1F5RA

Rat trypsinogen mutant complexed with bovine pancreatic trypsin inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
216
Chain Sequence
b'DKGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNEPDLLKCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN II, ANIONIC
publication title The energetic cost of induced fit catalysis: Crystal structures of trypsinogen mutants with enhanced activity and inhibitor affinity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 216
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5rA02
1FXYA 3LGWA 4YZUA 2BYAX 2NU3E 1B5GH 5K0HA 1FY4A 1GBJA 3BTEE 2P94A 5HGGA 1ARBA 1JRTA 4ZAEA 4DIIH 1HFDA 1O0DH 1HBTH 4X6PA 5E8EH 5C67A 1ABIH 1XUFA 3A7ZA 4K3JA 4TWYA 2PSXA 1EB2A 2ZEBA 1GJ8B 1C4U2 4OS1A 1S81A 1O3IA 1TGNA 1SI5H 1TAWA 1BQYA 4KTUA 4LZ4B 4H4FA 3BTHE 2WUBA 1MAYA 1E34B 5EODA 1AWFH 1MTSA 1YPEH 4OS7A 4YTAA 2BY6X 4AN7A 1DXPA 3R3GB 3KHVA 1SLUB 4UE7H 1P2IA 2J9NA 4I33A 1NFUA 1UCYK 2Y7ZA 2QAAA 5ESTE 1QB6A 2ALVA 3TIUA 1J14A 1T31A 3A84A 5DP6A 2K1QA 1MMJN 1NFYA 3GDUA 4MDSA 1FAXA 1O31A 3LU9B 3RXDA 2PKAB 2QYIA 2XNIA 1WCZA 4BANB 1BBRK 2NU0E 2P3FH 4O97A 2P93A 2WUCA 2FTLE 4FUIA 1AVGH 1HJ9A 2VH0A 4JK6A 3I78A 1HJAC 2YNAA 3QUMP 1O3PB 2H1UA 2VVUA 5PTPA 1EAWA 2EI7A 1A3BH 1YPJH 4I8LA 1MQ6A 2ZA5A 1SGCA 1WTGH 2BOHB 1JWTA 1O32A 1H9LB 1Q31A 3HKIB 2AERH 3Q3YA 1AE8H 1YF4A 2A45B 1F7ZA 3O8RA 3Q77A 2ZFRH 1B0EA 2ZDLA 1KXCA 5L6NH 1Y5AT 1BRAA 4UFGH 4X1NU 3P8FA 4CRAA 2R0LA 3BV9B 3TH2H 3I29A 2GKVE 3L33A 2CV3A 1JIRA 1WTHD 4TWWA 5C1XA 2HNTC 1LKBA 2BY5X 3DHKH 3TPIZ 1LHGH 1MCTA 1UCYE 1BJUA 1CA0B 1ZRKA 2ZPRA 3SU0A 1BTPA 2UWPA 2D8WA 4OGYA 2Y6TA 2AH4X 3P70B 2ANYA 4NWKA 8LPRA 4GUXA 5EW2H 3FAOA 1YBWA 5E2PA 1GMHG 5DJ7A 4H42U 5HYOA 1HV7A 1V2LT 4O3TA 1BBRE 3K9XB 4X8UH 1QBOA 2GCHG 2ZI2H 2ODPA 1O2LA 4IC6A 3ZZ6A 1SGFG 2QXJA 4IN2A 1J9CH 2ZO3H 2ANWA 3TVJB 1SFQB 1SQOA 2G5NA 2I6SA 2ZFSA 4OS6A 1TQ0B 3BEIB 1KTSB 4X8VH 1PPEE 1AD8H 3EE0B 1BTUA 1Y5BT 1ZTLA 1V6DA 1K22H 1XKAC 5FX5A 3MU0A 1TGBA 1BITA 4IGDA 7ESTE 3TGIE 1QRXA 4I8GA 3RXCA 2FOHA 1DITH 1OKXA 2XCNA 4MPUA 3BIUH 2GT7A 1P3EA 4M7GA 3TITA 3A8BA 3QK1A 1FMGA 3EA8A 1O3LA 2CJIA 2BVXH 1IQIA 2Z9JA 5C5NA 1GHXH 4I32A 1NY22 2VIDA 3PM3A 2G81E 2XBXA 1C2HA 1EKBB 3FANA 1OWDA 1OYQA 3D49H 1JBUH 3PWCA 3GY3A 1Y3VA 3A7YA 4FUFA 4FU7A 2B9LA 1GJDB 1SSXA 1TBQH 3K2UA 1A5GH 2P95A 1QNJA 1MTNB 2R3YA 1SB1H 1GI3A 1HXFH 2WPJS 1KTTB 2EC9H 3SHAH 4NIYA 1XVMA 2Z7FE 3L6PA 2ZTXA 1DS2E 5SGAE 1HUTH 5F6MA 2BQWB 2GD4B 3EA7A 4RN6A 2ZU3A 1EASA 3E1XB 3LGTA 4ABGA 2ZFTA 3RXMA 1BUIA 2ASUB 3UR9A 1CBWB 1G3EA 2GMTB 2HPPH 3CS0A 4KGAA 1GJCB 4RKJB 2ZHFH 2VJ1A 1O3KA 3R0FA 4B71A 2IJOB 1D6WA 5FPSA 5C3NA 3BTKE 3T2NA 5AFZH 1P3CA 3ZZAA 4BAQB 3VXFH 1GCTB 2FLRH 4X8TH 2W26A 1YPMH 3HGPA 1FV9A 4AFSA 3MU5A 1VCQA 1GJ4H 1E36B 1UTOA 4Y0ZE 3PLPA 1XXDA 2A7JA 1Z8GA 1VGCC 1GMHF 2BQ6B 1QB1A 3MOCA 1C2GA 1IHSH 4Y11E 3BN9A 4FU9A 4LZ1H 1W14U 2BDCA 2GCHF 8GCHG 1GDNA 2ZGJA 4X0WU 5FX6A 4Y8YA 4ZHLU 1PJPA 4BAKB 5I46H 1QTFA 2ZGHA 1GHVH 1TOCB 1IQEA 1C1QA 3ZZ7A 3CENA 1C1WH 2D1JA 1RTLA 1VZQH 3E0PB 4Y0YE 1EJAA 1A5IA 1W7XH 1RS0A 3A89A 1UJ1A 4K60A 2GGVB 1O2JA 1C2JA 1UVSH 1C2MA 4FVDA 3K6ZA 1SGDE 4INLA 1ZOMA 3RXSA 3B8JA 4FUHA 3S69A 2Y7XA 5JDUB 2SGPE 1FPHH 4ABBA 2AEIH 1W8BH 2ANKH 2FIRH 3SI4H 2LPRA 1XMNB 1TNHA 2Z3CA 3JZ1B 5C20A 1DICA 1SGTA 2FYRA 3PMBB 1PPGE 1QB9A 3RMMH 1SHHB 1XVOA 2C3SA 3BG4C 1PQAA 1TYNA 3A80A 4WVPE 4XOJA 5A0BA 1CE5A 1AU8A 1ESTA 1C5UA 2BX3A 1AGJA 3SO3A 4JMYA 3ZZDA 2EEKA 1MH0A 1MTWA 1O2XA 3KCGH 3QZRA 1BDAA 3FP8E 2JKHA 2C8WB 1L4DA 1TX6A 2W5EA 4WH6A 2H2ZA 3KEEA 1MKWH 5F03A 3HATH 2BDYA 2Z3DA 3C27B 3MTYA 1ARCA 4AOQA 2A4GA 2GZ8A 4MNYA 1TGCA 3RXJA 5C2ZA 3N7OA 1ETTH 3A82A 1C9PA 2SGFE 1SMFE 1AVXA 4PROA 1QL7A 4AB8A 3UTUH 3LKWA 1XUKA 4X6OA 1GVKB 1SLXB 4INKA 4GHTA 1A46H 3PMHB 4DY7B 1DOJA 2FI3E 1XUIA 1HNEE 2XC0A 4Z6AH 2F9UA 1HB0B 1WQVH 1UTJA 3V13A 1GHBF 1Y3XA 1YCPH 3D23A 3GOVB 3RDZA 3TK5A 1GG6B 3M5MA 1O3MA 3LIWA 2R0KA 1ID5H 2F91A 5B6OA 2XBVA 2F9VA 2BOKA 2Y82A 1V2MT 1MZDA 1FY3A 1ELTA 4BAHB 2PTCE 3OY6U 1VJ9U 1CHGA 4TPIZ 2CF9H 2FOGA 1AUJA 4NSYA 8GCHF 3SQEE 3UIRA 4DT7B 1HIAB 1HGTH 1EX3A 3BTWE 2BDIA 5FPYA 3LC3A 1FNIA 1DWCH 3E3TA 2BLOA 2AMDA 2GCTC 1W10U 4Y7BA 4IS5A 1HYLA 1TGSZ 1WQSA 2GDDA 1GJBB 2FM2A 1YP9A 1IQGA 1NROH 3HPTB 1O2UA 2UWOA 3HGNA 1P0SH 2OP9A 1ZSKA 1C1RA 3P8OA 1C5RA 1O36A 3F9EA 5LGOA 2A7CA 3BTGE 4FUEA 5CE1A 2QIQA 3QZQA 4JYVH 1T7CA 4IC5A 1SQTA 1NC6A 3PO1B 1MCVA 1W12U 2A2QH 4K8YA 5GXPA 2CHAB 1A1RA 1H8IH 1JMOH 2A7HA 1ESBA 4BAMB 3V7TA 1N6XA 1V2NT 1WYKA 1O3DA 4NA8A 1QCPA 3VGCC 3RXEA 2VIVA 3VB5A 3S0NA 3PLKA 1GVZA 4VGCB 3DFJA 2FX4A 2SFAA 1C1SA 3FZDA 3UPEA 3ZVFA 1N8OB 2XRCA 1C2EA 2WYGA 1FN8A 1NZQH 1QJ6B 2YOLA 5FBEA 3UQOA 1GL0E 1AVWA 1UK2A 2O8LA 2Y5HA 5JB9S 3TJVA 1UK4A 2LNCA 4B75A 3LGYA 1NU9A 5CMXH 2W3KA 1SVPA 4WXIA 1EAUA 5A09A 4INHA 2G55A 1O2YA 1KXBA 3SUEA 1C2LA 1YPLH 4D9RA 1BTYA 2P8OC 3SBKA 1TA6A 4BAOB 4BNRA 4JZFH 3GCNA 1J8AA 4XSKU 3A7VA 2F9NA 3PWBA 1IOEA 3H5CB 1BTHH 3UUZA 1O5AB 4CR9A 1FONA 1ELFA 4AG1A 1SFIA 3MI4A 1O2OA 2BVRH 1FAKH 3TK6A 1KLIH 1TQ7B 1WSSH 1XX9A 5FAHA 4ABAA 1DLEA 1BJVA 