1F5RA

Rat trypsinogen mutant complexed with bovine pancreatic trypsin inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
216
Chain Sequence
DKGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNEPDLLKCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN II, ANIONIC
publication title The energetic cost of induced fit catalysis: Crystal structures of trypsinogen mutants with enhanced activity and inhibitor affinity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 216
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5rA02
3AVZA 5L6NH 4D76A 5JDUB 2ZI2H 1QB1A 1C1MA 4D9QA 1GHAG 2AERH 1ZMNA 1GWAA 1G37A 5K7RA 4BXWA 1FPHH 2BYAX 1C5YB 7GCHG 1V2UT 2BHGA 1KTTB 4CRDA 2C8WB 1DLKB 1CE5A 3MH6A 3AW0A 2ZPQA 5GIBA 2F3CE 1ARCA 2BY6X 3TIUA 2NWNA 5DG6A 2CMYA 4WVPE 1QRXA 3L3TA 3MOCA 4AZ2B 1HDTH 1P03A 5IYTA 2OD3B 4ABHA 1AO5A 1OOKB 2BDHA 1ORFA 1Q3XA 1E0FD 1NROH 4DG4A 1GJ6A 3ZZ5A 1NZQH 1S81A 1P10A 4Q7ZA 1V2QT 5FHTA 2A1DB 3U1IB 1LKBA 3KGPA 1DT2A 3T29A 5TJXA 2XC0A 1UTOA 2ASUB 3PWCA 4VGCC 3ZZCA 3A88A 4OS1A 1O5DH 1YC0A 4BXSA 1C1OA 1OWEA 1V2WT 3UR9A 4DIIH 1JOUB 5E0HA 3Q3XA 1ELCA 1OWIA 3CP7A 2HNTF 3M37A 1WAYB 3A8AA 3ATWA 1V2JT 4WMEA 5EW1H 1NC6A 3RC4A 1P8VC 4I8JA 7LPRA 3M36A 1Z6JH 3GY6A 2H1UA 3RXSA 4GHQA 3E6PH 3MNCA 2RG3A 1QURH 4O9VA 1C5LH 3RXAA 2G00A 2SGQE 1DXWA 1HB0B 1GHXH 1O3HA 1H1BA 1ELAA 1NRSH 1C2DA 4X1PU 1EAWA 3SU2A 4B2AA 1O38A 3ZZ8A 2ZFRH 1FQ3A 5EOKA 2GZ7A 2V0BA 2BVXH 3ESTA 5A8YA 2P95A 4X2WA 4NFFA 9ESTA 1BTXA 1UTKA 2BTCE 1ZHPA 1TBQH 5JYIA 1YPEH 1VGCC 3RMNH 1MKXH 5GJ4B 1JRSA 4O97A 1D6RA 4TWWA 1UK4A 1EP6A 1OP0A 1BMAA 1A0LA 1H9HE 1MH0A 3A8BA 1YYY1 3LJOA 2WPIS 3STJA 1W0ZU 1XUFA 2FODA 3NWUA 2OP9A 1C2GA 1C5MD 5ESTE 2EA3A 2ZQ1A 2JKHA 3A83A 1KYNA 1UTMA 2CF9H 4I33A 3RMLH 1ESAA 2XBXA 2ZDVH 4CHAB 3EQ0H 2BLVA 2ZTYA 4IBLH 1O2XA 4CRBA 1L0ZA 3HKIB 1QJ1B 4K1EA 1U6QA 1C2HA 2I6QA 2ULLA 3HPTB 4YOGA 3E1XB 1GBCA 1IQHA 2Y7XA 3GCHB 1C5RA 3P95A 1P05A 2NU3E 1TGNA 1F5LA 3M7UA 1OYQA 3MH5A 1TPOA 3QX5H 4Q7YA 1TWXB 4OS2A 2GV7A 4XBDA 1QY6A 4JZDH 1O5CB 3KHVA 2ZCLP 4JCNA 1IQKA 1OWHA 4A7IB 1BMLA 4XBBA 2ZGJA 4SGAE 2XCFA 1GJ9B 2A4OA 3ZVGA 2PGQB 1O34A 2EEKA 2B5TB 3E8LA 3NPSA 3RXLA 1UTJA 2BD5A 2GZ8A 3GY2A 1S82A 2QV1A 1IQEA 1UK2A 5EXNA 1ELVA 2AGEX 3GICB 1DM4B 3ZVDA 3L33A 1IQFA 1W8BH 1C5QA 4I8GA 4CRAA 5T6FA 1BHXF 2BDAA 1GJAB 1PYTC 3QGJA 5A0BA 3BIUH 1BB0B 1E34B 2VWOA 2LPRA 1LVYA 1CSOE 2STBE 3MU1A 2AEIH 2ZHQH 1OWDA 3TNTA 3ZZDA 3TLOA 3M7QA 3S69A 4BTUB 1IQMA 2XRCA 4GHTA 2BVSH 1F0UA 4GPGA 2BD8A 2O8UA 4TYDA 4ASHA 3S9BA 2PKSC 3TGIE 1THPB 1DPOA 1RRKA 1O2OA 2FPZA 4DVAU 1YKTA 3SJIA 5I46H 2VWLA 1B7XB 3UWIA 2R9PA 4PROA 1EATA 1TPPA 1Y3YA 2UWLA 3BG4B 1KDQA 4XBCA 1GBMA 4MLFB 4YLUA 2F9NA 1AWHB 5DP8A 3M7TA 1A3EH 3K2UA 4ABBA 5EPYA 2G55A 3A86A 1SGDE 3ZZ3A 1CU1A 1SGTA 1RTFB 8KME2 2TPIZ 1UHBB 1SI5H 3KQCA 4OGYA 1OYTH 3E16B 2BD7A 2Z9GA 1A5IA 1J14A 2I6SA 2ZQ2A 1A46H 1KDQB 1TPSA 1EJNA 5FPTA 1D6WA 2GT7A 4GVUA 1Y5AT 1F92A 4ABFA 1LO6A 1XX9A 1D3QB 4Q80A 4ISNA 4CRCA 1HJ9A 4MDSA 1S6HA 2FOEA 2PLXA 2HVXA 5AHGH 1P12E 1GVLA 3P17H 4ZKOU 1KLJH 4JMYA 2B9LA 1NT1A 3UTUH 4KTCA 3RDZA 1EP5A 2R3YA 1QGFA 1H8DH 3V12A 1HUTH 3ZZ6A 3Q3KA 1N6XA 5A0AE 5DP6A 3QZQA 1GI1A 1MTVA 5JBBS 1GDQA 3RXVA 1FONA 1YCPM 1P57B 3T25A 3MU5A 1PPFE 2HPQH 1FLEE 4DURA 1HAIH 2ZCHP 1CGHA 5FPYA 4Y7AA 4ZKSU 2Y82A 4WXIA 1HNEE 3LDXH 3RXDA 5F8TA 3GISB 2PSYA 3RXTA 3OY5U 2VVCA 3GYLB 2O9QA 3GY4A 2BY9X 3GCNA 1FAKH 4BTIB 4MPWA 2AMPA 3HGNA 3RU4E 1GI4A 1Q31A 1YCPH 2CN0H 4Y0YE 5ABWA 1ZMLA 3ATLA 1MAYA 2RA0A 3UOPA 3RMMH 1DVAH 4X6MA 2WYGA 5ESBA 3FFGA 2HNTE 2QF0A 1N8OC 1Y3UA 4X8SH 3KEEA 4LXBH 3OSYA 1YM0A 1TE0A 1UO6A 3MWIU 6LPRA 2ZU5A 2ANMH 1G3BA 1O5FH 1B0FA 3L6PA 3RP2A 4Y10E 1SLWB 2ZECA 6CHAC 4MNXA 2CXVA 5FBEA 2A0QB 3FZDA 3RLYH 1GL0E 3U8TH 2OC0A 4B74A 3QDZB 1V2RT 1YP9A 2H5DA 4AB8A 3P8GA 2PUXB 8ESTE 1GI0A 4F4OC 1AY6H 2A4GA 1KXFA 1YPKH 1YPLH 1DSUA 3KQBA 3DFLA 2A7CA 2C93B 2FXRA 4NWKA 1KXDA 1QA0A 1GG6B 2G5NA 8LPRA 1UCYE 1C1NA 1FN6A 1UVUH 7KMEH 4X2VA 3SNCA 3QN7A 3PO1C 2KAIA 5C3NA 2HRVA 5AFZH 3RU4D 2BOHB 5DP7A 3DFJA 5FAHA 1HGTH 3UR6A 1XMNB 5HM2A 4OGXA 1ESTA 1AQ7A 2SGPE 2GZ9A 1V3XA 2NU4E 4YZUA 3ZVFA 1HIAB 3RM2H 1QNJA 4AFQA 1V2TT 1O2VA 1O3JA 1QFKH 2BMGB 1ELEE 1O2WA 3QLPH 2B0FA 4I32A 1C4U2 4I7YH 2QYIA 2CHAB 1EOJA 3U98H 2ODQA 1GHBF 1EB2A 5JB8S 3QGNB 3CS7A 1W14U 3UPEA 1JXPA 4YTAA 2VWMA 1DWBH 4B2CA 1AUJA 3SV9A 3RXBA 1F0TA 3T5FH 3A7TA 4Y76A 4U01A 3ATIA 4X1RU 1HAHH 2ZZUH 5C2ZA 2D2DA 2QF3A 3B23B 3NCLA 3SGBE 2ALPA 5DGJA 1AN1E 4NG9H 2XBVA 1BZXE 3SV2H 2TBSA 2ZU3A 1CGIE 1C1TA 2ZWLH 2O8MA 4INLA 4GCHF 4RSPA 1SGQE 3SU5A 2GTBA 2PKAA 3A8CA 3D62A 2BX3A 1J17T 1XUHA 3A7VA 3SU3A 4BOHA 2ZFQH 4GLYA 1B5GH 2GCHF 2ZDMA 2J34A 1VITF 2BDBA 1SGRE 3E90B 1ZRKA 1GHVH 3AAVA 1O3AA 2H9HA 5EW2H 2UUJB 1W0YH 4MTBA 4BAKB 1DLEA 1V2LT 1HRTH 2BD3A 1DDJA 1C1SA 1THRH 5B6OA 2NU1E 5DP4A 2IJOB 2WPHS 1DOJA 2TGDA 3O8BA 1SLXB 2W5EA 3D23A 2XBWA 3NXPA 3DD2H 1TNIA 3BTWE 1ZPCA 4JYUH 4MNVA 1LHFH 3EDXB 3T26A 1CHGA 3SQEE 4X1NU 4NSYA 3B8JA 5CHAB 1OPHB 2Y7ZA 3PB1E 3TGKE 1CHOF 2FDAA 4IC5A 1OXGA 1C5VA 1GI6A 1SOZA 4NIYA 1G2MA 1ZTLA 2ZU4A 1P3CA 