1T0NB 2ESVA 3PWPA 2QL1A 4HBCL 1EEZB 2XZAH 1UH4A 4GRWH 1E28A 1R3JB 4P3CH 2XRAL 4OF3A 2CRMA 1U8HA 3MOBL 4LLVB 4Y4HC 1TNMA 2X4NB 5SWZB 4Y5YC 2VLLA 5ERWA 3STZB 5C2UB 5HTSA 4RZCA 2OL3L 1U36A 1UACH 5F6IC 4Z76A 4L1DA 3VFOA 5L2KE 1U8NA 2D7OA 1INDH 3MLUH 5D4QA 3UYRH 3OJ2C 3BYYA 3IJHA 3HFML 1E0OB 3MSPA 5DK2A 1WICA 4UIMB 4YR6A 4CADB 2FSEA 4QHNA 2AXGA 5F7KC 4PRHD 4Y4HA 1PY9A 2XN9B 4HSQA 4G7YL 1IJ9A 5JIPA 3GMRA 4HK0A 4HWUA 3HI6L 5IIEA 1G1YA 3BH8A 4WTZG 3T0XA 2XA3A 3HC4H 5ID0A 4JO2H 4JY5L 3UAJD 4S0SD 3ARDA 4HFUL 3ZT6A 2HFGH 1JGLL 1NL0H 4KUCD 2VMFA 4D0BA 3SKUD 3GUTB 3SOBH 4P2QA 4BH8A 4AH2B 2ICWB 3Q5YA 1T66C 32C2A 4OLYH 1VB9A 3UTSA 1BFVH 4RGMB 3QRGL 5GHWL 4RFEA 3T3ME 1I1AD 2QHLA 3F6LA 3O9WD 1RUKH 2QKIA 5K9QI 2CGRL 4LPTA 4YXHH 1B0RB 2BVPB 5JORB 4HWZA 1T1WB 4Y2DB 1P4IL 4KJQD 4GG6B 4NZRH 3BSZH 5GS0D 4KY1L 1CICA 4JQIH 1EUTA 1VFAB 5D93B 1MCBA 4YHNA 4QHUB 3R06B 2BNUB 5L8LB 1U8OA 4KJWD 3VFUA 4BFIB 2BSSB 5HPOA 4P57A 3EDFA 3CFIC 2BDNH 5HPMB 3LKPB 4P9HL 2P47B 2C9AA 2VDOH 3OKKB 5C07B 5HYSB 2IAND 1UYWH 1AXSA 4NN6B 2WIIB 1YY9D 3FB7B 5J1AB 5IB3B 1S7QB 2MHAA 4DQOH 2O5ZH 4U1NB 3CNKA 2D4FA 4LP5A 5C0DA 3I6KA 4FXKB 5HVHC 3QAZB 4X6EA 1B0WA 4XMKH 2ZNWA 4LQFL 3C2AL 3PIQB 5DJAB 4FQIH 4X5XA 3AMKA 2QLVB 4N8VG 1V3LA 3V4VH 4K7FA 3Q2CA 2B4CH 4NC0B 1QSEE 2OTWB 2N7BA 1I3GH 5MP6H 2FO4B 2NY1B 3Q6FB 2NW2A 1BVKA 5JW5B 4M5ZL 2VTFA 5CEYA 4NUJB 3CJJA 1J0ZA 1P9MA 3NPSC 4JRXB 4P5TA 4G80A 5DMKB 2IEPA 1LQSR 1UGNA 2DOCA 4MNQB 1YJDH 2QV2A 3RPIA 3MCLH 5E00A 3KPSB 2D3VA 2FIKA 4GFTB 5E7BA 4L1HA 3GFUA 4DK3A 5EUOB 3KPQB 3MODH 3VH8B 3HNVL 1F6AA 5AUMB 1I7ZB 1VPOH 2R39A 3QO1A 3MLPA 1A3RH 2NY4B 4I2XA 3ROOA 1ITBB 4WU7A 5KVDH 5IBTL 3EYSH 4Q9CA 1MRFL 4HWBA 5D2LE 4QCIA 4C56E 3QG6B 2EEBA 5A40E 2R2BB 1DP0A 4XP5L 2VLLB 5ERWB 1P4BH 1YN6A 4JRYA 3VFNA 4OTXL 4OCYH 3IS1X 1FDLL 3UP1A 1EIBA 1MAKA 2SEBB 2VITB 1JUFB 2CUIA 4KMLB 3T3PF 4KRPD 1VFBA 3UJJL 4LRNL 1W8OA 3G6JA 4FFZH 1QSZA 1TDQA 3QA3A 1TMCB 4U1IB 5B4MD 1YN7B 3NH7H 1TITA 1IGML 1LO4H 3HUJE 2HAZA 3TBTA 5JHLH 3QCUL 3UTQA 4Y5VC 4RMUA 2BJML 5EUOF 4ZSOE 4Y1AA 4ZAKA 4GRLD 2XWJB 3OXSB 2CO6B 5FECB 4GS7B 1S9YA 1Q1JL 2XQYG 4YC2C 1A6ZA 1IC5L 1TETH 2IH3B 3LQZB 3MRGA 3MXWL 3O4LB 3RWEA 5T5FL 2FHCA 2A77L 5L8KB 2AEPL 4FQCH 1F3RB 3QYCA 5J7CC 3DVIA 1FNAA 5D9SB 2A0LD 1F90L 4I18C 4CMHB 3R8BB 1F4WH 1FO0A 1TZHB 4NQCD 4RMQA 1IM9D 2GK0A 4XCFL 2ICWI 3FONB 5DJ0B 2XKUA 1PSKL 1MWAA 1EO8H 1LO0L 5E94B 3FFCE 2OR9H 1S7UA 1MCQA 2YD7A 1WF5A 1CVSC 3SGDI 3ZLQC 3V4UL 2XKSA 5JO5B 1HSAB 2GT9A 3MLXH 2NZ9C 3S36H 4L8BB 3VJ6A 4OQ1A 2FX8L 3G5VB 1QKZH 2VAAA 3SDYH 4L3AA 3T0DA 4L8SA 3LKQA 1KJMA 1NGYB 4ODSH 1BGXL 3P0YL 1Z0MA 5EZJB 5BW7A 4MMZC 4NQTA 1IKFL 4Z7NE 1U3HA 4ZUSB 5LJYH 5HHOA 4WEBL 1ND0A 3FB8B 1D3CA 4ZTPH 3HZKA 4XMPH 5F7HA 3SDXB 3G9VA 1U3JA 1AE6L 5IT2L 3DSFH 3UEZA 4M5YL 2X4UB 2ZPKH 4WI5A 4JPKH 4QRRB 2R0ZH 2F5AL 4L29B 3DYPA 5CJ8A 4PUBL 5CMAA 5GGSB 4YDJB 1I3RA 3S97C 1AC6A 1YMMD 2PTTB 5SX4I 1DQML 5IFHH 4GAJL 5E8NB 4KTEH 2VLJE 1UKQA 3B2UC 1FLRH 1T83C 1MNUL 1CICB 4HT1L 1MCWW 2DJ4A 2E5EA 3VDBA 1MLBB 1CXEA 1JWUB 2X40A 3PL6C 3CXDL 4LLWB 4ONGH 5JOPE 3OGCA 4L4TE 1AGFA 2FB4L 4ZXBD 3S9DB 