1F60A

Crystal structure of the yeast elongation factor complex eef1a:eef1ba
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
440
structure length
440
Chain Sequence
b'GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGATION FACTOR EEF1A
publication title Structural basis for nucleotide exchange and competition with tRNA in the yeast elongation factor complex eEF1A:eEF1Balpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 128
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1f60A03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1f60A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f60A01
3A1TA 4PHTA 1GILA 4NH0A 1NN1A 3ND9A 4BZQA 4AG6A 2RGNC 4PQRA 1BO6A 4YDHB 1TUEA 1UBGA 4OQNA 1U0HC 2AKYA 1J7KA 3LVRE 4TMKA 4A2PA 1Q21A 5KSYA 1S0UA 3BD9A 1N8RD 1R0XA 5L3QA 1SXJC 3CH4B 5C1BA 1H8HA 1Z2AA 4CW7A 1IBRA 1KO7A 2EYUA 3FMIA 5J40A 1KHTA 1CNFA 3CCLB 4IFEA 5JMTA 2H17A 1AMOA 3L82B 3X1XA 2J59A 3B1YA 3CPJB 1S72B 3FMPB 1ZVQA 2NPIA 4X8OA 4ZKDA 5SZJA 4OBEA 1V43A 5IRCD 1Q3HA 3HYRA 2RGNA 4XVQA 4P6VF 4IOKA 4X8MA 4DJTA 3UPUA 2W6ID 1IB0A 1KMHB 1OFHA 2WSMA 3QJYA 4GZMA 1N0UA 2ATXA 1OHHD 1Z0JA 1E9RA 3KTAA 4LGMA 4Q1EA 1C1YA 2J0UB 2Z4SA 3W34A 1LNZA 1SXJA 3ZS8A 1ZYUA 3OZWA 2A2ZA 2IXFA 1D6JA 3LY5A 1Q22A 4KSCA 4C9BA 2O8FA 1Z08A 2ZRBA 2EQBA 3IPYA 4CRWB 1CR1A 4LPSA 4N0EA 1NMYA 4IDOA 4PAOA 4G5QA 1M6NA 4X8LA 1MABA 3GD7A 4NYIR 3QFTA 2QPAA 1YRAA 1S96A 5DHFA 3ZS9A 3PEUA 5BXQC 4CEHA 1E0JA 4NONA 1R10A 5BYKA 4II7A 2BV3A 4TL6A 1E9CA 1XXHE 2G77B 3OEHD 1DG1G 4IDQA 2NO1A 3H2YA 2CBZA 2XB4A 3KKOA 4CEIB 821PA 2IS6A 1KY2A 4DLUA 1F60A 1AKEA 2F1HA 1RIFA 3HU3A 4TMVA 3NH9A 3SZRA 2ZJOA 3I1FA 5CDFE 1UF9A 5DN6A 1UBEA 3CIOA 3RAPR 3TR0A 1NVVR 3KQLA 5LD2B 1U8AA 3TNFA 1Q20A 5KDDA 5GJVC 2GEDA 2ZRKA 3CLVA 4UJ5A 3UG7A 2PBRA 4JL5A 3A1UA 5A0FA 2OFXA 2REXB 5EXXA 2BMFA 3TW8B 1EFCA 2IWRA 3CCEB 1DVRA 3PUVA 3ZVLA 4E22A 2R6AA 1XEFA 1XBTA 4NPHA 1GO2A 