4JYUH 3MU4A 4YM9A 2ZDAH 4I7YH 5EGMA 1ETRH 3RXKA 4HTCH 5G4BA 6CHAB 4E7RG 4TY7A 4D9QA 3PMAB 4CREA 5A0AE 1AN1E 3A7XA 3T28A 1DUAA 1A4WH 3GCHC 2BDAA 1RRKA 4I8KA 3M35A 1GJ5H 1TABE 4MLFB 3AVZA 3T25A 4Q7ZA 2P59A 1C1OA 1G36A 4HI3A 4YOJA 3GCOA 4CRGA 1VITG 4UD9H 5A2MH 1O2VA 3LOXA 1LPGB 2DUCA 1EJNA 2WINI 4GVUA 1KDQA 5JPMH 3PB1E 4HZHA 4BTIB 5GDSH 1CT0E 4J2YB 3PMJA 1Q3XA 5J4QA 1Y8TA 2A1DB 2ZHQH 1L1GA 4ABFA 4FUBA 5IDKA 1V2QT 4WWYA 1G37A 3P6ZB 4XBBA 1C2KA 2SGQE 2OQUA 1QRZA 1ELAA 1TPOA 1L2EA 2G51A 5CHAC 3GCTG 1LHEH 1TIOA 1OWKA 1P2NA 1NFXA 2H5DA 1SLWB 1NS3A 3U1JB 2V3OH 1TGTA 2TGAA 2AGEX 5HM9A 3M3VA 3FP7E 1O38A 3C1KA 1TPPA 2VVCA 4OS2A 1O2RA 1LHCH 2PUQH 2AMPA 3NPSA 3FP6E 2J38A 2FYQA 1WBGB 3ZZ4A 1G9IE 3SI3H 3A86A 1O3EA 3IG6B 2VIOA 3KQDA 2B5TB 3GY2A 1X7AC 1D3TB 1TB6H 1AZ8A 1BTWA 1JOUB 4NSVA 1UTMA 2FP7B 1GBHA 1FY5A 3UFAA 1P9SA 4ABDA 3MU8A 3SV2H 3F9GA 1GDQA 1MZAA 3D65E 1O5DH 2FI5E 1HXEH 1G3BA 2FTMA 4KTCA 1ZMLA 4H6SB 5JBTA 3BG8A 1GHZA 1QBNA 2O8WA 1HAYB 1ANDA 1V2TT 2QXIA 3A8CA 3BF6H 3URCA 2G4TA 2KAIB 4LK4A 2C90B 3TJNA 2VVVA 4JCNA 2HLCA 1YLCA 1C5PA 4CRBA 3M5NA 1GBFA 5EG4A 3MMGA 3KIDU 4X2WA 4F4OC 3TGKE 2PUXB 2ZTYA 3KL6A 4X2VA 1O2QA 4ZKOU 3MU1A 4O9VA 1NRRH 4TYDA 2SGDE 3LH3A 2ZECA 3UY9A 2HVXA 3T29A 2GDEH 4A92A 4XBDA 5L2YH 1TRMA 1DLKB 1Y59T 4FVBA 4ABHA 1ZSLA 1ABJH 1KYNA 1ZHRA 4D76A 4FUGA 2VINA 3SQHE 1ANCA 3LGVA 1J17T 3ODDA 2Z6BD 2FS9A 3A8AA 4E7NA 4DW2U 4UFDH 1GI4A 4X2YA 1K1OA 1VITF 3FVFB 1GI0A 2TGDA 5EQSA 3SGBE 3SU5A 4B76A 1SHYA 1F5LA 3SV9A 2XTTB 1FI8A 1QL8A 1Z7KA 1ZRBA 1KY9A 3VB6A 1HAOH 1E37B 4X6NA 1G3DA 1OOKB 1B7XB 3RXQA 3NZIA 2FOCA 4K8BA 1ELBA 1C4V2 2RCEA 1O3JA 1Y5UT 1OP0A 3E8LA 1KDQB 3MH6A 3SUFA 1MKWK 2A5KA 2AGIX 3ZZ8A 2GV6A 4CRDA 4I8JA 1CA0C 3RMNH 2OLGA 4NIXA 2UUYA 1V2PT 4NA9H 1CSOE 2AYWA 4WF8A 1LDTT 4D7GA 2EA3A 1L1JA 5JYIA 2GZ7A 2C8YB 4IMQA 1G32B 1BZXE 2FDAA 1RTKA 3K6YA 1CT4E 3SW2B 1TMTH 3LC5A 3U69H 2FS8A 2G00A 1YCPK 5E2OA 2ULLA 1JIMA 1XM1A 4ASHA 3B9FH 3TH4H 1S82A 5T6GA 3SJIA 4X1PU 1A5HA 2ZP0H 2VH6A 2FZZA 1TWXB 2I6QA 2GVFA 3L3TA 2PFEA 5AHGH 4D8NA 2OC7A 4A6LA 3VEQB 2ZG0H 3V3MA 2F9OA 1O35A 3TK9A 1Z8JB 1EP5A 3KQCA 2BD7A 3M36A 3PYHA 5EQQA 1DSTA 3RC4A 2CGAA 4UONA 1T8OA 1ZHMA 2Z9IA 3KGPA 2Z94A 3SORA 3U1IB 3SN8A 1OPHB 3SJOA 1N1LA 4DJZB 2WV5A 1IQFA 3M5OA 2OC8A 4NA7A 5GWZA 1P8VC 1AHTH 1D3QB 3EQ0H 2QC2A 1YGCH 1ZMJA 3M7QA 4R0IA 2BY7X 1P04A 1TPSA 1WOFA 2BHGA 3M3SA 3S9CA 1K1NA 2ZGBH 2VGCC 1J15A 1NESE 4ABJA 4DGJA 4FUDA 4AZ2B 2Q6DA 1K1LA 4OS4A 3SU6A 3MHWU 1V2JT 2B8OH 1O37A 1QR3E 1F92A 2ZZUH 2P3TB 3AAVA 1W11U 5H4IB 1ZSJA 3ATKA 2C4FH 2OINA 3ZVBA 1K1JA 3GY5A 1CGIE 3SGQE 4X8SH 1IQLA 3B23B 4YO9A 4MPVA 3SNBA 1UHBA 2BLQA 3UR6A 4ISNA 4CBNA 3S9BA 1V2RT 1UMAH 4A1VA 4WMFA 5DKMA 3I77A 5EPNA 2IPHA 1T4VH 3SV8A 5DK1A 4JYTA 3LGIA 1T4UH 5L2ZH 1Y3WA 2A0QB 2GMTC 5LPEA 1BA8B 1TNIA 1XUGA 1P2KA 2QCYA 2RG3A 1ZPZA 1S6FA 4Y10E 1C2IA 4GHQA 2F9BH 1QY6A 4CRFA 1E38B 5T6DA 1HRTH 2VWMA 1GCTC 5E0HA 1GGDB 2G4UA 1LHFH 1O3HA 1VGCB 5AFYH 1C1PA 4NWLA 1TPAE 1S84A 3QWCH 1P02A 3VB4A 1C5ZB 1W0ZU 1V2ST 2ZHWH 1PPHE 2NU2E 3BTFE 5GPIB 1S0RA 1WU1A 3T62A 1AB9C 3SU3A 1C9TA 1EZXC 1BMAA 4NGAH 3SZNA 3RXHA 1C5WB 3S7KB 3M7TA 2Q6FA 1V2KT 1PPBH 4MPWA 4ZMAH 1QJ7B 1PPCE 1FIWA 4AFQA 1K2I1 1ZTJA 3AW1A 5JB8S 1DX5M 1Z8RA 4WJG2 4IW4E 2R9PA 1INCA 1GL1A 2ODYB 1GMCG 2JH0D 1AI8H 2BD5A 1OP2A 1G30B 2Z9KA 1HAZB 1DANH 1EATA 4HGCA 4TPYA 1HLTH 3FFGA 2ALPA 4ZH8A 1IQHA 3BSQA 2XC5A 1QQ4A 3KNXA 2RA0A 1O2HA 1BB0B 1TNGA 4IMZA 4NG9H 1VCPA 5EOKA 3SNAA 5DGJA 4DG4A 1WUNH 2BMGB 3QDZB 2GTBA 3UNQA 1O5GH 5C1UA 3RC6A 1FQ3A 1TBZH 1EPTA 3T5FH 4E06H 5HXFA 3ZYEA 1EZSC 2Y5GA 2UWLA 5F8ZA 2XWAA 4AORA 1FDPA 2GT8A 4THNH 1C5TA 2QY0B 1SL3A 2FXRA 3SUGA 1MTUA 4YLQH 1FZZA 1TX7A 4XDEA 1TNLA 1SGRE 1EAXA 4K69A 3PTBA 1XXFA 1RIWB 4X1SU 1H4WA 1AFQB 4CHAC 3ESTA 1ANEA 3HK3B 3A8DA 3ITIA 1P57B 3VPKA 1SOTA 4MNVA 1O2PA 1UHBB 2HPQH 5FBIA 5DPAA 1FPCH 1QHRB 5GIBA 1RXPA 2VWOA 2BM2A 4B1TA 8KME2 1E0FD 2AIQA 5HM2A 1P01A 3A87A 1OWJA 5K7RA 4LOYH 1IQMA 1LTOA 2XW9A 4MG3A 2BZAA 1XKBC 2BD4A 1LVYA 5JBBS 4ISOA 2HOBA 3QN7A 4CRCA 1F0TA 1GG6C 3KQBA 1SGEE 3QGNB 2A4QA 4XFQA 4YOGA 3PTNA 3QX5H 1SC8U 1CQQA 2AMQA 3Q3KA 1LQEA 1RTFB 2WV4A 3RC5A 3LH1A 5FCKA 4WXVA 5F8XA 1ANBA 4MTBA 1AZZA 1BMMH 4GCHG 3A85A 3ZZCA 1DWBH 3SU1A 2AGGX 1W3CA 1O3GA 1C1NA 1ZGIA 3M37A 3EAJA 4YT7H 1SLVB 1ZZZA 3F6UH 3SU4A 1GVLA 3IITA 1DPOA 1TE0A 3RXFA 2F83A 4IBLH 4XE4A 1GJ7B 3RXLA 3SJKA 1K1PA 3GISB 5EXNA 2PWXA 3HK6B 3S7HB 3SV6A 1FY8E 1O30A 4KELA 1GMCF 1ELCA 1MBMA 3BTTE 1KLJH 1LVBA 2R3UA 1TX8A 1LCYA 2ZGXH 4Y8ZA 4QT8C 1IAUA 1S83A 4X2XA 1UO6A 2ZU2A 1THSH 1QA7A 2TIOA 3PO1C 1CO7E 2WPLS 3RU4E 2FEQH 2XWBI 4Y76A 2AIPA 2CHAC 4I8HA 3ZV9A 3RLWH 9LPRA 4KTSA 3U8RH 3SJ9A 4B74A 1YPHC 3AW0A 1MAXA 5EW1H 1QL9A 2QXGA 3KQEA 1C1VH 2VIQA 4ESTE 4FU8A 3AAUA 3TNTA 3BTME 2PHBA 4ABIA 1AE5A 1ESAA 5DP3A 3UWJH 4A1XA 1D9IA 3GICB 1NO9H 2G8TA 1G2MA 1NRNH 4AG2A 1N8OC 1O33A 1EPTB 1GHAG 3UNRA 1CHOG 1H9HE 1RJXB 2UUKB 3NXPA 1DFPA 1C2DA 3VB3A 3GYMA 4Y71A 1GBMA 1O2KA 1PQ5A 3ELAH 2Y80A 4I31A 2BXUH 3O8DA 4KP0A 1D6RA 2J2UA 4OS5A 4RSPA 2NU4E 2A31A 1CT2E 5FPTA 4ZKSU 1P03A 4DOQA 2OUAA 