1F5WA

Dimeric structure of the coxsackie virus and adenovirus receptor d1 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
b'FARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COXSACKIE VIRUS AND ADENOVIRUS RECEPTOR
molecule tags Viral protein receptor
source organism Homo sapiens
publication title Dimeric structure of the coxsackievirus and adenovirus receptor D1 domain at 1.7 A resolution.
pubmed doi rcsb
total genus 29
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f5wA00
3BEVA 1CL7L 2EXYC 1NGXA 3EOAA 1IKFH 2YN5A 3ZE2E 1KIRA 4MJ4A 1FZOB 5D9SB 1P5VA 5KVFL 1KFAH 1I1AB 3LKQA 3FO0L 5HI5D 3WXWH 5JA8B 2H6PA 5HYSG 1HXMB 43CAA 2OQJB 1JHKL 1NGQH 3ZKNC 2EYTB 2BY2A 4NO2A 4LOUC 4Y4FD 4XP4L 2J8OA 3TESA 4P0DA 1AP2A 3TCLA 4WCYH 2O5YL 5ACMA 5C0GB 4DKEL 2H2SC 4FZEH 5DEFA 1ADQL 3K8KA 4PRAA 4E5XB 2ZJSL 3LKRA 3F6IA 3TJHD 3VDBA 3QXDA 3L5WB 5GS1B 2RAMA 1AR2A 5H37G 3MNVB 1A7RL 4F7PA 4PTTA 4OAWB 1KSRA 4BYHA 3VW3L 4QXGH 3PP3H 2BSRA 2J7LA 4OI9A 1V5JA 4KI5D 5KSVA 1KELL 4QHKJ 1G9ML 2DQEH 3DX8A 2RIKA 1IGFH 1KYOK 4Z7VF 3V52L 2Q1EA 2X40A 4LLUA 4X6CF 1NJ9B 5IMKB 3D39D 1NUNB 4XPGL 1KXTB 1KJ3L 3PGDA 1N5AA 5ESVA 3ZZ1A 4KJWD 3EW3B 1JHKH 2VC2H 3OKOA 4DGIH 5I74B 1GZPB 3IFPA 2IH3A 4X4YB 4QRPB 3KJ4B 4PJBB 2H1PL 3GSOA 1IRAY 3MLZL 4GKNB 1EEYB 4X6CE 3G5ZA 3JWDC 4JDZB 4KC3B 1CVRA 3BE1L 4GXUN 3EGSA 1KTLA 3G04A 3TN0A 3RL2B 1PYWB 1UZ6E 1ZLWH 4EUPH 2P7TB 1KIQB 2HMID 1XIWC 4WJ5A 3QEGL 2I9LB 5JQ6H 2XFXA 5D7JB 2R2HA 1QRND 1RMFH 3V6OC 3U36A 3UZEA 2F54E 5JPNB 4PLOB 1AP2B 4NO3A 1NQBA 3VDAA 4YHMH 1AC0A 2MCPL 1A4KA 4YHYC 1MFNA 5GQBA 1K4DB 2EE2A 3SJVD 4RGOH 1SMAA 5IQ7L 1M71A 4XRCA 5DRZA 2ZOKB 2QSTA 2X4NA 4ZDHA 5T33H 3R8BB 1RIUL 2A73B 3O0RL 4JPIA 4NJ9H 1YPZF 4ZFZB 5I1EH 3MRNA 2QSQA 2ICCA 1MHEA 1LEIB 3SQOH 1Q0XL 4FQQB 2JJTA 4JM2D 1KTRL 2AEPL 2ICEA 4OZHF 3B9KA 5CINH 1OT1A 2V5YA 4Y5YB 3PL6A 4KTEH 4NNPL 3RUGA 1F58H 4G43A 1FG2A 1KT2B 3DARA 4ZUWB 3KNBB 3BKYH 4K94L 4TRPH 3DVNB 2JIXA 4NN7B 3BN3B 4WWKD 1FZMB 4NZTH 2XTJC 5IEKA 3D0LA 4U6HB 4K8RL 2DI7A 4PJ8D 2NZ9C 4ELME 3QULA 3C9NA 4L3CA 2GKIA 5C2BL 5MERB 1XF1A 3NPSC 4QNPF 5BQ7B 5I8EB 5J0BA 1GHFL 1HHIB 4OGYL 4QTHB 1Z9SA 1JGEA 3IGAA 3QZWA 3WS3B 4BK5A 4NRYB 4NCC1 5C71A 3QUMB 3Q5OA 3HG1D 3SHSA 3N9GL 2EZ0D 5E1AA 2A83B 3S7GA 1CT8B 2XFXB 5D7JA 2Z8SA 2J88L 2UZYB 1RJZA 3C09C 1JP5A 4KRPC 1F4YH 4PJIB 4POUB 3AS3A 3HTLX 1R0AH 4HV8A 4N0UA 1S9XB 1NCAL 3IDIA 4NQEE 5I18H 4PJEB 1YY9C 4KHXL 2W0FA 4NQDB 2OTUB 3K8MA 2YKLL 1BD2A 3KYOA 4KI5F 2MPAH 4LSRL 1IAII 3T65A 3KXFE 1I75A 1MRCL 4XGZB 2ARJQ 3H9HA 2AXFA 2GJJA 2FJHA 4S1RL 4BSVA 5IVNA 3O9WB 5ALBL 5E2WL 3DVFA 5IJKA 4OQTA 1XCTB 1IGIL 1IKNA 5C9JB 1B6DA 3GB7B 1GJIA 4FTVE 3DROB 2P8MB 1C08A 4BZ2L 4YHNB 4X6DB 5MEOA 1XR8A 4MA8L 4NNXA 1T0NB 2UZIL 1I7UA 2WLZA 2NNAB 5IOPA 3C09B 5GGTL 2GJ6E 3QFJE 5T1MB 4YIQB 4Q7DA 5MEQB 3TIEA 4UQ3B 3ROLB 1S7UA 5E99L 5D1XC 4FFVC 5D71H 5ECJE 1FO0A 2AV1A 1A22B 2FHFA 3CDGB 3VXNA 3UX9B 2B4CL 4HXAL 4HKJA 4JQXC 4M5YL 2NPLX 5L88L 1T2XA 5KSUB 3ZE1F 3MLYL 5BVJB 5HDBF 4BH7A 1DQTA 3O3EA 2B1AH 4IJ3B 4AYFA 3GMRA 1MCNA 3OR6B 5DK2A 1IE5A 3K2UL 1IKNC 2NXYC 1VFMA 1QBAA 2YN3A 4MDJB 4JHAH 3RHWK 1QACA 1I9JH 1XF5B 1ADQH 4JFXB 5F7LB 1I7RA 2WZPD 4DWHA 1HHJA 1O5DT 3QWRA 1T2JA 1AC6A 1EK3A 1GVIA 2YPLA 1MI5E 2DIJA 4BFIA 1IGCL 5CEXB 5TE6L 3ZKSD 4H5SB 4MAUL 4QT5A 2R8SL 2FIKB 3RVXD 5KTEH 2DMBA 1U91B 3JVGA 4ZFGH 3BHBB 4LSSL 3V4PH 3KR3H 4TULH 4O00A 2IANB 2YWYA 5C3TA 2HT4C 5DRWB 3V79C 2EDTA 1QQDA 1MLCB 5KVMC 4RFOL 3PV7A 4CMMB 1C08B 4IJ3C 3QUZD 1QG3A 5KZCB 2OR9L 1RZ8A 3DUSA 5F88B 4QXTB 4ISVB 2AXFB 4JG1L 4MNGE 4FHBD 4H25A 3ZTNL 3X11A 2HJLA 5J11C 2BSTB 2BVPB 2XNAA 5JIPA 4WHDA 5JXED 4X7TA 5D7IE 4XPBL 2IQ9H 1A02N 4QOKD 4NSKB 2P45B 4U3XA 3O4LD 1A6TB 2GCYB 1VKXA 2NY1D 2P8PB 1OSPH 2G5RA 1NSNL 3KPSD 1BIHA 1ND0A 4AT6B 2C3VA 5EU6A 1FH5L 4NC1C 5KTEL 5B38G 3HPJA 4NBXB 3STLB 3QRGL 5C0FA 3IJHB 3HUJB 3ARZA 1AR1D 4GUPA 3KS0J 2PCPA 1ITBB 3GSXA 5BQ7A 3MLSL 5F88A 4Y19A 5LAXB 2Q6WB 1VACA 3PXJA 4S1SH 1A9EA 1CD1B 1EZVX 2R23B 4YLQT 3T0EE 2D03H 2VL5A 1UXWB 2ZNWA 4FN0A 4NQXB 3F62A 3QIBD 5FAAA 5LBSH 3MRIB 5JXAL 2YZ1A 1MAML 4XP1H 4U0QB 4FQPA 1HCFX 2ADGB 4EQ2A 5J06A 2BDNL 5I66B 5E6IB 1K4CA 3SDAC 4GW1A 3L5HA 3GKZA 3IDXL 3ZYIA 2IADB 3NPSB 5K59F 1FAIH 3U2SB 4HHAB 5EIIB 1JYWA 3RVUC 1CBVL 1JTTA 2YPKB 4X5XB 3H7BA 3QFJB 1KFAL 5F7UA 1WBZA 4ZUVB 1W0WB 3HC3H 1CIUA 5E7FA 4Y2DA 2AVGA 1KCSL 2HFEA 3IB4A 3E0GA 5IMMA 2YBRA 1FNFA 2NY0D 2NW3B 1DFBH 1MHCA 3LRGA 1WIOA 3CDFA 3V5HB 1RUML 1F4WL 4HZAA 3B4NA 2X4PA 2BOCA 3VA2C 1HXYA 1NLDL 4FXLA 2MWCA 4M7LL 3TBSA 4WUUD 4C56B 1G0YR 5L8KB 4BQBA 3LN4B 3VD7A 3G5YA 2DKUA 3FO2B 2R29H 4JGMA 1F4YL 4Z95H 1PD6A 3CSGA 3STLA 1YC7A 3MRKA 3O2VH 2GUOA 1IQWH 4QHUA 4ONFL 5KSBE 4EI5C 4M93C 3EO1A 5I1JL 3BKJH 1MCCA 3DURB 1H3TA 4BH8B 1U8IB 4OCLC 2DLGA 5C3LD 1A14H 4WI3A 5I6XC 3TO2B 1S5IH 1O7VA 5E94B 3TBVB 3T4AA 2L7JA 3QUZA 5FA3A 4O51B 4PGCA 3NIGE 4QO1A 5F6IC 4LLUB 4M6NH 5LGHH 4YO0A 1PG7H 1WAAF 3MLUL 5CD3A 3V4VH 1XIWB 3MRFA 5C9KA 3RKDC 5D7SH 4LCYA 1K8IA 1RJLB 4XPTH 3N1QC 5DHVA 5B3JE 4MVBC 3NZ8A 1MELA 1U8LB 5D70L 4H1LB 3FRUA 