4L3CB 4LK4A 2CDGA 3VRJB 4ZNEA 1HKLL 1QO3A 1Q1JH 5HVGB 3ROOB 5TGBA 5TE6H 3K1KC 3JWDC 1VERA 1NAMA 4ODUA 3VFRB 2W9LA 3F5WB 4TUJA 1Y6KR 4LCYA 5T33H 3U9UB 2FWOB 5DVLA 4R97B 3TT3L 4QXTA 5TH2A 4LIQE 1BMGA 4YBQD 4FG6D 2F8XC 4PGDB 4R4ND 1N6VA 5D1ZC 3DROB 2P5WB 4IMLB 2VN4A 3FQNB 1OQXA 4AT6B 3PHSA 1SEQH 5F89A 3STLB 4UTAL 5HGBA 3GSRB 3HRZB 3FCTA 1KT2A 5C0BA 1OQOA 1BVKB 2W0LA 2X9XA 1H3VA 3CDGA 3SDAC 4D9RE 4JFPB 2RAMA 4HPOH 4APQD 1NMBH 3BJLA 3QI9D 5GJSL 3HC4L 4BZ1L 3HE6D 4LAJH 3SKOA 3EYSL 5CINH 5F9OH 1UCBH 2PO6D 5FGRA 1N7MH 2FJFA 4CMHC 5DVNA 3RNKB 3LQZA 1OARH 3MRGB 1FFQA 1KJ3L 4PJDE 1ZANH 1JPST 4HIEA 1T22B 1XCTB 4KK9D 3H0TB 4TSBL 1CGSH 2HLAB 4FP8L 2L4OA 3WNOA 1OAKH 5LAXB 4L9DA 4A2MA 3U4EB 3HA0A 2D2OA 4KKBC 2PTTA 1QRKA 4KK9C 1S9XA 4LARH 1DQMH 5IFHL 4IHOB 4R0LC 4R2GD 1MCHA 2B7DT 5I30L 2DWDB 1WBZA 3H9SE 4HUXB 4XNYL 2ZUTA 3G08A 1NGPH 1XF5B 5C08E 3ZDZE 3RWJB 4PJGB 5DR5L 3QXVA 5KVFH 3GGWB 1U58B 1DCLA 1G7QA 1DR9A 3L9RA 5FK9A 4NZDA 4DN4L 1XF3B 1OTTD 3T0AA 4U0RC 3U4AA 4QCIB 4JVUA 4BKLB 2IAMD 4EI5A 3K3QA 3MNVB 2UUDH 1UACL 4PTTB 1ZLVK 3RZCB 2JB6A 3CPLB 5K93A 4KK6C 3BPLB 3HMXH 4HKJA 4M3KB 4D9LH 5EU3A 4ZDHA 4TVPH 3RAJL 5JPNB 1JGUH 1MJ7L 2V6HA 2FX7L 1FFPB 2J12B 1WCBB 3O11A 3G6JF 3WS6C 2HRPH 4OGXH 4PJFF 5JQ6H 4P5TB 5I1LB 1RZGA 2WWMD 4H20H 2AERT 5GS1C 2I9LA 3CZFB 4JO4L 3NA9L 2Y6SD 3MLVH 3K2UL 3WKML 3OPZH 3RBSA 25C8H 2CUHA 2CIKB 1PG7L 5L7XL 4FFWD 5FCUH 1QBLL 1C08B 4UT7H 1XAUA 3ZL4L 3P30H 1RUKL 3A67L 2R56L 5D8JH 3MCLL 1AGCB 2Z35A 3RWFB 1I8IB 1UZ6E 5AZ2H 5M7QA 3NZ8B 1AO7D 3WFEH 3B5GA 4OF5A 4IS6A 4ETQB 4BZ2H 5C6TH 3G6DH 3NAAL 2Q6WB 1TTFA 3G6JB 2NX5A 1R6VA 4ZS6D 4JFEA 4QHMA 1P7HL 5B39G 5LBSH 2IFFL 2A6KB 2R2HA 5KSBE 3UPRA 4XVTL 3U4EA 2AEWA 2W92A 1FYTE 3ZMRA 5IB4A 4OGZA 3N50A 3G6DL 5F8RC 3B9KC 3QCVL 5EG6C 2Q86B 2VH5L 4U1GB 5KSVA 4X5LA 3I9GL 4YHKH 4P4KB 2CIIA 5B22A 4NZUL 3T65A 4ZOEA 3GI9H 1QBBA 5CHNA 5LWYL 1Y6MR 5D7JA 1Q72L 1HILB 2YRLA 3MQIA 1RY7B 4K8RD 4LOUD 1ODAA 2BSED 3C6LD 1KTLA 2E6PA 4DAGL 4NO3A 1U3ZA 3QDME 5E08L 5HDOA 4KDTC 4GS7C 3TT3H 1G0DA 2NQCA 2LE9A 4LCWA 1KJMB 1NGYA 5EDXA 3BP6B 4NHUB 5IQ7H 3VD9A 2DQFA 5CD3B 3K46A 4KJWC 2XG4A 4F2MA 3W9DA 1ORSB 4PP2B 4HLZG 3PP4H 2HRPL 3ZDXF 3MXVL 5IVZB 4XNXL 2F5BL 4F8TA 4TUJB 3HKFA 4XAWL 5GGVL 2HVJB 1VACB 4MJ6A 4U0RB 4OAWB 2ZKHH 2ZUWA 3ARRA 3T08A 2ZOLB 3PDDA 4KJYB 5IHUH 2D0FA 4F7TA 2HFFA 3LKSA 4LVNB 4Z7UA 4E41A 3P9LA 1X5LA 3T1FB 4Y5XB 5BS0E 2IH3A 4K94H 4GXUM 4GT7A 1PKOA 4OZFG 5I19H 4NNPH 3ARDC 4EOWL 5INCB 2APWA 2WZPD 2VZUA 3QEQB 1L6XA 1RPQA 1X6NA 3QNZB 1RHHB 1UKSA 2HKHL 2WWKT 4AEHH 4M5YH 1KFAL 3SDXE 3QR2A 1J18A 5ITBL 1OF2A 1T3FA 2P8PA 4HGKC 4JY6B 3IU4H 3ARDD 2G5BA 3G5XB 5DQ9A 3NCCB 5GXBB 4P2QD 2A6DA 5FA4A 2GSGB 3UTSD 5GS0C 1XGPA 3E3QE 3SDDC 3L5WB 1JWMB 3VD5A 3GJFH 1WQVT 3X13B 1BBJB 4ORZC 1PFCA 1BEYL 3QWRD 3WEXA 1RZJC 2BVOA 3DSNA 4FZEL 1OGTA 2X4PA 4IJ3C 1C7TA 4NKMB 3AS0A 3T0EB 1UA6L 3HRZA 5FV1L 2LAGB 2I26N 2B1HL 5KW9L 5BO1H 3CVHL 5EPMB 2AJXL 1JMZA 3T8XA 1II4E 1VGEL 5DLML 3U6RA 1QFUH 1FCCA 2UZXB 1HHKB 4UQ3A 4M1CC 5JQ6L 1YPZA 3DXAB 4WVRA 2N7AA 3T0EE 4Z7WB 1UA6H 4HIJB 1DQDL 3AC0A 2PW2B 3OF6A 5CIPH 3BXNB 2ZSVA 5B38G 