1CQXA 4G1VA 4D26A 1TPZA 3ZVMA 3Q5EA 2Y8EA 4MUAA 4B44A 4DSUA 1DG3A 3TKLA 2OG2A 2QM8A 2ZI4A 1Z22A 3RNLA 1VQMB 1CJKC 1MV5A 4AD8A 1QGAA 2OBNA 1EFRA 1DBSA 1UMKA 2KB0A 4A92A 1W87A 2RH5A 4CF7A 1QFZA 5TMPA 3K0AB 3BJIC 4KVAA 4EPVA 1XCPA 5IHPA 1NIPA 5KSPA 1I4LD 4FMBB 4XD7D 3GJ3A 4EPRA 4KFSA 4HZUA 2RHMA 2PT5A 5FOSA 4BE7B 3WMEA 1RKBA 2OSBA 4TSFD 5C4GB 3ZVNA 2FGJA 1KK3A 2ZITA 3RWOA 5G40A 4EKDA 1NDHA 1KO4A 2F7SA 4MRNA 5H68A 1XXHA 2VBCA 2ZJBA 4NCJA 3S1AB 3PVSA 4Q1BA 2FSGA 1VIAA 1W4RA 3EG5A 4LWZA 4IDNA 1PJRA 1R2QA 4WOPA 1BKDR 3EZFA 2I3BA 2QTLA 4FD2A 5CDFA 4EQ6A 3FB4A 3KQUA 4NYJQ 4HATA 2LWIA 3THWA 5FUVA 2FE4A 2WJYA 3A1SA 4PPGA 2FSHA 4JYCA 1QRAA 2IA5A 4PXAA 721PA 2GESA 3CRMA 1O87A 4D0LB 4DLWA 2FPMA 1E2FA 4MQBA 1JALA 1KI6A 3A4MA 5FPYA 4HDQB 3G5UA 4NBSA 3AB3A 1OXSC 5JCZA 5JSZA 4TL9A 3WNBA 4WAUA 1DAGA 2OCAA 1VQ5B 3CNNA 3UANA 2WOOA 4M1TA 4P4TA 2W6IA 5F2EA 2ZRPA 4MDFA 1NN0A 2E9SA 4HZIA 1H85A 4J0QA 5GJWC 2V8OA 4RCZA 1KZGB 2RGDA 2AXPA 2DHRA 5CJ2A 1KO8A 1IN7A 3GPLA 4WZAE 4HAUA 4YXWD 1VQ9B 1KY3A 1LFDB 2VPPA 3ONWA 4LYJA 4NCKA 3WXMA 2XZPA 2J1LA 3RLFA 3T34A 1VQLB 2CL6X 2EU8A 2GILA 2GK7A 2JJ8A 2N42A 2ZJ8A 3WP0A 1IHUA 4AYTA 2V1UA 1JJ7A 5LBIA 2D2EA 1E1QA 1XJ0A 1G3QA 3QE0A 5FBRB 4W5HA 4FWTA 4DDWA 1JB9A 1Q57A 4EFLA 3SJAA 1LY1A 2KE5A 4HAZA 1ZD9A 5C4MA 1ZNYA 3RS5A 2H92A 2QORA 3SYLA 3IEVA 4H9GA 4HAVA 4GOKA 3ZLJA 1GAJA 1N5IA 4GP6A 5J5CA 1XX6A 1J8MF 3LVBA 1ZUIA 4O2LA 3TSZA 4EPWA 3VX4A 4XSGA 4LHVA 2HXYA 4Q7JB 2ZI9A 3FJOA 1K8AD 2ZROA 3SHFA 2CXXA 3FHTA 2GBLC 4EJSB 1WBDA 4QG7A 1A7JA 2F43B 4QBFA 1UJ2A 2WVJA 3BH7A 3Q7PA 4BEJA 5JEEA 1G4AE 1Q1QA 1Z07A 3K53A 1UAAA 2BGIA 1N6PA 2P5TB 2VH5R 3FTQA 2JASA 2NQ2C 2ZIAA 3AVYA 2G6BA 3FHCB 4F92B 3A6PC 1QFYA 3O8DA 2J7KA 4Q7MB 5DI3B 1FW6A 4UNPA 3U4QA 3LV8A 4GNKA 3X1DA 4BLOA 1E94E 1EXMA 3GJ4A 1E63A 4OK3A 3SYKA 2MSCB 2XXAB 2WHXA 4D0NA 3KQKA 3SE0A 1XCMA 3BWDD 2O8EA 4DDUA 5K8IA 2QT0A 5JS8A 4R2IA 2ZAMA 1R0YA 4M21A 3EWAA 