3SUDA 2VIPA 4ZH8A 3ZZ7A 3SOSA 1IAUA 2ZEBA 3KN2A 1XM1A 1ANCA 4ABEA 2AMQA 2W7SA 5C1YA 4YT6H 1K1JA 1HJAC 2P3TB 2VH0A 4MNWA 3BEFB 1EXFA 3SJ9A 2YOLA 1GBFA 2XXLA 3K6ZA 3RXKA 2BQ7B 4ZMAH 1UCYH 1V2OT 1NN6A 1Z1JA 4Y11E 1UTQA 2ZGBH 6ESTA 2ZTXA 6GCHF 3AASA 1SQAA 1HAVA 4ZROA 3DT0H 1F5RA 4UFFH 5EPNA 3MNSA 3RU4T 4B71A 3IWMA 2K1QA 2LNCA 1OWJA 3V13A 1TNGA 2FYQA 2HWLB 1F2SE 2D26C 3U9AH 4UONA 2QXGA 3ZV9A 4IMQA 2Q6GA 1BTWA 4OS5A 1HAVB 1E38B 4RKOB 3BTTE 2AMDA 1DANH 2FO9A 4ISIH 2FI4E 2BY7X 1RIWB 4E7RG 3ZVEA 1KLIH 1MD8A 3V3MA 3LGWA 2A5KA 1C1UH 4IGDA 4MPXA 4U32A 3BTGE 1GPZA 2C90B 2ZPRA 2ZFSA 5LPFA 2STAE 4B76A 1C5SA 3FVFB 4TPYA 2XW9A 4AG1A 3LGYA 3MMGA 1AU8A 1TRMA 3S7HB 1EQ9A 4A1VA 2AIQA 2WUBA 5J4QA 2CF8H 1JRTA 3SORA 2G4UA 3UIRA 1C1VH 1NRNH 1ARBA 4DOQA 1AKSB 5G4BA 1TRNA 2W26A 4X2XA 3OU0A 1N1LA 1WSSH 1GVKB 4NGAH 1K28D 1DICA 4ZXXH 1G9IE 4XSKU 2OBOA 5C5NA 1ZJDA 2A31A 1ANBA 2ZGXH 1A4WH 4KTSA 1EJMA 3E3TA 1MQ6A 3U8RH 2GCTC 3KIDU 1MZDA 4AYVB 1O0DH 4THNH 3ZV8A 4F49A 4CH8B 5ETXA 1O5EH 4CRGA 1T8OA 2EC9H 3GYMA 3A87A 4UEHH 1G3CA 5FX5A 1OWKA 3PMBB 1P2OA 2OLGA 1LMWB 3M5NA 1Y59T 2EI7A 4X6PA 1AVXA 1ZLRA 3KNXA 2RA3A 1C5OH 1C5TA 1GMCG 4IC6A 4SGBE 1YPHE 3RXJA 1O3CA 2PUQH 3E0PB 2QA9E 3Q77A 1GGDC 1SG8B 1TALA 5E0JA 1YBWA 1FJSA 3F6UH 3NZIA 1FN8A 1P11E 2XC5A 4GCHG 1O39A 2R0LA 3M3TA 2YNBA 1GI8B 1O3EA 5FCKA 1BBRH 5EQSA 4ZHAA 1EZQA 2FIRH 1ABJH 3R3GB 2GCHG 1V6DA 4JZIA 4MPVA 4UFGH 1C1PA 1VITG 4WWYA 1VGCB 3ZZ4A 2B8OH 1IHSH 1JBUH 2FX6A 4X1QU 4X1SU 1C4V2 3ATMA 3LKWA 1NFXA 1EPTB 2PGBB 4FU8A 2OC7A 1D3PB 3SGAE 1QBVH 2BLOA 2F9VA 4LOYH 3ZVBA 1C2KA 1W11U 1Y5BT 4JZEH 3C27B 5GCHF 2GGVB 3SHAH 4YT7H 1DS2E 2A4QA 2J94A 1P06A 2GMTC 4BANB 2R0KA 3QO6A 3RXOA 1MTWA 1O33A 3TPIZ 5L2YH 1BMMH 1G3EA 1YPHC 2VIWA 1TPAE 4X8TH 4Y0ZE 3GY7A 3UWJH 3TH2H 1AE5A 1EZUC 5JB9S 2GX4A 1TRYA 2WV5A 1YCPK 5F8XA 1V2MT 1H9IE 2C8XB 3A80A 3ZVAA 1SC8U 2FEQH 2R3UA 1HAZB 2A4RA 1FY5A 4R8TB 3SO3A 4D8NA 5HGGA 3FP6E 1HXFH 1SLUB 1JMOH 4ABIA 1G3DA 3Q3YA 3A7XA 1DITH 1W12U 3T2NA 1NRQH 1HAPH 4NA8A 2ANYA 1GDNA 3M35A 1HPGA 1OX1A 2FI3E 3BIVH 3RXEA 2GVFA 4K1SA 1PQ8A 6GCHG 2FTLE 1T4VH 4B1TA 1GHZA 1UVPA 1GBBA 2O8LA 1ZHRA 4IW4E 1C2MA 1A61H 1F0RA 4A6LA 2VGCC 5EXMA 4K3JA 1NM6A 2ODYB 4WMFA 3NK8A 1C2FA 4RN6A 1UTNA 3KL6A 1PPBH 5HM9A 3KQDA 1GVZA 3S7KB 3TVJB 3PM3A 3MH7A 4DY7B 3W95A 4OS4A 1ANEA 5EQQA 5HYOA 1LHEH 1SFQB 5F6MA 3PWBA 1FNIA 2ZDKA 1O3OA 1GCDA 1FIWA 1SHHB 3I78A 4BAHB 8GCHF 3PV4A 3QZRA 3TGJE 1ID5H 4Y6DA 2PWXA 1O2YA 4ZKNU 5T6DA 1SSXA 2BD2A 4AGJA 1O5AB 2QGRA 2G51A 1LHDH 4FUFA 3TJOA 4FUJA 1PYTD 4RKJB 1DWDH 1K1IA 1OP8A 1QIXB 3RXIA 4CR5A 2G8TA 4X0WU 1WTGH 2BM2A 1UHBA 1O5GH 5AVDA 1PFXC 4UDWH 2UUKB 1AGJA 2CV3A 3P8OA 3V0XA 1NU7B 1TX6A 5AF9H 2OINA 2UWPA 4FVDA 5LPRA 1QJ6B 3VPKA 1ETTH 1Z71A 1CVWH 1GJDB 1C5NH 3RXFA 1HJ8A 2UWOA 1EASA 1QRZA 1XKAC 1P04A 2FP7B 3SGQE 1GI5A 1W3CA 2FOBA 1ELDE 1UTLM 1LPZB 1BDAA 3EYDA 2VIDA 2G4TA 5HMAA 3NKKA 1C2IA 2C4FH 1O3DA 1KXBA 2TRMA 3LGIA 3M61U 3BEIB 1O3IA 2Y81A 4KKDA 2NU2E 1QTFA 3P8NA 1V2KT 3BG4C 5FX6A 3RXCA 2P16A 2WUCA 2XNIA 2QXJA 4JYTA 2Z3DA 1VITH 3RLWH 1TBRH 1ZSKA 3VB4A 1DY9A 2QXIA 1L4ZA 3M5OA 1MZAA 1CA0B 1GI7B 1B0EA 1VCWA 1KXCA 2OUAA 5JPMH 1SMFE 3HK6B 3ZZ9A 4AG2A 1S0RA 4INHA 2G52A 2IPHA 4WJG2 3EA7A 3FP8E 5DP3A 4I8HA 4UE7H 1NFYA 2A7HA 3SU1A 1LVBA 2D1JA 2ZHDA 3MH4A 2V35A 2Z9KA 3RXHA 2A5AA 1H4WA 1EZXC 1QL9A 1PPGE 2SGAA 1SQTA 1YF4A 1SGNE 2J9NA 1AB9C 1AIXH 2A45B 1K9OE 1WUNH 2XYAA 5JBTA 2XTTB 1TABE 1O37A 4K5ZA 4IMZA 3B9FH 1O2PA 4XOJA 2BDGA 1GCTB 1GJBB 2Y80A 1QBNA 4JZ1A 1CBWB 1GBIA 1X7AC 3KCGH 1ZPZA 2OBQA 6CHAB 1IQLA 4X2YA 1UCYK 1GHYH 1EAUA 4AN7A 1VJ9U 1GBAA 4AX9H 3GY8A 4YOJA 1K1OA 1BMNH 2F9PA 1KY9A 2ESTE 1AFEH 5TCAA 5A0CA 2FI5E 3VXFH 1K21H 4I31A 4ABDA 5A8ZA 3QTVH 2F83A 4XFQA 4NIWA 1BTHH 4ISOA 1PPHE 3MO9A 1MAXA 4NA7A 3GCTF 1GHWH 3ZYDA 4FU9A 3URDA 4GSOA 3JZ2B 3PO1B 1TOCB 2HLCA 4UD9H 4ZKRU 1WU1A 3ENSB 2FLBH 4Y8YA 1HAXB 2VVVA 3PMHB 3E91A 1HIAA 1XUGA 3D49H 4OS7A 1BRUP 4K8BA 3U8OH 4MVNA 2VJ1A 4XE4A 4Z6AH 1BT7A 1A0HB 4FUIA 2FWWA 3DA9B 3SV8A 4YLQH 4JZFH 1AMHA 4YOIA 3SNDA 1YGCH 3OX7U 1XUJA 1GHAF 1UMAH 1TX8A 2QY0B 2VVUA 3SBKA 1CGJE 3PTBA 1RGQA 2C8ZB 1NS3A 1T8MA 2BDYA 5EU8A 1S0QA 1PPZA 1P3EA 2ALVA 3BTDE 3SU4A 1J8AA 2BXTH 3PLBA 2JETC 2IN2A 2VU8E 1ZR0A 4K60A 5EQRA 1L1NA 1O3LA 1AD8H 1HLTH 4LZ4B 4YM9A 2Q1JA 1GG6C 3SQHE 3RC5A 5HXFA 3BTFE 2P93A 2UUYA 3BTKE 1UK3A 4B2BA 1MKWH 8GCHG 5I25A 1P01A 1UJ1A 4XDEA 1ZJKA 5DO4H 1AWFH 3A89A 4M7GA 3TJNA 2GD4B 1W7GH 2ZIQH 4FUGA 1P0SH 1O2RA 1XUKA 2FOMB 1T7CA 3OY6U 3RXPA 1LHGH 1E35B 1UVOA 3LOXA 3OYPA 3STIA 3ZZAA 1C5PA 1WTHD 4NFEA 1VCPA 1TAWA 3A7WA 4O3UA 1CQQA 5GPIB 4JK5A 2CHAC 1LVMA 3EGKH 3A84A 1K22H 2OC8A 1Z8IB 2BQ6B 2AH4X 4BTTB 3FZZA 2SGFE 5C1XA 4JYVH 3DUXH 2QN5T 2FTMA 1CA8B 1LQEA 5LH8A 4MNYA 1FY4A 1IQGA 1WYKA 5JBAS 3HGPA 1MU6B 5T3HA 1AE8H 2ZGCA 3UOUA 1RXPA 3H7TA 5BRRE 2Y5GA 4HTCH 4WY3A 1BBRK 1D3TB 1OS8A 3Q00A 2ANKH 3MI4A 2SFAA 4BAQB 1SHYA 1BITA 5BPEA 3MO6A 1HYLA 3F9GA 3M3SA 5L2ZH 1LQDB 2CGAA 1A7SA 3VGCB 1O2TA 5T6GA 4B75A 2O8WA 3GOVB 3MNXA 1F0SA 1Y3XA 2TGPZ 2UUFB 1QCPA 1DWCH 1SGFA 3KQEA 5JBCS 1P9UA 1MTNC 4ZHLU 1TBZH 