3QGJA 1BRBE 2GX4A 1DY9A 2QGRA 5JBCS 2TGTA 1DY8A 1AIXH 1GBTA 3E6PH 3V0XA 2ZF0H 4NCYA 1F0UA 3W95A 2ZCLP 5GJ4B 4AGKA 6ESTA 2HGTH 1LO6A 3H7TA 3CP7A 1F0SA 1ZPCA 2DE9A 3BTQE 2PKSB 2HNTE 1LPZB 4WMEA 4OGXA 3UWIA 3NKKA 2H6MA 5A8YA 3F9FA 2ZHDA 5BPEA 5DO4H 3DUXH 3RMLH 1GBDA 2B7DH 3OTJE 1SGQE 2ZDKA 3U8OH 3ODFA 3RUOA 1TMBH 1C1TA 1PQ7A 1O5EH 2BQ7B 4AGJA 1TALA 3M7UA 2HWLB 2FO9A 2PGQB 5A8ZA 1QQUA 3RXTA 3DA9B 3VB7A 1KXAA 1YC0A 3NCLA 1WAYB 4AYVB 2BDBA 2JETC 1ZTKA 4X6MA 3ZVAA 4FUCA 2P3UB 1GJ6A 1GBCA 4AFZA 1C5XB 4Y79A 1C5OH 2Y5FA 2V0BA 1MBQA 1OSSA 3RXBA 1ELGA 1AQ7A 1MUEB 3LGUA 3ZZBA 1FY1A 7GCHG 4SGBE 1C1UH 1T8MA 1O3CA 2CN0H 2IN2A 3G01A 5LPRA 4UFFH 3GY7A 3SV7A 1GI1A 1DXWA 1P09A 2XYAA 2ZFPH 1AO5A 2ZQ1A 3U98H 1HAXB 2ZKSA 2JH5D 3F9HA 1C5LH 1FUJA 1XUJA 3RLYH 1AKSA 3Q3XA 4UEHH 2OC0A 2H5CA 1K1MA 4ISIH 3CS7A 3TH3H 1SGPE 1SGNE 1Z6EA 1C5SA 1F5KU 1PYTD 1O5BB 3TLOA 1ACBE 2UUJB 2BDGA 1UVPA 4NZQA 3RXAA 2XXLA 1V2WT 1GHAF 1CHOF 4WMDA 1UTNA 3JZ2B 5TCCA 2VU8E 2ZCHP 1QIXB 1Y3YA 5FCRA 2A32A 1O2IA 4U2WA 2SGEE 2GV7A 1BT7A 3DD2H 1A3EH 1MTVA 2BXTH 1TONA 3QTOH 2V35A 4ZKNU 1BTXA 1G2LA 1YM0A 4X1RU 1LHDH 3FZZA 1F5RA 1UTLM 1EP6A 4U30A 4JK5A 1HPGA 5E0GA 2ESTE 2QXHA 1LPKB 2ZHEH 1B0FA 3U8TH 1K28D 1EAIA 1QA0A 1ZYOA 1HJAB 1OYTH 2R2WU 2A4RA 1GHWH 3DFLA 1HJ8A 4IN1A 1NRSH 7LPRA 1Y3UA 2YNBA 1TNJA 5EU8A 1SBWA 2WPKS 1C1MA 2O8UA 1P12E 3ZVGA 2ZPSA 4WY3A 3MH4A 4X1QU 2OD3B 4AFUA 1P2QA 2OQ5A 2RDLA 1NFWA 2D26C 1IQNA 2CF8H 3EDXB 2CXVA 2DE8A 3MYWA 1AUTC 1L0ZA 2BY9X 5F8TA 2C93B 2ZCKP 2ZU4A 3HKJB 3ENSB 2HRVA 5EXMA 1MD8A 1GBEA 1FN6A 1SG8B 1EQ9A 3MNBA 4UFEH 2SNWA 1UTQA 1BMNH 3UOPA 2A4OA 1ZGVA 5L30H 1GI9B 2ANMH 1K1IA 3GCTF 4CH2B 3UQVA 1GDUA 2OBQA 7GCHF 1O2WA 1TFXA 2D2DA 3AASA 3ZVCA 1P06A 8ESTE 3SOSA 2XCFA 3RXUA 5BRRE 1K21H 1P05A 1V2VT 2FI4E 2PLXA 3BIVH 4CR5A 3Q76A 1GBIA 2ZIQH 5IYTA 1CA8B 1NT1A 1UK3A 1ZMNA 1BHXB 3SJ8A 4GSOA 3PROA 1THPB 4JZEH 2FLBH 4JZIA 3TGJE 1FJSA 3RXIA 2GZ9A 2BD8A 4BXWA 2PV9B 2WPMS 1AKSB 2VB0A 1CVWH 3OX7U 5DP8A 1OXGA 1TLDA 1MQ5A 1S6HA 4Z0KA 4MPXA 3ZVEA 1NRPH 1O2SA 1ELVA 2R2MB 1S5SA 2Q1JA 2NWNA 2PTNA 1ZLRA 4U01A 3O8BA 4YT6H 1O2GH 1Z8IB 3OSYA 2ZNKH 1ETSH 2V3HH 1ZJDA 1GPZA 1DUEA 2WYJA 1KXDA 3ATMA 1QGFA 2H9HA 3LONA 3URDA 4BXSA 7KMEH 1O2MA 1Z71A 1PPZA 2BX4A 2O8MA 2ZDVH 2ZGCA 2B0FA 2A5AA 1UVOA 1F2SE 2W7SA 1H1BA 4K2YA 5TCAA 1MU6B 1V3XA 3TU7H 3MO9A 1HAVA 1GI8B 3E0NB 1HAHH 4SGAE 2OXSA 3NK8A 2VGCB 1MKXH 2STAE 2QV1A 1L4ZA 1OS8A 1GBKA 1YPGH 1W7GH 2FMJA 5ABWA 1VR1H 2WPHS 1MTNC 1L1NA 1O5FH 2EI8A 1G3CA 2FOEA 2BZ6H 2TGPZ 4FUJA 1QBVH 2OTVA 1ZR0A 3MH7A 1MD7A 1CU1A 2F9PA 3M5LA 2BLWA 3LT3A 5A0CA 3O8CA 2TBSA 2XC4A 1SR5C 1JRSA 1Z1JA 3A81A 1O5CB 2VIPA 1C5YB 4ZXXH 1CBWC 2QF3A 1EOLA 2ODQA 1DE7H 3UNSA 4B73A 2ZQ2A 3ZZ3A 4Y7AA 1A2CH 1NM6A 1Z1IA 1A0HB 1KXFA 2TRMA 4FXGH 5JBAS 5FHTA 2ZWLH 4GLYA 5DP4A 3SNEA 3GYLB 1D3DB 1JXPA 2H9TH 2W3IA 2ZFFH 4KKDA 1P10A 2TPIZ 1D4PB 1PQ8A 4DCDA 1GMDG 1T8LA 1O39A 1DWEH 2G5VA 3BEUA 4GPGA 4JZDH 3RU4D 1TRYA 1O3NA 1GHBG 1YYY1 1KIGH 1VITH 3RXPA 4A7IB 2A5IA 1ORFA 3LDXH 2J4IA 1J16A 3SUDA 3ZYDA 4D7FA 2GP9B 1GGDC 1TNKA 1HIAA 1SPJA 1GBLA 5FXLA 1RGQA 1TOMH 4Q7XA 1AB9B 6GCHG 1NRQH 3P17H 3STJA 2Z9LA 4WH8A 3MNXA 3MNSA 3MO6A 2OBOA 4NFEA 1GHYH 1UCYH 1HCGA 3M3TA 5EXLA 1SGFA 1GI2A 4AX9H 6LPRA 1ELEE 2PGBB 1DSUA 1P11E 1YPHE 3RXOA 3A7WA 1O34A 3F1SB 5E0JA 2FPZA 1GI7B 2SGAA 2J94A 1TMUH 1BBRH 4JZ1A 2RA3A 5T6FA 2XBYA 1ZJKA 4ZHMU 5C5OA 1LVOA 1A7SA 2STBE 3KF2A 4K1TA 1CGJE 2QN5T 4ISHH 5LH8A 4CBOA 2A2XH 5AVDA 4CH8B 1LMWB 4ZROA 1AWHB 2J95A 3ATLA 2EI6A 3BG4B 4NZLA 5I25A 3ZZ9A 1E35B 1ZHPA 4NIVA 1O3OA 1V2OT 3LPRA 3A7TA 3V12A 1V2UT 3E16B 5GCHG 2O8TA 1VJAU 2J34A 2Y81A 1BRCE 2G52A 3UREA 4J1YA 3RXGA 1HAVB 2WPIS 1C2FA 1BCUH 4ZUHA 2FESH 1HAPH 1IHTH 2QF0A 1D3PB 1GI6A 2OCVB 3STIA 1BOQA 4U32A 5EPYA 2ZTZA 3U9AH 1A0LA 1C5NH 3GY8A 4ABEA 2FX6A 1W2KH 2M5TA 3PV4A 3GY4A 1S0QA 5DP9A 5T3HA 1NPMA 5ESBA 3SGAE 2HALA 1O3FA 1OWEA 4ISLA 5HMAA 4A1TA 1RFNA 4CHAB 5DG6A 9ESTA 3KN2A 1DVAH 3RMOH 3SU2A 2XBWA 1O3BA 1RIWC 1GJAB 1N6YA 1EJMA 1T8NA 3ZZ5A 1EZUC 4RKOB 1AFQC 3BTDE 2ZDNA 3F68H 3EGKH 1NN6A 1GMDF 3A88A 1HDTH 4Q80A 2AS9A 3OY5U 5EQRA 1PYTC 1F0RA 2FOAA 1UVTH 2ZPQA 4ZXYH 4YLUA 3UOUA 1GJ9B 1BRUP 2FODA 1UTKA 4GAWA 1QFKH 3ATIA 1M9UA 2O9QA 3P95A 4Q2KA 3E90B 1K9OE 5TJXA 2GCTB 1PPFE 1SOZA 2BLVA 3RP2A 5A8XA 3GDSA 6GCHF 2H9EH 1DWDH 1GI5A 2BY8X 1IQJA 1NU7B 1WV7H 1AMHA 1W0YH 2ZU1A 3Q00A 1YPKH 1NTPA 4HFPB 2Q6GA 1OX1A 3TJOA 4BTUB 2ILNA 2BDHA 1HAIH 3H7OA 2CMYA 3VXEH 1EUFA 3MO3A 1XUHA 2BD2A 1KSNA 2ZU5A 1C5MD 3VGCB 4K5ZA 4YOIA 1LQDB 1P2OA 2VWNA 3SNDA 2SNVA 1QRWA 3SNCA 3D62A 1EZQA 3ZVDA 2UUFB 1KLTA 4Y8XA 1C5VA 1FIZA 3E91A 3ATWA 4NIWA 2Z9GA 4VGCC 5LPFA 4R8TB 1O2ZA 1EOJA 4B2BA 4AYYB 4O03A 3T27A 3VFEA 2C8ZB 4K1EA 5GCHF 2FOBA 1BMLA 1TRNA 3LJOA 1P2MA 1AFEH 3OYPA 2OC1A 3P8GA 5DP7A 1BTZA 4F49A 1DM4B 1THRH 1W13U 4Q7YA 4TY6A 3A83A 4ZHAA 1EXFA 3GY6A 1H9IE 1AY6H 1U6QA 3QO6A 4MNXA 3T26A 3TNSA 2VNTA 1Q2WA 3K65B 4DURA 5AF9H 2P8OB 2AFQB 3RXVA 1EPTC 3IWMA 4YESB 3M61U 1DDJA 4DIHH 3MFJA 2KAIA 1A0JA 3RU4T 2THFB 4LXBH 1RD3B 2BVSH 1QJ1B 4MQAA 1LVMA 2FWWA 1S85A 1KXEA 1OP8A 1GBAA 1CGHA 2PKAA 