4P4KD 1IAKB 1ZHNB 4HPOH 2BVOA 5DS8A 5B38B 3U0TA 1BPVA 4UDUB 1FBIL 4D0DB 2P24A 1W0WA 4OCRH 4BK4A 3ZDYE 2HN7A 2HT2D 2BVQA 5EFIB 2IG2L 4I48A 3UTTA 4GMSL 4FOMA 4KROB 3PWPA 3K3QA 5D7LD 3ARTA 3HR5B 3SPVB 3SY0A 4L4VA 1QVOA 4C56E 1MCWW 3TBWB 1Q0XH 4MJ2A 2Q20A 1FZMA 4XNXH 1A0QL 4NM8H 2WIIA 3ORJA 4TULL 5SWZD 3PWLB 3C6LA 4CDHA 2RR3A 4LGPB 1TCMA 3VMPA 4ZUWA 1QRNE 3MLYH 2CKBH 4BELD 3MRLA 2ZOKA 5C0AA 4QRTA 3DVGA 4Y5YA 1QO3B 1D6EB 3QO1A 4UILH 3PWNB 3T2QA 3S37H 3FQNA 3BZFB 3SDDD 3BPCA 3ESVF 1YEDB 2F8VA 1M7IA 3KDMB 5INCB 2AI0L 1ROWA 1JYNA 4EIGB 1LK3L 3QNZB 3FN0L 3MA9H 1MQKH 1DQJB 2F5AL 4ELMA 4Z7WB 2BSTA 3O2DA 4CVWA 5CCKH 2VLJA 5GHWH 2C3XA 5HVHC 5MHSD 2MCG1 2LAAA 2APFA 3EYVA 4PB0H 3X14A 3NCCB 1Q9OA 4PP2B 4ODSL 4GXVL 2VAAB 1UB5B 5KG9A 3MLSH 4OLEA 5I16B 4ODTH 3X17A 1I3VA 2DJSA 2BC4B 4G8GB 1FZJB 1J11A 1E27A 2DAVA 1QO3A 3QO1B 5CZXD 3VXSE 1MHPH 4HF5L 2BSRB 2GFBA 3MV9D 2R0WH 4TSAL 5CJQL 5DMGD 5FF6A 1XGUB 2DQUH 4M5ZL 3ETBF 4RWYH 3G08A 4FQJL 1PAMA 2DOCA 2IGFH 3DGCR 4G6AC 2AXGB 3HRPA 1F90H 4OM0L 1BAFH 2EDLA 4PB9L 2HVJB 3B9KD 3RVVD 5DJ6A 5TF0A 3PP4H 1TJIL 2VIRA 4JR9H 2YPVH 3BPOB 3GSVA 2AEWA 2OJZL 4M1CD 4R96A 3ULVH 1U8MA 4O2FB 4BH7B 4OZ4B 5DT1H 5HYEA 4Z78B 3KXFA 3RPIB 3S34H 1BM3H 2HG5B 1OAXL 4P4KA 5BZWA 2DLTA 4JKPL 4M4RA 5JDSA 1X5GA 2VZ3A 2BNQD 5F7EH 1JYXA 1NGYB 2AJSH 2V7NA 3C5ZC 3OG4B 4EN3D 5AD0A 1FE8H 5DQ9A 3UTSD 3QI9A 1I9IH 3TA3B 4LMQE 2DQFA 4OLWL 4LCWB 3UTTD 3RJQB 4L3AA 4V2CB 1B2WH 5D2NE 2CRIA 2XTJB 4F57L 1W72A 3BIKB 3CMGA 5CWSA 4JQIH 1HQ4B 4YDKH 4RQQB 3IDGB 3OG6B 4XNZC 4O9HH 3MLRL 1CFQA 3BQUA 4HC1H 4JFFE 4E41B 3FFDA 1R5WA 3WHE1 4YHML 5J9PB 2W9LA 4ERSL 4NNYB 2A0LC 3RI5F 4TOYH 1VPOL 4UZGA 2GTZA 3TWCH 4O4YL 5E6ID 3ZYJA 4UTAL 1QLEL 3T2PA 4OBSA 5T33L 4XP9H 4G80B 3TGXA 4RNRB 2VERN 3ULSA 4S11A 4HDIA 3UBXG 4BH8A 1JFQH 3FONA 3SDDA 3VDCA 3P9MA 1RULH 1CDBA 3U83A 1I8LC 2OJEB 1OAYH 4LCCA 3DBXA 5IBLD 3ZDXE 4NRXB 4Y5XA 5CUSL 3O8XC 1VA9A 1S9YA 3WFHA 1DE4A 4GW5A 3WLWD 4JFFB 1RHFA 4E41E 1KELH 4P3WA 3RTQB 1GIGH 2D2OA 2OTWA 3MSPA 5J6HB 1OGTB 4PYGA 1KXVC 1ONQA 1FPTL 1T2QH 4QOKB 3B6SB 2OMNA 4MA3B 4Y5VB 5MI0C 4NKOB 3H7BB 4POYA 1G7JB 1LD9B 2YK1L 4JFFD 3DO7A 5EZOH 1MJUL 43CAB 4JB9H 1ZLVK 5C0BA 1KTDA 1M7DB 1VB9A 1WFOA 1R3IH 1ZHBA 1L9NA 1CG9A 4PRPB 4ZAKA 3O4LE 5C07D 1FN4B 1T1XA 4LHUD 4DEPB 4ELMF 1WCBA 2EE3A 3WFCL 2FGZA 5ANME 4WW2C 2AEIT 5HHMB 4HGWB 3HMXL 3BJ91 1N0LA 1X5FA 1TDQA 4JFZH 2VDPH 1EHNA 2A2QT 2X1QA 3MGOA 5IB1B 3RA7L 1IEAA 4R4NC 3PIQB 5IHUH 3VXOA 3MRBA 5JHDB 1CFBA 1A9EB 1EDQA 2EKSA 3EOBA 1YPZB 3U36B 2MKWA 3E2HC 4DVRH 4LDEB 3PGFL 5FKAA 4ZSOA 4XNXL 1CFVL 1UEYA 1UJ3C 4KKNA 1INQA 3IF1B 5FECA 2CMRH 2AEPH 1I3UA 1P4BH 1XGYL 4APQB 3BYTA 4O2EB 1JGVL 4PJAA 1JHLL 4HFUL 4TVSa 4WNQA 2A6DB 3C87A 4PD4J 5DR5L 4OCMC 5I1HL 3QUXB 3MGAA 5CJ5A 4P9HH 3TA3D 3V4UH 3CMOH 5EWIH 5GS0C 1FFOB 1TZIA 3VH8B 4XVJH 5DVLA 3HMXA 1RUMH 1NMCB 3MROB 1P2CB 1KCUL 5DFWH 5JW5A 5F44A 3QEUB 2DQIL 4JFYB 1RJYA 3DRQB 4XI5D 5IBUB 3GBML 4GRLC 5EUOA 4D9RD 4UNUA 4ZO9A 2R0WL 1JPFA 3L5XL 2HKHL 5BS0D 4MWFB 5IB3A 4NJ9L 5M94B 2VOTA 1UACL 3O4OB 2ZZUT 4Q0XH 1DQDL 2UY7A 1F2QA 2X4RB 2C9AA 4UV4H 4PJ9D 3RL1B 4ISVA 3NFNB 4HWEL 1RUAL 5L0QB 1U8QB 4XAKE 5ANMA 2JB6B 4L8BB 1IEHA 5EU6E 4WW2B 5IQ9B 4KGLA 3JV4A 4RISL 4ODSH 2AJUL 3TIDA 3B9EA 4HUVB 4XVTH 4P5TA 3SDCD 5JO5B 2IBBA 3CIQA 4DAGH 4XAWH 4OD1L 4LIQH 2ZKHL 1YZZA 4KK6D 4OD3H 1U93A 1ZTXH 4IOIB 3SDYL 2ZCLL 4KHXH 4NZUH 3MGTA 1JNJA 2VYRE 3D3VB 5DUPL 5IESL 2VE6B 3GHBH 3HA0A 1ZGLP 1ZANL 4OCYH 4PJ5A 4YHLH 5E4IA 4PY7A 1QFHA 3KHOA 4P2RA 2YUZA 1MIEL 1D9KA 3S88H 4GG6F 4R8WL 3QHZH 3OKLA 4EXPX 1BVLA 1M7XA 2R4RL 3RX7A 4BZ1H 1Z0NA 1IAOA 1T1ZA 3UC0L 2G60L 3BEWA 1C1EL 3TZVD 3I6GB 1A6UL 3J8F7 2CGRH 4HC1L 1S8DA 1DCLA 3P11L 4MJ6B 2WUCL 3T0XA 1U8OB 5I76A 3IJSA 4LAJH 4LVEA 1A3LH 1FVCB 1FLTX 1ZLUH 4QRRA 1CGWA 1ZA3B 4QHLB 4HLZH 4OF7A 2HT3D 1A7BA 1XEDA 2F8OA 5I1CL 2EDRA 3MRIA 3AY4C 3QXVA 5FGRA 4TUOA 5GSVA 2FR4B 2CH8A 1PY4A 4OLYH 1A3RH 4AMKH 4G8IB 2ZUSA 3QISA 3C8KB 3ARGA 4FZEL 2FBJH 1A6VH 5T1DH 2CK2A 4FP8L 3CUPA 2W0FB 1HEZA 5EUOB 1EZVY 2FB4L 3EYUL 25C8H 5T5NF 3TF7C 5ID1B 1QR1A 5E4EC 2BSED 4AM0A 4HQQH 3ARSA 4NPYB 5LCVH 3I6KA 4JFQB 3U30B 5TDPB 3QDGE 5TE6H 1QRNA 4MAUH 4R4FH 4YWGH 2QEJA 2MJWA 1UWGH 3RY5A 4XNZB 3GSRB 4N0FB 1B0RB 4L8DA 4M6OH 1WC7A 3IU4H 5I8KL 2ICWB 1QSFB 5FYKU 2G5BB 2YC1B 2HJLB 1Q0YL 2V9TA 4PGEB 3SCMB 3ROOB 5E70A 1MFBL 4PLNC 2OMBA 2WUBL 3RU8L 1FL3B 3G6JB 3HG1A 4I0PC 2R1XB 4FQHA 2C7UA 3D1MC 4MLSA 1MLCA 4DN3H 5AEAA 5HHNB 3CXHJ 2I07A 1I4FA 1L0QA 1BVKB 1TJHL 4KRPB 3G9AB 3GMPB 4IRJB 4S0SD 5JMRA 4X8JB 5TE4L 4P2OD 4BZYA 4TSCH 3S4SB 1FG2B 1QHPA 4K7PX 3NTCL 3MV8A 1LE9A 3WD5H 4R7NA 4N0CC 1BIIB 5D7IA 1UVQA 5CHNB 4LLDA 4HUMB 5SWZA 3U48A 4K9EH 1XIWD 5DVNA 3OKMA 3AREB 1GIGL 4LBEA 4PJ9A 3S35L 3V7MA 1OAQH 3AUVA 3RGVC 5IHUL 2I25N 4KQ4H 1KCLA 4P3DB 4JPIB 1YNKL 1K8DB 5C0AD 3T2OA 4G43B 1U92A 4LVOB 3UTQB 4O58L 2CUHA 5TDNB 1S7RA 3O6LL 3V5DA 4NNYA 1IM9A 1J8KA 4XC3H 1AKJD 5EN2B 4JVWA 4HUWB 3VRJB 4FQJH 1WIUA 2BERA 3MV7B 1E0OB 4HXBL 5FOBA 4XNUH 3WSQL 5MI0B 3U82B 2W9DH 3OXRB 2CLZA 2ARJA 3MBEA 1CYGA 4EN3C 5D2LB 2AJZB 