3D3VB 3MRRB 3BN9D 1YEEL 3GMPA 4HCRL 1SJHB 4UIKL 3IJHB 2Q76B 2IANA 1JPGB 5HHQA 5FB8B 3PP4L 2EZ0C 4R97C 1KEMH 5E4EC 5I76A 1X7QB 3MFFB 4NRXB 3TN0B 3BFOA 2X9YA 4GBXC 4DKEL 1IE5A 5E1HB 3HMWL 2YBRA 4S1SH 3RIFK 5C0JB 1N26A 1NBVL 1A5FH 1AGFB 1K3IA 1AC0A 4K55A 2LU4A 2EDRA 4PD4K 2RCSL 3PWPB 4HUKB 3GGWA 4B41A 3MGOA 3VFMA 2ZPKL 4QRQA 2KZ1B 5EBMA 4HUNB 3H9SD 3NN8B 1CGYA 1N7ML 2EE6A 4GKSA 4NO2B 4M93B 5IW6A 4E0RB 2V17L 1E4WL 4P5TD 4YDIL 1DFBL 4ZFZA 5D72H 1EJOH 15C8L 3RWCA 1IQDB 3O8XC 2XXCB 4LSUH 5JDSA 2DICA 4QEGA 2HTKC 4JHAL 3L5XH 4ODHH 1MVUB 5DURB 3OJDB 4NN6C 4KKLD 1MHPL 3EO1B 3EBAA 4XPGL 5C0AA 4X7CC 1AR2A 4L5FL 3KDMA 4QRPA 4CJ0A 2GW5A 2E8YA 2CKBL 3QAZC 4HJJH 4JN1L 1TPXC 2C4XA 4NM8H 4ZSOB 3HI5H 5EIQA 2O5YH 2F53B 1RZFH 1WLHA 3GM0A 1K5NB 4Y16D 2DM7A 1QLEH 4G8EB 4PV8A 3DURB 5JHLL 5E03A 2FIRT 4J3TA 1Q94B 2P8LA 2VC2H 2I9LB 3CZFA 5K9OA 3KXFD 2ENYA 3BO8A 1R5VB 1FL3A 1MJ8H 3CVIL 4QHKJ 1HHKA 4RAUA 1JFQL 5IHBA 4LGRB 5DEGA 3HUJF 1YEFL 5EPMA 1FH5L 2C1OB 2HYMA 3NIFE 5CJOL 3ZYIA 4C56B 2JCCE 4GRLA 5E4IA 4NQDE 1U8PB 3WDHA 1PD6A 5MERB 3X11A 4M1GH 4TUOA 3WMSA 3KLAB 1JNNL 3OR6B 2AJSH 5E2TH 4EI5B 1JV5A 3WKNA 4HUWA 5CBAB 1FIEA 1F4XL 3K4ZA 3DXAE 3BP4A 4KC3B 5D5MB 3RDTC 3I75A 3UPRB 1BJ8A 1SVZA 4OM0H 1D9KB 1TCRB 4JRWA 5IB3A 2HLFC 1BHGA 5KG9B 4ZNCD 5HYSA 4KY1H 1CG9A 4PRIB 3ULVD 3FO9A 1MRFH 3EOYG 3P77A 5H94A 1EO5A 1ZT1B 3U2SB 5J6GA 3IETB 5F71A 4IIQC 3O4LE 4BFIA 4QXUL 1YN6B 4NN5B 3S6CA 4L9LB 4CL7A 4GBXB 4DUWA 3K0WA 3FQRA 3P9LB 5E2UL 1LO5A 1MPAL 2P45B 3I02A 2CRIA 2I60H 1NCDL 2A83B 4PRIE 3C8HA 3T4YA 4M7JH 4EIZC 1FYTD 4GW5A 3HZVA 3BRGC 3D48R 3IDYC 4NPYA 3M17B 3RVVD 2NNAA 3KAAA 5CZVL 3JWDH 4NQSB 3JTSA 2DLTA 3QCVH 3C8KA 4EQ2A 3RPIB 2J8UF 3SN6N 2ARWA 4YXLH 1RUAL 4E5XB 1BQHG 3BYTA 2NXYC 1Z9SA 2D7TH 5IFJA 1HHIA 2J1KA 5DZNA 5HHQB 4WUKL 2D0GA 3K8KA 3TP4A 3BZFB 5L0QB 1CF8L 5AEAA 5JXEC 4NQUA 2ZCHL 2BY0A 2AK4D 4HKBA 4KKBD 2OR7A 1OP5K 3BZDA 3V0AC 1V7NL 4JPIB 5I73B 1J88A 1K8DA 3C5SB 4D8PB 2GK2A 5ISZD 3DVGB 5EBGA 5JZ7C 1M7DA 4ZMAT 3NMEA 2XV6B 1IC4H 1OAYH 1INQB 2DB8A 2KZWA 1NCUA 4MDJB 3K4AA 4RDQG 3EJYC 3U1SL 1FVEA 1T1ZA 4Y2DD 4G7YH 2XPGA 5KVMC 4L8CB 4K3JH 2D9CA 2RCSH 5D7SL 5DMJB 1NLDH 5GJTH 1Z6JT 1S7QA 3C87A 2XZCH 5F21B 5B8CC 1QHPA 5KZCB 2B5IC 1C7SA 4ZYKB 1HNFA 1U8HB 3IDMB 1FL6B 1IQDA 2P42B 2XWJA 1T5XB 1E4WH 1LEKA 2KQMA 1FG2A 4YHLH 1RZJH 2AV7A 4LCIH 3GJFK 4PJIF 1NSNH 3D5OF 1GPOH 3P0GB 2YD3A 4OLXH 1UWGL 3I50L 3BUTA 3TFKD 3MBXL 1CXFA 1T04B 1R3KA 1U95A 1YMHB 3PL6B 4RMWA 1S7TA 1I3RB 2Y6SC 2V7HB 4M43L 1R5WA 2YBRB 3HE6A 3LSOA 4CVXA 1TQBC 35C8L 3IU4L 1B2WH 3O6MH 1I8KA 2I60L 4OM1H 2P8MA 1EXUA 3MBXH 1V8HA 2Z8SA 2XNAB 2Q76A 3GSRA 5D7IE 1D6EA 2H26B 3T0WA 2IQAB 2ZSWA 3WJJA 1I7UA 5BVJA 1QLRB 5I74B 5CP3H 3O6ML 1CFTB 1MUJB 2HN7A 3GKWH 3HNSH 3CK0L 2O5ZL 2IPUG 2JF1A 4UQ3B 1T5WB 3V6ZB 1NDMA 4L4TD 3CC5B 1IBGL 3DURA 5LKNA 3B4NA 3O3DA 2GI7A 2WP3T 1BZ7A 1DBMH 4QOKA 3KPRA 5JHDD 2VXTL 2VLKB 3DYOA 4I9WD 1VADA 3WHE0 3MXVH 4LPCA 5DD1H 3FT4B 2JIXD 1G9NC 4JO1H 2ZCKH 4KKAC 1BJ1H 3C5ZB 1E27A 1MOEA 4NSKA 4RRPA 4EI5D 3PUCA 1KIRA 3GMQA 2R29L 1EAJA 3C60B 1P4LA 4G3YH 1KXQE 3HMXA 3QUMH 1GHFH 1NDGB 3ORJA 