2BJWA 3ASZA 3C8UA 2JLZA 4KSBA 4LDJA 1ZP6A 2WKQA 2VP9A 2OXRA 3W2FA 5JI2E 1YR6A 4KFRA 1UM8A 4XD7A 4PFSA 4C0BA 2GBLA 1OSNA 2WMNB 3T12A 1QHGA 3P20A 4M53A 5FUWA 2ZREA 3TSWA 3WRYC 2PH1A 4DSTA 5J4VA 2FV8A 4TSFA 4Q19A 2VP2A 1OYYA 2C04A 3BBPA 4FI3C 1KK2A 2R65A 1U0JA 3MLEA 4MYCA 3MWLA 4B74A 2IYZA 2VNHA 2O0JA 2B7CA 2CMKA 2XSZD 1CULC 5FTKA 2R6GA 3U6KA 1ZIPA 3IBYA 5G3ZA 5IDVA 3TK1A 5FL7A 1G7SA 2VSFA 1GP2A 1DS6A 4A4DA 3OIWA 3GLIB 1EG7A 3EZ7A 1HQCA 3B13B 1VQKB 5EP3A 2JLSA 2WOJA 5BN5A 5DSZA 1U9IA 2C95A 5CK5A 3EPKA 4DLRA 2GXAA 2GXUA 3CW2A 1TEVA 2UKDA 2ZS8A 5JBQA 2QTHA 2D4HA 4I1VA 1S1CA 2G83A 1DAMA 4GT1A 3FFAA 1GNRA 2ZJYA 4D4KA 5LB2A 1E0AA 4C0HA 4LBWA 3TE6A 1KMHA 1F5NA 1E2GA 5EXSA 2V7QA 5LD2C 3B9PA 4AWXA 2J0UA 1IJEA 5KU1A 4UAJA 1FTSA 1FNDA 1FQKA 1X8LA 3I56B 4KVGA 3W6PA 3WBKA 1UPTA 3KFVA 1GVNB 4BWYA 1ODFA 1SHKA 5FPHA 2BKUA 2D3WA 1G6HA 1XMSA 3SFZA 1P2SA 3KKNA 1A82A 1NSTA 3W6NA 3VR4A 4B73A 4D0GA 4L5BA 4LC1A 4B6EA 4K1XA 2OBMA 3PIRA 5HXBA 3E70C 4DUGA 1ESMA 4CEIA 1SHZA 5EP4A 2WIAA 4DDTA 6Q21A 2FU5C 3R9WA 2CCGA 4V0LA 2PZGA 2BBTA 2IL1A 2VLIA 1NIJA 3QXHA 2QQ0A 4Q00A 2ZI7A 3OFND 4OQMA 1CRQA 4CGZA 1EK0A 1D2MA 3QOFA 1JR3D 1FNMA 4BLTA 3W8NA 3KXIA 2AK2A 4EPYA 1X8KA 4BUJA 4YXWA 4IHQA 4Q66C 1HH4A 2J41A 2VL7A 2ZJ2A 3DL0A 4LZZA 1ZNZA 3A4NA 1NN3A 1W47A 3DM9B 4UJ3A 1C4OA 2QENA 2WWHA 3B1XA 2BEKA 4XSHA 4B71A 2HT6A 1M74A 2EFDB 2XZOA 3B6EA 4PHGA 3K9GA 2BKEA 2HF9A 2P65A 2JDIA 5J4LA 1JXOA 2IUTA 1NJGA 1AK2A 2NZJA 4MKFA 4FK8A 1G18A 4JVMA 2QMOA 5CM8B 5KYKA 3Q8XB 1FTNA 3ZC3A 3CM0A 3CR7A 4Q5IA 4QXAA 3CD6B 2O8DB 4V03A 3SQWA 2GA8A 3K0AA 4D2IA 4QM7A 4MRRA 3P27A 2OV2A 2ODEA 2REOA 3QVUA 1FMJA 4QRHA 1T8UA 1G20E 3CMAB 4KFUA 4Q02A 4B3DA 1T8TA 2YWGA 2FH5B 2WV9A 5HCIA 1QX4A 5FOXA 4DLXA 2OILA 3OEED 4HI0E 5H1YA 1DAKA 3U7EB 1GR1A 2EWWA 3FMOB 3K9HA 3S1AA 2DERA 1G8YA 3QVVA 4Z54A 2ZJZA 1RRFA 2V54A 1X6VA 2ZJ5A 4AURA 3ZD6A 1W36B 2ZYWX 1OGIA 2XSZA 4GI7A 4I1SA 2GCPA 