1O2TA 5C1YA 3EA9A 1TBRH 3QTVH 2F3CE 4MNWA 2PW8H 2BD9A 1P2JA 3S9AA 4BOHA 4O3UA 3DT0H 2BTCE 3NWUA 5ETXA 1C4Y2 3P8NA 3P92A 4B2CA 5J4SA 2ZFQH 1T32A 3PLBA 2BD3A 1EB1H 1IQKA 1GWAA 3MH5A 1O3AA 4DVAU 4Y6DA 1Z6JH 3GCHB 2VWLA 2HNTF 1YLDA 2W7UA 3BEFB 4NFFA 2QA9E 2PKSC 1OWHA 1SQAA 6CHAC 1FLEE 4K1SA 2P16A 4A5TS 4H6TA 2PSYA 3GDVA 2Z3EA 3RXRA 1DT2A 2V6NA 3LJJA 2IOTA 1GBBA 1YCPM 4GCHF 1H8DH 1YKTA 3RM0H 1ZPBA 2J92A 2FOFA 2C8XB 1OWIA 2BB4A 2JH6D 5DP5A 2ZDMA 4ZKRU 2ZC9H 1C5QA 1UVUH 2VIWA 3W94A 2JETB 1MKXK 1SGYE 1LKAA 3QLPH 1UTPA 3ZV8A 1ELDE 3OU0A 1QURH 2PR3A 1GCDA 4XBCA 1HAGE 5CHAB 3RM2H 1P9UA 4MVNA 3MWIU 1TA2A 3NUMA 1BHXF 2FOMB 1PFXC 4BTTB 1O2NA 3EYDA 1BIOA 4UDWH 4B2AA 3SHCH 3WY8A 1A61H 4AB9A 4E05H 1VCWA 2NU1E 1SGIB 1MU8B 3TJUA 3MNCA
chains in the Genus database with same CATH superfamily
1FXYA 3LGWA 4P00A 4YZUA 2BYAX 2NU3E 1B5GH 5K0HA 1FY4A 1GBJA 3BTEE 2P94A 5HGGA 1ARBA 1JRTA 4ZAEA 4DIIH 1HFDA 1O0DH 1HBTH 4X6PA 5E8EH 5C67A 1ABIH 1XUFA 3A7ZA 4K3JA 4TWYA 2PSXA 1EB2A 3OEHD 2ZEBA 1GJ8B 1C4U2 4OS1A 1S81A 2RFKC 1O3IA 1TGNA 1SI5H 1TAWA 1BQYA 5GNDA 4KTUA 4LZ4B 4H4FA 3BTHE 2WUBA 1MAYA 3KYGA 1E34B 5EODA 1AWFH 1MTSA 1YPEH 2V7QD 4OS7A 4YTAA 2BY6X 5EIYA 4AN7A 1COWD 1DXPA 3R3GB 3KHVA 1SLUB 4UE7H 1P2IA 1H8ED 2J9NA 4I33A 1NFUA 1UCYK 2Y7ZA 2QAAA 5ESTE 1QB6A 2ALVA 3TIUA 1J14A 1T31A 3A84A 5DP6A 2K1QA 1MMJN 1NFYA 3GDUA 4MDSA 1FAXA 1O31A 2M2AA 3LU9B 3RXDA 2PKAB 2QYIA 2XNIA 1WCZA 2GJGA 4BANB 1BBRK 2NU0E 2P3FH 2JJ1D 4O97A 2P93A 2WUCA 2FTLE 4FUIA 1AVGH 1HJ9A 2VH0A 4JK6A 3I78A 1HJAC 2YNAA 3QUMP 1O3PB 2H1UA 2VVUA 5PTPA 1YWUA 1EAWA 2EI7A 1A3BH 1YPJH 4I8LA 1MQ6A 2ZA5A 1SGCA 1WTGH 2BOHB 1JWTA 1O32A 1H9LB 1Q31A 3HKIB 2AERH 3Q3YA 1AE8H 1YF4A 2A45B 1F7ZA 3O8RA 3Q77A 2ZFRH 1B0EA 2ZDLA 1KXCA 5L6NH 1Y5AT 1BRAA 4UFGH 3U28C 4X1NU 1UW7A 3P8FA 4CRAA 1YY3A 2R0LA 3BV9B 3TH2H 3I29A 4B6FA 2GKVE 3L33A 2CV3A 1JIRA 1WTHD 4TWWA 5C1XA 2HNTC 1LKBA 2BY5X 3DHKH 3TPIZ 1LHGH 1MCTA 1UCYE 1BJUA 1CA0B 1ZRKA 2ZPRA 3SU0A 1BTPA 2UWPA 2D8WA 4OGYA 2Y6TA 2AH4X 3P70B 2ANYA 4NWKA 8LPRA 4GUXA 5EW2H 3FAOA 1YBWA 5E2PA 1GMHG 5DJ7A 4H42U 5HYOA 1HV7A 1V2LT 4O3TA 1BBRE 3K9XB 4X8UH 1QBOA 2GCHG 2ZI2H 2ODPA 1O2LA 4IC6A 3WW7A 3ZZ6A 1SGFG 2QXJA 4IN2A 1J9CH 2ZO3H 2ANWA 3TVJB 1SFQB 1SQOA 2G5NA 2I6SA 2ZFSA 4OS6A 1TQ0B 3BEIB 1KTSB 1E1QD 4X8VH 1PPEE 1AD8H 3EE0B 1BTUA 1Y5BT 1ZTLA 1V6DA 1K22H 1XKAC 5FX5A 2KZ4A 3FN8A 3MU0A 1TGBA 1BITA 4IGDA 7ESTE 3TGIE 1QRXA 4I8GA 3RXCA 2FOHA 1DITH 1OKXA 2XCNA 4MPUA 3BIUH 2GT7A 1P3EA 4M7GA 3TITA 3A8BA 3QK1A 1FMGA 3EA8A 1O3LA 2CJIA 2BVXH 1IQIA 2Z9JA 5C5NA 1GHXH 4I32A 1NY22 2VIDA 3PM3A 2G81E 2XBXA 1C2HA 1EKBB 3FANA 1OWDA 1OYQA 3D49H 1JBUH 3PWCA 4F55A 3GY3A 1Y3VA 3A7YA 4FUFA 4FU7A 2B9LA 1GJDB 1SSXA 1TBQH 3K2UA 1A5GH 3F2FA 2P95A 1QNJA 1MTNB 2R3YA 1SB1H 1GI3A 1HXFH 2WPJS 1KTTB 2EC9H 3SHAH 4NIYA 1XVMA 2Z7FE 3L6PA 2ZTXA 1DS2E 5SGAE 1HUTH 5F6MA 2BQWB 2GD4B 3EA7A 4RN6A 2ZU3A 1EASA 3E1XB 3LGTA 4ABGA 2ZFTA 2PP6A 3RXMA 1BUIA 2ASUB 3UR9A 1CBWB 1G3EA 2GMTB 2HPPH 3CS0A 4KGAA 1GJCB 4RKJB 2ZHFH 2VJ1A 1O3KA 3R0FA 4B71A 2IJOB 1D6WA 5FPSA 5C3NA 3BTKE 3T2NA 5AFZH 5EJLA 1P3CA 3ZZAA 4BAQB 3VXFH 1GCTB 2FLRH 4X8TH 2W26A 1YPMH 3HGPA 1FV9A 4AFSA 3MU5A 1VCQA 1GJ4H 1E36B 1UTOA 4Y0ZE 3PLPA 1XXDA 2A7JA 1Z8GA 4I86A 1VGCC 1GMHF 3AK5A 2BQ6B 1QB1A 3MOCA 1C2GA 1IHSH 4Y11E 3BN9A 4FU9A 5HIZA 4LZ1H 1W14U 2BDCA 2GCHF 8GCHG 1GDNA 2ZGJA 4X0WU 2QF5A 5FX6A 4Y8YA 4ZHLU 1PJPA 4BAKB 3F2GA 5I46H 1QTFA 2ZGHA 1GHVH 3FKSD 1TOCB 1IQEA 1C1QA 3ZZ7A 3CENA 1C1WH 2D1JA 1RTLA 1VZQH 3E0PB 4Y0YE 1EJAA 1A5IA 1NBMD 1W7XH 1RS0A 3A89A 1UJ1A 4K60A 2GGVB 1O2JA 1C2JA 1UVSH 1C2MA 4FVDA 3K6ZA 1SGDE 4INLA 1ZOMA 3RXSA 3B8JA 4FUHA 3S69A 2Y7XA 5JDUB 2SGPE 5HKKD 1FPHH 4ABBA 2AEIH 1W8BH 2ANKH 3PRBA 2FIRH 3SI4H 2LPRA 1XMNB 1TNHA 2Z3CA 3JZ1B 5C20A 1DICA 1SGTA 2FYRA 3PMBB 1PPGE 1QB9A 3RMMH 1SHHB 1XVOA 2C3SA 3SZEA 3BG4C 1PQAA 2JIZD 1TYNA 3A80A 4WVPE 4XOJA 5A0BA 1CE5A 1AU8A 1ESTA 1C5UA 2BX3A 1AGJA 3SO3A 4JMYA 3ZZDA 2EEKA 1MH0A 1MTWA 1O2XA 3KCGH 4FOUC 3QZRA 1BDAA 3FP8E 2JKHA 2C8WB 1L4DA 1TX6A 2W5EA 4WH6A 2H2ZA 3KEEA 1MKWH 5F03A 3HATH 2BDYA 2Z3DA 3C27B 3MTYA 1ARCA 4AOQA 2A4GA 2GZ8A 4MNYA 1TGCA 3RXJA 5C2ZA 2CK3D 3N7OA 1ETTH 3A82A 1C9PA 2SGFE 1SMFE 1AVXA 4PROA 1QL7A 4AB8A 3UTUH 3LKWA 1XUKA 4X6OA 1GVKB 1SLXB 4INKA 4GHTA 1A46H 3PMHB 4DY7B 1DOJA 2FI3E 1XUIA 1HNEE 2XC0A 4Z6AH 2F9UA 1HB0B 1WQVH 1UTJA 3V13A 1GHBF 1Y3XA 1YCPH 3D23A 3GOVB 3RDZA 3TK5A 1GG6B 2YMSB 3M5MA 1O3MA 3LIWA 2R0KA 1ID5H 2F91A 5B6OA 2XBVA 2F9VA 2BOKA 2Y82A 1V2MT 1MZDA 1FY3A 1ELTA 4BAHB 2PTCE 3OY6U 1VJ9U 1CHGA 4TPIZ 2CF9H 2FOGA 1AUJA 4NSYA 8GCHF 3SQEE 3UIRA 4DT7B 1HIAB 1HGTH 1EX3A 3BTWE 2BDIA 5FPYA 5C17A 3LC3A 5IK2D 1FNIA 1DWCH 3E3TA 2BLOA 2AMDA 2GCTC 1W10U 4Y7BA 4IS5A 1HYLA 1TGSZ 1WQSA 2GDDA 1SKYE 4RT0A 1GJBB 2FM2A 1YP9A 1IQGA 1NROH 3HPTB 1O2UA 2UWOA 3HGNA 1P0SH 2OP9A 1ZSKA 1C1RA 3WWBA 3P8OA 1C5RA 1O36A 3F9EA 3ZIAD 5LGOA 2A7CA 3BTGE 4FUEA 3FO8D 5CE1A 2QIQA 3QZQA 4JYVH 1T7CA 4IC5A 1SQTA 1NC6A 3PO1B 1MCVA 1W12U 2A2QH 4K8YA 5GXPA 3PV5A 2CHAB 1A1RA 1H8IH 1JMOH 2A7HA 1ESBA 4BAMB 3V7TA 1N6XA 2LELA 1V2NT 1WYKA 1O3DA 4NA8A 1QCPA 