3EOTH 3PE9A 3VGAB 4HXBL 4UT9L 2YD5A 3BHBB 1NMAH 1X5FA 4NZTL 3E0GA 3TJHD 1NC2B 3V52L 3BEWB 3P40A 1YN7A 4I3GA 1NFDB 4V2CB 1A6TA 3GI8H 5DTFB 2HH0H 5KJRH 1OAKL 4UILL 3V8OA 4KUZL 1MQ8A 2YEZB 4OCRL 3O4LD 4P59L 4GRMA 4PJ5E 2VZ3A 3HCVB 3CFCL 4JO3L 1MF2H 3MOAH 4YAQA 3BDXA 3PJSA 1HKFA 3O8XB 3ESUF 1GL4B 4YXLL 3F7RA 3MMEB 3Q6GL 3RGVD 4N5UA 1WFUA 5I6XC 5HGBB 4YDVA 3TO4B 2P5WA 4IMLA 5DURD 5GPRA 2BJMH 4CDHA 3CFBB 3KPNA 4L4VE 4F7MB 3SJVD 5TH2B 2R1WA 3QP3A 1T1YB 2NX5D 2MQCA 4GW1A 5DJXB 3N1QC 4UDTA 4X6CE 3VXQB 2OK0L 2ZSWB 4BQ8A 3AROA 4ONFH 3OZ9L 2YPKA 2NY5L 4NRZA 4HDIB 3FQUA 1MFAL 4PJ8A 1J7VR 5ESVA 1NEZB 1GGYA 1UT9A 3H9SB 5HYIA 1F58H 3WNMA 1OP5H 3RKPA 2E7MA 5HGDA 2LU7A 2HFTA 1FL5A 2YOCA 1U8QB 4JRXE 4Y4FA 3VXRA 3ZTJH 4NT6B 3PWJB 1E4KA 2P49B 5EBLA 2V7HA 2PR4H 1YY9C 1OAZH 1SY6L 5EO9B 3WFDL 3DUUB 5ESQA 3NIGF 3MZTA 1KB5H 5HD8D 1JI1A 4WUUB 1MIMH 3UTQB 2M8XA 3NBNA 1UM5H 2FX8H 3RWDA 1JNJA 4YQXL 3T04D 2F5BH 2CLVA 5DMGC 1XF5A 2YPLB 5EOTA 3EOTL 1IGCH 4M1DH 5CJBA 4I77L 2XWBB 4RWHA 2ARJB 3EUUA 2HFGL 1CFQB 2F58L 4S1RL 3TA3D 4I0KA 1R24B 5GSRA 1F3DJ 1HINH 3G9AB 4U6VH 5IHLB 1P5UA 3FO2B 4UOW1 5I8CA 1RZ8B 3O3UN 4X6BB 5BRZD 5DT1H 1OTSC 3QXWA 3F7VA 5IVXB 1AO7E 1T22A 1XCTA 2DIBA 1JMXA 4AMKH 4EOWH 1KBGH 2X4TB 1HOCA 5IV2B 4HULB 2IALA 4E41D 1I3UA 3LIZH 3NIFF 4P23D 4A6YH 2EC8A 4I4WB 3C5ZA 3QISA 4O5LH 3DMMA 1MNUH 3KYOB 1MEXH 3L7FB 1WC7B 1K8DB 3RUGB 3D0LA 2WM0A 4QOKB 4XPTH 5JIHA 3EOAB 4P3CL 4LPUA 1WFOA 1F6LL 4RGNB 3RAJH 1ZOXA 5I1IH 3IDXL 4ISVB 4P2RB 5DYOB 4X4XB 3JV6B 2ITCA 1DBJL 4CVWA 4GW1B 4O2EB 2BMKB 1JTOA 4YDLC 2BERA 2UWEA 3VFGL 2FWOA 2IQAA 3WO4B 3B5HA 5MI0B 1PSKH 1F5WA 1XGUA 4R7DA 4ZD3H 4BKLA 1K4DA 5C0CE 1J5OL 4PJEE 5E5UB 3GO1H 1QUNA 3QDMD 1DBJH 3FMGL 5H37H 1EXUB 3I2CH 3HI6H 5I6XB 5A16B 1UENA 3MV7A 1RI8A 1S5IL 4N1HB 4U3HA 3MRFA 3MNWB 1A47A 4JVWA 3QSKB 4K71B 5ISZB 2CK2A 1A7BA 2ZJSL 1T6VN 3P9WB 5L2KD 3UYOD 1GZQA 1T04A 1V7ML 4O58H 1BBDH 4XMPL 3RZWA 2AQ2A 3DV4A 3C6SB 3VWKB 5KSAA 1L7IL 4MS8D 5BMFL 3MLYH 3VXSE 5I0ZA 3OF6D 1TZIB 2WBJD 4NHCH 3Q0HA 1TQCB 2QQNH 5H8DA 5HYJA 1Z2KA 3EDJA 5DJ8B 1OAQH 1EEYA 3HAEA 3QPQC 3GBMH 1AGCA 2Z35B 3AS3A 4OZ4B 4QXUH 3RWFA 1XFPA 3MA9H 5F7WC 2FEDC 1T2QH 3LVEA 4F7CB 2QQLH 3RL2A 4PJFA 1KIRB 4WDIA 1FL5B 5A43C 5KAQF 4M48H 4E41B 4XP5H 5C0EB 2XA8H 1NCDH 4G8GE 2JJTC 1FPTL 1QFHA 5INDB 1YY8A 5F89B 3STLA 4XRCA 1OCWL 1P7KB 5E5MB 1A0QH 2FR4B 4R2GB 4JDZA 2ZG1A 4I3SH 3O2VL 4OM1L 1X3DA 1UFUA 5I17B 5GS3A 1T21B 2NY3D 4O4YH 4TNVF 4I9WE 3UJTL 1OLLA 2DQFB 5EU3B 5CD3A 3RVUC 3PQYB 5DK2B 4YDVB 2WUCH 3R4DA 4NM8L 1MJUL 3HI5L 4Q0XH 3DBXB 5IVOA 5D71H 1A14H 3RBGA 2VUYA 2VWEE 2BNQD 1D6EB 4G6AC 4DTGH 1IM3B 5ITFA 2W0FB 5EOQL 2XRAH 4QRPD 5GGSY 4LU5L 3VCLB 4NWUL 4IMKC 3O3AA 3D39B 2YUXA 4N68A 5DD0H 2HRLA 3PQYE 1R5WB 4ZXBC 3D85B 1FVDB 3ZKXC 4Z7VA 3QXAA 2VR4A 3MJ9L 4X6FB 5CJOH 4ZOCA 5FO8A 1YEKH 5BQ7A 3MACH 3HZYB 1T6WA 5DHXB 3B2UD 5FHAH 1M7IB 1EGJA 3B3IA 3TYFB 3K1DA 2VKXA 5D5ME 5MENA 1YEDB 5SV3A 1DUZA 1GPOL 1TFHA 4PJDB 1YJDC 2D9QB 4KKCC 1UM6H 5EOTB 3L1OL 5JW3L 1H3GA 1YEKL 2HVKA 4LSDA 3UJIL 3S7GA 3VXSB 1S3KL 3KG5A 3ZSSA 3QIUD 4X9GA 2EDWA 3SE8H 3FN9A 4W4NA 1ZGLB 2HLFD 1HIML 