2WPJS 1BHXB 3BTQE 1ELGA 2BD9A 1HCGA 2FMJA 3K65B 3M5LA 2FOCA 5FXLA 1TMBH 3UQOA 1BJUA 1O2KA 1SLVB 5GDSH 1O2ZA 1S5SA 3SNAA 4CH2B 1GI3A 4O3TA 5A8XA 1GMHF 4E05H 1RFNA 3A8DA 3LGTA 5CHAC 2BLWA 3GDSA 4YO9A 1E36B 1TYNA 2V6NA 3A81A 1FIZA 1FZZA 1Z7KA 1FY1A 1AFQC 1ZSJA 3SJOA 2OC1A 4HI3A 1PPCE 1G30B 4GAWA 4Y8ZA 4BNRA 1EAIA 3H5CB 2ZFTA 1SL3A 1C5ZB 1EAXA 1ZRBA 1SGEE 4DCDA 1QR3E 1YLDA 2J4IA 1FMGA 1FPCH 2DE8A 2BD4A 4KP0A 5FBIA 3GDUA 2Z94A 2AGIX 1LKAA 2GP9B 2P8OB 2R2MB 2DE9A 1JWTA 1C1RA 1XVOA 3N7OA 3K9XB 1K1NA 2VIVA 1ZOMA 1IOEA 3CS0A 3PMJA 5GWZA 3A85A 4D9RA 4IS5A 2BDCA 2H5CA 1AKSA 3H7OA 1D3DB 1F7ZA 1GJ8B 3T27A 1C9TA 4Y79A 1Q2WA 4D7FA 3GCTG 1FXYA 3RXUA 2FM2A 2BB4A 1XKBC 1DUEA 1KSNA 3GY5A 5GXPA 1KTSB 1P2MA 4FUDA 1TMUH 5DKMA 1TIOA 3RXRA 2GCTB 1QQ4A 2JH0D 1QB9A 1RIWC 1PQ5A 2W3KA 1V2NT 1ZGVA 1BRCE 4X8VH 3O8CA 4YESB 4E7NA 2NU0E 1PQ7A 3QUMP 1XXFA 1H9LB 1VZQH 2A7JA 4Z0KA 1J16A 2OCVB 4Y71A 4VGCB 3UUZA 4O03A 1BTUA 4X6NA 1NRRH 2WYJA 5DP5A 2A2XH 3LT3A 1O3MA 1KLTA 4Q7XA 1SGCA 5DJ7A 2PHBA 3FP7E 4Y8XA 2TGAA 2P3UB 1K2I1 2Q6DA 1QQUA 3TJUA 1GHBG 2HALA 4IN2A 5CE1A 3UNRA 1FY3A 3GY3A 1W13U 1Z6EA 4U2WA 1GGDB 2WPMS 2Z9LA 3ELAH 1S83A 3UNQA 2IOTA 2J92A 1AI8H 4DIHH 2BLQA 1LPGB 1V2ST 1D4PB 3RM0H 4INKA 1P2NA 1MD7A 1EPTA 2QXHA 1AUTC 4NIXA 2H6MA 1WOFA 2C8YB 1C5XB 3URCA 4H6TA 1ZMJA 1J9CH 3EA8A 4B73A 3MU0A 1W7XH 4H4FA 7ESTE 2Y5FA 5F03A 1ANDA 1HFDA 2G5VA 3VB5A 5IDKA 1TQ0B 3RUOA 1C5UA 3SJKA 1A0JA 2SGDE 5C20A 5LGOA 1GBEA 1FV9A 2QC2A 5AFYH 1A3BH 3U69H 3MHWU 1O3GA 3ODDA 4HFPB 2GMTB 3F9FA 4I8KA 4ESTE 1ZSLA 2AIPA 2ZTZA 1SR5C 1YPGH 3PMAB 9LPRA 4ABGA 3AW1A 2BY8X 1GI9B 1O2NA 4K1TA 2GDDA 3TJVA 3LGVA 2ZF0H 3MU4A 1SGYE 2HOBA 3U1JB 2BX4A 1CHOG 2XC4A 3WY8A 3VB3A 4HGCA 4ZUHA 1WCZA 2VIQA 1YPJH 3GDVA 3SV6A 3T28A 5EGMA 4DT7B 1TB6H 3BF6H 1RTKA 2EI6A 2ZHFH 3P92A 4U30A 4DW2U 3O8DA 1EPTC 1AZZA 3VXEH 2BVRH 3TH3H 4E06H 1ZPBA 3F68H 5J4SA 1E37B 1IQNA 1TA2A 1GL1A 2DUCA 2F9BH 2ZDLA 5E0GA 1PQAA 2VGCB 3GCOA 1FDPA 2THFB 2Y6TA 2FS9A 1JIMA 4MQAA 1GMHG 2PTCE 4QT8C 2P59A 2ZGHA 3BSQA 4K2YA 1ELFA 3BN9A 5E2PA 2FS8A 4UFDH 2QAAA 3TK5A 1A1RA 5CMXH 4LZ1H 4CBOA 1HV7A 3PYHA 1MU8B 1Z1IA 2FLRH 2SNWA 1KXAA 1V2VT 1O5BB 4FUEA 4FUCA 2PFEA 4CHAC 1ZYOA 2ZU1A 4IN1A 3D65E 3P8FA 3JZ1B 1O3KA 1NO9H 2VB0A 3GCHC 1O35A 1TLDA 3RXMA 2H9TH 4HZHA 1G36A 2Z9IA 3SUEA 2PKSB 1C1WH 3ATKA 1CO7E 3M5MA 4WH6A 3TH4H 3SV7A 2A32A 1WBGB 2BDIA 3LC3A 4X6OA 1IQJA 4ISLA 1TGCA 3BEUA 2Z3EA 4JK6A 5PTPA 2BXUH 2FOAA 1VJAU 2BY5X 2P3FH 2FYRA 1D9IA 3LPRA 2ODPA 2D8WA 3K6YA 3IITA 2O8TA 3LU9B 1HXEH 5E2OA 2WPLS 4J1YA 2JH6D 1TA6A 1Y3WA 3C1KA 5E8EH 3S0NA 3BV9B 1M9UA 3SU6A 3MO3A 1RJXB 1SPJA 5TCCA 1QA7A 2EI8A 1ZTJA 3ZVCA 3EE0B 1MKWK 2GV6A 1NTPA 4LK4A 1G32B 1Z8JB 1EOLA 3SU0A 2GT8A 4WMDA 3F1SB 1O2MA 1IQIA 4BAMB 1C4Y2 2AFQB 1NFWA 3G01A 2FOHA 3PROA 1L4DA 1A2CH 1K1PA 3LONA 1DY8A 4AFZA 2FESH 2OXSA 1O3PB 4J2YB 3LIWA 1TGSZ 2TGTA 2OQUA 3QK1A 5FCRA 1P9SA 1C2JA 3SUFA 4TY7A 5C1UA 1T31A 3CENA 2VINA 1TNLA 2YNAA 4NSVA 1W10U 1LTOA 4ZAEA 1NPMA 1P2JA 5EODA 1AVGH 1K1MA 1TNKA 1O2SA 3LC5A 1P2KA 3MU8A 4NA9H 1N6YA 4FUBA 1GMDF 3PLKA 1SVPA 1AB9B 1ELBA 1WQSA 2XWAA 1O30A 4ISHH 4CBNA 1HAYB 3MYWA 2GKVE 4Q2KA 1TNHA 1Y5UT 3SZNA 1C1QA 2J2UA 2ZFFH 4FU7A 2Y5HA 4TY6A 2FZZA 1GJCB 3SNEA 2J38A 3S9AA 1YPMH 1N8OB 1BA8B 4A92A 4AYYB 2TIOA 3A7ZA 1A5HA 1TGTA 3SI3H 1GJ7B 4R0IA 3FAOA 3Q76A 1CA0C 4AFSA 1ZHMA 1NU9A 2BZAA 5EG4A 1QL8A 3RMOH 2HPPH 1QRWA 3E0NB 1NFUA 3ZYEA 1O2QA 2H9EH 3EAJA 2Z6BD 4FUHA 1DSTA 5GCHG 3A7YA 3SW2B 1GBHA 1GBDA 4WXVA 1O32A 1S6FA 2ILNA 5A2MH 1CT0E 3LH1A 5K0HA 3EA9A 2Z9JA 1EZSC 1G2LA 2HGTH 2ZDNA 1T8NA 1CT4E 1O2LA 2V3OH 4K69A 1SBWA 4UFEH 2OTVA 1K1LA 1EKBB 1EUFA 1ZZZA 2C3SA 2J95A 3IG6B 4WH8A 3O8RA 1SQOA 2ZA5A 2RDLA 1BTZA 1BTYA 1Z8RA 1GDUA 2P94A 5DPAA 2ZDAH 2XBYA 1WV7H 1XXDA 3HKJB 1NESE 4CREA 4CR9A 1BRAA 1O2HA 1ETRH 2QCYA 1EJAA 4ZHMU 2AS9A 4Y7BA 2F91A 4X8UH 3M3VA 1GCTC 1ABIH 3S9CA 4KELA 1C9PA 1CBWC 3QTOH 1BIOA 4GUXA 4A5TS 1XVMA 1DUAA 2FOFA 3TNSA 1BTPA 2ZKSA 3SJ8A 3UNSA 1MBMA 5A09A 3P6ZB 4NZQA 1O3FA 2PTNA 2ZO3H 3NUMA 1GBLA 5F8ZA 3TK9A 1VR1H 4CRFA 3ITIA 3ZZBA 2JETB 4OS6A 3VEQB 2FX4A 1F5KU 2RCEA 4TPIZ 1O2UA 1ACBE 1SGIB 2M5TA 1C5WB 7GCHF 1MTUA 3SI4H 1MBQA 1S84A 1GJ4H 1LPKB 3HATH 2ZPSA 2XWBI 4DJZB 3LJJA 2HNTC 1DXPA 3P70B 2GDEH 1J15A 1O2IA 3A82A 1MMJN 3SNBA 1VCQA 4D7GA 4NZLA 4MPUA 1TGBA 1MQ5A 5L30H 2KAIB 2OQ5A 2QIQA 1RTLA 4FVBA 3PLPA 5LPEA 5SGAE 3VFEA 2Z3CA 3LGUA 1P2QA 1WQVH 1HBTH 2A5IA 3V7TA 2XCNA 2B7DH 3OTJE 4H6SB 1TOMH 1FAXA 1EX3A 1GMCF 1DE7H 1LHCH 1PJPA 1DFPA 3ODFA 3W94A 5FPSA 2ZHEH 1S85A 2WINI 1SB1H 1ELTA 4NIVA 3UQVA 1GBTA 1SGFG 2JH5D 1UTPA 1AVWA 2F9OA 1TFXA 1Y8TA 3RC6A 2PR3A 2BZ6H 2G81E 1ETSH 3MNBA 5C67A 2W3IA 2Q6FA 3BTME 4NCYA 4ZXYH 1AHTH 1C2LA 2ANWA 2FOGA 1IHTH 1KIGH 3T62A 1GBJA 1Y3VA 1PPEE 1O3NA 4MG3A 2ZP0H 1P02A 1O2JA 1BUIA 4I8LA 1INCA 1MTNB 3R0FA 1L1GA 1ESBA 1TONA 2PKAB 3UREA 1GJ5H 1QJ7B 3UFAA 1HAGE 1QHRB 2BOKA 2ZC9H 1TNJA 3TK6A 1HJAB 2WPKS 5C5OA 2Z7FE 1LCYA 2AYWA 3SHCH 1A5GH 1QB6A 1KXEA 1MCTA 2V3HH 2ZHWH 1O3BA 3DHKH 3TU7H 1RD3B 1NY22 2WV4A 4WF8A 1MTSA 1BOQA 1T4UH 1BCUH 1GMDG 1OSSA 1SGPE 1Z8GA 2VH6A 5DP9A 