3MV9E 1JV5A 2CO7B 2L7UA 3OBAA 4CGTA 5C0CB 4Y8DC 4NQDE 5JXAH 4TVPL 3TLRA 1YY8A 1ETZA 3FMGH 1UXSA 3KXFB 1DBMH 4KKCC 4WHTB 1FH5H 5KVEH 4DOHB 3RGVA 5E00A 3REWB 3NIDE 3UJJL 4YHZL 4UQ3A 3RY6C 3NCYP 3EYQD 3PWUA 3HZVB 3P9WB 1HYSC 5CP7B 3F7RA 4XPAH 3VGEA 4KQ4L 5D72L 1FGVL 5CKGA 5BOZG 2HFGL 4TTDC 2AK4A 4XNQA 1N5AB 3KYOB 2XA3A 1ADQA 1PKQA 5CP3A 3HFML 4PJEA 3VH8A 1UACH 1QTYT 1FP5A 3PHOB 1AE6H 4XGZA 5JZ7D 3WSQH 3GSOB 3M1BA 3RI5K 1J05A 3AS2A 2JB5L 1NAMH 5HHPA 4L5FH 2A6JB 3IVKA 2F74A 3DETD 3DURA 2AJUH 3QIUA 3GJFH 4U33A 1KV3A 4KMQA 3PGCA 1L0XA 2WP3T 4NQSA 2O5XH 4KVNH 4LASH 3I75A 4LVOC 1GGCL 4ZAKC 1RZKH 5E0QA 1RK0A 3JZ7A 1XF3B 5DLMH 4NN5C 1I7TB 4AEIH 4LARH 4JRXD 3JUYA 1ZT7A 3FHQA 4DZBA 2C3WA 1ZOXA 3EDEA 2BSSB 4B0MM 4FG6C 2QQNH 5GRJL 2ZNXA 1HXMA 2JTDA 2VLJB 3JUZA 3GI9H 3EOYG 1H3UA 2Z4QA 5ISZA 2HAZA 1RZGA 5BV7H 5F7YC 2M26A 3QEQE 3OXRA 5D7SL 4M8QA 2NY1B 4XWGL 5L7XL 5AZEH 2V9QA 4MX7A 4P2OA 3CFBB 5TF1H 1WZ1H 4ONFH 3HNTH 2EH7L 4GLRI 4M7LT 1JPGB 3SO3B 4LKXB 3RZWA 3ZTJG 3HMXH 4NKOA 5CIPB 5E95B 4LP4A 1A2YB 2HWZH 3OWEA 4G3YL 3FRPA 1KPVA 4Z7WF 1BVKA 2WAHA 4PFEA 1KGCD 3VFOB 4HK0B 3EFDL 4NUGL 4R8WH 3UYOD 3VFTA 4LSPH 4GBXA 5IFAH 1XGQA 2YA2A 1KACB 2X4UB 4I3RL 4KROD 2QQNL 1WBYA 5LAXA 4P2YA 4A6YB 4ZXBA 1QVOB 5I19L 5ITBH 3MACH 3SE9H 4Y88A 5IG7B 2LFGA 2QADB 3GSNA 4PGZA 3WIIL 2DLFL 4E42A 2BHUA 1J8HE 5KW9L 1NGWA 2R2BB 2BOBB 3UTZA 4JRXE 2DM4A 3MRHA 3ZT5A 2E7CA 4UTBH 3EKCA 3G04B 3RX5A 1A7NH 1HZHL 5DD0L 3QA3A 1MHHB 1UH2A 2VLRA 1J0HA 1T21A 4MA7L 2Y4SA 1NL0L 4UBDD 3GJFA 4JE4B 5BXFB 2NTFA 1NFDB 2YSSB 2EIDA 4JO1L 5HYJD 4X7TB 1DANT 4JDZA 4Y4KC 1RV6X 1EXUB 2K3TA 1IAKA 1ZHNA 2BNRA 3BYYA 4GRWE 3G6DH 4H8WH 1BWMA 4QRPA 1H3XA 3GBMH 2HTLC 4KY1L 4FTVB 1IQDA 3PDDA 5TGBB 3ZKMC 4BZ2H 3OJDA 5DGRA 1K8IB 2WINB 4N9OB 4WEMB 2FO4B 3NACH 2CIIA 4FXGA 1I3GL 4KI5C 1FRGL 3ECBA 4GKOA 3GMOA 1VPOH 3VFNB 4X9BA 4F7PB 3HMWL 3I6GA 4OD2A 4YBQD 4F7EB 5FYJD 3TN0D 1CXLA 3RDTA 2EYSA 3QIBC 3VU2A 3LS5L 1BD2E 2X6MA 2VXTL 4RGMC 5LXGL 1D9KB 1CTOA 1DQDH 5JHLL 4U2ZA 2FHCA 3SBWA 4ZFOA 5HBBA 3GJFK 2H3NA 4C56D 2VAJA 3TC9A 3GIZH 2XV6B 3EYFA 4PS4L 4XI5C 43C9A 2Z92B 5BS0E 1F8TL 5ADOH 2VIRB 3VGBA 5T5FL 5DEZA 1VFUA 5GRUL 4PLKD 1UQSB 1RHHA 1D6VL 3CFDB 1TITA 4YPJA 4KMTH 1F90L 5GGVL 1HXYB 1YQ2A 1U58A 2VQTA 5T3XH 4XAKD 4MGXA 2EDQA 4O02H 3QCUH 3KR3L 3SGDH 2YXMA 1MHCB 2NXZB 1GGIL 4ZQKA 1XF4A 1H15B 1TJGH 5E5MA 2FX7H 3RZCC 4G7YL 1SYVA 5IROC 1E4XL 1DFBL 4M61A 4Y4KD 5C08E 5IHZB 3MUY1 3QPXL 3KPRB 2R2EB 5L2KD 4ZO6A 3D5OF 3ZE2F 1JTOA 1JUFA 2IWGA 3GIVA 4OZIA 3DVIA 3ZT6A 2JB6A 5SX4I 1A3RL 3JV6A 4OSUH 5EO1A 4DVBA 1OAKH 3C60C 3HC0B 4ORZC 4LFHD 3VJ6B 4JZJB 3QUKA 5DI8B 2DBJA 4Z0XA 5L2KB 1UM4L 4R97B 2R1XA 3OAUH 3VFPA 1A1MB 3L5JA 3DX9B 4OLUL 5C07B 1A3LL 4MAYC 1DQJA 4AEEA 4R0LC 1MIML 3WE6A 1X4YA 3MQIA 2HT2C 4PV8B 1SVZA 2YR3A 2YC1A 4OV6F 5JPMB 4QF1A 3LKSB 1UEMA 4L8DB 4OLYL 3SKJH 3IJHA 1NEZA 2X44D 5M95B 4RGNB 1ZK9A 3T3PE 4GG6B 5DUBA 3SJVB 2IALB 4P4RA 2XICA 1LE5A 1IC5H 4U1JB 4KK9C 1QOKA 3DVGB 4HIIA 5KVDL 1HHKB 4YXLH 5E8DL 5I1IL 1Y0LA 1D9KD 1IJ9A 4ZUSB 5JHDE 2BVPA 4H88H 5IMLA 3O3AB 3QEQD 3UTPD 1BWWA 3PQYD 3SDAA 1YEGL 2JJSC 1MFAH 1W2KT 1FDLL 1YNTA 2DDQH 2FECL 1RULL 4FQLL 5DJCB 4HS3B 4HJ0D 5TF1L 1MCPL 3BPLB 5DRXA 1JRHL 1MIMH 1KIUA 5D7KD 4XBEH 1E4KA 4KKBC 1YNLH 5JZ7C 1U8KB 3A67L 4ZS6C 4ONOA 3DO3A 4MD0B 1CFSB 1B4RA 5AZ2L 1XAUA 4F58L 1G6RL 1LEKB 4Q9RL 4KDWA 1ZGLM 3MTRA 4O4YH 4TNVF 5LJYH 2AQ2A 1F6FB 1EBPA 2CKBB 3UTSE 4UTAH 1J1XH 3FQXA 3O6LH 3C60D 4XCYA 4I2XB 1JGDB 3UEZA 3WIHA 5JORA 3HAEB 5EOQH 4P2QE 1I7RB 4DUWA 3LZFH 4X99B 5J1AA 1WIPA 4PG2A 3MLVH 2J1KA 1UG9A 4LSTH 5L7XH 2H2PC 3HI6L 1FNHA 3P30H 1RQ5A 3VG0H 5DVMA 3L9RA 1MREL 3K80A 4YDJA 3VWJA 1IBGH 3E2HB 4B7LA 1A3QA 3D25B 5B39B 4XCCH 3TT3H 3OGCB 4N0CD 3T0AA 4H26B 2J6EA 5DJ8B 3CD4A 4LF3B 5TQ2H 4PRPE 4ELKB 3T1FA 2E3VA 1ZLUK 1CLZH 1FIGL 1FO0B 5AAWA 2J8HA 2VTFA 1J12A 1I85A 4Y5XB 2Y7QA 3GEWB 3BZEB 4GKNA 1FC1A 4JZJC 4RNRA 5FM8A 2NY3C 4P49A 2IQAB 1FNEA 1FYTB 4NP4L 2IPKA 5LGHL 5EZOL 3BW9A 2DBLH 3MPCA 3ARDC 3BH8A 3ULVC 1UM6H 1U8NB 2XIDA 3OX8B 3QQ4A 2FBOJ 1BJMA 1EUUA 1N59B 2V2WA 1JPST 1A14L 3BPOC 4HIEA 3W0WB 2Z93B 1DUZA 3ZT7A 4OZGA 1N26A 5KJRH 3JTSB 3O6KH 4W4OC 2V2TB 5EZIH 5CWSB 4NN5B 3BHBA 4RZCB 5CEYB 3QJHA 5DMYA 4LCWA 4P9MH 4M6NL 2XA8H 2A6DA 3D39A 2IAMA 2UVFA 4FZ8L 1NC2A 3FAWA 1UJ3B 5C07E 2ZSVA 3CK0H 2QQLL 4Z77B 3S96A 2VN4A 4YDVB 3UTSA 4GAFB 3SEPA 4CRPA 1EH9A 5KANI 3Q6GH 5HPOA 3MRQA 1C5BH 2A83A 2GQHA 4HQQL 2OR8A 1KCKA 3TNNB 1NBVL 4LSUL 3WS3A 4JN1H 3BGFB 2GK0A 2VZTA 1ZE3C 5FCUH 4OFYD 3ARED 3D9AH 1T5XA 4OFVA 5IF0A 3ILPA 1PDKA 3QUYD 3IDNB 3ZL4H 2FEEI 1G6VK 2A6KA 1BEYL 4JKKA 4PJDA 3QDMD 2MQCA 5F1NB 5I18L 4RX4D 3S4SG 5A43C 4H0IA 3QUML 1IGML 3QJFA 3JWDL 1VACB 4J23A 3S36L 2X7LA 3MRPB 1MCIA 2LVEA 1U9KA 4YXKH 1MRCH 2VLMD 3N50A 3FO9B 3GHBL 3KPQA 4YGVB 2A74A 1A1NA 5LBSL 4LLVB 1JN6B 4X6BA 4EDWL 1SBSL 3O45B 4JHBA 1LP9B 1U3HC 3VXRA 5EU5B 1BBJB 5DA4A 2XZCH 4U3CA 1CL7I 3M8OL 2DQDH 1KN2H 2R56L 1U36A 3MXWH 1OGTA 1BD2B 2V5RA 1YMHB 3QXUA 5DK3A 5C70A 5C0IA 1RVFL 3B6SA 1FL5B 3RJDA 3V0AC 3EIFA 2XWTB 2R0ZH 5HGHB 4NHUA 1NFDA 