3B9VA 3B9DA 5CUSL 1WWCA 1AQDA 3ZE2E 2EYRA 4YDKL 5BRZE 3UTPD 4QF1B 5FM4A 4J1UB 3UTTA 1EHNA 3SE3A 3TO2A 5DXWA 3V9FA 4WFED 1S9WA 4G5ZL 4UT6H 2IC2A 4LRIA 1TCMA 1RK1A 4FQQB 1EBAA 1IAIH 3QG7L 1T20B 1OCWH 5DD5L 1JF1A 1L4IA 2PETA 2A9MH 4OFYA 2AJXH 3U36B 1OW0A 1LMKA 4MA7L 4QNPE 2DL2A 3VRIB 3WCYA 3GKWL 3HNSL 4G80B 4Y4HB 5DJXA 3QH3B 1TJIH 1NGXA 3WDJA 1A1NB 3W9EB 2A77H 4LSSL 2VLRD 5GGUA 5HI5C 5K9OB 2EXWD 2FX7H 1O0VA 4BFEA 5HVHB 1JWSB 4PV8B 4X80H 2VQTA 4OFVA 4XWOD 2BVOB 1DVFC 3U0PB 2NXZD 5F97E 2Y07H 1IGFL 1DN0A 4OCXH 1YNLL 4MJIB 1WZ1L 3KPLB 4DKDC 3B8YA 3TN0D 5T3ZD 1JYNA 3V0WH 4OZ4A 2WUBH 3WIFA 4ZAKB 1IQWH 1Q0XL 1U9KA 3I6KB 4M7LL 1IEHA 1FVCA 3RTQD 4EDXB 3FRPA 2EDHA 1KB5B 1KULA 4WU5B 5DHVA 2AEQH 4S10A 5GGTH 5LQBL 1I3GL 1BGXH 3P0YH 2NY3B 4M3JA 4OZHE 5D1QB 5BS0D 4PG9A 3OKKA 3P30L 4PB9L 5EU6B 2VDMH 2JE8A 2AK4A 3DVFA 5INCA 3QWOA 1JHTB 2D7NA 3MLSH 4OCWL 5CZXD 5DFVC 2BNUA 1CCZA 1H3TA 3GSUB 3WS6A 3BPOB 4FFVC 5SV4A 3N9GL 4L9LC 2Q87A 2C7UA 4NO5A 3MV7B 4OCNC 4HJGA 3ULVL 3FB8A 3QEHB 3VXUE 1T1WA 4Y2DA 1JGEA 3WUZA 3MRNB 1OARL 3SCMD 2W0FA 4P59H 4POZC 2ICWJ 1RZJL 2VNCA 5C09E 3V4PL 1DBKL 3V79C 4CVUA 1CBVL 2W91A 4NKOA 4AEIH 2UZYB 5EOCJ 3QUMA 3MGAA 1QFWM 2Z4QA 5BRZB 2IBZX 5E7FA 5DQDL 2FECL 4M7JL 3FFDA 1E6JL 2WP3O 5TQ0H 2J8HA 4K8RH 3QG7H 2FYYA 1NGZB 5DJYB 4AG4L 1U91B 3MJ8A 2Y1VA 2EIZB 4J3SA 1JIBA 4Z7WA 3MPCA 1SEBB 2HWZL 1GAFL 4HWEL 3LPGA 5KVFL 2DTSA 3BH9B 4IDJL 4YNYA 3X3FH 3WNPA 1TXKA 4QLRA 3B9EA 4I5BB 4DTGL 4K7FB 1N5YL 4XVSH 4JFFE 1NFIA 3OAZK 1EGJL 4H8WC 1MRDH 2VDRL 2X4TA 3T4YB 4UAOB 2BK8A 5HJ3B 4KK8D 3KLHC 1G9NH 3H9ZA 1KJVB 5J0BA 1RURH 1ZA3A 1JWMA 3ARWA 4C55A 1KLUB 1F8TH 1ED3A 3KJ6H 4OIIL 1YEEH 5FHAL 4ELMB 3RVWD 5D2NE 2FJHB 3FB5A 1HQ4A 4KFZC 1J05B 1TVBA 5EWIL 4ACPA 1CLYL 4PG9B 4D9RD 3WJLC 3MV9E 4Y89A 3ZTNL 3LAFA 2EEAA 3CSBA 1C5CL 2XFXA 3QIWD 4U2YA 3INUH 4BQ9A 3MLSL 2ORBH 5JLZB 1M71B 3OL2A 4FFWC 5JHDA 1I9EA 1MAJA 5M94B 3BGFC 3B9KA 1QBLH 2JIXA 1HXMA 3HE7A 4P3DA 3IKKA 3S35H 3U0PA 3UC0H 4LOUC 1T7VA 5FOJA 1CD9B 5CGYD 5ANMB 4Z9KB 1EA9C 1CE6A 1Y18A 3EFDL 1P7QA 2YPLE 3E8UL 1IC7L 2JKXA 3S8WA 2VLKA 4MXWL 3AB0B 1XEDA 4NOFA 3AY4A 5GRWA 3IDUA 4RAUB 4U6YA 3UC0L 5JPMA 3G6AB 4HZLB 2CKNA 5FGBA 1VEMA 3M8OL 2HKFH 3L3GA 1UXWA 2CXGA 2DMKA 4HKBB 3N85H 1OSPH 2Y36H 4JG0H 2X10A 1FNFA 1BECA 4NM4L 3LQAL 1KJ2B 1UZ6F 4Y4FC 1VGKB 3SQOH 4HT1H 2G2RA 2A1WL 4FQXB 1VKXA 5BOZG 3MV9B 5T1LB 5CP7B 1U3YA 1I8LA 3VFGH 4UDUA 1AQKL 1P7KA 3PWVA 3I85A 2VISB 4I18B 2X4QB 4O4YL 1DL7L 4RAVB 5D9SA 2Y4SA 3RX5A 4ONHA 4D9QE 1FAIL 3WUWA 1A6UH 2NNAB 2QHRH 2VLRE 1LE5B 4C54A 1QVOA 3C5ZC 1W72L 2D0HA 2R1XB 3JWOL 5E08H 1UJ3B 5IOPA 4MJID 4PJGA 1JFQH 1OP9A 4S1DD 2VLME 4KQ3L 1DUZB 4QGYA 2GYSA 2ED7A 2P7TA 4AENA 1S7TB 3NA4A 1JHTA 5DD3H 4RMVA 2DQTH 4S1SL 4M00A 5KSUA 4DGYL 3SJVA 1NMCC 1PX4A 3EJZD 4O58L 3ILPA 5D96B 5ALBL 1T89C 5BV7C 4KQ3H 1NUFA 2AV7B 1IKFH 2DYPD 5F1SA 4ODVL 2QSCH 2XICA 4LSPL 4HXBH 2GFBB 5F96L 2FL5A 3KYNA 1FYHB 3AVEA 2OM5A 3UTPE 1XGTB 5I66A 1LEIB 2OI9C 5D2LF 2IAMB 5DJ2B 4OTXH 4Y4KA 1RUPL 4P2YA 3SCMB 4WFEE 2BNRB 4JB9H 2IH1A 2EDEA 5D7LA 2FEEL 1QHOA 4M43H 1ZT7A 5TQ2H 3GI8L 2VDNL 1N8ZB 1KT2B 5HHNA 