1AM4D 1Z06A 2FEMA 4LPKA 4MGIR 4QGFA 1VDZA 3NEJA 4EIWA 4OHYA 1FNBA 1VMAA 4RKFA 3DZDA 3ICQB 3G71B 1ZD1A 2B92A 5FUXA 1CU1A 1J8YF 4Q1DA 4B33A 3VO1A 1G3UA 1N5KA 4L9SA 3NH6A 1E0SA 2Q3HA 1VQ8B 4IVQA 4TYPA 4D4JA 2IC5A 4CEJB 2A5FA 4FWIB 4PC1A 2RCNA 4ASUD 4OKSA 2B8WA 3KZ1E 4B75A 1F2UB 4RFSB 1YJ9B 1A4RA 1MRSA 4RD4A 3SJZA 1YZKA 1CJVC 2P3SA 2TMKA 2ZRLA 4PO9A 4BFWA 1RC8A 1CS4C 4IFBA 1JEEA 3QF4B 4LOAA 4BPRA 4BLPA 3FYHA 1VQ6B 3W9YA 4HB2A 5GV8A 5D3MB 4EJSC 3C15C 3PEWA 1OXTA 2CJWB 2AX4A 5EE3A 1KDPA 4JBXA 3MUFA 4WW0A 3AVTA 4DEYA 3VR6A 4HUTA 2HLDD 2JGNA 2WAXA 2UZIR 3H0KA 3ZIAD 3RDPA 1QH0A 5B57C 4Q21A 4OL0A 5EP2A 3UWKA 2CDNA 4JMPA 4TYNA 4LYAA 1UADA 1ZM7A 1ZM2A 1TUIA 3CRVA 4F91B 3GLIE 1GL7A 3TR5A 5DIFA 4D6PA 3AF4A 2ORIA 3OFNA 4HYYA 2GPJA 3RC8A 1KJYA 1XMVA 3GJ7A 5DYIA 4KYIB 3F3YA 3QBTA 1ZU4A 4FW9A 2C9OA 3R8FA 4YC7A 2BEJA 4Q7KA 4IJMA 1Z8FA 4B34A 4Q1FA 4OI4A 4EJSA 2F43A 4KJZA 1FQJA 1AGRA 3KJGA 1R5OA 3CCUB 1T5IA 1KI7A 5HZHA 2QQEA 4XIGS 5HE8A 1WCV1 4BFUA 1VYTA 4XTRA 3IKJA 3E1YE 3AVPA 5GVSA 4DB4A 4O0MA 5DHAA 5DI3A 4LRWA 1X1SA 1P2VA 4DB2A 2IT1A 1JA1A 3CCQB 2XXAA 2GAAA 4BZXA 1M2OB 2WWXA 3W5UA 2Z4RA 1RPZA 2BOVA 2ZXUA 2OK8A 4FMDB 2OFOA 3LW7A 2YKGA 3KXLA 1L4UA 4XWKA 3QFCA 1Z63A 1G7CA 3W3AA 5F3WB 3DKVA 2PZEA 1AGPA 1VG9B 1T91A 4HUQB 1E4VA 1R5NA 1XP8A 2FWRA 3LRPA 4TLDA 1TVCA 3L0OA 2WKRA 1OT3A 3I73A 5KNDA 4AI6A 2ZETA 2O52A 4L4UA 2JCSA 2IHBA 3OEEA 3PEYA 1W36D 1S3GA 1U99A 2J45A 2YJTD 5F9FA 3KDSE 3HU2A 3QXJA 5AUPB 1JA0A 3EIQA 1OPXA 1VG0B 5JI3E 5AR1A 5KSOA 3EA5A 1VCNA 2XGJA 1W0JD 4C0KA 5IF9A 3F0TA 1OH5A 2OM2A 3GLIA 4FMCF 4M1YA 5EZ5A 4DCNA 3QE2A 2DWOA 2QU8A 4NHOA 3MWYW 2YINC 4JJZA 5KSWB 1T3HA 1YJWB 2IYXA 3DO6A 5AJZA 1X3SA 5AJWA 1AJEA 4LCBA 3W5VA 1UDWA 5FBVB 1Q1ZA 1Z28A 1NNEA 4KV9A 4BZPA 2XJ4A 1ZNXA 4JVNA 2VA8A 4JS0A 2XNDA 4TL7A 5KO2A 1CXZA 3PUWA 5E7JA 3L43A 4KBGA 3MHPA 2Q3FA 5BN3A 5K8TA 2QG6A 3D6TB 3SQXA 3AVVA 8OHMA 3PCRB 4ASUA 1XFAA 3EPHA 2ZRCA 