3OTTA 4AEHL 3GGWA 4GAYB 5J6HA 1YEIH 3WFHB 3GSWA 5CLTA 3O81A 3KG5A 4M48L 3GMLB 1YN6A 2CDEB 5I15H 3BMVA 4UNVA 3P9MB 3K0WA 1RD6A 3LHPH 5DQJA 2ERJB 4YHOH 3MLWL 2F58H 4TPRH 2FH6A 4MVBD 5IVXA 2ADIB 1NGPL 3RWDB 2OXHA 3WFBH 4PJHA 3T0EA 1CF8H 1VDGA 5D1QA 2K7QA 4CU6A 2B0SL 1IGCH 4WO4C 4J3OC 3W2DL 4ZTPH 4I9WE 2E7LA 4U1KB 1TJIH 4KTDL 4PPTA 3RBGA 2W60B 1A1NB 1BJ1J 2PXYD 4HULB 4NT6A 5HDQL 5IWLC 5EB9A 3LQAC 3EO0A 5BS0A 2B2XH 3TVMC 3ZKXC 4QYOB 4PRID 5IEHB 1CK0L 4I3GA 1Q1JL 4G6FD 1KLGA 4HCRL 4N68A 1AE6L 1PZ5B 4UNTA 4JB9L 4RAVA 2X7LB 3LZFL 3FQRA 4PJFE 4OIIH 4YHOL 3VRIB 1MUJA 3X3FL 3PP4L 4PJ8A 1T5XB 3T09A 2EE6A 3L5WA 4C58B 3MCKB 1QLRA 1HDMA 1AGFB 4EI6A 4XNYH 1KG0A 3IDJA 4XVSH 4I8DA 3HMWH 2DL9A 3WFCH 2OQJA 1ZT7B 5DWUL 1TXKA 1NCUA 3QIWB 4F58H 1FFQA 2G75B 3MYZA 4P5KA 3CCHB 1JK8A 5HYQA 2BXZA 2QADD 2DQEL 2R2HB 4N8CH 3UYRL 2VH5H 3T1WA 3MV7A 3QQ9D 4YPGA 3HNVH 1C8PA 2BVOB 2AJVL 1IM3B 5I2IA 4K7FA 1JPSL 1UYWL 1A7QH 1AO7A 4ZD3H 2L0DA 3VFVA 3X12B 3EO0B 4P3CH 3RQ3A 4DKFL 4MA8H 4MCYB 4LQFH 3FQWB 4HCRA 1UZ6F 5FEBA 1ZMYA 1T4KA 1E6JL 4N5EC 5KSAC 3JVGC 4Z7UA 5TE7H 1WWAX 1UM4H 1MVFA 4YC2B 1CVSC 1XR9B 1MFEH 3I6LE 5GPRA 4PJGF 4X8XA 3IFLH 4XPHH 3WJJC 3WIFA 4TVPD 4GS7B 4S1SL 4U49A 3DV6A 2HMIC 1J1PH 2DQIH 5EZJA 1DLFL 1S7VB 4JHWL 3PABA 1A6ZA 4KAQH 2VNCA 4MJIE 4JKWA 2ED7A 4RFEA 3QSKB 2CDGA 4HAFA 1GOGA 1R3KB 3MLXH 3MRKB 4QRUA 3VFUA 4NJAL 2X70A 4HXBH 4MJIB 4TNWF 5IKCB 3IDYC 4P3CL 1G9NH 4CUCA 3BSZH 3C6SA 1JWUA 1MJ7L 4NO0D 4I18A 4U7MA 3WFZA 5DJAA 3VRLE 4PJ5E 3JWOC 4ZS7L 1YDPA 4KTEL 4AG4L 5J1AB 1PJ9A 2YBRB 1NCDL 1H5BA 3T77B 4GKZB 4PBVC 4QRRD 4ZFZA 3ARYA 1ED3A 2X9YA 4X9GA 2VDLL 4JRYB 2PTUA 3O0RH 4NKIH 1U2CA 3WIHH 4FQ2H 4LAQH 3KPOA 2FL5A 4PUBH 2F19L 3SKNB 3CK0L 4RAHA 5GS1C 2E7MA 4KHTH 2VXSH 1A4KB 4JFED 1QBLL 4LDLB 4ENEC 1L0YA 1S78C 4PJCB 5JW3H 3ARFC 2NY4C 3G6AB 4OGXH 4PRNB 3B5HA 1LVEA 3MRPA 4P5MB 5CILH 1ZLSL 4A6YL 4PJDE 4TRPL 2AABL 1TVHA 5T3ZD 4MNQD 3PQYE 2AKRA 2VLLB 4OQTH 4B41A 5DRXB 1RVFH 1YJDH 1FL3A 4MB5A 2Z31D 4M03A 3LS4H 4GW4B 2UWEB 3D6GA 2V5MA 3QI9D 2ZUVA 5HI3D 3DRTA 3TFKD 5T5NG 2DB8A 1A6AB 1EEQA 5IFJB 5LXGH 2VDLH 1ZT1A 1T7ZA 3ZLQC 2CDFA 2IH1A 2PUQT 4XBGA 3IS0X 3EZ8A 4MZ3A 5B4MD 1IGJB 2F58L 5E2WH 3MV7D 3QEHA 4U7SA 2V2TA 3G5XB 3DGGB 3UPRB 2O5ZL 3NH7H 2DQDL 4HIEB 1N0XL 3VGGA 4U4BA 3WLWC 4NM8L 2ZOLA 3UPAA 3IDXH 2EECA 4QXUL 2R1WA 5FA3B 1OAZL 1NBZB 1QSEE 2VR4A 1ERNA 5L0QC 3B9VA 3VD3A 3TNMA 1OTTD 5T1LB 1CD8A 2XTJD 3VG9B 3QQ4B 3U46B 1NCNA 4I2XE 4OV5A 4KZDL 4AENA 1J1OH 5CBAA 1AKJA 3CJJA 5ICXA 4V1DE 1GZQB 3VXMB 2YA1A 2ZP0T 3HZYA 1I8MA 2BFVL 4C55A 2Y9RT 4GFTB 2N1KA 3TBSB 3W9DB 3UMTA 2A9MH 1CDYA 2CKBL 1LK3H 3EJYC 1AH1A 2N7AA 2QR0A 4HPYL 5CZKA 3VXQA 5D6DA 1ZVSB 1WBZB 4IRZL 4ZUVA 3DMMA 1D7FA 3VWJD 4EJ1C 2W07A 2VLLA 4FZ8H 1OW0A 3BDYH 4ODXB 1MCRA 1HHGB 5ALCL 3O6FB 3FN9A 3CPLA 4O5LL 2UZXB 1X5LA 2OSLB 3VGDA 3BKML 1U8HB 3U46A 5HY9A 1KNOB 4ONHA 1JTPA 3BXNB 4NQUA 2CLVB 3CZJA 1U2HA 4L4TD 5ICXB 3Q0HA 2Q76B 5CEZL 4LP5A 3U7WH 4DJMA 1NFIB 3MJ9L 5J3HD 2PNDA 1MI5B 2EEDA 1RZIA 4LKCB 5JOFA 4G8GD 1JVKA 3ECBB 2VSDA 3PDOA 1G7QA 3QQ3B 1VERA 4PJFF 1QZ1A 1NFDE 1ZEAH 4NWTH 5FHBH 3MJ7A 4JPVL 3PWVB 3V7AE 5A3IC 1VFAB 3ILQC 3MMEA 1BOYA 4HJJL 4KFZC 2XPGB 2JKXA 5EC2A 4GRWH 1IQDB 1ZT4B 1ODAA 2OJZH 1CD9B 2CLRA 3QCUL 1K5NB 4KXZI 5FYKH 1G1YA 4JKMA 5GS0H 2R0KL 4FP8H 5EU6B 2PW2B 4O5LH 3VXUD 1AGDB 3BWAB 3K4DA 4B53A 4M5ZH 3Q3GA 5ESQB 3KHQA 4G6AD 1W0VB 3H3PH 3JTTB 3AAZA 2X09A 4OIAA 2GJ6B 3L3OA 1ND0B 4J3SA 4AT6A 1HI6A 1SJHA 3TVMA 4ETYA 4PV9A 4WI7A 1FCGA 4AG4H 3I02B 4N9GB 1BJ8A 3LVEA 5DF0A 4Y0GA 4JPVH 5A2IH 4KDVA 3LKPB 1T1WA 5BV7B 3NCEB 1F6AA 1XH3B 5GRWA 4JFEA 1U6AL 3MRDB 1VHPA 1S7XA 1BD2D 2C4FU 2YA0A 4PG2C 4QRPD 2GAZA 5CEZE 3TYGH 1JZ8A 4Z5RA 3BO8A 1UJTA 3HRZB 4G80A 1NCBH 3MLXL 3VFPB 4GBXB 5I8CA 2P44B 4MJ5A 2DYPD 2NLJB 4X80H 4CN4A 4PY8I 4DKDC 1IC5L 3IAGC 4FQXC 1IZKA 1VESA 1WGOA 1OLZA 2LVCA 2Z31A 3PL6B 4MQXC 4RMQA 3DYPA 5I2IB 1UFUA 2FSEB 2W9DL 3HLAB 2Z35B 1K4DA 3CFIC 3DX7A 3FFDB 4P46A 4U1HA 4W70A 3P0VH 4DKAA 4HJ0C 4M6MH 5T3XD 2VLKE 2QADC 4ERSH 3SKUD 2W59A 1MCDA 4RISH 4U7KA 4BKLA 1MOEA 3CPLB 4PJGB 3QEGH 3FOLB 5DD1H 1T80A 1M71B 4NN6C 1TQCC 2VLRD 4W81A 3S3SA 4U0RC 3WL9B 2WWMD 4OM1L 5KAQG 1DQQB 1ZXQA 4OT1H 2ZSWB 4OZFA 1DP0A 1QKZL 2XKNA 2GHWB 4HFWA 3O9WC 2HWZL 3VFRB 3KYNB 4M7ZB 4X6EB 2OXGA 3TPUA 5ERWA 4WW1B 3VRIA 1U8JB 1HNFA 1TVBA 2QQLH 1U3HA 4EEEA 1ACZA 1G7MA 3UJIL 1DEDA 1EO5A 1EEUA 4HUKB 1RZKC 2W0KA 3S35X 2VDMH 3WNOA 1C16A 4G8FA 4OF0A 2I9TA 1XGTA 2P8LA 1CLYH 1MCSA 3LV3A 3D3VD 4JKLA 2F53A 1EO8L 2QBWA 4JDTH 1F3DH 2EYSB 3T0ED 3K4ZA 3PL6C 4PJDF 2AXGA 4OCXL 2D7PA 1N6QH 3FQWA 2CIKB 2GEEA 4Y5VC 2DJ4A 1AFVL 4WV1C 1B4JL 4CKVX 1R5IA 3S36X 3MNVA 4O2CB 1JMZA 3QNYB 1GPOL 3O3DA 4JJ5A 2XTJE 8FABA 1E27B 5C0BE 2HTLD 1OAXH 2H45A 1B0WA 3SDXA 5GIRB 1IT9H 2FDBP 1T7VA 4X9IA 3NGBC 3VFVB 2CPCA 4FQXD 4GAGH 1CT8A 1JWSB 4N0UB 5DQDL 2BNRE 3S5LB 4ZODA 2EE9A 4P2OC 4ZPVA 2FB4H 4U1LB 3T8XB 4TSBH 3GMNB 1KUMA 1U8NA 1T1YB 2A9ML 4M62H 5CGMA 1JGEB 1FV1B 4G8EA 2VDML 3BISA 4QHMB 1N2RA 3U4EB 4LSVL 1UC6A 3MXWL 4LGSB 1T04A 2P5WE 2VDOH 1DBAL 4JFOB 4UT7H 4GT7A 