1UVQA 5AG9A 5ESVB 4GAFB 5IW3A 2EXYC 5DI8A 5TF0A 4I0PB 2EH8L 1A7OH 4M6NL 3ELAT 3MCKB 4K9EL 3S98A 5DEFA 1DDHB 5E5RB 4PREB 5HHVL 5CAYB 1KELL 5DFTA 5GISH 2HN7B 1YUHA 5C0NC 4U6YB 1OAXL 2EXYD 5BJTB 2IMMA 2N56A 3TA3A 4PG2A 5HGAA 3BPCA 1GOGA 1QLEL 4HZAA 4GQPH 3IFPB 4P2OA 3T4AA 1MCSA 5I1JH 4DFHA 5T1DH 4Z7WF 3QIBA 4O5LL 3TO2B 4HWBL 4AQOA 3NFPB 2NZIA 5IK3A 3DMMC 2A0LC 2OMBA 3MR9B 5DR5H 1OT2A 3RIAF 4YHOH 1Q9WA 5KZCD 3WFHA 1AP2B 4FMFA 5ISZE 4LLQB 2NY5H 3MRKB 3TF7C 3PNWA 3ULUL 1ZGLA 4LLVA 2DQDL 3OR7A 4K3DH 1FAIH 4P23A 3HFMH 3BD3A 1G9MC 3SDDB 4AZ8A 4Y5VA 3SDXF 5FYKE 3LEXA 3FRUA 5FGCB 2H32A 1MRCL 4WO4A 3FN0L 1NFDA 4PRBA 2UY6A 3MRIA 1GGIL 2I07B 5M95B 2A6KA 4ZFOA 3HZYA 3PWUB 3BEWA 3GBLA 3Q3GA 3O2DH 1UM5L 3GSNA 3EGSB 4MAYA 5KS9E 4LLMA 5KVEH 3BIKA 1S78D 3VGGA 4BZ1H 3S96A 5TE4H 5DWUL 2VR9A 4MXQD 2NTSP 2JCCB 1FVCB 4UILH 3MRHB 5IR1A 3ZKMC 2ZUVA 4HAFA 1EPFA 1VPOL 3O81A 4KPHL 4UQ2A 5CP7A 3QULB 2P4AB 3H6JA 4LSQH 2HKHH 3AREC 2CIKA 4PFEA 1RUML 3BUYB 1U3HC 3NTCL 4LCCA 4ESKA 1UH3A 1UB6B 4FXGB 3FQXB 3PG2A 1FSKC 1C5DA 5DEZA 2VDQL 5L2KA 3DRTB 2F74B 1RMFL 1FDLH 2X70B 3MA7A 5DJYA 1A7NL 2H2PD 5K9KA 3HAEG 3IDIB 1J0YA 3VXQA 5BVJB 2X5PA 1CBVH 3SQOL 4NQXA 1J11A 1PX3A 3U36A 4FZ8H 3RUGA 5E8PA 4YDLB 1Y18B 2VDQH 4HK0B 2H8PB 2KL6A 1E4XL 3WSQL 4D0CA 1QR1A 4M6ML 1CF8H 3RWGB 1BLNB 1QD0A 3CFJA 4MJ4A 3LD8B 3LRGA 1W72H 4NCC2 4NDMB 3ARBD 1T83A 1X9QA 3O41A 3O9WB 3VXMD 4MNGE 4HJGB 1Z5LB 4LBEA 3KPMA 4JFYB 5DVMA 4JM2C 4P4KA 3MFGB 2H32H 2IPKB 2X4RA 2IH1B 3H3BC 2R2EB 3H42H 3PL6A 1WTGT 2VDKH 1FCGA 4MVBC 5GQBA 3BESR 4N0UE 3MRQB 3MLTB 4PJGF 1ZLSL 2X41A 3ECBB 4GG8A 1SJEB 4IOFD 1YA5A 5CLTA 1OT1A 5JDSB 2AABL 1TVBB 1BP3B 2CLVB 2P1YA 4KHTL 2WW8A 1OLZA 5CINL 4PRHE 3HG1E 1L7TL 4V1DA 5CIPA 4I8DA 2A73A 4IOFC 2EICA 5IFAH 3C08H 3UTOA 1UC6A 3T0ED 5EO1B 3BWAB 3OWEA 4P99A 2BNQA 2XKNA 4U31A 3EHBC 4Y19E 3SE3C 4CN4A 2R56H 1T1XB 4UV4L 4F15C 5AUMA 3RVVC 3IXTB 4NRYA 1BVLA 5F9JA 5GRVK 2HFFB 3LKSB 1RJLA 4MCZA 1VEOA 4X6DE 3FOLA 3WL9B 2DDQH 3JXAA 2DQJL 3KNBA 1CU4L 1A4KB 3QUYA 4M03A 4MJ6B 5F7NC 4RFOL 4HKXB 4TRPL 4TQEH 1Q9OA 3DV6B 2Z8WC 3LRSA 3PV7A 1BQUA 5DSCB 5FEBA 1FNGB 3QNXA 5CSZA 3U0TA 3F7YA 4XB8A 1U8JB 1G9EA 4KJPC 3PV6B 3MA7B 1RMFH 5HBBA 3GJFB 1AGBA 1J8KA 3DX8A 3D25A 1S7UB 4LL9A 1OTTC 1R3IH 4PY7A 4UNTA 4MQTB 5F6IB 3UROR 5IEHB 2EKSA 4I4WA 5ICYB 1U41A 3VGBA 5HYEA 3MCG1 1A3QA 2FX9H 4H25B 2DS4A 3BE1L 5E6IC 5ESAA 1MRDL 3DVNA 3EO1A 2XQBH 3MLWL 3HE6C 4X6BA 3QO0A 4POZD 3GZKA 1HKLH 3PWLB 1JYVA 2Z92B 1YEFH 1CR9H 5C07A 5L88L 5IB1A 2VDLH 1ZT4B 5E8OB 3GSNB 1XGPB 2AJVL 1AXTH 2WK2A 5FA4B 3WXVL 3NCEB 4WHYH 5DQ9B 4DGIH 2EE3A 4OFYD 3VFUB 3QJFA 4UTBH 2FZ3A 4JRYE 3MREA 4MCYA 4CAGA 3WUWG 2W9EL 3RWDB 2NY1D 3TIDA 4XAKE 4PLNC 1T7YA 2H6PB 2RFXA 1P5VA 2GSIA 1BJMA 2C4FU 4OF6A 4L29A 1BQSA 5CLWA 3EO0B 4G9FA 1OTUC 4DKAA 1BIIA 4RBPH 5GHWH 5GGTL 4Y1AE 4I48A 5CEXA 5F9OL 4YK4C 4EN3D 2I25N 2YK1H 1DEDA 1S7VA 4TUOB 1RULH 5F6HJ 3QDJD 5DFVD 4MXVF 4GUPB 2IAMC 4M6OL 4PGBB 4NWTH 1X5IA 2GEEA 5HI4D 3UO1L 3LKQB 3GMNB 3DPBA 1FL3B 4NKQB 1MCPH 1DQTA 3JTTA 2BMKA 4PREA 2H2SD 3MBEC 4ISVA 4P2RA 5DYOA 1EDQA 2CMRL 1N0XL 1L6ZA 1ZVSB 1WITA 4M6MH 5E9DE 