3VGCC 3RXEA 2VIVA 3VB5A 3S0NA 3PLKA 1GVZA 4VGCB 3DFJA 2FX4A 2SFAA 1C1SA 3FZDA 3UPEA 3ZVFA 1N8OB 2XRCA 1C2EA 2WYGA 1FN8A 1NZQH 1QJ6B 2YOLA 5FBEA 3UQOA 1GL0E 1AVWA 1UK2A 2O8LA 2Y5HA 5JB9S 3TJVA 1UK4A 2LNCA 4B75A 3LGYA 1NU9A 5CMXH 2W3KA 1SVPA 4WXIA 1EAUA 5A09A 4INHA 2G55A 1O2YA 1KXBA 3SUEA 1C2LA 1YPLH 5FL7D 4D9RA 2EQNA 1BTYA 2P8OC 3SBKA 1TA6A 4BAOB 4BNRA 4JZFH 3GCNA 1J8AA 4XSKU 3A7VA 2F9NA 3PWBA 1IOEA 3H5CB 1BTHH 3UUZA 1O5AB 4CR9A 2K8IA 1FONA 1ELFA 4AG1A 1SFIA 3MI4A 1O2OA 2BVRH 1FAKH 3TK6A 1KLIH 1TQ7B 1WSSH 1XX9A 5FAHA 4ABAA 1DLEA 1BJVA 4JYUH 3MU4A 4YM9A 2ZDAH 4I7YH 2J97A 5EGMA 1ETRH 3RXKA 4HTCH 5G4BA 6CHAB 4E7RG 2QF4A 4TY7A 4D9QA 3PMAB 4CREA 5A0AE 1AN1E 3A7XA 3T28A 1DUAA 1A4WH 3GCHC 2BDAA 1RRKA 4I8KA 3M35A 1GJ5H 1TABE 4MLFB 3AVZA 3T25A 4Q7ZA 2P59A 5T1VA 1C1OA 1G36A 4HI3A 4YOJA 3GCOA 4CRGA 1VKYA 1VITG 4UD9H 5A2MH 1O2VA 3LOXA 1LPGB 2DUCA 1EJNA 2WINI 4GVUA 1KDQA 2XNDD 5JPMH 3PB1E 4HZHA 4BTIB 5GDSH 1CT0E 4J2YB 2K0QA 3PMJA 1Q3XA 5J4QA 1Y8TA 2A1DB 2ZHQH 1L1GA 4ABFA 4FUBA 5IDKA 1V2QT 2JJ2D 4WWYA 1G37A 3P6ZB 4XBBA 1C2KA 2SGQE 2OQUA 1QRZA 1ELAA 1TPOA 1L2EA 2G51A 5CHAC 3GCTG 1LHEH 1TIOA 1OWKA 1P2NA 1NFXA 2H5DA 1SLWB 1NS3A 4P02A 3U1JB 2V3OH 1TGTA 2TGAA 2AGEX 5HM9A 3M3VA 3FP7E 1O38A 3C1KA 1TPPA 2VVCA 4OS2A 1O2RA 1LHCH 2PUQH 4F48B 2AMPA 3NPSA 2KR7A 3FP6E 2J38A 2FYQA 1WBGB 3ZZ4A 1G9IE 3SI3H 3A86A 1O3EA 3IG6B 2VIOA 3KQDA 2B5TB 3GY2A 1X7AC 1D3TB 1TB6H 2YMSD 1AZ8A 1BTWA 1JOUB 4NSVA 1UTMA 2FP7B 1GBHA 1FY5A 3UFAA 1P9SA 4ABDA 3MU8A 3SV2H 3F9GA 1GDQA 1MZAA 3D65E 1O5DH 2FI5E 1HXEH 1G3BA 2FTMA 4KTCA 1ZMLA 3OTPA 5C94A 4H6SB 5JBTA 3BG8A 1GHZA 1QBNA 2O8WA 1HAYB 1ANDA 1V2TT 2QXIA 3A8CA 3BF6H 3URCA 2G4TA 2KAIB 4LK4A 2C90B 3TJNA 2VVVA 4JCNA 2HLCA 1YLCA 1C5PA 4CRBA 3M5NA 1GBFA 5EG4A 3MMGA 3KIDU 4X2WA 4F4OC 3TGKE 2PUXB 2ZTYA 3KL6A 4X2VA 3DSGA 1O2QA 4ZKOU 3MU1A 4O9VA 1NRRH 4TYDA 2SGDE 3LH3A 2ZECA 3UY9A 2HVXA 3T29A 2GDEH 4A92A 4XBDA 5L2YH 1TRMA 1DLKB 1Y59T 3DCLA 4FVBA 4ABHA 1ZSLA 1ABJH 1KYNA 1ZHRA 4D76A 4FUGA 2VINA 3SQHE 3MQKC 1ANCA 3LGVA 1J17T 3ODDA 2Z6BD 2FS9A 3A8AA 4E7NA 4DW2U 4UFDH 1GI4A 4X2YA 2JDID 1K1OA 1VITF 2OK5A 3FVFB 1GI0A 5KEDA 2TGDA 5EQSA 3SGBE 3SU5A 4B76A 1SHYA 1F5LA 1MABB 3SV9A 2XTTB 1FI8A 1QL8A 1Z7KA 1ZRBA 1KY9A 3VB6A 1HAOH 1E37B 4X6NA 1G3DA 1OOKB 1B7XB 3RXQA 3NZIA 2FOCA 4K8BA 1ELBA 1C4V2 2L6OA 2RCEA 1O3JA 2QE7D 1Y5UT 1OP0A 3E8LA 1KDQB 3MH6A 3SUFA 1MKWK 2A5KA 2AGIX 4FETA 3ZZ8A 4ASUD 2GV6A 4CRDA 4I8JA 1CA0C 3RMNH 2OLGA 4NIXA 2UUYA 1V2PT 4NA9H 1WDIA 1CSOE 2AYWA 4WF8A 1LDTT 4D7GA 2EA3A 1L1JA 5JYIA 2GZ7A 2C8YB 4IMQA 1G32B 1BZXE 2FDAA 1RTKA 3K6YA 1CT4E 3SW2B 1TMTH 3LC5A 3U69H 2FS8A 2G00A 1YCPK 5E2OA 2ULLA 1JIMA 1XM1A 4ASHA 3B9FH 3TH4H 1S82A 5T6GA 3SJIA 4X1PU 1A5HA 2ZP0H 2VH6A 2FZZA 1TWXB 2I6QA 2GVFA 3L3TA 2PFEA 5AHGH 4D8NA 2OC7A 4A6LA 3VEQB 2ZG0H 3V3MA 2F9OA 1O35A 3TK9A 1Z8JB 1BMFD 1EP5A 5DSFA 3KQCA 2BD7A 3M36A 3PYHA 5EQQA 1DSTA 3RC4A 2CGAA 4TT3D 4UONA 1T8OA 1ZHMA 2Z9IA 3KGPA 2Z94A 3SORA 3U1IB 3SN8A 1OPHB 3SJOA 1N1LA 4DJZB 2WV5A 1IQFA 3M5OA 2OC8A 4NA7A 5GWZA 1P8VC 1AHTH 1D3QB 3EQ0H 2QC2A 1YGCH 1ZMJA 3M7QA 4R0IA 2BY7X 1P04A 1TPSA 1WOFA 2BHGA 3M3SA 3S9CA 1K1NA 2ZGBH 2VGCC 1J15A 1NESE 4ABJA 4DGJA 4FUDA 4AZ2B 2Q6DA 1K1LA 4OS4A 3DSPA 3SU6A 3MHWU 1V2JT 2B8OH 1O37A 1QR3E 1F92A 2ZZUH 3N99A 2P3TB 3AAVA 1W11U 5H4IB 1ZSJA 3ATKA 2C4FH 2OINA 3ZVBA 1K1JA 3GY5A 1CGIE 3SGQE 4X8SH 1IQLA 3B23B 4YO9A 4MPVA 3SNBA 1UHBA 2BLQA 5C0UA 3UR6A 4ISNA 4CBNA 3S9BA 1W0KD 1V2RT 1UMAH 4A1VA 4WMFA 5DKMA 3I77A 5EPNA 2IPHA 1T4VH 3SV8A 5DK1A 4JYTA 3LGIA 1T4UH 5L2ZH 1Y3WA 2A0QB 2GMTC 5LPEA 1BA8B 1TNIA 1XUGA 1P2KA 2QCYA 2RG3A 1ZPZA 1S6FA 4Y10E 4TSFD 1C2IA 4GHQA 2F9BH 1QY6A 4CRFA 1E38B 5T6DA 1HRTH 2VWMA 1GCTC 5E0HA 1GGDB 2G4UA 1LHFH 1O3HA 1VGCB 5AFYH 1C1PA 4NWLA 1TPAE 1S84A 3QWCH 1P02A 3VB4A 1C5ZB 1W0ZU 1V2ST 2ZHWH 1PPHE 2NU2E 3BTFE 5GPIB 1S0RA 4RT1A 1WU1A 3T62A 1AB9C 3SU3A 1C9TA 1EZXC 1BMAA 3CNRA 5HIYA 4NGAH 3SZNA 3RXHA 1C5WB 3S7KB 2IJD1 3M7TA 2Q6FA 3N7EA 1V2KT 1PPBH 4MPWA 4ZMAH 1QJ7B 1PPCE 1FIWA 4AFQA 4Z1MD 1K2I1 1ZTJA 3AW1A 5JB8S 1DX5M 1Z8RA 2L74A 4WJG2 4IW4E 2R9PA 1INCA 1GL1A 2JH0D 1GMCG 2ODYB 1AI8H 2BD5A 2WV9A 1OP2A 1G30B 2Z9KA 1HAZB 1DANH 1EATA 4HGCA 4TPYA 1HLTH 3FFGA 2ALPA 4ZH8A 1IQHA 3BSQA 2XC5A 1QQ4A 3W1EA 3KNXA 2RA0A 1O2HA 1BB0B 1TNGA 4IMZA 4NG9H 1VCPA 5EOKA 3SNAA 5DGJA 4DG4A 1WUNH 2BMGB 3QDZB 2GTBA 3UNQA 1O5GH 5C1UA 3RC6A 1FQ3A 1TBZH 1EPTA 3T5FH 4E06H 5HXFA 3ZYEA 1EZSC 2Y5GA 2UWLA 5F8ZA 2XWAA 4AORA 1FDPA 2GT8A 4Q63A 4THNH 1C5TA 2QY0B 4M9FA 1SL3A 2FXRA 3SUGA 2VBCA 1MTUA 4YLQH 1FZZA 1TX7A 4XDEA 1TNLA 1SGRE 1EAXA 4K69A 3UB0A 3PTBA 1XXFA 1RIWB 4X1SU 1H4WA 2LP6A 1AFQB 4CHAC 3ESTA 1ANEA 3HK3B 3A8DA 3ITIA 5CDFE 1P57B 3VPKA 1SOTA 4RI0A 4MNVA 1O2PA 1UHBB 2HPQH 5FBIA 5DPAA 1FPCH 1QHRB 5GIBA 1RXPA 2VWOA 2BM2A 4B1TA 8KME2 1E0FD 2AIQA 5HM2A 2J98A 1P01A 3A87A 1OWJA 5K7RA 4LOYH 1IQMA 1LTOA 2XW9A 4MG3A 2BZAA 1XKBC 2BD4A 1LVYA 5JBBS 4ISOA 2HOBA 3QN7A 4CRCA 1F0TA 1GG6C 3KQBA 1SGEE 3QGNB 2A4QA 4XFQA 4YOGA 3PTNA 3QX5H 1SC8U 1CQQA 2AMQA 3GS9A 3Q3KA 1LQEA 1RTFB 2WV4A 3RC5A 3LH1A 2WSSD 3N7DA 2KCPA 4WXVA 5F8XA 