1EIBA 2AJZA 4WV1A 1PKOA 1LK2B 3QNZA 2VXQL 1JMXA 4L4TA 4P4KB 5BZWB 3LEYH 1MLBB 2JIXB 4Y4FA 2XN9D 1OGAD 2QTEA 4XNMB 3BKMH 3D0LB 3KYAA 1T03H 3FB6A 4LVNB 4KKLC 5D9SA 4FQCH 32C2B 3BP4A 2ZG1A 3N1GC 4QXWA 1F3RB 1MJ7H 4U1HB 2BK8A 2GT9A 4Z0BL 3SKOA 4BSJA 4HK3N 4RAUA 1AIFA 4RIRA 3CVIH 3GM0A 5FO8B 4PJCA 4AH2B 2ZJSH 3MX0A 3QIBA 1D5ZB 1CGVA 1K8DA 4MNHB 4NT6B 5DJDA 4H8WC 4X7DC 1DZBA 1WFNA 4FFZL 5DRNA 5GS0D 1I7ZA 4PJXF 1PX4A 5F9JA 2ZG3A 2P48B 4KK5D 4QGTA 5CHNA 1H3PH 3U4BH 3U6RA 3PE9A 3TBWA 1E4WL 4GMTL 1E28B 2VDNL 5C86A 4EUPB 3FOMA 4XAWL 4GAJL 4ODVL 4O58H 4M1GH 2VN7A 3MRQB 3QEQB 1B3JA 1LO3L 4GQ9H 5C09A 4JJHA 3KGRA 4ZPTB 5IIEB 4D8PB 1YQVL 3RVXC 2PETA 1IGTA 3FN0H 4A2MA 5C0JB 4C57C 3I9GH 2ADJA 2CRYA 1CFTA 2AABH 4MNQB 5DMJB 5I1AB 2F8XC 2BNQB 2HT4D 3CZFB 1A47A 3NFSH 4ZS6D 4XVSL 5J6GA 4ZUSA 1FNGB 3WKMH 3G5VB 4OD1H 5EPMB 2VDQH 1QEWB 5D6CA 3AAZB 4WFEE 2DQJH 4ZNEA 3SBWC 4LSSH 1MCOL 2P49B 4P4RB 2BY3A 5C2UB 2V5TA 1TQCB 2A74B 2I26N 4ZXBC 2LV4A 2V7HA 4OFDA 1J87A 3IVKB 4OB5L 4WO4B 5JUEL 5A3ID 5C0CE 5DJ2A 5HPMB 2Y06L 4FTVD 5ESAB 4UOW1 5ENWB 5HI3C 2E6QA 3C60A 4OKDA 5MENA 2ICWI 5EBLA 2D31A 4NFCA 1I3RB 4U0RB 4U1SB 2CXKA 4NC2B 2RGSA 3HE6B 3V4PL 1MCLA 3TM6A 3PNWB 5HGDB 1XGRA 2AK4B 3UO1L 1KPUA 2GSGA 3Q5TA 1MY5A 3GK8H 3LAFA 3OGOE 1GSMA 2JIXD 5HDLA 3FO0H 1MH5B 5B22A 1CU4H 2XWJB 2NXZD 3QUYB 4GRLA 4OTXH 3CX5J 3LN9A 5K9OB 5J1TC 5ACZA 2P5EB 3U7YL 4I0KA 2VB5A 4MQSB 4QWWD 2F54B 2JCCA 2NY3D 4F15B 3OKKB 1EJOL 3BDYL 4PJ5B 1SM3L 5FKPB 1ZS8B 3GSNH 3O6FA 5DS8B 5CSZA 5B38A 1E4XH 1I1AA 4ZFOL 5TPWH 5ICZB 4D0CA 1IFHH 3W9DA 4N8PA 3HAEA 3UBXB 4NJAH 2WUBH 4MXQD 3LPFA 2H2PD 4R4BA 4RRPA 4FXKA 5GRUH 1YN7B 1BGXH 3LHPL 4FQXB 3MLVL 5D2NC 5E6IC 1FZKB 2CMRL 3AREA 4TUKL 2OL3B 4PRDB 4PBXA 3ARDB 5EO9B 3KLAA 3H9SE 5IEHA 1C12A 4LLAA 4Y1AB 3BN9D 3O2DH 4K3HA 1U92B 2X4RA 2FATH 1BX2B 2FJFB 3HZKB 5IP4A 2EXWD 5HYSB 4I0PB 3L3DB 5GJSH 2D31B 4W6YB 1DSFH 1UVQB 5EBGA 3BUYB 2YD5A 2L4OA 5E8OB 4JZNB 3BRDA 5FUOL 4H1LG 3RZCB 3G6JA 3HC3L 3HS0A 3ZDZF 3VRLF 2QKIA 4UAOC 1HN1A 3NA4A 2AQ1A 3NIDF 2V7HB 1A64A 1T2QL 4NBYB 1U3ZA 4GRMB 3B3IB 5FCSH 2WWMC 2UZIH 3T0BA 5C92A 5C09D 3ARUA 2XZAL 3L3KA 4Y4HD 4U6VH 3VD5A 1OGAA 3X3FH 1QA9B 1X5KA 3H7LA 2PYED 5ILTL 2DWEB 3CVHA 2YUXA 1TLKA 3S35H 4BA8A 2WUCH 5DD0H 1W0VA 3JTTA 5ETUB 1T66D 3NIFE 1SMOA 3VA6A 1ZLVH 2PW2A 3CFJA 1TZGH 3PDGA 3VXUB 1KEMH 1UWXK 2AXHA 4H0HB 3WNMA 3ABZA 5KVEL 4DGIL 4M1DH 5HHVH 3IFLL 4NO5A 4XPHL 3L3DA 2ADFH 2PYEB 5F3BA 3H3PL 5HXMA 2ZUWA 1S5HB 3UXFA 5AZ2H 4N8CL 2Y07H 1NCCH 3MRGB 1RUKH 2DTML 3NIFF 1B88A 4RGNC 3MRBB 5EBWA 4WTXA 1NC4D 3UJTL 5E8PA 1FVDB 1R5VB 4Q6YA 1Q9WA 1A7PH 1YECH 2CR6A 3WMSA 3VXRD 1N0XH 4KKCD 3MLUH 4Q2ZA 3A6BH 3V4VL 1A21A 1DBAH 5IHBA 2FR4A 4U05A 4MNGB 5FCUL 1U6AH 2DKSA 4IRJD 3LKNA 1I9RH 3P4OB 4L3EA 3SCMC 3VCLA 4Y19E 1ZKAA 4CNIA 2BJMH 3FFCE 4X7SL 5TJWK 1MCJA 4U3HA 3ELAT 3SE4A 2YD7A 4PJDB 2NY6D 1KJ2B 4NQEA 5CSGA 3RPKA 3W0WE 1ZHBB 3FCTB 1GH7A 1Z5LA 5C09E 5C6TH 4F7TB 5B8CA 5J12C 1JZ7A 1V3LA 2N56A 2EDWA 4K71C 1ZV5A 5DJAB 3VFGH 2AEQH 1NH6A 1HK6A 4QHNB 2NYYD 2F19H 4G42A 4D9QE 4OGZA 4KJQC 4LARL 1D5BA 1RFDL 3GRWH 4PR5B 3VXQB 4IOIA 5DJZA 1K6QH 5F6IB 3X13A 1AKJB 3GUTA 1KCRL 3W39A 1N64H 4JCMA 4UIKH 3VXPA 3MLPA 3BKYL 1SYSB 3K4AA 4KKLD 3CMOL 3QFJD 4CDGC 2XNAB 3L5IA 1U8QA 4OF3A 1NBYA 3KLHD 1XCQB 4OT1L 3RVWC 3RL1A 4JFDA 5F7WC 4PJXE 2IPUK 3BQUD 5F89B 4CADB 3SOBL 1PX3A 3X11B 4KUCF 3B2UC 3ULUE 2O93L 3HC0A 1X44A 2JJWA 1D5XB 3M07A 1N6QL 4OFIA 3W0WA 3IT8D 4ZPVB 4U6YA 4M48H 1IGYA 3AU1A 1INEH 3FO1A 4WFHE 3VXTA 5CKAA 4M7KH 5CEZH 4L3EE 5E5MB 1CLYL 1LO0L 1VGKA 3FFCD 3O8XB 5DO2C 4X6DE 3H9YA 5H94B 2EYRB 1KF9B 2RCSL 2FX8L 2KBGA 3OL2A 3KLDA 4L9LB 5D71L 2MHAB 4F9LC 3TO4C 4X6CA 3VMNA 1TQBC 1C5CL 2EDDA 4Y4KB 2Q86B 3W82A 1IM9D 4JFYA 2DQCH 2PXYC 4LIQL 5IK3B 3ARBA 4YPGB 1QSFD 4X6DF 5EA0L 1MCEA 1Q9KA 1DBML 3AFLA 2NY6C 4PJFA 4HH8A 4MQ7B 4XB8A 4NHCH 12E8L 1LO2H 4FMFA 4XBGB 3CXDH 4HG4K 1AY1H 4PJXB 2XA8L 5EU7C 4K07A 4J4PA 5DQ9B 2DIBA 4S1RH 5B8CB 5CZXC 3P77B 2GJZA 1WFTA 3EFDH 1EEZA 4NUGH 4P5MA 3V6ZA 4LSPL 5IFAL 1RK1A 5M7QA 2GSIA 1INDL 5F7NC 2JK5A 1B0GB 1QLRB 1VGEL 5FYKE 4X99A 4F7EA 1Q9LA 3R4DA 4OZGE 4PREB 3MACL 3SE9L 4L3EB 3ULUD 4MXWH 4PJIF 5GGRA 4Y16B 2YRZA 4ORGA 5IGXL 3CH1A 4OD2B 1R24B 1FFNB 2D0HA 2FD6L 1MAKA 3KPSE 4LU5H 4D9RE 5DYOB 4JANA 4MD4A 5DWUH 2B8OT 2FO1A 4UV7H 1CG9B 3QDJE 3HB3C 4N5UA 4EBQH 2NQCA 2FHBA 3T65B 4M3JA 1NCWL 3BIBX 3V5KB 4XBPA 2VQ1B 4AQOA 3HNVL 1IVLA 5D2LE 5FYLH 4P48A 2WBKA 2MHAA 1SEBA 2A73A 4Y4HA 4BQ9A 3S8WA 3QIUD 4CVXB 4TYUA 5DT1L 1QPXA 2APTA 4LBEB 2AV7B 3HI1A 4HV8B 5GGRY 3CFEB 3H9SA 3RU8H 2WWKO 4YK4B 5LCVL 4IRSA 1HHKA 1EA9C 1V3JA 5AYUL 1QEWA 2J4WL 3MLWH 1KB5A 3Q1SL 3C6SB 2JCCF 3EFFB 3EDJA 3OKEA 4WU7B 5C09B 3RWFB 5L6YL 3D2UD 3IDMA 3DV6B 5T5FH 4QTIL 2C1OB 3WKML 4EKXA 4OCWL 1G7PA 4HS6B 1CFTB 4WI6A 5ISZD 5I71B 4V1DD 3BVNA 1EERB 2OP4H 4PJGE 5C8JB 5D7IF 1GGCH 4GLRH 3GO1H 4LHUA 4U1MB 3QDJB 5JHDD 1F4AA 2DMKA 4OFKA 1CLZL 2VLKB 1L4IA 2ARWA 2VQ1A 3Q3GB 5ESQA 1PSKL 4LCCB 4YR6A 3VI4E 5MP6L 4I0PD 2DQHH 2EIBA 1TPXB 5DFTA 3I84A 2EZ0C 3BSZL 1PG7W 2R9HD 2H1PH 4K7PL 1GC1H 1OP5K 4TTDD 