1KNOA 4KRPB 2V9TA 4JAMA 4Q7DA 2X70A 4ELMF 4P0DA 4X9HA 4DVRL 5CZVH 5L2KB 1QSFD 4EIGB 4IJ3B 5AWNL 4DGVL 1OHQA 1ULVA 1ONQB 5F3BB 3HE7C 5FYKD 3WEXB 3C8KB 4JCMA 1WUNT 4X4MA 3MGTA 2W07A 2CMRH 4IRSA 4UQ2B 3SCMA 3PIQA 1W0VB 5DJAA 3VFVA 4X7SH 5TE7L 5I1IL 1G1CA 1OPGL 1LK3L 3TNMB 3IDXH 1YEHH 4CN6A 4MJ5A 2ZG2A 2VZVA 5T33L 4BA8A 4CN1A 3X3GH 5J3HD 3GSOB 1S7SB 3GSWA 2A73B 3C6SA 2V7NA 2NPLX 3IETA 4U6HB 4GG6F 5FUCC 1I85C 2EYTA 3CDFA 2OMNA 3VFMB 4YDJA 2KQNA 4LLDB 4JANA 5IW6B 1JK8B 5I71B 5C92A 2BFVH 2B4CC 2UZIH 3IDGB 4DOHB 4PB9H 2IPTL 5IF0A 2Q8BL 4PRAA 3LPFA 2OR9L 2HJLA 1T2XA 4NNPL 2PN5A 5FO9A 1MFEH 4KVCL 1ZLUH 5FXCH 4G8FA 3TBVA 2ZG3A 1DANT 3OBAA 4U33A 4NO0A 4LLQA 4I2XB 4XH2B 4PJXB 4GSDH 5CSGA 4NYLA 4TRPH 1NC4D 4AIZA 4HS6A 4YGVA 4F37K 3DTXB 4PY7B 2XZQH 1EHLL 1F4XH 4L8BA 3ZTJG 5IVXE 3QRFM 2HFEB 4G5ZH 3EDKA 2VSDA 3FCTB 2AAVA 1T21A 5DDHA 1A7OL 4M6NH 4YE4L 3MRRA 2FBJL 4P46B 5I30H 2DL9A 2VQUA 5C3TA 3DGCR 4F57L 5DZOA 4BSVA 2X42A 3O3EA 3VRIA 1QPPA 4JDZB 1MEXL 1VCAA 4W4OC 2HH0L 2V5RA 2O5XH 2DI9A 2WLYA 3DIFA 3EW3B 1D5MB 3QIWA 5GGVY 4R3SB 4OV5A 3TT1L 3F5WA 5DJZB 2VL4A 1JBJA 1QBML 4PRDA 3GK8H 4HKJB 1JE6A 1MCCA 3FQTB 2CKBH 2F53A 2EH7L 2YRPA 4JKPL 3O6KL 3PDOB 5F7EL 1HH6B 3RI5K 1ZMYA 1QA9B 1WWWX 3PGDB 2OP4L 3WO3B 1D5XB 5EULV 1YMHA 5IHZA 5FGBC 3GEWB 1U6AL 3HB3D 4XHQA 3NABL 3OGCB 1URLA 4NM4H 3I6LD 4ONOA 1JJUA 5I1EL 3MBEB 3QQ9C 1A6TB 5DTFA 3SO3C 2X1XR 1AD9A 2OX5A 4L8DB 5CEZH 3TA3C 3DX6A 2WSKA 3D2UB 4GLRH 1LP9B 2CPCA 4K3HA 3JUZA 4ZUUB 3TVMA 1ED3B 3QQ9D 1ZA3B 3E2HB 3OPZL 5EUKA 2BOCA 4G9DA 5GGSA 1EFXB 2YD8A 1JV5B 1VENA 3T3PE 3M1BA 1FE8L 3HG1D 3TH4T 4WFFD 1YYLL 3CDCA 4JY5H 2CLRB 4D2NA 1FVEB 1T1ZB 7FABL 2BOBB 2R9HD 1CE1H 3QJHB 3TCLA 5I2IA 4NQEB 3VWJA 4YNYB 3OG6B 4RFEB 4D8PA 4LSQL 4XPFL 1DSFH 5IMLA 5T1LA 4JFXB 1PEZA 3L5XL 3AB0C 4HS3B 3L6FA 5JXAH 4PV9B 4F33A 5IGXL 3MTRA 3EDEA 3QIBC 1RZ7H 4U4BA 3PV6A 4JB9L 4JG1L 5LGJB 1NCNA 3VWJC 1CGSL 4PJ5D 2BVQB 2IGFL 1KFAH 3LS5L 4HAGA 3JTSB 1Z9MA 1UWGH 3I50H 4QHNB 1K85A 4UT6L 1AH1A 1O5DT 1IL1A 1IC5H 2HKFL 5HI3D 5DRXB 4LPYA 4OKVB 3GK8L 1FIGH 4R96A 1NGWB 3JWDL 3MLRH 3ZZ1A 1MWAH 3RKDD 3VRJA 4L4VD 2XKNB 3T65B 4JR9H 4J8RB 4JANB 1XGTA 2FO1A 3BAEH 4KAQL 5LCVH 1MQKH 3OHXA 3EOBB 3NPZB 3P11H 3QZWG 4AY0A 3O6LL 4C83B 2XOTA 1MHCB 4R4BA 4K7PY 4L8SC 3QHTC 1A7RH 3LOWA 3AGVA 5FF6B 1BPVA 5CJXA 4P2OD 1AD0B 4GG6A 3QPQD 2WUBL 2EYSB 3CLFH 2V9QA 2CJUL 3SE9L 1XIWB 1FL6A 3O8XD 4XNUH 4MJIE 1G6RH 3QFJE 3P4NB 4HUUA 5EBLB 1C16B 4QXGH 4K3JL 3GHBH 1VFOA 1ADQL 3DVNB 4U1JB 3L95B 3TZVB 1P6AB 1JTPA 2EDFA 3QUXC 4YUEL 4MZ2A 1AR1C 2GY7B 1A5FL 5KTEH 4PJCF 2E7BA 1G6RL 4KTDL 1KNOB 3LB6D 1HIMH 3P4OB 1KGCE 2A74B 2W38A 4LQ1A 5GGQH 3GMMB 5GZOC 1KJ2A 2GTZB 4Y16C 5BW7C 1X5ZA 3NZHL 3CIQA 1RIHL 1AR1D 2Y7QB 4ZO6A 5IWLC 3ARFB 5A3ID 4GRWE 1CD1B 4XP1L 2OXHA 5L6YH 1WEJH 4LCWE 1N4XH 5JW4Q 2NY5C 3CPLA 3GBNL 5FHBL 4PYGA 4N5EC 5HHMD 2EECA 2Z4QB 2XI9A 4NBYB 4ZDHB 2P8MB 1RIHH 3OKEB 3RZCC 35C8H 5I1AA 4PR5B 4Z76B 4F9PC 3DMMB 4NYLB 3BZEB 2NXYD 4H88H 2WIMA 3NGBC 1E6JH 3H9HB 3L9RB 3EFFA 2HG5A 2W60A 3U7WL 2B20A 3ZYJA 4Y5YB 5CCKL 1KACB 2V2TB 2CLRA 5E56A 4HJJL 2RGSA 1XR8A 4Z0XA 3A6OA 