2ONJA 2QBYB 3MWKA 5KOYA 1XD2B 4BECA 2J0VA 3QENA 4X8HA 2VHCA 1TF7A 1K8RA 2VEDA 4D25A 1W5SA 2CE7A 4RD6A 2VIIA 2PX3A 4KITB 3VFDA 4CT4B 5TDHA 3EX7C 4UQOA 2E1RA 4A9AA 1CF4A 1YHQB 1XTQA 1RYFA 3VKWA 2XNSA 1OXXK 3AP3A 2C99A 3LW8A 4CZ2A 2JJ1D 2WMOB 4LJ9A 4JBYA 4O25A 5H5JA 2YOGA 2G0NA 2J46A 3GJ8A 4MGZR 4A0HA 3ZIAA 3WHKA 2ZRAA 1HV8A 4HLUC 4IDPA 4TQUS 5E95A 3I62A 4QJ4A 1VECA 2FPLA 1OKKA 1Q1EA 2ZE5A 3DHWC 4DCTA 5JLJA 1G21E 4Y7CA 1XTKA 2PMDA 1HA3A 2VNIA 1HQYE 1DAIA 1VIYA 4XTCS 2ZE6A 2G9NA 2IUUA 3CMEB 2I1VB 2OZEA 1ZD8A 2C9CA 1IONA 3GLFB 1E62A 1DAEA 4IXMA 2WTUA 3N2EA 3T5GA 4Q9IA 4A0RA 5C18A 1G7TA 3FOZA 3BE4A 2H5EA 4W5WA 2J7PA 1PZNA 2PIAA 1XTJA 1GNPA 1W36C 4MYTA 2QT1A 2O8DA 4HLUA 3T1QA 4EUNA 1T9HA 4JT4A 4G3XA 4LJ5A 3ADBA 1IXSB 1II9A 5FBWB 1HT1E 3X1YA 1M7HA 3RABA 4F38A 2DB3A 1QVRA 3SU8A 4KO8A 1DEKA 5AJYA 3WNDA 3CX8A 4Q9JA 1DDGA 1CBUA 1YIJB 2NTYC 3FVQA 1KSFX 2OLJA 2GXSA 2ZRFA 2QPOA 4WZBE 3NC0C 3IEUA 2ERXA 3TLXA 3E20A 2RKOA 2FEOA 4I4LA 5JHHB 2WIBA 2OBLA 2RGEA 2BSAA 3OJWA 1DPFA 4IW3B 4Q48A 1XJQA 2G1JA 4HAXA 1I2MA 4OI1A 1CIPA 2JJ2D 4OK5A 1GG2A 1Z6AA 3EC2A 4M8NE 3GEIA 2BPOA 2AFHE 1NVUQ 3G82C 3KXKA 2WWWA 1NF3A 3X1WA 1IXZA 1KI3A 2C5LA 4B2LA 2XTMA 3LXRA 2P6UA 5E4FA 1R8SA 1N6HA 3VNUA 4CT5A 1Z0AA 4KHZA 2P6RA 1EP2B 1ZCBA 4HB4A 3RSLA 3W6OA 1FX0B 1FUUA 3W5IA 2PJRA 2IF0A 4NMMA 4CEJA 5AN9A 2IXGA 1G8PA 4ILEA 3TBKA 1TNDA 4E07A 2F1JA 4OJKA 1VYUA 1NY5A 1YJ5A 1W44A 4AKGA 1NLFA 1RZ3A 3U3MA 3U5ZB 2WM9B 1PLJA 3HR8A 1F2UA 3ZQJA 1XZQA 3AGQA 1GRNA 3N5CA 4GMDA 4Y9RA 4RFSA 5LDDC 4BFTA 1HEIA 3VR2A 3WHLA 3C5CA 1PVOA 2EFGA 1YR8A 5G3YA 3L0IB 1K5GA 3B7GA 3I3SR 3QF4A 1VKJA 1IN8A 3EC1A 3VTKA 4C2UA 1KSHA 2C9YA 3K70B 3CB4A 5D3MA 5LPNA 3J81k 1E99A 3ECCA 2GCOB 3O8CA 3NG1A 2ZYTX 4PQYA 3DOFA 1A2KC 2CJWA 3RRZA 1KAOA 1D9ZA 5FBLB 3CC7B 5B30A 3C16C 2CK3D 2GHIA 4LBZA 5D3QA 4TT3D 4URYR 2ZUCA 1S9HA 2BMEA 4ZGNB 3C41J 1DARA 2BM0A 2V9PA 5CLLA 2JJ1A 4R2HA 1GJRA 1VCMA 