1L2EA 3SUGA 2PW8H 1XUIA 1BRBE 3VB7A 4FXGH 3UY9A 4ABJA 2VNTA 1AFQB 1O2GH 1UVTH 1C2EA 4KGAA 4DGJA 1THSH 2A2QH 3MFJA 3VB6A 1UVSH 2SGEE 3TITA 1O31A 3PTNA 1MUEB 1DX5M 4AB9A 1TMTH 2ZFPH 2ZG0H 1MKXK 3BTHE 3VGCC 1TQ7B 3FANA 3QWCH 2AGGX 3I77A 1OP2A 1LDTT 3RXQA 1DWEH 1QL7A 1BBRE 3HK3B 2BQWB 1JIRA 1P09A 1HAOH 3MTYA 2H2ZA 1FI8A 3KF2A 5H4IB 2R2WU 2PSXA 3BTEE 4AFUA 1RS0A 2ZU2A 2VWNA 3I29A 2ZCKP 4H42U 1BJVA 3AAUA 3LH3A 1L1JA 5EXLA 2CJIA 3F9EA 1GBKA 4BAOB 2SNVA 1W2KH 1O36A 4ABAA 4TWYA 2ZNKH 4AOQA 1YLCA 1CT2E 1H8IH 1QBOA 5DK1A 4AORA 1MCVA 1SOTA 2F9UA 2PV9B 1FUJA 1ZTKA 1OKXA 1T8LA 1GI2A 3BG8A 3SN8A 1FY8E 1AZ8A 1BQYA 4A1TA 1EB1H 4AGKA 4A1XA 3F9HA 1NRPH 4NWLA 1V2PT 2W7UA 1T32A 2P8OC 1P2IA 4K8YA 1SFIA 3RXGA 2VIOA 4KTUA 1ZGIA 1LVOA 1TX7A
chains in the Genus database with same CATH superfamily
3AVZA 5L6NH 4D76A 5JDUB 2ZI2H 1QB1A 1C1MA 4D9QA 1GHAG 2AERH 1ZMNA 1GWAA 1G37A 5K7RA 2J5UA 4BXWA 1FPHH 2BYAX 1C5YB 2IPQX 7GCHG 1V2UT 2BHGA 1KTTB 4CRDA 3MQKC 2C8WB 1DLKB 1CE5A 3MH6A 3AW0A 2ZPQA 5GIBA 2F3CE 1ARCA 2BY6X 3TIUA 2NWNA 5DG6A 2CMYA 4WVPE 1QRXA 3L3TA 3MOCA 4AZ2B 1HDTH 1P03A 5IYTA 2OD3B 4ABHA 1AO5A 1OOKB 2BDHA 1ORFA 1Q3XA 1E0FD 1NROH 4DG4A 1W0KD 1GJ6A 3ZZ5A 1NZQH 1S81A 1P10A 4Q7ZA 1V2QT 5FHTA 2A1DB 4XD7D 3U1IB 1LKBA 3KGPA 1DT2A 3T29A 5TJXA 2XC0A 1UTOA 2ASUB 3PWCA 4VGCC 3ZZCA 3A88A 4OS1A 1O5DH 1YC0A 4BXSA 1E1RD 1C1OA 1OWEA 1V2WT 3UR9A 4DIIH 1JOUB 5E0HA 3Q3XA 1ELCA 3F2FA 1OWIA 3CP7A 2HNTF 3M37A 1WAYB 3A8AA 3ATWA 1V2JT 4WMEA 5EW1H 1NC6A 3RC4A 1P8VC 4I8JA 7LPRA 3M36A 1Z6JH 3GY6A 2H1UA 3RXSA 4GHQA 3E6PH 3MNCA 2F43B 2RG3A 5C94A 1QURH 4O9VA 1C5LH 3RXAA 2G00A 2SGQE 1DXWA 1HB0B 1GHXH 1O3HA 1H1BA 1ELAA 1NRSH 1C2DA 4X1PU 1EAWA 3SU2A 4B2AA 1O38A 3ZZ8A 2ZFRH 1FQ3A 5EOKA 2GZ7A 2V0BA 2BVXH 3ESTA 5A8YA 2P95A 4X2WA 4NFFA 9ESTA 1BTXA 1UTKA 2BTCE 1ZHPA 1TBQH 5JYIA 1YPEH 1VGCC 3RMNH 1MKXH 5GJ4B 1JRSA 4O97A 1D6RA 4TWWA 1UK4A 1EP6A 1OP0A 1BMAA 1A0LA 1H9HE 1MH0A 3A8BA 1YYY1 3LJOA 2WPIS 3STJA 1W0ZU 1XUFA 4I86A 2FODA 3NWUA 2OP9A 1C2GA 1C5MD 5ESTE 2EA3A 2M2AA 2ZQ1A 2JKHA 3A83A 1KYNA 1UTMA 2CF9H 4I33A 3RMLH 1ESAA 2XBXA 2ZDVH 4CHAB 3EQ0H 2BLVA 2ZTYA 4IBLH 1O2XA 4CRBA 1L0ZA 3HKIB 1QJ1B 4K1EA 1U6QA 1C2HA 3KYFA 2I6QA 2ULLA 3HPTB 4YOGA 3E1XB 1GBCA 1IQHA 2Y7XA 3GCHB 1C5RA 3P95A 1P05A 2NU3E 1TGNA 1F5LA 3M7UA 1OYQA 3MH5A 4RT0A 1TPOA 3QX5H 4Q7YA 1TWXB 4OS2A 2GV7A 4XBDA 1QY6A 2W6JD 4JZDH 1O5CB 3KHVA 2ZCLP 4JCNA 1IQKA 1OWHA 4A7IB 1BMLA 3N7EA 4XBBA 2WV9A 2ZGJA 4SGAE 2XCFA 1GJ9B 2A4OA 3ZVGA 2PGQB 1O34A 1OHHD 2B5TB 2EEKA 3E8LA 3NPSA 3RXLA 1UTJA 2BD5A 2GZ8A 3GY2A 2KCYA 1S82A 2QV1A 1IQEA 1UK2A 5EXNA 1ELVA 2AGEX 3GICB 1DM4B 3ZVDA 3L33A 1IQFA 1W8BH 1C5QA 4I8GA 4CRAA 5T6FA 1BHXF 2BDAA 1GJAB 1PYTC 3QGJA 5A0BA 3BIUH 1BB0B 1E34B 2VWOA 2LPRA 2KCPA 1LVYA 1CSOE 2STBE 3MU1A 2AEIH 2ZHQH 1OWDA 3TNTA 3ZZDA 3TLOA 3M7QA 3S69A 4BTUB 1IQMA 2XRCA 4GHTA 2BVSH 2XOKD 1F0UA 4GPGA 2BD8A 2O8UA 3FN8A 4TYDA 4ASHA 3S9BA 2PKSC 3TGIE 1THPB 1DPOA 1RRKA 1O2OA 2FPZA 4DVAU 1YKTA 3SJIA 5I46H 2VWLA 1B7XB 3UWIA 2R9PA 4PROA 1EATA 1TPPA 1Y3YA 2UWLA 3BG4B 1KDQA 2EQNA 4XBCA 1GBMA 4MLFB 4YLUA 2F9NA 1AWHB 5DP8A 3M7TA 1A3EH 3K2UA 4ABBA 5EPYA 2G55A 3A86A 1SGDE 3ZZ3A 1CU1A 1SGTA 1RTFB 8KME2 2TPIZ 1UHBB 1SI5H 3KQCA 4OGYA 1OYTH 3E16B 2BD7A 2Z9GA 1A5IA 1J14A 2I6SA 2ZQ2A 1A46H 1KDQB 1TPSA 1EJNA 5FPTA 1D6WA 2GT7A 4GVUA 1Y5AT 1F92A 4ABFA 3WWBA 4B6FA 1LO6A 1XX9A 1D3QB 4Q80A 4ISNA 4CRCA 1HJ9A 4MDSA 1S6HA 2FOEA 2PLXA 2HVXA 5AHGH 1P12E 1GVLA 3P17H 4ZKOU 1KLJH 4JMYA 2B9LA 1NT1A 3UTUH 4KTCA 3RDZA 1EP5A 2WHXA 2R3YA 1QGFA 1H8DH 3V12A 1HUTH 3ZZ6A 3Q3KA 1N6XA 5A0AE 5DP6A 3QZQA 1GI1A 1MTVA 5JBBS 1GDQA 3RXVA 1FONA 1YCPM 1P57B 3T25A 3MU5A 1PPFE 2HPQH 1FLEE 4DURA 1HAIH 2ZCHP 1CGHA 5FPYA 4Y7AA 4ZKSU 2Y82A 4WXIA 1HNEE 3LDXH 3RXDA 5F8TA 3GISB 2PSYA 3RXTA 3OY5U 2VVCA 3GYLB 2O9QA 3GY4A 2BY9X 3GCNA 1FAKH 4BTIB 4MPWA 2AMPA 3HGNA 3RU4E 1GI4A 1Q31A 1YCPH 2CN0H 4Y0YE 5ABWA 1ZMLA 3ATLA 1MAYA 2RA0A 3UOPA 3RMMH 1DVAH 4X6MA 2WYGA 5ESBA 3FFGA 2HNTE 2QF0A 1N8OC 1Y3UA 4X8SH 3KEEA 4LXBH 3OSYA 1YM0A 1TE0A 1UO6A 3MWIU 6LPRA 2ZU5A 2ANMH 1G3BA 1O5FH 1B0FA 3L6PA 3RP2A 4Y10E 1SLWB 3F0PA 2ZECA 6CHAC 4MNXA 2CXVA 1S6LA 5FBEA 2J98B 2A0QB 3FZDA 3RLYH 1GL0E 3U8TH 3OAAD 2OC0A 4B74A 3QDZB 1V2RT 1YP9A 2H5DA 4AB8A 3P8GA 2PUXB 8ESTE 1GI0A 4F4OC 2CK3D 1AY6H 2A4GA 1KXFA 1YPKH 1YPLH 1DSUA 3KQBA 3DFLA 2A7CA 2C93B 2FXRA 4NWKA 1KXDA 1QA0A 1GG6B 2G5NA 8LPRA 1UCYE 1C1NA 1FN6A 1UVUH 3PRBA 7KMEH 4X2VA 3SNCA 3QN7A 3PO1C 2KAIA 5C3NA 2HRVA 5AFZH 3RU4D 2BOHB 5DP7A 3DFJA 5FAHA 1HGTH 1NBME 3EE7A 3UR6A 1XMNB 5HM2A 4OGXA 1ESTA 1AQ7A 2SGPE 2GZ9A 1V3XA 2NU4E 4YZUA 3ZVFA 1HIAB 3RM2H 1QNJA 4AFQA 1V2TT 1O2VA 1O3JA 4F48B 1QFKH 2BMGB 1ELEE 1O2WA 3QLPH 2B0FA 4I32A 1C4U2 4I7YH 2QYIA 2CHAB 1EOJA 3U98H 2ODQA 1GHBF 1EB2A 3ZIAD 3QGNB 5JB8S 3CS7A 1W14U 3UPEA 4DT4A 1JXPA 4YTAA 2VWMA 1DWBH 4B2CA 1AUJA 2KCOA 3SV9A 3RXBA 1F0TA 3T5FH 3A7TA 4Y76A 4U01A 3ATIA 4X1RU 1HAHH 2ZZUH 5C2ZA 2D2DA 2QF3A 3B23B 3OEHD 3NCLA 3SGBE 2ALPA 5DGJA 1AN1E 4NG9H 2XBVA 1BZXE 3SV2H 2TBSA 2ZU3A 1CGIE 1C1TA 2ZWLH 2O8MA 4AC9A 4INLA 4GCHF 4RSPA 1SGQE 4ACAA 2VBCA 3SU5A 