1WT5A 4XVUD 2BSRA 4XGZB 2MPAL 1UCTA 1OGAA 4YIQA 1E4XH 43C9B 4WHTA 5D1ZA 2BCKA 1TLKA 4KRNA 1DQDH 5CCKH 4XNQB 1S7SA 3GSWB 1T0PB 1UM4H 4GKSB 4PJ9C 1Z3GL 3CH1A 2AJUL 2NX5B 5E1AA 1NLDL 4MNHB 1JUFA 1XGRB 4G7VH 4MVBD 4ODWB 3U0WL 2ZCKL 4JM2A 4P4KC 3EYFA 4OZHB 4FQJL 5FM5M 3KYMA 3EO9H 4NJ9L 3OKMB 4F58L 1U8MA 5ACZB 4RNRA 4F7TB 3F12A 2Y5EA 4Z5RA 3K2UH 1J10A 3PWPE 3ARBA 4NC2B 3WKMH 5EN2A 4UNUA 3VXMA 5LGHL 5HI5D 3OR7B 3U82B 1KTDB 5E6ID 4NFBA 4P4KD 1L7IH 5JA9A 2AQ3A 2DQHH 1T0MA 3JSSA 4Y8DC 2JK5B 2PXYA 1RZIA 4PJBA 5KN5B 1DQJB 4HFUH 2ZSVB 2ICEB 5HYFA 5DJCB 3CC5A 4F2MB 1HZHL 4MLIA 3QHFH 5MHSE 3K4DA 2VL5B 4HZLA 1UZ8A 3N1GC 5D93C 2GTZA 5FKAB 2YPLD 5C09B 1UWXH 3W0WD 1ORQA 2OBGA 4JFXA 1K8IB 1H0DA 1MFNA 1XIWC 4MJ2A 5E2WH 5I19L 4QHKI 1CE6B 4Y19B 3CFDB 2K9UA 2O61A 3DARA 1UXSA 3IFLL 5DO2D 1FPTH 3T0EA 2GJZB 3BWUC 5EO0A 1CL7I 2C1PB 1OGTB 2X4PB 4PJFB 5CHNB 3TN0C 5K59E 2YWYA 4PRPB 4U1LB 3UZEA 4PGCB 1E6OL 5J13C 1JTTA 4IDJH 1NMCB 4AMKL 1AFVH 1OB1B 1XIWA 4Y2DC 1M71A 4C59B 4D9LL 2KDGA 1XCQB 3PHQA 1QBMH 4MA8H 2MKLC 3TBTB 5E70A 2RQ8A 3QUYD 3PP3H 2JLLA 1F4HA 3L3HA 2UWEF 3ZYOA 3KPSD 2LABA 1MVUA 2AKRA 4IDLA 1HEZB 2ED8A 4KXZI 4RCAA 5E95B 1TENA 5A2LH 5GS1A 2OJEB 2VZTA 3HRPA 2V7NB 2BHUA 4GXUN 4LSVH 3UX9B 5FV2A 4KDVA 4ZTOL 1GIGH 1D5XA 4JLRB 4MXVE 5CMAB 4KZEL 2MCG1 1CYGA 2OS7A 1ZAGA 4U6TA 4PP1C 4ZUVB 5CEZL 2DLHA 3HZKB 3GRWA 1AY1H 4OSUL 3CAFA 1JPSL 1P53A 9CGTA 1JGLH 4LVHB 1XGUB 4IBLT 3ULUD 1HQRA 1FFNA 2NY1C 4ORGA 3MR9A 5GJTL 4QRPE 4D3CL 5E8DL 4YHZH 3VXSD 2AK1H 3X14A 5DMKA 2GJ6B 5EU6E 2HT4D 2F5AH 1HNGA 3IS0X 3NPSB 2AJZA 1A1NA 1I9IH 4XP1H 1I3VA 4Z0BH 1S7XA 3HI1B 1QSEA 3L6FB 4OCRH 3SGJC 1JZ6A 1K4CB 5FM8A 4X4YB 1IC7H 3WJJC 5CBEA 4O2CB 2P5ED 2YK1L 2O5XL 2Z0BA 4WI6A 3U83A 1YMMB 4KXZH 3TCLB 4YJZL 4JQVA 4JFFB 3C2SA 1JHLL 1HHHB 3L3DA 2GAZB 8FABA 1NCAH 3IFNH 3RWEB 4BK4A 4FQLH 1T1XA 3MRJA 3QDMB 1KUMA 4B50A 4U1HB 2F54E 4OKDA 1U8MB 2JCCA 5FECA 3C6LC 1RUAH 3FL7A 4JFZH 3FB7A 3QDJA 5TFSL 4WTWA 3U4BH 1BD2E 3CU7A 4JZOB 2BHZA 1B6DA 3NVQA 2LTQC 4ZFZB 1CZ8H 4N90E 4WI2A 4LNRA 4RIRB 4JFDD 1KJ2L 5MI0C 2VZ1A 4PJXF 4GG8B 2MFNA 1MHCA 2DKMA 1G6RA 1HYSD 5B3JE 4XWGH 4HUMB 5T3ZE 5F1KC 5CBAA 1IM9B 3V6OA 1RD6A 4Y5YA 3IDMA 4YC2B 3T09A 4HK3J 2X4UA 3H9HA 4HKZA 3NIGE 1TJGH 5SWZE 3U7AA 4KDTA 3DO7B 2R2EA 3X3GL 4IRSD 3DHMA 1U8IA 1SYVB 2ILLA 4R7NA 4NRXA 4ZXBB 1DN2A 1MJJA 3RUGF 3VCLA 2NY7L 4R96B 4UBDD 4Z95H 2VDML 3SBWA 3KJ6L 3JVGA 5CZKA 4NQEE 3ALXA 1H0DB 25C8L 1G7MB 1H3XA 1ZVHA 3DROA 2EKSB 1ORQB 2WINA 3L3KB 3DGGB 3MLYL 3V5HB 3IDIA 3BH9A 2UVEA 3C5SA 1R5VA 5JDJA 4QXTB 3IDJA 1FNSL 2AEIT 4XP6L 3KR3H 1NL0L 3GJFA 2F74A 4AIOA 4ZPTB 3HI1A 2ICEA 1FAKT 4YDIH 4KTDH 4I13B 3HC3H 3P0VH 2DQCL 1GZPA 1EMTL 4CNIA 3IXAA 1M05A 3FFCA 4B7LA 3SDDD 1UB6A 1FRGL 2R0WL 1BZQK 3W0WE 5IM7B 4LKXA 5I1KL 1QO3B 2XZQL 1EHLH 3SGKA 1YY8B 1I75A 4QRPB 2XTLA 4QRRE 2EEDA 2F15A 1U92A 3P4NA 4HUUB 4MNQE 4NPYB 2HTLC 4U6XA 4LEOB 4YX2L 3RGHA 3ZT5A 1AGDB 1U93A 2J88L 1OD7A 4NO0D 2Y06H 5ICZA 5HHOE 3ESVF 1MI5B 4PJAE 1JK8A 1UKTA 1A22B 3VI4E 4G6FB 2DWEB 5KVGH 4WCYH 2FD6L 4NBXB 3UDWC 2XZAL 4KGJA 5T5FH 4XNQA 5EU4B 2NY6C 3BAEL 2X4SA 4KAQH 3LKRB 4MD5A 4JFHE