5CK4A 3RHFA 2EFHB 3HJNA 1G9XA 3I61A 2ZQ5A 5CLQA 2ZRMA 3W2HA 4B6FA 4AKIA 3WYAA 1IJFA 1Q82D 2OCBA 2WJVA 2W0MA 4R98A 4PO8A 1BIFA 3BS4A 4OQXA 2ZEJA 3M4YA 1ZC3A 3VMFA 1SVOA 3QG1A 2P0EA 1KSJA 2VF7A 3NVAA 4B2PA 4QC2A 4O3MA 2CVHA 5EJEA 1HY3A 4DSNA 3T06B 2ONKA 2DFNA 4E09A 1TX4B 2ZJAA 1E2JA 3NBYC 4NKRA 2OO7A 1P4SA 2WZQA 4LI0A 3LFUA 1WDTA 2VTKA 3TAHA 1UEIA 1W5TA 3TUJC 4XWAA 2ZI3A 4TQAA 4A1FA 1E2MA 1VCIA 2F1IA 3EARA 3K0EA 1G64A 1E2IA 2A78A 2MMCA 4N3NA 4ZCMA 3EIEA 4YAFA 4TWZA 1K6MA 2WWFA 3QEOA 4N1AA 4U00A 3UKDA 2PX0A 4Y9UA 5AJXA 1K73D 1XEWX 1G5RA 1BQEA 2VQSA 2W6JD 3CF6R 2ANCA 4LHXA 4MRSA 1JR6A 1F6BA 3NBFA 3Q3JB 4XOIA 4M2LA 1M7GA 1VG1A 4OHXA 1H65A 2AKAB 4LBVA 2P2LA 3I4LA 4TLBA 1KQSB 4B32A 1P5ZB 1FL9A 1XF9A 1T5LA 1ZU5A 3OF5A 4HUQA 4Q9HA 1QUEA 1KGDA 4US0R 3BFVA 1Z3IX 4K81B 2DETA 1T4GA 2ZVQX 5CM9C 3WY9A 2VP0A 3D8BA 2OFWA 1DOAA 1N25A 2ZU0C 4LYFA 4OHVA 5FPTA 1N5JA 1G3RA 3CF2A 4M9QA 1YI2B 3AVOA 3PJRA 2VF8A 4A36A 3DM5A 1P2TA 4JL8A 1OHHA 1T3SA 1GKIA 4P3YA 4YHBA 1R7RA 4NCIA 2JJ2A 1MT0A 2IS4A 4U9UA 3TVDA 1JAIA 1NMXA 4PSKA 3KQNA 1OF1A 4C43A 1E4YA 2ZRNA 4RY2A 4JLNA 3U3KA 4C0LA 3GLFE 1UKZA 4CIDA 2PLRA 1JXMA 2OLKA 1HUQA 3QKRB 4LJ7A 3AVXA 1R8QA 1OH8A 2VHQA 4G5OA 1KKMA 3QF7A 3I92A 4DIDA 2IHYA 1X86B 5CYPA 2VNJA 4DLZA 4RD2A 5THXA 5E7IA 1BS1A 1H8ED 1Q0UA 1TAGA 2KSQA 3HP1A 3OEHA 4MRVA 2YWFA 3RS7A 3ZVRA 2J0QA 4H1UA 4A82A 4AG5A 3BXZA 1X1RA 1E9AA 4GZLA 2QBYA 3R20A 4DLSA 1TTTA 1EESA 1CR4A 1XD2A 5TR9A 1D2NA 1E9EA 4TTQA 4FCVA 2PEYA 2ZS9A 2JLXA 3WP1B 1ELOA 3K70D 2QMHA 4NDZA 2IWHA 4W5JA 4GL2A 5FOVA 5FTLA 5KTYA 4M1OA 4ERNA 1FUKA 3LO5A 1US8B 3SR0A 3NTUA 1E2NA 2ATVA 1KDOA 5FPSA 1DAHA 1JJ2B 1LVGA 3IBGA 1FP6A 4YDSA 1YRBA 3ZZ0A 1E9DA 2CK3A 3SC3A 2NIPA 3F8TA 4WVFA 3W2IA 1NN5A 4DCVA 4LC0A 1KO1A 3QXSA 1A2BA 4FIDA 1G17A 2XOKD 4KLZA 4BPBA 4QL3A 4HE5A 2GAOA 3DZ8A 2NO0A 3V4RA 1NSFA 3IIJA 4XJXA 2PZFA 1E2KA 3M1IA 4HB0A 5AUOB 2QSZA 3AKEA 1T0JB 3SFVA 1XPOA 1N6OA 