2GTBA 1E79D 2PKAA 3A8CA 3D62A 2BX3A 1J17T 1XUHA 3A7VA 3SU3A 4BOHA 2ZFQH 4GLYA 1B5GH 2GCHF 2ZDMA 2J34A 1VITF 2BDBA 1SGRE 2K8IA 1ZRKA 3E90B 1GHVH 3AAVA 1O3AA 2H9HA 5EW2H 2UUJB 1W0YH 4MTBA 4BAKB 1DLEA 1V2LT 1HRTH 2BD3A 1DDJA 1C1SA 1THRH 3DSOA 1NBMD 5B6OA 2NU1E 5DP4A 2IJOB 2WPHS 1DOJA 3FKSD 2TGDA 3O8BA 1SLXB 2W5EA 3CNRA 3D23A 2XBWA 3NXPA 3DD2H 1TNIA 3BTWE 1ZPCA 4JYUH 4MNVA 1LHFH 3EDXB 3T26A 1CHGA 3SQEE 4X1NU 4NSYA 3B8JA 5CHAB 1OPHB 2Y7ZA 3PB1E 3TGKE 1CHOF 2FDAA 4IC5A 1OXGA 1C5VA 1GI6A 1SOZA 4NIYA 5C17A 1G2MA 1ZTLA 2ZU4A 1P3CA 3SUDA 2VIPA 4ZH8A 3ZZ7A 3SOSA 1IAUA 2ZEBA 3KN2A 1XM1A 1ANCA 4ABEA 2AMQA 2W7SA 5C1YA 4YT6H 1K1JA 1HJAC 2P3TB 2VH0A 4MNWA 3BEFB 1EXFA 3SJ9A 2YOLA 1GBFA 2XXLA 3K6ZA 3RXKA 2BQ7B 4ZMAH 1UCYH 1V2OT 1NN6A 1K0HA 5EJZA 1Z1JA 4Y11E 1UTQA 2ZGBH 6ESTA 2ZTXA 6GCHF 3AASA 1SQAA 1HAVA 4ZROA 3DT0H 1F5RA 4UFFH 5EPNA 3MNSA 3RU4T 4B71A 4HG6A 3IWMA 2KZ4A 2K1QA 2LNCA 5HKKD 1OWJA 3V13A 1TNGA 2FYQA 2HWLB 1F2SE 2D26C 3U9AH 4UONA 2QXGA 3ZV9A 4FOUC 4IMQA 2Q6GA 1BTWA 4OS5A 1HAVB 1E38B 4RKOB 3BTTE 2AMDA 1DANH 2FO9A 4ISIH 2FI4E 2BY7X 1RIWB 4E7RG 3ZVEA 1KLIH 1MD8A 3V3MA 3LGWA 2A5KA 1C1UH 4IGDA 4MPXA 4U32A 3BTGE 1GPZA 2C90B 2ZPRA 2JIZD 2ZFSA 5LPFA 2STAE 4B76A 1C5SA 3FVFB 4TPYA 1QZ8A 2XW9A 4AG1A 4Z1MD 3LGYA 3F2GA 3MMGA 1AU8A 2W6ID 1TRMA 3N99A 3S7HB 1EQ9A 4A1VA 2AIQA 2WUBA 5J4QA 2CF8H 1JRTA 3SORA 2G4UA 3UIRA 1C1VH 1NRNH 1ARBA 4DOQA 3KQ5A 1AKSB 5G4BA 1TRNA 2W26A 4X2XA 3OU0A 1N1LA 1WSSH 1GVKB 4NGAH 1K28D 1DICA 4ZXXH 1G9IE 4XSKU 2OBOA 5C5NA 1ZJDA 2A31A 1ANBA 2ZGXH 1A4WH 4KTSA 1EJMA 3E3TA 1MQ6A 5HIYA 3U8RH 2GCTC 3KIDU 1MZDA 4AYVB 1O0DH 4THNH 3ZV8A 4F49A 4CH8B 5ETXA 1O5EH 4CRGA 3DCLA 1T8OA 2EC9H 3GYMA 3A87A 4UEHH 1G3CA 5FX5A 1OWKA 3PMBB 1P2OA 2OLGA 1LMWB 3M5NA 1Y59T 2EI7A 4X6PA 2QF4A 1AVXA 1ZLRA 3KNXA 2RA3A 1C5OH 1C5TA 1GMCG 4IC6A 4SGBE 4TT3D 1YPHE 3RXJA 1O3CA 2PUQH 3E0PB 5KEDA 2QA9E 3Q77A 1GGDC 1WXRA 1SG8B 1TALA 5E0JA 1YBWA 1FJSA 3F6UH 3NZIA 1FN8A 5EJLA 1P11E 2XC5A 2HLDD 4GCHG 1O39A 2R0LA 3M3TA 2YNBA 1GI8B 1O3EA 5FCKA 1BBRH 5EQSA 4ZHAA 1EZQA 2FIRH 1ABJH 2JDID 3R3GB 2GCHG 1V6DA 4JZIA 4MPVA 4UFGH 1C1PA 1VITG 4WWYA 1VGCB 3ZZ4A 2B8OH 1IHSH 1JBUH 2FX6A 4X1QU 4X1SU 1C4V2 3ATMA 3LKWA 1NFXA 1EPTB 2PGBB 5F53A 4FU8A 2OC7A 1D3PB 3SGAE 3FOAA 1QBVH 2BLOA 2F9VA 4LOYH 3ZVBA 1C2KA 1W11U 1Y5BT 4JZEH 3C27B 5GCHF 2GGVB 2WPDD 3SHAH 4YT7H 1DS2E 2A4QA 2J94A 1P06A 2GMTC 4BANB 2R0KA 3QO6A 3RXOA 1MTWA 1O33A 3TPIZ 5L2YH 1BMMH 1G3EA 1YPHC 2VIWA 1TPAE 4X8TH 4Y0ZE 3GY7A 3UWJH 3TH2H 1AE5A 2PP6A 1EZUC 1YLNA 5JB9S 2GX4A 1TRYA 2WV5A 1YCPK 5F8XA 1V2MT 1H9IE 2C8XB 3A80A 3ZVAA 1SC8U 2FEQH 2R3UA 1HAZB 2A4RA 1FY5A 4R8TB 3SO3A 4D8NA 5HGGA 3FP6E 1HXFH 1SLUB 1JMOH 4ABIA 1G3DA 3Q3YA 3A7XA 1DITH 1W12U 3T2NA 1NRQH 1HAPH 4NA8A 2ANYA 1GDNA 3M35A 1HPGA 1OX1A 2FI3E 3BIVH 3RXEA 2GVFA 4K1SA 1PQ8A 6GCHG 2FTLE 1T4VH 4B1TA 1GHZA 1UVPA 1GBBA 2KCAA 2O8LA 1ZHRA 4IW4E 1C2MA 1A61H 1F0RA 4A6LA 2VGCC 5EXMA 4K3JA 1NM6A 2ODYB 4WMFA 3NK8A 1C2FA 4RN6A 1UTNA 3KL6A 1PPBH 5HM9A 3KQDA 1GVZA 3S7KB 3TVJB 3PM3A 3MH7A 4DY7B 3W95A 4OS4A 4ZCNA 1ANEA 5EQQA 4P00A 5HYOA 1LHEH 1SFQB 5F6MA 3PWBA 1FNIA 2ZDKA 1O3OA 1GCDA 1FIWA 1SHHB 3I78A 4BAHB 8GCHF 3PV4A 3QZRA 3TGJE 1ID5H 4Y6DA 2PWXA 4ACBA 1O2YA 4ZKNU 5T6DA 1SSXA 2BD2A 4AGJA 1O5AB 2QGRA 2G51A 1LHDH 4FUFA 2F4LA 3TJOA 4FUJA 1PYTD 4RKJB 1DWDH 1K1IA 1OP8A 1QIXB 3RXIA 4CR5A 2G8TA 4X0WU 1WTGH 2BM2A 1UHBA 1O5GH 2J97A 1PFXC 5AVDA 4UDWH 2UUKB 1AGJA 2CV3A 3P8OA 3V0XA 1NU7B 1TX6A 5AF9H 2OINA 2UWPA 4FVDA 5LPRA 4OM9A 1QJ6B 3VPKA 1ETTH 2QF5A 1Z71A 1CVWH 1GJDB 1C5NH 3RXFA 1HJ8A 2UWOA 1EASA 1QRZA 1XKAC 1P04A 2FP7B 3SGQE 1GI5A 2IJD1 1W3CA 2FOBA 1ELDE 1UTLM 1LPZB 1BDAA 3EYDA 2VIDA 2G4TA 5HMAA 3NKKA 1C2IA 2C4FH 1O3DA 1KXBA 2TRMA 3LGIA 3M61U 3BEIB 1O3IA 2Y81A 4KKDA 2NU2E 1QTFA 3P8NA 1V2KT 3BG4C 5FX6A 3RXCA 2P16A 2WUCA 2XNIA 2QXJA 1EFRD 4JYTA 3OTPA 2Z3DA 1VITH 3RLWH 1TBRH 1ZSKA 3VB4A 1DY9A 2QXIA 1L4ZA 3M5OA 1MZAA 1CA0B 1GI7B 1VKYA 1B0EA 1VCWA 1KXCA 2OUAA 5JPMH 1SMFE 3HK6B 3ZZ9A 4AG2A 1S0RA 4INHA 2G52A 2IPHA 4WJG2 3EA7A 3W1EA 3FP8E 5DP3A 2RDEA 4I8HA 4UE7H 1NFYA 2A7HA 2K0QA 1LVBA 3SU1A 2D1JA 2ZHDA 3MH4A 2V35A 2Z9KA 5C0TA 3RXHA 2A5AA 1H4WA 1EZXC 1QL9A 1PPGE 2SGAA 1SQTA 1YF4A 1SGNE 2J9NA 1AB9C 1AIXH 2A45B 1K9OE 2EY4C 3VG8A 1WUNH 2XYAA 3UAIC 5JBTA 2XTTB 1TABE 1O37A 4K5ZA 4IMZA 3B9FH 1O2PA 2L74A 3WW7A 4XOJA 2BDGA 1GCTB 1GJBB 2Y80A 1QBNA 3DSPA 4JZ1A 1CBWB 1GBIA 1X7AC 2WSSD 2J98A 3KCGH 1ZPZA 2OBQA 6CHAB 1IQLA 4X2YA 5C0UA 1UCYK 1GHYH 1EAUA 4AN7A 1VJ9U 1GBAA 4AX9H 3GY8A 4YOJA 1K1OA 1BMNH 2F9PA 1KY9A 2ESTE 1AFEH 5TCAA 5A0CA 2FI5E 3VXFH 1K21H 4I31A 4ABDA 5A8ZA 3QTVH 2F83A 4XFQA 4NIWA 1BTHH 4ISOA 1PPHE 3MO9A 1MAXA 4NA7A 3GCTF 1GHWH 3ZYDA 4FU9A 3URDA 2XNDD 4GSOA 3JZ2B 3PO1B 1TOCB 2HLCA 4UD9H 4ZKRU 1WU1A 3ENSB 2FLBH 4Y8YA 1HAXB 2VVVA 3PMHB 3E91A 1HIAA 1XUGA 3D49H 4OS7A 1BRUP 4K8BA 3U8OH 4MVNA 2VJ1A 4XE4A 4Z6AH 1BT7A 1A0HB 3F3BA 4FUIA 2FWWA 3DA9B 3SV8A 4M9FA 4YLQH 4JZFH 1AMHA 4YOIA 3SNDA 1YGCH 3OX7U 1XUJA 1GHAF 1UMAH 1TX8A 2QY0B 2VVUA 3SBKA 1CGJE 3PTBA 1RGQA 2C8ZB 1NS3A 1T8MA 2BDYA 5EU8A 1S0QA 1PPZA 1P3EA 2ALVA 3BTDE 