3VXSA 5HI5C 2A9NL 1LHZA 1YUHA 3QI9C 5DHYA 5GGRB 1QFOA 3UP1A 4HMEA 3ARRA 2Q8AL 4X6BB 3BIKA 2E27H 1IC4H 1HILB 2QL1A 1AFVH 3QXDB 1VFBA 3C5ZB 4M1DL 1N3NB 2E9IA 4GXVH 2NX5E 3TV3L 3OKDB 1FCCA 4PREA 4YHZH 3K1DA 4BUGA 1KCVH 1KBGH 1V7NL 1QBMH 3ARFD 2VH5L 4NO0B 5D2LA 4FA8A 1KPRB 4NUJA 3EOTL 4I3RH 2C26A 4V1DB 2YRPA 3ILPB 5FYJL 5EFIA 5K59E 3RNKB 5GRVK 4XP1L 4OZ4A 3BOVA 1OARL 1C5BL 3ZE0F 3S5LA 5E03A 3C2SA 2DLFH 3FKUS 4MHHI 4MQ7A 1T22A 4UT7L 3NACL 3P0VL 4W68A 2HLFD 5EU3B 3PGCB 4P57A 1BZ9B 2IH3B 2Q8AH 5ESAA 3JWOH 1U8MB 1I8IA 5EUKA 3BI9X 3ZE0E 1QRKA 4F80A 4F7MB 1ORQB 4U6XB 4CN1A 2FH8A 4WO4D 1G7HB 1FGNH 3RWGB 4KZEH 3JWDH 5GJSL 1BQHA 3VG9C 4KWUA 4RZCA 2FO4A 1QP1A 3AROA 4MMZC 1P69B 2VXVL 1D3CA 4PJCF 5FA4B 3G08B 2AJSL 4HZLB 4N1CA 3CX2A 3RWFA 5FK9B 4WW2A 4L1DA 2IQ9L 2ERJC 5E00B 3WN5B 4Y89A 1F5WA 4U1IB 3DV4B 4BUHA 3T0EC 5ADOL 2CK0L 3MOBL 5C08B 4HLJA 1T7YA 4Y5XC 1K3ZA 4HKXA 2G5BA 2ZUQB 4K94H 3P3YA 3GGWB 4WFGD 2ITCA 2O5XL 4LSTL 2YD9A 4XMPH 3KYNA 2FJFA 4CMHC 3ES6B 3GSRA 4MDIB 1BHGA 3B8SA 4HWBH 3B5TA 4YAQA 1E6OL 2R1YB 4GRLD 3O4LA 1QRNB 5C2BH 1YEEH 4FQIH 4F2MB 2XXCB 1K9TA 5J3HC 5E9DD 2EH7H 3ZSTA 1BOGB 1UWEH 2YS4A 3OGCA 5BVPL 1CE6A 3QG7H 2X1XR 2GW5A 3MMEB 3ILQD 1I9IL 2AJXL 3HI6H 1WBYB 5FO7B 3QQ9C 1N5YH 5IGXH 1QBLH 1BZ7B 2DWDB 5DVKA 5BV7C 3IFOB 4TQEH 4D9LL 3WS6C 1A6WH 1KIPB 5F7DB 1KULA 1Z5LB 4HUXA 1I8KA 5I66A 5FGSA 1JPGA 3FTGA 3QR2A 4IOFD 4MXVE 4A2LA 3UDWA 5ALBH 1OHQA 4RA3A 4JPKH 2GI7A 3KYMB 3MRMB 4Q6IC 1FORH 1RAMA 1K2DA 1I1YA 4R7DB 4PG9B 4MXVF 5J1SC 2NYYC 1T1WB 1B0RA 4KJQD 4ETQA 4W6XB 1S7TA 4Y2DD 4HIHA 4F8QA 1R3IL 3MGTB 4FRWA 1EHLL 4HXAH 3CDYA 1VGKB 3O2WH 4HIXH 4NQCA 4MA7H 4IIQA 4JEGB 2ESVE 3LQZB 1G7JA 1LD9A 4AZ8A 1ZTXL 3SDYH 2CGRL 3FB5A 4Y19D 3MYJB 4I18B 1F4XL 3JV4B 3VFWA 3KVQA 1YA5A 5I73B 3MV8D 1FO0L 3I3EA 4KQ3L 5DUBB 3ZMRA 4PLKC 3DOSA 3D18A 1QR4A 2VDNH 2UV3A 1R3KA 4NWUH 3IAQA 3S88L 1Y6KR 1JPSH 3BJLA 1VEPA 5D4QA 1T03L 2D7TL 4FFVD 3ESUF 3MV01 4LSQH 5KVDH 1LO3H 1BGXL 3EUUA 4LOUD 5B8CC 1KJMA 4L4VE 5LWYH 1EAJA 3HE7A 4M7JL 3MUZ1 5BZDB 5SWSA 4L8SC 4K2UH 1WT5C 3REVA 3EDFA 4WEBH 4D3CH 3O2DL 3AY4A 4S1QL 1QUNA 5D2NA 4ZUUA 1QQDB 2BHZA 1BEYH 1FYTD 2HH0L 1JHLH 5FXCH 5FB8A 4OLXL 4F7MA 2IANA 1SBBA 2YD1A 4GRWF 2YPLB 1S8DB 2E9JA 2EH8L 4YDJB 1XF5A 4JFXA 4JLRA 3CSYB 4LRIA 4HUNB 3I50L 4R2GC 4NKMB 5AYQA 4F37K 2JF1A 1TZHA 2DM7A 3PXHA 4OZFB 2GSIB 3MOAH 1OM3H 1W72L 3RTQC 2D0FA 3AM8A 3OB0K 2X4OA 1RZ7L 1SJXA 2APWA 4Q58C 4N8VG 1QFPA 2DM3A 1QSEA 3PGFH 2NCMA 4Z76A 4NOFA 4YUEL 1DVFD 1FLRL 1KLUA 2VZUA 3F8UB 5D1XB 4ZTOH 3MJ9H 4X5WA 15C8H 3EAKA 2IBGA 3FHAA 5SWSB 4R4ND 3AXLA 4HG4J 1S7RB 4PD4K 3ULVL 3QI9B 2Z31C 2OI9B 5I6XB 1YMME 2GSGB 1JRHI 5FB8B 3SDCB 4P5TC 5ANMB 4HGMA 2KH2B 4X6DA 4L4VD 5D2NB 5HD8D 4TNWK 1F11B 1CU4L 2Z8RA 5SWZB 4NBZB 3O41B 4WI9A 1VGEH 3THML 2NXYB 3MV8B 1LE9B 5IB3B 2P8MA 3K2UH 4IDJH 4ZUUB 5HGDA 4Q9QL 5F21B 1TMCB 1HCVA 3WFBL 5F3BB 5BS0B 2AQ3A 4WI4A 4P2QD 3TYFA 4P46C 4K3EL 4RMSA 3NFPB 5HHOD 4JRXA 4R26L 2HVKB 4GSDL 2LU4A 2YXFA 2IAMD 3LRSB 5AYUH 1C1EH 2BRQA 2V17H 1NEZB 4HT1L 1ZGLA 1MFAL 4JAMA 1Q8MA 5JQHC 5JPMA 1HOCB 3GDBA 1LO5A 3ZL4L 5BJTA 1FGNL 1D9KC 1BFSA 1D5BB 4PR5A 3DBXB 2M1KA 3GZKA 2FLRT 2NY7H 1MFDL 1QPPA 1QFWM 5FM5M 1A1MA 2NY2B 3E3QE 5IESH 1NUGA 4PGDA 2P1YA 5C0EB 3BP6A 3C2AL 2PTTB 3TO4A 3PIQA 4QCIA 3I85A 4HIHB 2XI9A 4H88L 4QRSB 2FJGB 1YPZA 4KKAC 4EDWH 2MFNA 1CDJA 2R4RH 4BZ1L 5J13B 5L2JB 1T4KB 1DLHA 2ATPB 2R9HC 5EO0B 3QUKB 3X3GL 4R26H 2YZ8A 3QIBB 1N3NA 2NW2A 1NFIA 4R90L 3QG6A 5GGSB 1CN4A 2VXUL 3LN5B 1ORSA 1J8HB 3LEYL 2P5WB 4R3SB 1P6FA 4CN6A 1LP9A 2VZSA 1MNUH 3O6ML 3P0YL 1YEHL 1WWWX 2OSLA 2A77H 3WXWL 2DQHL 4ZD3L 1G0XA 2GY7B 1S9VA 35C8L 3QNXB 4MJ6A 4RIRB 3FO9A 1ES0A 4P23A 3OQ3B 1ZA6A 4KUZL 5T3ZE 5D7LE 2X4TA 5CSZB 3WV0A 4P99A 4F8TA 2Z0BA 4GKSA 5D7LB 1D5ZA 4NC0B 3L1OH 3H9SD 1KENL 2Q7YA 4OLWH 1BQLH 5DR5H 2OM5A 2NY0B 3MRJA 1U0QA 3TEUA 1TPXC 4F3FA 5IB2B 2R69H 4LDOB 2XZQH 1LNUA 2D3VA 2G2RB 5FHAL 4NZRH 1JWUB 1HKFA 2WNGA 4Z7VA 5J57B 5BVJA 1QSVA 4PGJA 1NMAH 2I60H 4PP1D 4PV9B 4JREC 1I7TA 4KK5C 4NN6B 3H42L 4RFEB 3DROA 1MFBH 3MV9A 3TNMB 1CXIA 4O2CA 1JF1A 1S7UB 1HH6A 4XPFH 4BSVB 1KJ2L 4P59H 5H35A 1OSZA 3QAZB 1UENA 1A7OL 4FTVA 4M02A 2PO6D 4U1IA 5C7XH 3T0EB 4OZHB 2AEQL 5DFVC 4G6FB 3D39E 2WINA 1N6VA 2BNUA 3AMKA 1BQHB 1ITCA 4S1QH 4PRIB 1SJEA 4YE4H 3B9AA 2FD6H 3V5KA 4IM8A 1N64L 1YPZE 1LQSR 4J3UA 3C08H 4ODWA 2NTFB 3NAAH 3E3QC 1KC5H 3VWKB 2XQBH 1MCOH 1WEJL 3O41A 5SWQB 4NZRL 5EZLA 3MRHB 4W6WB 1FL6A 3WNPA 2G2RA 1FNEB 3MOAL 3KPNB 1OM3L 4G6ML 1X4XA 5JUEH 1SYSA 2M2DA 1W72H 4HLZG 5F1IB 1S5IL 4AQ1B 5F7KC 1U8IA 3BRGC 1UYWH 4NGHH 3WFEL 4CW1A 1X7QA 4DQOH 4I3SL 1WAAA 1JV5B 4IHOB 4KPHH 3MOBH 4YBLC 4OCNC 5IBTL 3GSNB 1LO0H 5HVHB 3FTGB 3FT2B 4AL8H 1X5ZA 3M45A 4Z18A 4L5FL 3FN3A 3LKQB 1D6EA 2DQUL 1CIDA 4PB0L 4DAGL 5AUMA 1AHWC 3QFDB 2CLZB 5KSBB 3LIZH 4K3JH 2ZCKH 5L8LB 2MKLC 5MENB 3Q48A 3EZJB 3KPOB 3R0MA 1TENA 1MJ8L 1WCBB 2A38A 5E1HB 3N1PC 3G6DL 3VWKC 4XZUA 3JV5A 4GAJH 4Q9QH 4M9PA 4KY1H 2AJYL 1UM5H 3MRDA 2ITDB 3VXMA 4HJGA 2Z35A 4LLQA 1F4HA 1GHFH 3IJYB 1A6WL 1P9MC 2VUYA 5KANG 3PG2A 1B6UA 4I48B 4UT9L 