2R6FA 2EFEB 4DXAA 1W46A 1CNEA 3GEHA 4XH9B 1U9IC 2WJGA 2DBYA 4Y0VA 5DLQC 3W5JA 3GLFA 2Q9AA 3NBXX 2BN4A 1LF0A 1BH2A 2QE7D 4S2EA 4ZKEA 4F4JA 3TIFA 3A8TA 4GBMA 3NC1C 3VAAA 4LX0A 5L8VA 4BFYA 1GWNA 2F9LA 1WQ1R 3KUDA 1GDDA 1JNYA 4P4SB 3UG6A 1Z6TA 4HDCA 5JWRA 3B1WA 1CJTC 4AYXA 2LKDA 3KUCA 3MAAC 1EGAA 1Q1BA 4A15A 5DH9A 5J4YA 3UXMA 1N2CE 3IIMA 1FNCA 2H16A 3DDCA 3QUSA 2WWGA 3GMTA 5K8LA 2C78A 1BMFD 2G88A 5HCNA 2VHUA 3B85A 1QHNA 1QHXA 2FFHA 5JZVA 2W6JA 2FOLA 3E5HA 4PC6A 3M6AA 4LBYA 1G6OA 2GWHA 4ACBA 4GOJA 2AXNA 2B5OA 2IXEA 1VQPB 3QG5A 2BBSA 2R9VA 1D5CA 2ZM5A 2CHQA 2RAPA 1XMJA 1VQ4B 3NDBB 3KJEA 2IX3A 1NVXQ 2IYTA 5TV2A 1V5WA 4PHFA 1WB9A 4URXR 2BM1A 5H70A 1MO4A 1ZUNB 1KSGA 1QHSA 3RANA 1NG1A 4TLEA 2GKSA 2XTNA 3ZDQA 4AIIA 5C2JB 3TGPA 2W83A 3KX2A 4OK6A 4QNMA 3K0FB 5HPYB 2JIZD 4HAYA 1D1NA 3K70C 3A1VA 4AY2A 5FFMA 4TL8A 2ZU6A 4DDVA 3I32A 3AVWA 3QY0A 3BB4A 3WMGA 4ZO4A 2QM7A 1RJ9B 1XD9A 2AD1A 4PGOA 1FX0A 3D3QA 2FFBA 4E03A 4OI0A 2OHFA 4BGDA 2FGKA 1WE2A 2YNMA 3NWJA 3JVUA 1J70A 3AUYA 4C7OB 1Z0FA 4M9ZA 1H8EA 4MA4A 3CXCB 2CL0X 2ORWA 4ARZB 4W7SA 1TF5A 3THYB 4CYMA 1TLLA 1XPRA 4YLGA 1LB1B 1P73A 4NYJR 4HSEA 3V76A 4F7DA 2CNWD 4HLCA 3FFBA 4BQSA 4GMXA 4TQ9A 2F9MA 2NPFA 2OE2A 2GCOA 2HYDA 2YZ2A 1Y3AA 4WXRA 3BERA 5FBQB 4TMWA 1W2GA 4ZGQB 2Q9BA 4R71A 4PZLA 2ZI6A 5FTMA 5HTKA 1UBCA 2O0HA 3CUEF 3AF1A 3V4FA 4QM6A 3CZQA 4KCGA 4E5UA 4RZ3A 5EZ6B 1N6RA 2YC2C 521PA 1NG9A 2BWJA 3CCMB 4G01B 2FNAA 1TQ2A 2GVDC 1E98A 2RGXA 1FRQA 3DEFA 2CCJA 4A0FA 2OUKA 2XOKA 2GF0A 5CB8A 2AHOA 3DPUA 1VYVA 3K8YA 5CIQA 5JHGB 4IOMA 2EWVA 3IPXA 2YOFA 3BB1A 1AIPA 1KI2A 2EIXA 4RSGA 1OE0A 4JLMA 4M0LA 1ZMXA 2XNJA 1SVLA 2VYFA 1D9XA 5GV7A 4FINA 4RZ2A 2ZYVX 2REBA 4D4LA 3QKSB 3R7WB 4BEBA 1Z6GA 1O3YA 4W9MC 2YV5A 4LHZA 4YALA 5EUQB 2CLCX 4Z1MD 2QA4B 3TH5A 3OAAD 2ZSDA 1FRNA 1GIAA 1EP1B 5DYGA 1T6NA 3G6EB 3I72A 2MSEB 3CC4B 3U6BA 1CTQA 1JR3E 1EWQA 1GTVA 4R7ZA 2IYWA 1EP3B 2O8CB 2VRWA 1E32A 