3SU4A 3NRLA 1J8AA 2BXTH 3PLBA 2JETC 2IN2A 2VU8E 1ZR0A 4K60A 5EQRA 1L1NA 1O3LA 1AD8H 5KECA 3OE7D 1HLTH 4LZ4B 4YM9A 2Q1JA 1GG6C 3SQHE 3RC5A 5HXFA 3SYJA 3BTFE 2P93A 2UUYA 3BTKE 1UK3A 4B2BA 1MKWH 8GCHG 5I25A 1P01A 1UJ1A 4XDEA 1ZJKA 5DO4H 1AWFH 3A89A 4M7GA 3TJNA 2GD4B 1W7GH 2ZIQH 4FUGA 1P0SH 1YWUA 1O2RA 1XUKA 2FOMB 1T7CA 3OY6U 3RXPA 1LHGH 1E35B 1UVOA 3LOXA 3OYPA 3STIA 3ZZAA 1C5PA 1WTHD 4NFEA 1VCPA 1TAWA 3A7WA 4O3UA 1CQQA 5GPIB 4JK5A 2CHAC 1LVMA 3EGKH 3A84A 1K22H 2V3MA 2OC8A 1Z8IB 2BQ6B 2AH4X 4BTTB 3FZZA 2SGFE 5C1XA 4JYVH 3DUXH 5EJ1A 2QN5T 2FTMA 1CA8B 1LQEA 5LH8A 4MNYA 1FY4A 1IQGA 1WYKA 5JBAS 3HGPA 1MU6B 5T3HA 1AE8H 2ZGCA 3UOUA 1RXPA 3H7TA 5BRRE 2Y5GA 4HTCH 4WY3A 1BBRK 1D3TB 2RFKC 1OS8A 3Q00A 2ANKH 3MI4A 2SFAA 4BAQB 1SHYA 1BITA 5BPEA 3MO6A 1HYLA 3F9GA 3M3SA 5L2ZH 1LQDB 2CGAA 1A7SA 3VGCB 1O2TA 5T6GA 4B75A 2O8WA 3GOVB 3MNXA 1F0SA 1Y3XA 2TGPZ 2UUFB 1QCPA 1DWCH 1SGFA 3KQEA 5JBCS 1P9UA 1MTNC 4ZHLU 1TBZH 2WPJS 1BHXB 3BTQE 1ELGA 2BD9A 1HCGA 2FMJA 3K65B 3M5LA 2FOCA 5FXLA 1TMBH 3UQOA 1BJUA 1O2KA 1SLVB 5GDSH 1O2ZA 1S5SA 3SNAA 4CH2B 5DN6D 1GI3A 4O3TA 5A8XA 1GMHF 4E05H 1RFNA 3A8DA 3LGTA 5CHAC 2BLWA 3GDSA 4YO9A 1E36B 1TYNA 2V6NA 3A81A 1FIZA 1FZZA 1Z7KA 1FY1A 1AFQC 1ZSJA 3SJOA 2OC1A 4HI3A 1PPCE 1G30B 4GAWA 4Y8ZA 4BNRA 1EAIA 3H5CB 2ZFTA 1SL3A 1C5ZB 1EAXA 1ZRBA 1SGEE 4DCDA 1QR3E 1YLDA 2J4IA 5IK2D 1FMGA 1FPCH 2DE8A 2BD4A 4KP0A 5FBIA 5GNDA 3GDUA 2Z94A 2AGIX 1LKAA 2GP9B 2P8OB 3F0OA 2R2MB 2DE9A 1JWTA 2HVYB 1C1RA 1XVOA 3N7OA 3K9XB 1K1NA 2VIVA 1ZOMA 1IOEA 4RI0A 1H8ED 3CS0A 3N7DA 3PMJA 5GWZA 3A85A 4D9RA 4IS5A 2BDCA 2H5CA 1AKSA 3H7OA 1D3DB 1F7ZA 1GJ8B 3T27A 1C9TA 4Y79A 1Q2WA 4D7FA 3GCTG 1FXYA 3RXUA 2FM2A 2BB4A 1XKBC 1DUEA 1KSNA 3GY5A 5GXPA 1KTSB 1FX0B 4XRNA 4F55A 1P2MA 4FUDA 1TMUH 4Q4LA 5DKMA 1TIOA 3RXRA 2GCTB 2JH0D 1MABB 1QQ4A 1QB9A 1RIWC 1PQ5A 2YMSC 2W3KA 1V2NT 1ZGVA 1BRCE 4X8VH 3O8CA 4YESB 4E7NA 2NU0E 1PQ7A 2JJ2D 3QUMP 1XXFA 1H9LB 2YMSD 1VZQH 5T1VA 2A7JA 4Z0KA 1J16A 2OCVB 4Y71A 4VGCB 3UUZA 4O03A 1BTUA 4X6NA 1NRRH 2WYJA 1UW7A 5DP5A 2A2XH 1YY3A 3LT3A 1O3MA 1KLTA 4Q7XA 1SGCA 5DJ7A 2PHBA 3FP7E 4Y8XA 2TGAA 2P3UB 1K2I1 2Q6DA 2KR7A 1QQUA 3TJUA 1GHBG 2HALA 4IN2A 5CE1A 3UNRA 1FY3A 3GY3A 1W13U 1Z6EA 4U2WA 1GGDB 2WPMS 2Z9LA 3ELAH 1S83A 3UNQA 2IOTA 2J92A 1AI8H 4DIHH 2BLQA 1LPGB 1V2ST 1D4PB 1H8HD 3RM0H 4INKA 1P2NA 1MD7A 1EPTA 2QXHA 1AUTC 4NIXA 2H6MA 1WOFA 2C8YB 1C5XB 3URCA 4H6TA 1ZMJA 1J9CH 3EA8A 4B73A 3MU0A 1W7XH 4H4FA 3H09A 7ESTE 2Y5FA 5F03A 1ANDA 1HFDA 2G5VA 3VB5A 4ASUD 5IDKA 1TQ0B 3RUOA 1C5UA 3SJKA 1A0JA 2SGDE 5C20A 5LGOA 3OEED 1GBEA 1FV9A 2QC2A 3F2HA 2KFWA 1A3BH 5AFYH 3U69H 3MHWU 1O3GA 3ODDA 4HFPB 2GMTB 3F9FA 4I8KA 4ESTE 1ZSLA 2AIPA 2ZTZA 1SR5C 1YPGH 3PMAB 9LPRA 4ABGA 3AW1A 2BY8X 1GI9B 1O2NA 4K1TA 2GDDA 3TJVA 3LGVA 2ZF0H 3MU4A 1SGYE 2HOBA 3U1JB 2BX4A 1CHOG 2XC4A 3WY8A 3VB3A 4HGCA 4ZUHA 1WCZA 2VIQA 1YPJH 3GDVA 3SV6A 2V7QD 5EGMA 3T28A 4DT7B 1TB6H 3BF6H 1RTKA 2EI6A 2ZHFH 3P92A 4U30A 4DW2U 3O8DA 1EPTC 1AZZA 3VXEH 1SKYE 2BVRH 3TH3H 4E06H 5EIYA 1ZPBA 3F68H 5J4SA 2JJ1D 1E37B 1IQNA 1TA2A 1GL1A 2DUCA 2F9BH 2ZDLA 5E0GA 1PQAA 2VGCB 3GCOA 1FDPA 2THFB 2Y6TA 2FS9A 1JIMA 4MQAA 1GMHG 2PTCE 4QT8C 2P59A 2ZGHA 3BSQA 4K2YA 1ELFA 3BN9A 5E2PA 2FS8A 4UFDH 2QAAA 3TK5A 1A1RA 5CMXH 4LZ1H 4CBOA 1HV7A 3PYHA 1MU8B 1Z1IA 2FLRH 2SNWA 1KXAA 1V2VT 1O5BB 4FUEA 2OK5A 4FUCA 2PFEA 4CHAC 1ZYOA 2ZU1A 4IN1A 3D65E 3P8FA 3JZ1B 1O3KA 1NO9H 3PV2A 2VB0A 3GCHC 1O35A 1TLDA 3FO8D 1E1QD 3RXMA 2H9TH 4HZHA 1G36A 2Z9IA 3SUEA 2PKSB 1C1WH 3ATKA 1CO7E 3M5MA 4WH6A 3TH4H 3SV7A 2A32A 1WBGB 2BDIA 3LC3A 4X6OA 5DSFA 5HIZA 1IQJA 4ISLA 1TGCA 3BEUA 2Z3EA 4JK6A 5PTPA 2BXUH 2FOAA 1VJAU 2BY5X 2P3FH 2FYRA 4TSFD 1D9IA 3LPRA 2ODPA 2D8WA 3K6YA 3IITA 2O8TA 3LU9B 1HXEH 5E2OA 3KYGA 2WPLS 4J1YA 2JH6D 1TA6A 1Y3WA 3C1KA 5E8EH 3S0NA 3BV9B 1M9UA 3SU6A 1COWD 1RJXB 1SPJA 3MO3A 5TCCA 1QA7A 2EI8A 1ZTJA 3ZVCA 3EE0B 1MKWK 2GV6A 1NTPA 4LK4A 1G32B 1Z8JB 1EOLA 3SU0A 2AHME 2GT8A 4WMDA 3F1SB 1O2MA 1IQIA 4BAMB 1C4Y2 2AFQB 1NFWA 3G01A 2FOHA 3PROA 1L4DA 1A2CH 1K1PA 3LONA 1DY8A 4AFZA 2FESH 2OXSA 1O3PB 4J2YB 3LIWA 1TGSZ 2TGTA 2OQUA 3QK1A 5FCRA 1P9SA 1C2JA 3SUFA 4TY7A 5C1UA 1T31A 3CENA 2VINA 2GJGA 1TNLA 2YNAA 4NSVA 1W10U 1LTOA 4ZAEA 1NPMA 1P2JA 5EODA 1AVGH 1K1MA 1TNKA 1O2SA 3LC5A 1P2KA 1KMHB 3MU8A 4NA9H 1N6YA 4FUBA 1GMDF 3PLKA 1SVPA 2QE7D 1AB9B 1ELBA 1WQSA 2XWAA 1O30A 4ISHH 3GS9A 4CBNA 1HAYB 2WZQA 3MYWA 2GKVE 4Q2KA 1TNHA 1Y5UT 3SZNA 1C1QA 2J2UA 3SZEA 2ZFFH 4FU7A 2Y5HA 4TY6A 2FZZA 1GJCB 3SNEA 2J38A 3S9AA 1YPMH 1N8OB 1BA8B 4B6EA 3PV5A 4A92A 4AYYB 2TIOA 3A7ZA 1A5HA 1TGTA 3SI3H 1GJ7B 4R0IA 3FAOA 3Q76A 1CA0C 4AFSA 5CDFE 1ZHMA 1NU9A 2BZAA 5EG4A 1QL8A 3RMOH 2HPPH 1QRWA 3E0NB 1NFUA 3ZYEA 1O2QA 2H9EH 3EAJA 2Z6BD 4FUHA 1DSTA 5GCHG 3A7YA 3SW2B 1GBHA 1GBDA 4WXVA 1O32A 1S6FA 2ILNA 5A2MH 1CT0E 3LH1A 5K0HA 3EA9A 2Z9JA 1EZSC 1G2LA 2HGTH 2ZDNA 1T8NA 1BMFD 1CT4E 1O2LA 2V3OH 4K69A 1SBWA 4UFEH 2OTVA 1K1LA 1EKBB 1EUFA 1ZZZA 2C3SA 2J95A 3IG6B 4WH8A 3O8RA 1SQOA 2ZA5A 2RDLA 1BTZA 1BTYA 1Z8RA 1GDUA 2P94A 5DPAA 2ZDAH 2XBYA 1WV7H 1XXDA 3HKJB 1NESE 4CREA 4CR9A 1BRAA 1O2HA 1ETRH 2QCYA 1EJAA 