3X14B 1WICA 1IGYB 1KTKE 3N9GH 3BAEL 1IKFL 3K74B 4FFWC 1MAJA 2AK1L 2PYEA 5DK0B 5GGUB 5KN5A 1CFNA 4PJHB 2WBJB 3A6OA 2HTKC 4ODVH 3D18B 3RIAK 4RFNC 1FV1A 3V4UL 3LRHA 8FABB 1CD1A 3VFWB 3QYCA 3WFDH 5CS7A 5EIQA 1H5BC 1YMHA 3S37L 1KCUH 3MNZB 3OR7A 1L7IH 3KPSB 5HHPB 5LGJB 4YDIH 3RVTC 4JGUA 5K9KB 2E8ZA 1ZT4A 4GO6B 4LNRA 4JY4B 7CGTA 3K2MC 4U31A 4NHUB 3LPGA 2B1HL 4GRMA 2NX5A 1CK0H 5D5MF 2B0SH 1ZAGA 4LLVA 1BQUA 4QRPE 2V17L 1P4IL 4NSKA 1O0VA 3HUJE 4ZS7H 3VH8G 4WTWA 2J4WH 5AZEL 1RZIB 2XPGA 4R9HA 3IU4L 2VLME 5D5ME 4OI7A 5ALCH 2ESVB 1T0MB 2FX7L 1LWRA 3QDGB 1KEML 4CNIB 5C0NC 2X41A 8CGTA 2VR9A 4POZC 4UV7L 3LKNB 3P4OA 3LDBC 4KK8C 5D5MB 5KSVB 3MCLL 4ORGB 4IIQC 3DPBA 2APXA 3T3ME 4JFPB 3VMOA 2GJZB 3CCHA 3GSUB 3STZB 1FFRA 2PTVA 5I1GL 4K71B 5DURB 3RIAF 3QQ3A 1J0KA 4XX1E 1P7QD 1EO7A 4WY7L 4OJFH 1KENH 5LGKA 5JOFB 5GRYA 1MRFH 1G7IA 5IW6A 5C0CD 4ZUTB 1ES0B 1RU9L 4Y2DB 1NFDF 4X5WB 2R8SH 2OLDA 1WZLA 4XMLL 3QFJA 2CJUH 1MCQA 5EZLB 3HZMA 4N8VA 3SGKA 5EUOF 3V52H 4J3VA 3RVUD 3KPTA 1T1YA 3LB6C 2Y5TA 1R3JB 3V8CA 4CU7A 2MTPA 2W65A 3BD3A 4F2MA 4IRJC 5CD3B 2H32B 35C8H 2BRRH 4DW2H 1OPGL 2VE6A 2SEBB 3HE7B 1S7SB 1FPTH 3GSVB 2J8UB 2Z9TA 3C6LD 4JHZA 4MDIA 3TV3H 5I1CH 1Q9KB 3QP3A 3V0VA 1U93B 3WHXA 5DHXB 2HVJA 3QHFL 1AGEB 4HS3A 5JA9A 3H6JA 4PJ7E 4UUJA 4Y8AA 1J5OH 2R1WB 2YPLD 1PQZA 4EI5B 4L8SA 1NBYB 3VI3F 3TZVC 4KROC 5ISZE 3IRZA 2ORBL 4NKQB 4DN4L 4UBDC 3HE7D 1OAUH 5JIIA 1Y6NR 3SCMA 3IXAA 4M9OA 4HKBA 4AENB 1OTSD 4KRMB 1GGTA 3FO2A 5F89A 4CADA 4OZFH 4ZSOE 1E4WH 4LPTA 5F9WC 5FYLD 5C0FB 3RWGA 4K8RH 3ZO0A 1D5XA 2FJHB 1G9MH 1YMMB 4UQ2A 5TDPA 1KOAA 5BCAA 3MJ8B 2W9EH 3PQYB 3EHBD 3V0VB 1IC7L 1PG7L 1I1RA 5I1DA 1AD9A 3SKMB 4HFWB 4P2CG 1FIGH 1INQB 3SE8H 1VSCA 1JNLH 3TZVA 4NDMB 4KHTL 3ARGB 2XWBB 4NPYA 4H1LH 5JW4N 1D5IH 4JZJA 4OLVL 5EU6D 3CFKA 2ENYA 1U8PB 3GNMH 6FABL 5JHDA 4LASL 3N1MC 4O02L 3TJHC 3VXMD 4X6FB 4RDQF 4M61B 4BJLA 3U6RB 4Y1AE 5T3ZL 1CDHA 2PXYA 3E8UH 2NY4D 4AEIL 3N85H 4MSWA 1U3JA 2K9UA 3PNWA 2EDOA 4JRYD 4NRZA 2KL6A 3UJIH 1Q9LB 2OX5A 3TT1H 1YEEL 5CSBA 2VISB 2R0KH 5GZOD 4U1SA 2DL2A 1TVHB 1YJDC 2Y06H 5JOEA 4OFPA 4ALAH 4GKZA 1PZ5A 2VXVH 3CFDA 3QWQB 4MD0A 3DI2B 1F4WH 1KEGL 4GAGL 2GK0B 3WS6A 1DEEA 5CGYC 3D85D 3DLQR 4GH7B 3GRWL 5DEGB 5FHBL 3AGVA 4DFIA 4K55A 4M62L 1MJJB 2R29L 3LIZL 2IALA 5JIKA 2EDNA 5IMLB 1SJHB 4FQLH 1HINL 1HYSD 3WLBB 6FABH 1T6VN 4WEUD 5GXBB 4XMPL 3RP1A 1UADC 3BZ4A 3LKSA 1QBBA 1MJ8H 4XC1H 3NFNA 1BFVL 4MS8C 1PQZB 4YDIL 4QNPE 3CDCA 5ETUA 1GZQA 4XPAL 5SWQA 1NCBL 1ZWIB 5D2LF 4L1HA 5DTFB 2ZOLB 3DX9A 2ZUXA 4ZOCA 1F3DJ 3MZTA 5IB4B 4L8BA 2XG4A 2OS7A 1WLHA 1MSPA 4PRIA 3G5XA 4WVRA 1X9QA 3BUYA 3FT4B 5CCKL 1EVUA 2AK1H 3DUSB 3ARDA 2RCSH 1JNHB 1RUPL 3V0WH 2ATKA 3TN0B 3NA9L 2OK0H 2E6PA 2J88H 4PLJD 2NR6D 2E7HA 1S7VA 5IR1B 1JRHH 5HGBA 2J8UA 3E6FB 5EA0H 1IGMH 3NZHH 2KZWA 2FIKA 3RVVC 4DTGL 2FGWL 2C3HA 1X5HA 1W8OA 5HDBE 3T1FB 3BXNA 3O3BA 5C7XL 3WEXB 4XTRC 4FS0A 1KPRA 5KOMC 1XF2A 1UWXH 1SYVB 1CWVA 1JJUA 4QHKI 2EDYA 1R5WB 2OYPA 4AK1A 3VWJC 5EU3A 2VZOA 3C08L 3IDGA 2DQCL 2DLHA 4NUJB 4PJ7B 1UH4A 1R3LB 2N4IA 3MRMA 3MJ6A 1GOFA 4X6EA 2VR5A 4Y4FB 4HT1H 5T3XL 4PJEF 4IMLB 4CVZA 5ACLA 4JRWA 4YDLB 5BMFL 4TSCL 4UINH 3QHTC 5AD0B 4LLWB 4F15C 1BM3L 4KVCL 4ZAKD 1FL6B 5MEOB 1XGRB 3QPXH 3P73B 4R96B 2EYTA 4K9EL 4WIQA 2IADA 3JSSA 4LK4A 3RWHB 5HVGB 4F33A 1NDMB 3BX7C 4FG6D 2D03L 1X5IA 4QRQB 3I50H 2ADGA 2WM0A 5A2JH 3DI3B 2XWBA 1VEOA 4LVNC 4JRYA 5TE4H 2LU3A 3OJDB 4Z6AT 1ZEAL 4NWTL 5EPMA 3WNNA 4JQIL 4BQCA 2G9HB 3OMZA 4NQDA 4YGAB 5CJXA 4JDVB 3D85A 3OR7B 4HAGA 4JY5L 5DK0A 3WJJA 3EFFA 3OKEB 4WU7A 3BT2L 4QTIH 4UINL 2DD8H 1GPOH 3QUXD 1Q94A 3I3DA 4YBHA 3EYSL 1A5FH 1I4FB 4LHUG 4HKXB 4XX1G 2H26B 2IPKB 2H8PA 2OZ4L 3NGBB 1ACYH 3QDJA 2ITDA 1HI6B 2F54D 1JIBA 3NBNA 4WGVB 4GW5B 4E0RA 1XR9A 1SEBB 2GJ6A 4WI2A 2Y7QB 3NABL 1LP9E 2Y25A 1U3YA 4ZNEE 1BFOB 5E8EA 4X9FA 4JM2F 3SJVE 4POZD 2FZ3B 4OF5A 2R2BA 5EU5A 4OUUA 4LQFL 3LEXA 4M6AA 4H25B 4EXKA 1FAIL 3FQTA 1NANH 1LP9F 4APQC 1WTGT 1L9MA 2VZVA 2APVA 3MRJB 4YWGL 5C6PB 3QDMA 4XXCC 1AIFB 5FGBC 2PO6B 4AM0B 1ZLWK 4LLMB 3RWEA 4HJGB 4LLQB 4JO2H 5CP7A 5B21A 1R3HB 3LSOB 1WTLA 4F33B 5IQ7H 4OF8A 3KPRD 4H20H 1T0PB 4LHQB 4HH9B 4PRPD 4ZUTA 4BSWB 3MRNB 1WF5A 4LCCC 1P6AB 1EHXA 5C0GA 3U9PL 4CVZB 1H5BB 5BRZA 5FDYA 2IJ0C 1M6OA 4XCEA 3BZDA 2GAZB 1X6LA 3QG6B 3STZA 2GY5A 4JPWL 4B5EA 4P2RD 1MAMH 3OAYH 4URTB 1DDHA 1NKOA 1G1CA 3BP6B 2XQBL 4U6VL 3EYFB 3QJFB 4LLYA 3BP7B 4PGDB 5LG1A 3BIAX 4YBQC 1FNLA 5GS2D 5IKCA 1RUQL 4L9LA 4G6MH 1OCWL 3TT1L 1PBYA 5IK3A 3TBTA 5F9OL 1B4JH 1KJ3H 1FORL 3L7FB 1H3WM 4PTUB 3P2TA 5GRJH 5HHOE 4E0RB 3QDHA 4K3DH 5L9DH 4I3SH 2M8XA 1IAMA 4PJXA 1YMMA 3WIHL 2OTPA 1JWSA 4PJBA 1H3VA 2DM2A 1NJ9A 5DMGC 1OLLA 4BFEA 2AXJA 3RWDA 1NAMA 4J3WA 4YK4C 3RWIB 4U1KA 1HQRB 3P40A 4P5TB 5D1ZB 5JW3L 3CFCH 4OAWA 4XP6L 5GZOC 1HINH 4G5ZL 3S6CA 4DCQB 1WZ1L 2GTWA 4Z95L 5I16A 3TT3L 4KU1A 3ALXA 1YN6B 2CDEA 1HNGA 4YHYB 5DSCB 4OTXL 3HB3D 3AVEA 4KTDH 3LKRB 1G7MB 5C6WH 2F5BH 1VFAA 1JPTL 1HH6B 2QQKH 2NZ9D 4PJHF 3FZUD 4Z0XB 1C16B 4G8FB 2X4SA 1DVFC 3DIFA 3NPZB 2Q87A 3WYRA 4RGOL 1H8SA 5EO1B 3HZVA 4F3FB 5IB2A 4K3DL 3U9UB 