5FCKA 1ANBA 4MTBA 1AZZA 1BMMH 4GCHG 3A85A 3ZZCA 1DWBH 3SU1A 2AGGX 1W3CA 1O3GA 1C1NA 1ZGIA 3M37A 3EAJA 4YT7H 3H09A 1SLVB 1ZZZA 3F6UH 3SU4A 1GVLA 3IITA 1DPOA 5KECA 1TE0A 3RXFA 2F83A 4IBLH 4XE4A 1GJ7B 3RXLA 3SJKA 1K1PA 3GISB 5EXNA 2PWXA 3HK6B 3S7HB 3SV6A 1FY8E 1O30A 4KELA 1GMCF 1ELCA 1MBMA 3BTTE 2WZQA 1KLJH 1LVBA 2R3UA 1TX8A 1LCYA 2ZGXH 4Y8ZA 4QT8C 1IAUA 1S83A 4X2XA 1UO6A 4B6EA 2ZU2A 1THSH 1QA7A 3OEED 2TIOA 3PO1C 1CO7E 2WPLS 3RU4E 5KGOA 2FEQH 2XWBI 4Y76A 2KCYA 2AIPA 2CHAC 4I8HA 1E79D 3ZV9A 3RLWH 9LPRA 4KTSA 3U8RH 3SJ9A 4B74A 1YPHC 3AW0A 1MAXA 5EW1H 1QL9A 2QXGA 3KQEA 1C1VH 2VIQA 4ESTE 4FU8A 3AAUA 3TNTA 3BTME 3WWFA 1E1RD 2PHBA 4ABIA 1AE5A 1ESAA 5DP3A 3UWJH 4A1XA 1D9IA 3GICB 1NO9H 2G8TA 1G2MA 1NRNH 4AG2A 1N8OC 1O33A 1EPTB 1GHAG 3UNRA 1CHOG 1H9HE 1RJXB 2UUKB 4OM9A 3NXPA 1DFPA 1C2DA 3VB3A 3GYMA 4Y71A 1GBMA 1O2KA 1PQ5A 3ELAH 2Y80A 4I31A 2BXUH 3O8DA 4YXWD 4KP0A 1D6RA 2J2UA 4OS5A 4RSPA 2NU4E 2A31A 1CT2E 5FPTA 4ZKSU 1P03A 4DOQA 1NBME 2OUAA 3QGJA 1BRBE 2GX4A 1DY9A 2QGRA 5JBCS 2TGTA 1DY8A 1AIXH 1GBTA 3E6PH 3V0XA 2ZF0H 4NCYA 1F0UA 3W95A 2ZCLP 5GJ4B 4AGKA 6ESTA 2HGTH 1LO6A 3H7TA 3CP7A 1F0SA 1ZPCA 2DE9A 3BTQE 2PKSB 2HNTE 1LPZB 4WMEA 4OGXA 3UWIA 3NKKA 2H6MA 5A8YA 3F9FA 2ZHDA 5BPEA 5DO4H 3DUXH 3RMLH 1GBDA 2B7DH 3OTJE 1SGQE 2ZDKA 3U8OH 3ODFA 3RUOA 2J98B 1TMBH 1C1TA 1PQ7A 1O5EH 2BQ7B 4AGJA 1TALA 3M7UA 2HWLB 2FO9A 2PGQB 5A8ZA 1OHHD 1QQUA 3RXTA 3DA9B 3VB7A 1KXAA 1YC0A 3NCLA 1WAYB 4AYVB 2BDBA 2JETC 1ZTKA 4X6MA 3ZVAA 4FUCA 2P3UB 1GJ6A 1GBCA 4AFZA 1C5XB 4Y79A 1C5OH 2Y5FA 2V0BA 1MBQA 1OSSA 3RXBA 1ELGA 1AQ7A 1MUEB 3LGUA 3ZZBA 1FY1A 7GCHG 4SGBE 1C1UH 1T8MA 1O3CA 2CN0H 2IN2A 3G01A 5LPRA 4UFFH 3GY7A 3SV7A 1GI1A 1DXWA 1P09A 2XYAA 2ZFPH 1AO5A 2ZQ1A 3U98H 1HAXB 2ZKSA 2JH5D 3F9HA 1C5LH 1FUJA 1XUJA 3RLYH 1AKSA 3Q3XA 4UEHH 2OC0A 2H5CA 4ZCNA 1K1MA 4ISIH 3CS7A 3TH3H 1SGPE 1SGNE 1Z6EA 1C5SA 1F5KU 1PYTD 1O5BB 3TLOA 1ACBE 2UUJB 2BDGA 1UVPA 4NZQA 3F2HA 3RXAA 2XXLA 1V2WT 1GHAF 1CHOF 4WMDA 1UTNA 3JZ2B 5TCCA 2VU8E 2ZCHP 1QIXB 1Y3YA 5FCRA 2A32A 2WPDD 1O2IA 4U2WA 2SGEE 2GV7A 3NRLA 1BT7A 3DD2H 1A3EH 1MTVA 2BXTH 1TONA 3QTOH 2V35A 4ZKNU 3SYJA 1BTXA 1G2LA 1YM0A 4X1RU 1LHDH 3FZZA 1F5RA 1UTLM 1EP6A 4U30A 4JK5A 1HPGA 5E0GA 2ESTE 2QXHA 1LPKB 2ZHEH 1B0FA 3U8TH 1K28D 1EAIA 1QA0A 1ZYOA 1HJAB 1OYTH 2R2WU 2A4RA 1GHWH 3DFLA 1HJ8A 4IN1A 1NRSH 7LPRA 1Y3UA 2YNBA 1TNJA 2HVYB 5EU8A 1SBWA 2WPKS 1C1MA 2O8UA 1P12E 3ZVGA 2ZPSA 4WY3A 3MH4A 4X1QU 2OD3B 4AFUA 3DSOA 1P2QA 2OQ5A 2RDLA 1NFWA 2D26C 1IQNA 2CF8H 3EDXB 2CXVA 2DE8A 3MYWA 1W0JD 1AUTC 1L0ZA 2BY9X 5F8TA 1KMHB 2EY4C 2C93B 2ZCKP 2ZU4A 3HKJB 3ENSB 2HRVA 5EXMA 1MD8A 1GBEA 1FN6A 1SG8B 1EQ9A 3MNBA 4UFEH 3OAAD 2SNWA 1UTQA 1BMNH 3UOPA 2A4OA 1ZGVA 5L30H 2KFWA 1GI9B 5F53A 2ANMH 1K1IA 3GCTF 5EJZA 4CH2B 3UQVA 1GDUA 2OBQA 2KCAA 7GCHF 1O2WA 1TFXA 2D2DA 3AASA 3ZVCA 1P06A 8ESTE 3SOSA 2XCFA 3RXUA 5BRRE 1K21H 1P05A 1V2VT 2FI4E 2PLXA 3BIVH 4CR5A 3Q76A 1GBIA 2ZIQH 5IYTA 1CA8B 1NT1A 1UK3A 1ZMNA 1BHXB 3SJ8A 4GSOA 3PROA 1THPB 4JZEH 2FLBH 4JZIA 3TGJE 1FJSA 3RXIA 2GZ9A 2BD8A 4BXWA 2PV9B 2WPMS 1AKSB 2VB0A 1CVWH 3OX7U 5DP8A 1OXGA 1TLDA 1MQ5A 1S6HA 4Z0KA 4MPXA 3ZVEA 1NRPH 1O2SA 1ELVA 2R2MB 5C0TA 1S5SA 2Q1JA 2NWNA 2PTNA 1ZLRA 4U01A 3O8BA 4YT6H 1O2GH 1Z8IB 3KYFA 3OSYA 2ZNKH 2F4LA 1ETSH 2V3HH 1ZJDA 1GPZA 1DUEA 2WYJA 1KXDA 3ATMA 1QGFA 2H9HA 3LONA 3URDA 4BXSA 7KMEH 1O2MA 1Z71A 4Q4LA 1PPZA 2BX4A 2O8MA 2ZDVH 2ZGCA 2B0FA 2A5AA 1UVOA 1F2SE 2W7SA 1H1BA 4K2YA 5TCAA 1MU6B 1V3XA 3TU7H 3MO9A 1HAVA 1GI8B 3E0NB 4DT4A 1HAHH 4SGAE 2OXSA 3NK8A 2VGCB 1MKXH 2STAE 2QV1A 1L4ZA 1OS8A 1GBKA 1YPGH 1W7GH 2FMJA 4XD7D 1VR1H 2WPHS 5ABWA 1MTNC 1L1NA 1O5FH 2EI8A 1G3CA 2FOEA 2BZ6H 2TGPZ 4FUJA 1QBVH 2OTVA 1ZR0A 3MH7A 1MD7A 1CU1A 2F9PA 3M5LA 2BLWA 3LT3A 5A0CA 3O8CA 2KM0A 2TBSA 2XC4A 1SR5C 1JRSA 1Z1JA 3A81A 1O5CB 2VIPA 1C5YB 4ZXXH 1CBWC 2QF3A 1EOLA 2ODQA 1DE7H 3UNSA 4B73A 2ZQ2A 3ZZ3A 4Y7AA 1A2CH 1NM6A 1Z1IA 1A0HB 1KXFA 2TRMA 1FX0B 2V3MA 4FXGH 5JBAS 5FHTA 2ZWLH 4GLYA 5DP4A 3SNEA 3GYLB 1D3DB 1JXPA 2H9TH 2W3IA 2ZFFH 4KKDA 1P10A 2TPIZ 1D4PB 1PQ8A 4DCDA 1GMDG 1T8LA 1EFRD 1O39A 1DWEH 1QZ8A 2G5VA 3BEUA 4GPGA 4JZDH 3RU4D 1TRYA 1O3NA 1GHBG 1YYY1 1KIGH 1VITH 3RXPA 4A7IB 2A5IA 1ORFA 3LDXH 2J4IA 1J16A 3SUDA 3ZYDA 4D7FA 2GP9B 1GGDC 1TNKA 1HIAA 1SPJA 1GBLA 5FXLA 2J5UA 1RGQA 1TOMH 4Q7XA 1AB9B 6GCHG 1NRQH 3P17H 2KCOA 3STJA 2Z9LA 4WH8A 3MNXA 3MNSA 3MO6A 2OBOA 4NFEA 1GHYH 1UCYH 5EJ1A 1HCGA 3M3TA 5EXLA 1SGFA 1GI2A 4AX9H 6LPRA 1ELEE 2PGBB 1DSUA 1P11E 1YPHE 3RXOA 3A7WA 1O34A 3F1SB 5E0JA 2FPZA 1GI7B 2SGAA 2J94A 1TMUH 1BBRH 4JZ1A 2RA3A 5T6FA 2W6JD 2XBYA 1ZJKA 4ZHMU 5C5OA 2W6ID 5CHBA 1LVOA 1A7SA 2STBE 3KF2A 4K1TA 1CGJE 2QN5T 4ISHH 5LH8A 4CBOA 2A2XH 5AVDA 4CH8B 1LMWB 4ZROA 1AWHB 2J95A 3ATLA 2EI6A 3BG4B 4NZLA 5I25A 3ZZ9A 1E35B 1ZHPA 4NIVA 1O3OA 1V2OT 3LPRA 3A7TA 3V12A 1V2UT 3E16B 5B6LA 3OE7D 5GCHG 2O8TA 1VJAU 2J34A 2Y81A 1BRCE 2G52A 3UREA 4J1YA 3RXGA 1HAVB 2WPIS 1C2FA 1BCUH 4ZUHA 2FESH 1HAPH 1IHTH 2QF0A 1D3PB 1GI6A 2OCVB 3STIA 1BOQA 4U32A 5EPYA 2ZTZA 3U9AH 1A0LA 1C5NH 3GY8A 4ABEA 2FX6A 1W2KH 2M5TA 3PV4A 2IPQX 3GY4A 1S0QA 5DP9A 5T3HA 1NPMA 