4ZHMU 2AS9A 4Y7BA 2F91A 4X8UH 3M3VA 1GCTC 1ABIH 3S9CA 5FL7D 4KELA 1C9PA 1CBWC 3QTOH 1BIOA 4GUXA 4A5TS 1XVMA 1DUAA 2FOFA 2KX4A 3TNSA 3UB0A 1BTPA 2ZKSA 3SJ8A 3UNSA 1MBMA 5A09A 3P6ZB 4NZQA 1O3FA 3AK5A 2PTNA 2ZO3H 3NUMA 1GBLA 5F8ZA 3TK9A 1VR1H 4CRFA 3ITIA 3ZZBA 2JETB 4OS6A 3VEQB 2FX4A 1F5KU 2RCEA 4TPIZ 1O2UA 1ACBE 1SGIB 2M5TA 1C5WB 7GCHF 1MTUA 3SI4H 1MBQA 1S84A 1GJ4H 1LPKB 3HATH 2ZPSA 2XWBI 4DJZB 3LJJA 2HNTC 1DXPA 3P70B 2GDEH 1J15A 1O2IA 3A82A 1MMJN 3SNBA 3PRDA 1VCQA 4D7GA 4NZLA 4MPUA 1TGBA 1MQ5A 5L30H 2KAIB 2OQ5A 1W0JD 2QIQA 1RTLA 4FVBA 3PLPA 5LPEA 5SGAE 3VFEA 2Z3CA 3LGUA 1P2QA 1WQVH 1HBTH 2A5IA 3V7TA 2XCNA 2B7DH 3OTJE 4H6SB 1TOMH 2KM0A 1FAXA 1EX3A 1GMCF 1DE7H 1LHCH 1PJPA 1DFPA 3ODFA 3W94A 5FPSA 2ZHEH 1S85A 2WINI 4RT1A 3U28C 1SB1H 5B6LA 1ELTA 3OFND 4NIVA 1GBTA 1SGFG 3UQVA 2JH5D 1UTPA 1AVWA 2F9OA 1TFXA 1Y8TA 3RC6A 2PR3A 2BZ6H 2G81E 1ETSH 3MNBA 5C67A 4P02A 2W3IA 2Q6FA 3WWFA 3BTME 4NCYA 4ZXYH 1AHTH 1C2LA 2ANWA 2FOGA 1IHTH 1KIGH 3T62A 1GBJA 1Y3VA 1PPEE 1O3NA 4MG3A 2ZP0H 1P02A 1O2JA 1BUIA 4I8LA 1INCA 1MTNB 3R0FA 1L1GA 1ESBA 1TONA 2PKAB 3UREA 1GJ5H 1QJ7B 3DSGA 3UFAA 1HAGE 1QHRB 2BOKA 2ZC9H 1TNJA 3TK6A 1HJAB 2WPKS 5C5OA 2Z7FE 1LCYA 2AYWA 3SHCH 1A5GH 1QB6A 1KXEA 1MCTA 2V3HH 2ZHWH 4YXWD 1O3BA 3DHKH 3TU7H 1RD3B 1NY22 2WV4A 4WF8A 1MTSA 1BOQA 1T4UH 1BCUH 1GMDG 1OSSA 1SGPE 1Z8GA 2VH6A 5DP9A 1L2EA 3SUGA 2PW8H 1XUIA 1BRBE 3VB7A 4FXGH 3UY9A 4ABJA 2VNTA 1AFQB 1O2GH 1UVTH 1C2EA 4KGAA 4DGJA 5CHBA 1THSH 2A2QH 3MFJA 3VB6A 1UVSH 2SGEE 3TITA 1O31A 3PTNA 1MUEB 1DX5M 4AB9A 1TMTH 2ZFPH 2ZG0H 1MKXK 3BTHE 3VGCC 1TQ7B 3FANA 4Q63A 3QWCH 2AGGX 3I77A 1OP2A 1LDTT 3RXQA 1DWEH 1QL7A 1BBRE 3HK3B 2BQWB 1JIRA 1P09A 2LELA 1HAOH 3MTYA 2H2ZA 1FI8A 3KF2A 5H4IB 2R2WU 2PSXA 3BTEE 4AFUA 2L6OA 1RS0A 2LP6A 2ZU2A 2VWNA 3I29A 2ZCKP 4H42U 1BJVA 3AAUA 3LH3A 1L1JA 4FETA 5EXLA 2CJIA 3F9EA 1GBKA 4BAOB 2SNVA 1W2KH 1O36A 4ABAA 4TWYA 2ZNKH 4AOQA 1SQRA 1YLCA 1CT2E 1H8IH 1QBOA 5DK1A 4AORA 1MCVA 1SOTA 2F9UA 2PV9B 1FUJA 1ZTKA 1OKXA 2YMSB 1T8LA 1GI2A 3BG8A 3SN8A 1FY8E 1AZ8A 1BQYA 4A1TA 1EB1H 4AGKA 4A1XA 3F9HA 1WDIA 1NRPH 4NWLA 1V2PT 5KGOA 2W7UA 1T32A 2P8OC 1P2IA 4K8YA 1SFIA 3RXGA 2VIOA 4KTUA 1ZGIA 1LVOA 1TX7A
chains in the Genus database with same CATH topology
3AVZA 5L6NH 4D76A 5JDUB 2ZI2H 1QB1A 1C1MA 4D9QA 1GHAG 2AERH 1ZMNA 1GWAA 1G37A 5K7RA 4BXWA 1FPHH 2BYAX 1C5YB 7GCHG 1V2UT 2BHGA 1KTTB 4CRDA 2C8WB 1DLKB 1CE5A 3MH6A 3AW0A 2ZPQA 5GIBA 2F3CE 1ARCA 2BY6X 3TIUA 2NWNA 5DG6A 2CMYA 4WVPE 1QRXA 3L3TA 3MOCA 4AZ2B 1HDTH 1P03A 5IYTA 2OD3B 4ABHA 1AO5A 1OOKB 2BDHA 1ORFA 1Q3XA 1E0FD 1NROH 4DG4A 1GJ6A 3ZZ5A 1NZQH 1S81A 1P10A 4Q7ZA 1V2QT 5FHTA 2A1DB 3U1IB 1LKBA 3KGPA 1DT2A 3T29A 5TJXA 2XC0A 1UTOA 2ASUB 3PWCA 4VGCC 3ZZCA 3A88A 4OS1A 1O5DH 1YC0A 4BXSA 1C1OA 1OWEA 1V2WT 3UR9A 4DIIH 1JOUB 5E0HA 3Q3XA 1ELCA 1OWIA 3CP7A 2HNTF 3M37A 1WAYB 3A8AA 3ATWA 1V2JT 4WMEA 5EW1H 1NC6A 3RC4A 1P8VC 4I8JA 7LPRA 3M36A 1Z6JH 3GY6A 2H1UA 3RXSA 4GHQA 3E6PH 3MNCA 2RG3A 1QURH 4O9VA 1C5LH 3RXAA 2G00A 2SGQE 1DXWA 1HB0B 1GHXH 1O3HA 1H1BA 1ELAA 1NRSH 1C2DA 4X1PU 1EAWA 3SU2A 4B2AA 1O38A 3ZZ8A 2ZFRH 1FQ3A 5EOKA 2GZ7A 2V0BA 2BVXH 3ESTA 5A8YA 2P95A 4X2WA 4NFFA 9ESTA 1BTXA 1UTKA 2BTCE 1ZHPA 1TBQH 5JYIA 1YPEH 1VGCC 3RMNH 1MKXH 5GJ4B 1JRSA 4O97A 1D6RA 4TWWA 1UK4A 1EP6A 1OP0A 1BMAA 1A0LA 1H9HE 1MH0A 3A8BA 1YYY1 3LJOA 2WPIS 3STJA 1W0ZU 1XUFA 2FODA 3NWUA 2OP9A 1C2GA 1C5MD 5ESTE 2EA3A 2ZQ1A 2JKHA 3A83A 1KYNA 1UTMA 2CF9H 4I33A 3RMLH 1ESAA 2XBXA 2ZDVH 4CHAB 3EQ0H 2BLVA 2ZTYA 4IBLH 1O2XA 4CRBA 1L0ZA 3HKIB 1QJ1B 4K1EA 1U6QA 1C2HA 2I6QA 2ULLA 3HPTB 4YOGA 3E1XB 1GBCA 1IQHA 2Y7XA 3GCHB 1C5RA 3P95A 1P05A 2NU3E 1TGNA 1F5LA 3M7UA 1OYQA 3MH5A 1TPOA 3QX5H 4Q7YA 1TWXB 4OS2A 2GV7A 4XBDA 1QY6A 4JZDH 1O5CB 3KHVA 2ZCLP 4JCNA 1IQKA 1OWHA 4A7IB 1BMLA 4XBBA 2ZGJA 4SGAE 2XCFA 1GJ9B 2A4OA 3ZVGA 2PGQB 1O34A 2EEKA 2B5TB 3E8LA 3NPSA 3RXLA 1UTJA 2BD5A 2GZ8A 3GY2A 1S82A 2QV1A 1IQEA 1UK2A 5EXNA 1ELVA 2AGEX 3GICB 1DM4B 3ZVDA 3L33A 1IQFA 1W8BH 1C5QA 4I8GA 4CRAA 5T6FA 1BHXF 2BDAA 1GJAB 1PYTC 3QGJA 5A0BA 3BIUH 1BB0B 1E34B 2VWOA 2LPRA 1LVYA 1CSOE 2STBE 3MU1A 2AEIH 2ZHQH 1OWDA 3TNTA 3ZZDA 3TLOA 3M7QA 3S69A 4BTUB 1IQMA 2XRCA 4GHTA 2BVSH 1F0UA 4GPGA 2BD8A 2O8UA 4TYDA 4ASHA 3S9BA 2PKSC 3TGIE 1THPB 1DPOA 1RRKA 1O2OA 2FPZA 4DVAU 1YKTA 3SJIA 5I46H 2VWLA 1B7XB 3UWIA 2R9PA 4PROA 1EATA 1TPPA 1Y3YA 2UWLA 3BG4B 1KDQA 4XBCA 1GBMA 4MLFB 4YLUA 2F9NA 1AWHB 5DP8A 3M7TA 1A3EH 3K2UA 4ABBA 5EPYA 2G55A 3A86A 1SGDE 3ZZ3A 1CU1A 1SGTA 1RTFB 8KME2 2TPIZ 1UHBB 1SI5H 3KQCA 4OGYA 1OYTH 3E16B 2BD7A 2Z9GA 1A5IA 1J14A 2I6SA 2ZQ2A 1A46H 1KDQB 1TPSA 1EJNA 5FPTA 1D6WA 2GT7A 4GVUA 1Y5AT 1F92A 4ABFA 1LO6A 1XX9A 1D3QB 4Q80A 4ISNA 4CRCA 1HJ9A 4MDSA 1S6HA 2FOEA 2PLXA 2HVXA 5AHGH 1P12E 1GVLA 3P17H 4ZKOU 1KLJH 4JMYA 2B9LA 1NT1A 3UTUH 4KTCA 3RDZA 1EP5A 2R3YA 1QGFA 1H8DH 3V12A 1HUTH 3ZZ6A 3Q3KA 1N6XA 5A0AE 5DP6A 3QZQA 1GI1A 1MTVA 5JBBS 1GDQA 3RXVA 1FONA 1YCPM 1P57B 3T25A 3MU5A 1PPFE 2HPQH 1FLEE 4DURA 1HAIH 2ZCHP 1CGHA 5FPYA 4Y7AA 4ZKSU 2Y82A 4WXIA 1HNEE 3LDXH 3RXDA 5F8TA 3GISB 2PSYA 3RXTA 3OY5U 2VVCA 3GYLB 2O9QA 3GY4A 2BY9X 3GCNA 