5FV2A 3MJ9A 5L9DL 3OXSA 2YK1H 2DBLL 3QIWA 5D93C 4EN3B 1A7OH 2EKJA 3U79A 5DDHA 3WDHA 5ID1A 4RWHA 4WEBL 1YY8B 4Y4HB 1JN6A 3WBDA 1HHGA 2EIZB 3LMJL 1DN0A 2D7QA 2R0LL 3GNML 2UWEA 4KK6C 3KYKH 4HH9A 2VQUA 1BBJA 1MUJB 1FFPA 3CU7A 4WFED 1TZHB 5J56B 2DYPB 3L3IA 5DZNA 5FYJE 2IFFL 1YY9D 4LF3A 3UYPA 4Z76B 2V9RA 1TQBB 2VISA 3CSYA 2XYCA 2RBLA 4QXUH 4WHYG 1F45A 1DEEB 4F7TA 4BM7A 4ESKA 2EO1A 1RZKL 3EO9H 4X5XA 4BFBD 2HFFB 1E4KC 5DUMH 5IUSA 1SBSH 1OP9A 5GISH 3LS5H 2NMSA 1CQYA 1T0MA 4UU9B 5EOQL 3HRZA 4WFFD 5JXEA 1RPQA 4KMLB 1WT5A 1E6JH 1A6UH 4MNGA 1KN2L 2R56H 3OKLB 3P11H 5F1IA 4X6FA 3MFFB 1UZ8B 3P77A 5HD8C 1A0QH 3HAEG 4X9HA 3OJMB 4J8RA 3T0VA 3VD4A 1YNTB 2AGJL 1P7KB 4Q9BA 4LRIC 4Z7NE 4QCIB 2BCKA 1WEJH 4JO3L 4JRXB 5JW4R 4Z7WE 1LO2L 3MBXH 1S3KL 3MYJA 1HWGB 4LCUB 1QA9A 5E2TL 3H0TA 1UJ3A 1BFVH 3D85B 3RGVD 1WWBX 3CGTA 3QQNA 2IEPA 2LE9A 3EO9L 1OP3K 4I0CC 3DWTA 3LKOB 4G9DB 3L95B 1CDCA 1I85C 5I1AA 4N1EA 4CVXA 2AK4D 4HIXL 5GGUA 2JELH 2Z93A 2ZCHH 2Y72A 4XMLH 1I1YB 2IQAA 1UCBL 5IIEA 1UWGL 12E8H 2F53D 1ZLSH 5MENE 2HTKD 4NOBA 3TJEH 3WE6B 4LQ1A 5TFSH 3UO1H 4D0BA 3BH8B 5ICYA 4PLJC 3TWCL 3QUZC 3CSBA 3EYSH 4JFDD 2QSCH 3I3BA 4EVNA 2B39A 2GUOB 2R2EA 3OHXA 2UVEA 1U8HA 1M1SA 5F7EL 2ICES 1RIVH 4RDQG 4LVHB 5ID0A 2ID5A 3DHJA 1HH9A 5HYSA 5EDXA 3RWCA 4FQXA 5C0DB 3MV8E 5JOPD 5DI8A 3V2AR 4J6RH 2DI8A 5EUOE 3PF2A 2Z91B 2A6KB 4CL7A 1K6QL 1HHJB 2V5SA 4R6UA 2X4TB 1C12B 2CK0H 3AREC 3WL9A 2NY1C 3UCRA 5K9OA 4P23B 2F9BT 2XWJA 4GRLB 1ED3B 2IGFL 2EH8H 2PYEE 1KLUB 4PB9H 2JCCB 5CJOH 5K9JL 1N8ZB 4JGJA 3O4OC 4QY8A 5FYKL 3WNKA 1MNUL 4PJ7F 5EN2A 5FO7A 2WBWB 4G7VH 4JFPA 4I5BB 4NDMA 4R0LA 5C6TL 3CX5K 3OR6A 2W9EL 5FKPA 4YHKL 1KPUB 1C7TA 1PEWA 3RY6A 3S36H 4LPUA 5ACZB 2ESVA 2P5ED 3Q5YA 3HC4H 4GRWB 2RJMA 4E9LA 4HX1B 3QUYA 3CU1A 5GS2H 1T5WB 4U1GC 5EORH 5IT2L 4YAQB 2E7BA 3GIZL 3C60B 4P23C 4TSAH 1CLOL 2DICA 2I24N 3H9ZA 3HZYB 4U6YB 4ZFOB 4N0YL 2JE8A 1SJEB 1SEQH 5SX5H 4AJ0A 4KVCH 4XBEL 5KSAB 3BKJL 4KRLB 4JR9L 5GJTH 1J1PL 3R06B 1UH3A 1QFWL 1A7QL 1DN2A 2Y36H 4QRRE 1TZGL 2XN9B 4JN2A 4R7DA 1BZ9A 3M1BB 2CR3A 4YHPA 5TDOB 2XRAH 4PJAB 4OIBA 1K3IA 3T0WA 1J88A 2XQYG 3LV3B 3B83A 4OUOA 4XNQB 4Z7VB 1K5NA 5IW3A 2H32A 1CL7H 4DKEH 4LPVA 5HTSA 5FYJH 2AW2A 2FWOB 2Y5TB 1GL4B 5IG7A 4YEEA 1OW0C 1AXSA 3DYOA 3L6FB 3WUZA 1KGCE 5E8OA 5E1AB 3RUGE 1P7KA 5IVZA 4IMKA 4CMHB 3IJYA 4RGND 1U8JA 3NTCH 1TCRB 4UDTA 1KIPA 2P5EE 4FNLL 4CJ1A 3BH9A 4UAOB 5FKAB 4KGJA 4OCSH 4NN7C 4JREB 1DDHB 1IGFL 2O5YH 3OKNB 4JO2L 2PW1B 4X4ZA 4AH2A 4N90E 4V1DA 1BREA 4QXTA 1KB9K 3RVWD 4XCEB 1F3JB 2I27N 2NZIA 2GT9B 3SKOB 5HY9B 5BRZB 2IBZX 3VFMA 4XC3L 5F70A 7FABH 5BV7L 2WIMA 1MF2H 3VXSB 3INUL 2FL5B 1HKLH 4QYOA 5EULV 2NY5C 2X89A 3LEXB 1P1ZB 2J8UE 5AG8A 4X83A 4OCXH 3FB6B 4MJ5B 3F6LA 2R15A 2XOTA 1DQLL 5EWIL 5DO2D 2CUIA 4JLRB 4I77L 1NDGA 2KPNA 3C5JB 3U4EA 4YEFA 1GGYA 1X5YA 1DQMH 2XY2A 4FQ1H 3K81A 5F96L 1RZFH 1QSED 2VDPL 2BHYA 3CFBA 3V8OA 1BQHG 2FWOA 2MCPH 2FLBT 3ES6A 4KI5E 4NRXA 1FSKB 5F9OH 1IL1B 2HLAB 2NNAA 3I02A 5IOPB 2R1YA 3O4LB 3MNZA 2CIIB 2AAVA 3C5ZD 3SDXB 3WO3B 3DSFH 4YDVA 3UTSB 2PKDA 2AV1B 5C8JA 1VADB 2VITA 4Y4KA 1FLRH 4ZTOL 4EI5A 1UCBH 3KPPA 3GMOB 2JJVA 1HKLL 3D3VE 5EG6C 1CFNB 2B4CH 5MEND 2HVKA 1OP5H 2MQ3A 3OKOB 5JR1H 1UB6B 1AO7D 4JY6A 4WRLA 1WUNT 4OD3L 4ZOAA 5EZJB 4L29A 2B5IC 3X12A 4DGVL 4S2SB 4HUUA 3AU1B 1RJLA 4WUUE 4NM4H 1J9CT 3ZHLA 1L7TH 5F9DC 3L7FA 3RKDD 1T21B 3W5NA 1JUFB 3GIVB 5A2LH 5J6GB 4OZIB 3L7EA 3BD5A 1JK8B 4O51A 4PGCB 5AWNL 2WQ8A 2BNQA 1TVBB 4HS8H 1E4JA 2BFVH 3S97C 4JFDB 1F11A 2P43B 2WMPA 3EOTH 4AIZB 2A6IA 1I9EA 4YFLF 1CLCA 1V7MH 3MV9B 4K9EC 2K7PA 5K93A 2E8YA 1AQKH 1AQDB 4I9WD 4Q97A 4XCNB 3UZQA 5DEFB 3D2UB 5F8QC 4GSDH 3I9GL 3RNKA 3S3JA 1JZ2A 2Q76A 4JANB 4MD4B 3FOLA 5F1NA 2W91A 1JL8A 1HILA 4K8RD 1XGTB 1A1OB 4NO2B 1G7LB 4BKLB 2WBJC 2E27L 5E4EB 3CLFL 5FGBA 5C1MB 1E28A 1WZMA 1JNNL 2Q3AA 2ZUQC 1OT2A 3DX7B 5ADPL 1RZJC 4K3JL 5D5MA 1IM9B 4DGVH 3QO0B 5FDWA 3QULB 1INDH 3HE6A 1MFCL 1U3HD 1DBBL 1Y18B 3ARBB 1J7VR 5IBTH 1G9NC 4YDLC 4Z7UF 5GGSA 5I30L 1ZANH 4YHLL 4LLDB 4AIZA 5DJ2B 2ZPKL 5HGBB 5CGTA 1Q1JH 4KK9D 1JZ5A 5IJKC 4ZG1A 4X4XB 4LSDA 3B9KC 1I1FA 2FSEA 5GSRB 5I19H 4QRSA 1OOAA 4KUCD 5E8EB 3RDTC 4L3ED 1K4CB 4M6OL 1QFUH 3TVMB 1YJDL 1LK2A 1MCBA 4HWBL 3E1F1 2CUMA 4JY6B 4XRCB 5TH2A 2VAAA 4NQED 2DQTH 3Q6FA 4HMCA 5JIHA 2I9LA 2OP4L 3WJLC 2KKQA 3H9SB 5D7IB 2P7TA 1I1CA 2BP3A 1IT9L 1S7XB 1TFHA 2AV7A 3HI1B 3GMNA 1S78D 3GMQA 5C0RL 4HS6A 4M7ZC 4WENB 1I9JL 4IRSB 1B9ZA 2C1OA 3V6OA 3GUTB 1BQLL 1RI8A 3IDMB 4WJ5B 5GIRA 3KDMA 4JM2C 5INCA 3SJVA 1X5XA 1RMFL 4ELMB 4RWYL 4G42B 5EOCH 2PF6A 3O3DB 2E5EA 15C8L 3L3OB 1CS6A 3SDXF 2N7BA 4YHIA 3FFCB 3FAXA 2A6JA 3KPQB 2P8PA 4YGVA 2XKSA 2OR7A 5BMFH 3T04D 4NQCD 5DJ0B 4PV8A 3MRLB 1MJJA 5D72H 1A4JA 1YEJL 1SHMA 4RMWA 5HYJA 3TYFB 3VXRB 1NFKA 4K3GA 5IFHH 2BXYA 4G9FB 4NKDA 4XPFL 1GYAA 1IC7H 3AMLA 4NRZB 4YNYB 4LNVA 5GGQH 4Z7OE 2PXYB 1J1OL 2JJUA 5MEPA 1CE1H 2PO6C 1QR1B 3V6OE 4MAYA 3F58H 1YQVH 4ZMAT 2LQRA 1D5IL 1U3HB 3WCYA 3MJ7B 4M3KB 2VMFA 1IQWL 4Z7OF 4P5TD 3SDCA 4G8IA 1BVLB 2QHRH 2UY6A 4KKBD 2ICWJ 3RUGF 3MXVH 3OKDA 1MI5D 3SE4C 1MVUA 1DLHB