5ESBA 3SGAE 2HALA 1O3FA 1OWEA 4ISLA 2RDEA 5HMAA 4A1TA 1RFNA 4CHAB 5DG6A 9ESTA 3KN2A 3PV2A 1DVAH 3RMOH 3SU2A 2XBWA 1O3BA 1RIWC 3FOAA 1GJAB 1N6YA 1EJMA 1T8NA 3ZZ5A 1EZUC 4RKOB 2HLDD 1AFQC 5DN6D 3BTDE 4ACAA 2ZDNA 3F68H 3EGKH 1NN6A 1GMDF 3A88A 1HDTH 4Q80A 2AS9A 3OY5U 5EQRA 1PYTC 3EE7A 2YMSC 1F0RA 2FOAA 1UVTH 2ZPQA 4ZXYH 4YLUA 1S6LA 3UOUA 3F0OA 1GJ9B 1BRUP 2FODA 1UTKA 4GAWA 1QFKH 3ATIA 1M9UA 2O9QA 3P95A 3F3BA 3E90B 1K9OE 4Q2KA 5TJXA 2GCTB 1PPFE 1SOZA 2BLVA 3RP2A 5A8XA 3GDSA 6GCHF 2H9EH 1DWDH 1GI5A 2BY8X 3KQ5A 1IQJA 1NU7B 1WV7H 3PRDA 1AMHA 1W0YH 2ZU1A 3Q00A 1YPKH 1NTPA 4HFPB 2Q6GA 1OX1A 3TJOA 4BTUB 2ILNA 2BDHA 1HAIH 3H7OA 2CMYA 3VXEH 1EUFA 3VG8A 3MO3A 1XUHA 2BD2A 1KSNA 2ZU5A 1C5MD 3VGCB 4K5ZA 4YOIA 1LQDB 1P2OA 2VWNA 3SNDA 2SNVA 1QRWA 3SNCA 3D62A 1EZQA 3ZVDA 2UUFB 1KLTA 4Y8XA 1C5VA 1FIZA 4AC9A 3E91A 3ATWA 4NIWA 2Z9GA 4VGCC 5LPFA 4R8TB 1O2ZA 1EOJA 4B2BA 4AYYB 4O03A 3T27A 3VFEA 2C8ZB 4K1EA 5GCHF 2FOBA 1BMLA 1TRNA 3LJOA 1P2MA 1AFEH 3OYPA 2OC1A 3P8GA 5DP7A 1BTZA 4F49A 1DM4B 1THRH 1W13U 4Q7YA 4TY6A 3A83A 4ZHAA 1EXFA 3GY6A 1H9IE 1AY6H 1U6QA 3QO6A 4MNXA 3T26A 3TNSA 2VNTA 1Q2WA 3K65B 4DURA 5AF9H 2P8OB 2AFQB 3RXVA 1EPTC 3IWMA 4YESB 3M61U 1DDJA 4DIHH 3MFJA 2KAIA 1A0JA 3RU4T 2THFB 4LXBH 2XOKD 1RD3B 2BVSH 1QJ1B 4MQAA 1LVMA 2FWWA 1K0HA 1S85A 1KXEA 1OP8A 1GBAA 1CGHA 2PKAA 1O2TA 5C1YA 3EA9A 1TBRH 3QTVH 2F3CE 4MNWA 2PW8H 2BD9A 1P2JA 3S9AA 4BOHA 4O3UA 3DT0H 2BTCE 3NWUA 3F0PA 2KX4A 5ETXA 1C4Y2 3P8NA 3P92A 4B2CA 5J4SA 4ACBA 2ZFQH 1T32A 3PLBA 2BD3A 1EB1H 2AHME 1IQKA 1GWAA 3MH5A 1O3AA 4DVAU 4Y6DA 1Z6JH 4HG6A 3GCHB 2VWLA 2HNTF 1YLDA 2W7UA 3BEFB 1SQRA 4NFFA 2QA9E 2PKSC 1OWHA 1SQAA 6CHAC 1FLEE 4K1SA 2P16A 4A5TS 4H6TA 2PSYA 3GDVA 2Z3EA 3RXRA 1DT2A 2V6NA 3LJJA 2IOTA 1GBBA 1YCPM 4GCHF 1H8DH 1YKTA 3RM0H 1ZPBA 2J92A 2FOFA 2C8XB 1OWIA 1WXRA 1YLNA 4XRNA 2BB4A 2JH6D 3UAIC 5DP5A 2ZDMA 4ZKRU 2ZC9H 1C5QA 1UVUH 2VIWA 3W94A 2JETB 1MKXK 1SGYE 1LKAA 3QLPH 1UTPA 3ZV8A 1ELDE 3OU0A 1QURH 2PR3A 1GCDA 4XBCA 1HAGE 5CHAB 2F43B 3RM2H 1P9UA 4MVNA 3MWIU 1TA2A 3NUMA 1BHXF 2FOMB 3OFND 1PFXC 4BTTB 1O2NA 3EYDA 1BIOA 4UDWH 4B2AA 3SHCH 3WY8A 1A61H 4AB9A 4E05H 2WHXA 1VCWA 2NU1E 1SGIB 1MU8B 3TJUA 3MNCA 1H8HD
chains in the Genus database with same CATH topology
1FXYA 3LGWA 4YZUA 2BYAX 2NU3E 1B5GH 5K0HA 1FY4A 1GBJA 3BTEE 2P94A 5HGGA 1ARBA 1JRTA 4ZAEA 4DIIH 1HFDA 1O0DH 1HBTH 4X6PA 5E8EH 5C67A 1ABIH 1XUFA 3A7ZA 4K3JA 4TWYA 2PSXA 1EB2A 2ZEBA 1GJ8B 1C4U2 4OS1A 1S81A 1O3IA 1TGNA 1SI5H 1TAWA 1BQYA 4KTUA 4LZ4B 4H4FA 3BTHE 2WUBA 1MAYA 1E34B 5EODA 1AWFH 1MTSA 1YPEH 4OS7A 4YTAA 2BY6X 4AN7A 1DXPA 3R3GB 3KHVA 1SLUB 4UE7H 1P2IA 2J9NA 4I33A 1NFUA 1UCYK 2Y7ZA 2QAAA 5ESTE 1QB6A 2ALVA 3TIUA 1J14A 1T31A 3A84A 5DP6A 2K1QA 1MMJN 1NFYA 3GDUA 4MDSA 1FAXA 1O31A 3LU9B 3RXDA 2PKAB 2QYIA 2XNIA 1WCZA 4BANB 1BBRK 2NU0E 2P3FH 4O97A 2P93A 2WUCA 2FTLE 4FUIA 1AVGH 1HJ9A 2VH0A 4JK6A 3I78A 1HJAC 2YNAA 3QUMP 1O3PB 2H1UA 2VVUA 5PTPA 1EAWA 2EI7A 1A3BH 1YPJH 4I8LA 1MQ6A 2ZA5A 1SGCA 1WTGH 2BOHB 1JWTA 1O32A 1H9LB 1Q31A 3HKIB 2AERH 3Q3YA 1AE8H 1YF4A 2A45B 1F7ZA 3O8RA 3Q77A 2ZFRH 1B0EA 2ZDLA 1KXCA 5L6NH 1Y5AT 1BRAA 4UFGH 4X1NU 3P8FA 4CRAA 2R0LA 3BV9B 3TH2H 3I29A 2GKVE 3L33A 2CV3A 1JIRA 1WTHD 4TWWA 5C1XA 2HNTC 1LKBA 2BY5X 3DHKH 3TPIZ 1LHGH 1MCTA 1UCYE 1BJUA 1CA0B 1ZRKA 2ZPRA 3SU0A 1BTPA 2UWPA 2D8WA 4OGYA 2Y6TA 2AH4X 3P70B 2ANYA 4NWKA 8LPRA 4GUXA 5EW2H 3FAOA 1YBWA 5E2PA 1GMHG 5DJ7A 4H42U 5HYOA 1HV7A 1V2LT 4O3TA 1BBRE 3K9XB 4X8UH 1QBOA 2GCHG 2ZI2H 2ODPA 1O2LA 4IC6A 3ZZ6A 1SGFG 2QXJA 4IN2A 1J9CH 2ZO3H 2ANWA 3TVJB 1SFQB 1SQOA 2G5NA 2I6SA 2ZFSA 4OS6A 1TQ0B 3BEIB 1KTSB 4X8VH 1PPEE 1AD8H 3EE0B 1BTUA 1Y5BT 1ZTLA 1V6DA 1K22H 1XKAC 5FX5A 3MU0A 1TGBA 1BITA 4IGDA 7ESTE 3TGIE 1QRXA 4I8GA 3RXCA 2FOHA 1DITH 1OKXA 2XCNA 4MPUA 3BIUH 2GT7A 1P3EA 4M7GA 3TITA 3A8BA 3QK1A 1FMGA 3EA8A 1O3LA 2CJIA 2BVXH 1IQIA 2Z9JA 5C5NA 1GHXH 4I32A 1NY22 2VIDA 3PM3A 2G81E 2XBXA 1C2HA 1EKBB 3FANA 1OWDA 1OYQA 3D49H 1JBUH 3PWCA 3GY3A 1Y3VA 3A7YA 4FUFA 4FU7A 2B9LA 1GJDB 1SSXA 1TBQH 3K2UA 1A5GH 2P95A 1QNJA 1MTNB 2R3YA 1SB1H 1GI3A 1HXFH 2WPJS 1KTTB 2EC9H 3SHAH 4NIYA 1XVMA 2Z7FE 3L6PA 2ZTXA 1DS2E 5SGAE 1HUTH 5F6MA 2BQWB 2GD4B 3EA7A 4RN6A 2ZU3A 1EASA 3E1XB 3LGTA 4ABGA 2ZFTA 3RXMA 1BUIA 2ASUB 3UR9A 1CBWB 1G3EA 2GMTB 2HPPH 3CS0A 4KGAA 1GJCB 4RKJB 2ZHFH 2VJ1A 1O3KA 3R0FA 4B71A 2IJOB 1D6WA 5FPSA 5C3NA 3BTKE 3T2NA 5AFZH 1P3CA 3ZZAA 4BAQB 3VXFH 1GCTB 2FLRH 4X8TH 2W26A 1YPMH 3HGPA 1FV9A 4AFSA 3MU5A 1VCQA 1GJ4H 1E36B 1UTOA 4Y0ZE 3PLPA 1XXDA 2A7JA 1Z8GA 1VGCC 1GMHF 2BQ6B 1QB1A 3MOCA 1C2GA 1IHSH 4Y11E 3BN9A 4FU9A 4LZ1H 1W14U 2BDCA 2GCHF 8GCHG 1GDNA 2ZGJA 4X0WU 5FX6A 4Y8YA 4ZHLU 1PJPA 4BAKB 5I46H 1QTFA 2ZGHA 1GHVH 1TOCB 1IQEA 1C1QA 3ZZ7A 3CENA 1C1WH 2D1JA 1RTLA 1VZQH 3E0PB 4Y0YE 1EJAA 1A5IA 1W7XH 1RS0A 3A89A 1UJ1A 4K60A 2GGVB 1O2JA 1C2JA 1UVSH 1C2MA 4FVDA 3K6ZA 1SGDE 4INLA 1ZOMA 3RXSA 3B8JA 4FUHA 3S69A 2Y7XA 5JDUB 2SGPE 1FPHH 4ABBA 2AEIH 1W8BH 2ANKH 2FIRH 3SI4H 2LPRA 1XMNB 1TNHA 2Z3CA 3JZ1B 5C20A 1DICA 1SGTA 2FYRA 3PMBB 1PPGE 1QB9A 3RMMH 1SHHB 1XVOA 2C3SA 3BG4C 1PQAA 1TYNA 3A80A 4WVPE 4XOJA 5A0BA 1CE5A 