1FAKH 4BTIB 4MPWA 2AMPA 3HGNA 3RU4E 1GI4A 1Q31A 1YCPH 2CN0H 4Y0YE 5ABWA 1ZMLA 3ATLA 1MAYA 2RA0A 3UOPA 3RMMH 1DVAH 4X6MA 2WYGA 5ESBA 3FFGA 2HNTE 2QF0A 1N8OC 1Y3UA 4X8SH 3KEEA 4LXBH 3OSYA 1YM0A 1TE0A 1UO6A 3MWIU 6LPRA 2ZU5A 2ANMH 1G3BA 1O5FH 1B0FA 3L6PA 3RP2A 4Y10E 1SLWB 2ZECA 6CHAC 4MNXA 2CXVA 5FBEA 2A0QB 3FZDA 3RLYH 1GL0E 3U8TH 2OC0A 4B74A 3QDZB 1V2RT 1YP9A 2H5DA 4AB8A 3P8GA 2PUXB 8ESTE 1GI0A 4F4OC 1AY6H 2A4GA 1KXFA 1YPKH 1YPLH 1DSUA 3KQBA 3DFLA 2A7CA 2C93B 2FXRA 4NWKA 1KXDA 1QA0A 1GG6B 2G5NA 8LPRA 1UCYE 1C1NA 1FN6A 1UVUH 7KMEH 4X2VA 3SNCA 3QN7A 3PO1C 2KAIA 5C3NA 2HRVA 5AFZH 3RU4D 2BOHB 5DP7A 3DFJA 5FAHA 1HGTH 3UR6A 1XMNB 5HM2A 4OGXA 1ESTA 1AQ7A 2SGPE 2GZ9A 1V3XA 2NU4E 4YZUA 3ZVFA 1HIAB 3RM2H 1QNJA 4AFQA 1V2TT 1O2VA 1O3JA 1QFKH 2BMGB 1ELEE 1O2WA 3QLPH 2B0FA 4I32A 1C4U2 4I7YH 2QYIA 2CHAB 1EOJA 3U98H 2ODQA 1GHBF 1EB2A 5JB8S 3QGNB 3CS7A 1W14U 3UPEA 1JXPA 4YTAA 2VWMA 1DWBH 4B2CA 1AUJA 3SV9A 3RXBA 1F0TA 3T5FH 3A7TA 4Y76A 4U01A 3ATIA 4X1RU 1HAHH 2ZZUH 5C2ZA 2D2DA 2QF3A 3B23B 3NCLA 3SGBE 2ALPA 5DGJA 1AN1E 4NG9H 2XBVA 1BZXE 3SV2H 2TBSA 2ZU3A 1CGIE 1C1TA 2ZWLH 2O8MA 4INLA 4GCHF 4RSPA 1SGQE 3SU5A 2GTBA 2PKAA 3A8CA 3D62A 2BX3A 1J17T 1XUHA 3A7VA 3SU3A 4BOHA 2ZFQH 4GLYA 1B5GH 2GCHF 2ZDMA 2J34A 1VITF 2BDBA 1SGRE 3E90B 1ZRKA 1GHVH 3AAVA 1O3AA 2H9HA 5EW2H 2UUJB 1W0YH 4MTBA 4BAKB 1DLEA 1V2LT 1HRTH 2BD3A 1DDJA 1C1SA 1THRH 5B6OA 2NU1E 5DP4A 2IJOB 2WPHS 1DOJA 2TGDA 3O8BA 1SLXB 2W5EA 3D23A 2XBWA 3NXPA 3DD2H 1TNIA 3BTWE 1ZPCA 4JYUH 4MNVA 1LHFH 3EDXB 3T26A 1CHGA 3SQEE 4X1NU 4NSYA 3B8JA 5CHAB 1OPHB 2Y7ZA 3PB1E 3TGKE 1CHOF 2FDAA 4IC5A 1OXGA 1C5VA 1GI6A 1SOZA 4NIYA 1G2MA 1ZTLA 2ZU4A 1P3CA 3SUDA 2VIPA 4ZH8A 3ZZ7A 3SOSA 1IAUA 2ZEBA 3KN2A 1XM1A 1ANCA 4ABEA 2AMQA 2W7SA 5C1YA 4YT6H 1K1JA 1HJAC 2P3TB 2VH0A 4MNWA 3BEFB 1EXFA 3SJ9A 2YOLA 1GBFA 2XXLA 3K6ZA 3RXKA 2BQ7B 4ZMAH 1UCYH 1V2OT 1NN6A 1Z1JA 4Y11E 1UTQA 2ZGBH 6ESTA 2ZTXA 6GCHF 3AASA 1SQAA 1HAVA 4ZROA 3DT0H 1F5RA 4UFFH 5EPNA 3MNSA 3RU4T 4B71A 3IWMA 2K1QA 2LNCA 1OWJA 3V13A 1TNGA 2FYQA 2HWLB 1F2SE 2D26C 3U9AH 4UONA 2QXGA 3ZV9A 4IMQA 2Q6GA 1BTWA 4OS5A 1HAVB 1E38B 4RKOB 3BTTE 2AMDA 1DANH 2FO9A 4ISIH 2FI4E 2BY7X 1RIWB 4E7RG 3ZVEA 1KLIH 1MD8A 3V3MA 3LGWA 2A5KA 1C1UH 4IGDA 4MPXA 4U32A 3BTGE 1GPZA 2C90B 2ZPRA 2ZFSA 5LPFA 2STAE 4B76A 1C5SA 3FVFB 4TPYA 2XW9A 4AG1A 3LGYA 3MMGA 1AU8A 1TRMA 3S7HB 1EQ9A 4A1VA 2AIQA 2WUBA 5J4QA 2CF8H 1JRTA 3SORA 2G4UA 3UIRA 1C1VH 1NRNH 1ARBA 4DOQA 1AKSB 5G4BA 1TRNA 2W26A 4X2XA 3OU0A 1N1LA 1WSSH 1GVKB 4NGAH 1K28D 1DICA 4ZXXH 1G9IE 4XSKU 2OBOA 5C5NA 1ZJDA 2A31A 1ANBA 2ZGXH 1A4WH 4KTSA 1EJMA 3E3TA 1MQ6A 3U8RH 2GCTC 3KIDU 1MZDA 4AYVB 1O0DH 4THNH 3ZV8A 4F49A 4CH8B 5ETXA 1O5EH 4CRGA 1T8OA 2EC9H 3GYMA 3A87A 4UEHH 1G3CA 5FX5A 1OWKA 3PMBB 1P2OA 2OLGA 1LMWB 3M5NA 1Y59T 2EI7A 4X6PA 1AVXA 1ZLRA 3KNXA 2RA3A 1C5OH 1C5TA 1GMCG 4IC6A 4SGBE 1YPHE 3RXJA 1O3CA 2PUQH 3E0PB 2QA9E 3Q77A 1GGDC 1SG8B 1TALA 5E0JA 1YBWA 1FJSA 3F6UH 3NZIA 1FN8A 1P11E 2XC5A 4GCHG 1O39A 2R0LA 3M3TA 2YNBA 1GI8B 1O3EA 5FCKA 1BBRH 5EQSA 4ZHAA 1EZQA 2FIRH 1ABJH 3R3GB 2GCHG 1V6DA 4JZIA 4MPVA 4UFGH 1C1PA 1VITG 4WWYA 1VGCB 3ZZ4A 2B8OH 1IHSH 1JBUH 2FX6A 4X1QU 4X1SU 1C4V2 3ATMA 3LKWA 1NFXA 1EPTB 2PGBB 4FU8A 2OC7A 1D3PB 3SGAE 1QBVH 2BLOA 2F9VA 4LOYH 3ZVBA 1C2KA 1W11U 1Y5BT 4JZEH 3C27B 5GCHF 2GGVB 3SHAH 4YT7H 1DS2E 2A4QA 2J94A 1P06A 2GMTC 4BANB 2R0KA 3QO6A 3RXOA 1MTWA 1O33A 3TPIZ 5L2YH 1BMMH 1G3EA 1YPHC 2VIWA 1TPAE 4X8TH 4Y0ZE 3GY7A 3UWJH 3TH2H 1AE5A 1EZUC 5JB9S 2GX4A 1TRYA 2WV5A 1YCPK 5F8XA 1V2MT 1H9IE 2C8XB 3A80A 3ZVAA 1SC8U 2FEQH 2R3UA 1HAZB 2A4RA 1FY5A 4R8TB 3SO3A 4D8NA 5HGGA 3FP6E 1HXFH 1SLUB 1JMOH 4ABIA 1G3DA 3Q3YA 3A7XA 1DITH 1W12U 3T2NA 1NRQH 1HAPH 4NA8A 2ANYA 1GDNA 3M35A 1HPGA 1OX1A 2FI3E 3BIVH 3RXEA 2GVFA 4K1SA 1PQ8A 6GCHG 2FTLE 1T4VH 4B1TA 1GHZA 1UVPA 1GBBA 2O8LA 1ZHRA 4IW4E 1C2MA 1A61H 1F0RA 4A6LA 2VGCC 5EXMA 4K3JA 1NM6A 2ODYB 4WMFA 3NK8A 1C2FA 4RN6A 1UTNA 3KL6A 1PPBH 5HM9A 3KQDA 1GVZA 3S7KB 3TVJB 3PM3A 3MH7A 4DY7B 3W95A 4OS4A 1ANEA 5EQQA 5HYOA 1LHEH 1SFQB 5F6MA 3PWBA 1FNIA 2ZDKA 1O3OA 1GCDA 1FIWA 1SHHB 3I78A 4BAHB 8GCHF 3PV4A 3QZRA 3TGJE 1ID5H 4Y6DA 2PWXA 1O2YA 4ZKNU 5T6DA 1SSXA 2BD2A 4AGJA 1O5AB 2QGRA 2G51A 1LHDH 4FUFA 3TJOA 4FUJA 1PYTD 4RKJB 1DWDH 1K1IA 1OP8A 1QIXB 3RXIA 4CR5A 2G8TA 4X0WU 1WTGH 2BM2A 1UHBA 1O5GH 5AVDA 1PFXC 4UDWH 2UUKB 1AGJA 2CV3A 3P8OA 3V0XA 1NU7B 1TX6A 5AF9H 2OINA 2UWPA 4FVDA 5LPRA 1QJ6B 3VPKA 1ETTH 1Z71A 1CVWH 1GJDB 1C5NH 3RXFA 1HJ8A 2UWOA 1EASA 1QRZA 1XKAC 1P04A 2FP7B 3SGQE 1GI5A 1W3CA 2FOBA 1ELDE 1UTLM 1LPZB 1BDAA 3EYDA 2VIDA 2G4TA 5HMAA 3NKKA 1C2IA 2C4FH 1O3DA 1KXBA 2TRMA 3LGIA 3M61U 3BEIB 1O3IA 2Y81A 4KKDA 2NU2E 1QTFA 3P8NA 1V2KT 3BG4C 5FX6A 3RXCA 2P16A 2WUCA 2XNIA 2QXJA 4JYTA 2Z3DA 1VITH 3RLWH 1TBRH 1ZSKA 3VB4A 1DY9A 2QXIA 1L4ZA 3M5OA 1MZAA 1CA0B 1GI7B 1B0EA 1VCWA 1KXCA 2OUAA 5JPMH 1SMFE 3HK6B 3ZZ9A 4AG2A 1S0RA 4INHA 2G52A 2IPHA 4WJG2 3EA7A 3FP8E 5DP3A 4I8HA 4UE7H 1NFYA 2A7HA 3SU1A 1LVBA 2D1JA 2ZHDA 3MH4A 2V35A 2Z9KA 3RXHA 2A5AA 1H4WA 1EZXC 1QL9A 1PPGE 2SGAA 1SQTA 1YF4A 1SGNE 2J9NA 1AB9C 1AIXH 2A45B 1K9OE 1WUNH