1AU8A 1ESTA 1C5UA 2BX3A 1AGJA 3SO3A 4JMYA 3ZZDA 2EEKA 1MH0A 1MTWA 1O2XA 3KCGH 3QZRA 1BDAA 3FP8E 2JKHA 2C8WB 1L4DA 1TX6A 2W5EA 4WH6A 2H2ZA 3KEEA 1MKWH 5F03A 3HATH 2BDYA 2Z3DA 3C27B 3MTYA 1ARCA 4AOQA 2A4GA 2GZ8A 4MNYA 1TGCA 3RXJA 5C2ZA 3N7OA 1ETTH 3A82A 1C9PA 2SGFE 1SMFE 1AVXA 4PROA 1QL7A 4AB8A 3UTUH 3LKWA 1XUKA 4X6OA 1GVKB 1SLXB 4INKA 4GHTA 1A46H 3PMHB 4DY7B 1DOJA 2FI3E 1XUIA 1HNEE 2XC0A 4Z6AH 2F9UA 1HB0B 1WQVH 1UTJA 3V13A 1GHBF 1Y3XA 1YCPH 3D23A 3GOVB 3RDZA 3TK5A 1GG6B 3M5MA 1O3MA 3LIWA 2R0KA 1ID5H 2F91A 5B6OA 2XBVA 2F9VA 2BOKA 2Y82A 1V2MT 1MZDA 1FY3A 1ELTA 4BAHB 2PTCE 3OY6U 1VJ9U 1CHGA 4TPIZ 2CF9H 2FOGA 1AUJA 4NSYA 8GCHF 3SQEE 3UIRA 4DT7B 1HIAB 1HGTH 1EX3A 3BTWE 2BDIA 5FPYA 3LC3A 1FNIA 1DWCH 3E3TA 2BLOA 2AMDA 2GCTC 1W10U 4Y7BA 4IS5A 1HYLA 1TGSZ 1WQSA 2GDDA 1GJBB 2FM2A 1YP9A 1IQGA 1NROH 3HPTB 1O2UA 2UWOA 3HGNA 1P0SH 2OP9A 1ZSKA 1C1RA 3P8OA 1C5RA 1O36A 3F9EA 5LGOA 2A7CA 3BTGE 4FUEA 5CE1A 2QIQA 3QZQA 4JYVH 1T7CA 4IC5A 1SQTA 1NC6A 3PO1B 1MCVA 1W12U 2A2QH 4K8YA 5GXPA 2CHAB 1A1RA 1H8IH 1JMOH 2A7HA 1ESBA 4BAMB 3V7TA 1N6XA 1V2NT 1WYKA 1O3DA 4NA8A 1QCPA 3VGCC 3RXEA 2VIVA 3VB5A 3S0NA 3PLKA 1GVZA 4VGCB 3DFJA 2FX4A 2SFAA 1C1SA 3FZDA 3UPEA 3ZVFA 1N8OB 2XRCA 1C2EA 2WYGA 1FN8A 1NZQH 1QJ6B 2YOLA 5FBEA 3UQOA 1GL0E 1AVWA 1UK2A 2O8LA 2Y5HA 5JB9S 3TJVA 1UK4A 2LNCA 4B75A 3LGYA 1NU9A 5CMXH 2W3KA 1SVPA 4WXIA 1EAUA 5A09A 4INHA 2G55A 1O2YA 1KXBA 3SUEA 1C2LA 1YPLH 4D9RA 1BTYA 2P8OC 3SBKA 1TA6A 4BAOB 4BNRA 4JZFH 3GCNA 1J8AA 4XSKU 3A7VA 2F9NA 3PWBA 1IOEA 3H5CB 1BTHH 3UUZA 1O5AB 4CR9A 1FONA 1ELFA 4AG1A 1SFIA 3MI4A 1O2OA 2BVRH 1FAKH 3TK6A 1KLIH 1TQ7B 1WSSH 1XX9A 5FAHA 4ABAA 1DLEA 1BJVA 4JYUH 3MU4A 4YM9A 2ZDAH 4I7YH 5EGMA 1ETRH 3RXKA 4HTCH 5G4BA 6CHAB 4E7RG 4TY7A 4D9QA 3PMAB 4CREA 5A0AE 1AN1E 3A7XA 3T28A 1DUAA 1A4WH 3GCHC 2BDAA 1RRKA 4I8KA 3M35A 1GJ5H 1TABE 4MLFB 3AVZA 3T25A 4Q7ZA 2P59A 1C1OA 1G36A 4HI3A 4YOJA 3GCOA 4CRGA 1VITG 4UD9H 5A2MH 1O2VA 3LOXA 1LPGB 2DUCA 1EJNA 2WINI 4GVUA 1KDQA 5JPMH 3PB1E 4HZHA 4BTIB 5GDSH 1CT0E 4J2YB 3PMJA 1Q3XA 5J4QA 1Y8TA 2A1DB 2ZHQH 1L1GA 4ABFA 4FUBA 5IDKA 1V2QT 4WWYA 1G37A 3P6ZB 4XBBA 1C2KA 2SGQE 2OQUA 1QRZA 1ELAA 1TPOA 1L2EA 2G51A 5CHAC 3GCTG 1LHEH 1TIOA 1OWKA 1P2NA 1NFXA 2H5DA 1SLWB 1NS3A 3U1JB 2V3OH 1TGTA 2TGAA 2AGEX 5HM9A 3M3VA 3FP7E 1O38A 3C1KA 1TPPA 2VVCA 4OS2A 1O2RA 1LHCH 2PUQH 2AMPA 3NPSA 3FP6E 2J38A 2FYQA 1WBGB 3ZZ4A 1G9IE 3SI3H 3A86A 1O3EA 3IG6B 2VIOA 3KQDA 2B5TB 3GY2A 1X7AC 1D3TB 1TB6H 1AZ8A 1BTWA 1JOUB 4NSVA 1UTMA 2FP7B 1GBHA 1FY5A 3UFAA 1P9SA 4ABDA 3MU8A 3SV2H 3F9GA 1GDQA 1MZAA 3D65E 1O5DH 2FI5E 1HXEH 1G3BA 2FTMA 4KTCA 1ZMLA 4H6SB 5JBTA 3BG8A 1GHZA 1QBNA 2O8WA 1HAYB 1ANDA 1V2TT 2QXIA 3A8CA 3BF6H 3URCA 2G4TA 2KAIB 4LK4A 2C90B 3TJNA 2VVVA 4JCNA 2HLCA 1YLCA 1C5PA 4CRBA 3M5NA 1GBFA 5EG4A 3MMGA 3KIDU 4X2WA 4F4OC 3TGKE 2PUXB 2ZTYA 3KL6A 4X2VA 1O2QA 4ZKOU 3MU1A 4O9VA 1NRRH 4TYDA 2SGDE 3LH3A 2ZECA 3UY9A 2HVXA 3T29A 2GDEH 4A92A 4XBDA 5L2YH 1TRMA 1DLKB 1Y59T 4FVBA 4ABHA 1ZSLA 1ABJH 1KYNA 1ZHRA 4D76A 4FUGA 2VINA 3SQHE 1ANCA 3LGVA 1J17T 3ODDA 2Z6BD 2FS9A 3A8AA 4E7NA 4DW2U 4UFDH 1GI4A 4X2YA 1K1OA 1VITF 3FVFB 1GI0A 2TGDA 5EQSA 3SGBE 3SU5A 4B76A 1SHYA 1F5LA 3SV9A 2XTTB 1FI8A 1QL8A 1Z7KA 1ZRBA 1KY9A 3VB6A 1HAOH 1E37B 4X6NA 1G3DA 1OOKB 1B7XB 3RXQA 3NZIA 2FOCA 4K8BA 1ELBA 1C4V2 2RCEA 1O3JA 1Y5UT 1OP0A 3E8LA 1KDQB 3MH6A 3SUFA 1MKWK 2A5KA 2AGIX 3ZZ8A 2GV6A 4CRDA 4I8JA 1CA0C 3RMNH 2OLGA 4NIXA 2UUYA 1V2PT 4NA9H 1CSOE 2AYWA 4WF8A 1LDTT 4D7GA 2EA3A 1L1JA 5JYIA 2GZ7A 2C8YB 4IMQA 1G32B 1BZXE 2FDAA 1RTKA 3K6YA 1CT4E 3SW2B 1TMTH 3LC5A 3U69H 2FS8A 2G00A 1YCPK 5E2OA 2ULLA 1JIMA 1XM1A 4ASHA 3B9FH 3TH4H 1S82A 5T6GA 3SJIA 4X1PU 1A5HA 2ZP0H 2VH6A 2FZZA 1TWXB 2I6QA 2GVFA 3L3TA 2PFEA 5AHGH 4D8NA 2OC7A 4A6LA 3VEQB 2ZG0H 3V3MA 2F9OA 1O35A 3TK9A 1Z8JB 1EP5A 3KQCA 2BD7A 3M36A 3PYHA 5EQQA 1DSTA 3RC4A 2CGAA 4UONA 1T8OA 1ZHMA 2Z9IA 3KGPA 2Z94A 3SORA 3U1IB 3SN8A 1OPHB 3SJOA 1N1LA 4DJZB 2WV5A 1IQFA 3M5OA 2OC8A 4NA7A 5GWZA 1P8VC 1AHTH 1D3QB 3EQ0H 2QC2A 1YGCH 1ZMJA 3M7QA 4R0IA 2BY7X 1P04A 1TPSA 1WOFA 2BHGA 3M3SA 3S9CA 1K1NA 2ZGBH 2VGCC 1J15A 1NESE 4ABJA 4DGJA 4FUDA 4AZ2B 2Q6DA 1K1LA 4OS4A 3SU6A 3MHWU 1V2JT 2B8OH 1O37A 1QR3E 1F92A 2ZZUH 2P3TB 3AAVA 1W11U 5H4IB 1ZSJA 3ATKA 2C4FH 2OINA 3ZVBA 1K1JA 3GY5A 1CGIE 3SGQE 4X8SH 1IQLA 3B23B 4YO9A 4MPVA 3SNBA 1UHBA 2BLQA 3UR6A 4ISNA 4CBNA 3S9BA 1V2RT 1UMAH 4A1VA 4WMFA 5DKMA 3I77A 5EPNA 2IPHA 1T4VH 3SV8A 5DK1A 4JYTA 3LGIA 1T4UH 5L2ZH 1Y3WA 2A0QB 2GMTC 5LPEA 1BA8B 1TNIA 1XUGA 1P2KA 2QCYA 2RG3A 1ZPZA 1S6FA 4Y10E 1C2IA 4GHQA 2F9BH 1QY6A 4CRFA 1E38B 5T6DA 1HRTH 2VWMA 1GCTC 5E0HA 1GGDB 2G4UA 1LHFH 1O3HA 1VGCB 5AFYH 1C1PA 4NWLA 1TPAE 1S84A 3QWCH 1P02A 3VB4A 1C5ZB 1W0ZU 1V2ST 2ZHWH 1PPHE 2NU2E 3BTFE 5GPIB 1S0RA 1WU1A 3T62A 1AB9C 3SU3A 1C9TA 1EZXC 1BMAA 4NGAH 3SZNA 3RXHA 1C5WB 3S7KB 3M7TA 2Q6FA 1V2KT 1PPBH 4MPWA 4ZMAH 1QJ7B 1PPCE 1FIWA 4AFQA 1K2I1 1ZTJA 3AW1A 5JB8S 1DX5M 1Z8RA 4WJG2 4IW4E 2R9PA 1INCA 1GL1A 2ODYB 1GMCG 2JH0D 1AI8H 2BD5A 1OP2A 1G30B 2Z9KA 1HAZB 1DANH 1EATA 4HGCA 4TPYA 1HLTH 3FFGA 2ALPA 4ZH8A 1IQHA 3BSQA 2XC5A 1QQ4A 3KNXA