2XB2A 1FNNA 4ZCIA 4G0NA 2RC5A 4G1UC 5J47A 3QSYA 1BMFA 4LJ8A 3OE7D 4NTZA 2YWEA 1OXVA 3QFSA 3QIAA 1CRPA 3LQRA 3VKHA 5DGXA 4F7WA 1T3LA 4QKQA 5L3RA 2IYRA 2IW3A 2K5UA 2PLFA 2FN4A 3PUXA 3PXGA 5TY0A 1VQOB 3K9NA 4WZ6A 2KBFA 4TZ6A 1NVWQ 1EX6A 1UFQA 1LW7A 1AS3A 3RS0A 3TQCA 4DVGA 4LK2A 1U90A 4NYMR 1H42A 1NKSA 3QPVA 1NP6A 2GJSA 3CZPA 1I4DD 3C5HA 3SJBA 3KFXA 1W48A 2R6HA 2R6DA 4XWOA 421PA 1E3MA 5KPDA 3NHAA 1IY1A 3U2QA 3QKRA 1AS0A 2PMKA 2WPDD 4AK9A 3AEZA 2PCJA 3N2IA 1G5TA 2XX3A 1E9FA 4MGKR 1W4AA 2JLVA 1I4TD 3EXAA 1IN5A 2ZRHA 2QPTA 4JKYA 1G19A 3K09C 3QI2A 1EFHA 2X8AA 4RCYA 4V0OA 2EVWX 1N6NA 3RS2A 4ZDIA 1N6LA 1XJCA 1COWD 2HEIA 1YKSA 4TZ0A 4QGHA 1HYQA 3IO3A 2N1BA 1DO2A 4B35A 3ZYCA 2BBWA 3WYGA 1JR3A 4Q4AB 1B0UA 1KRHA 1GKUB 1F48A 1US8A 2J0SA 2CNWA 4POAA 3SI7A 2PCLA 1J2JA 3W8RA 4F4CA 1XWIA 4Z8XA 1BYIA 4OHWA 5ELXA 4L15A 2JLRA 2WAYA 2QEQA 1Q81D 1E6CA 1XU4A 3KJHA 1Q12A 1Z29A 3LH5A 3K09A 2X77A 3U3RA 1A8PA 3A58B 5SZKB 4B3GA 4AKEA 1RE0A 4F4IA 3LXXA 1S2MA 3KB2A 1GSIA 4NYIQ 2HJVA 2QRZA 2YWHA 1YU9A 4KFTA 1IN6A 3V9PA 2AWNA 3HPQA 1E2DA 2FSIA 4MKGA 1JPJA 4PO1A 2HCBA 3HR7A 2QA5A 3OIYA 2JEOA 4G5GA 2GNOA 5FOWA 5SZIA 2GZHA 1LTQA 4YMUA 2QUZA 4M9XA 2JAQA 4LJ6A 1NVVQ 3CNOA 3CR8A 1PUJA 2ZR0A 2J87A 4P4SA 1YQTA 1KI9A 4MYHA 5FR2A 4EFMA 1Z6XA 2XAUA 2YVUA 2YOHA 1G8FA 3MFYA 1DELA 2FJUA 1OV4A 2VP4A 3T15A 4U5XA 3ADDA 3VR1A 3OAAA 3W3ZB 4JLDA 3GJ5A 3UIEA 4YAWA 5JEDA 1P2UA 4D4MA 1GRQA 1XDBA 1SVMA 2QAJA 2CCKA 1QG2A 4M1MA 1PV4A 4TMXA 3WYFA 3EZ2A 2AD5A 5L3VA 4RD0A 4OJQA 1FP7A 1QHHB 1E64A 1OB5A 2W2TA 2GRJA 4IEEA 3U7GA 1M7BA 3MSXA 3OE7A 2P67A 4DQLA 3L0SA 1OFTA 621PA 3QFRA 1ZRHA 2IYUA 2XITA 2P5SA 4JLJA 5HR5A 5FI1B 3ZQ6A 3C14C 1W49A 3ES9A 2A30A 1IM2A 1P3JA 3GEEA 2XEXA 2VHTA 1U8ZA 3CRZA 4M4SA 3LD9A 4JKIA 1XNJA 5GJCA 5E3HA 5GJBA 3ADKA 4YAOA 3QPUA 3LQQA 5EXTA 4ZV4A 3K0FA 3AUXA 3C7KA 5JFGA 3I8XA 2RHDA 4A2QA 2IEYA 3T61A 1KD1D 2Q0HA 2ZS7A 3IUYA 1Z83A 4MDEA 5A4JA 5DN6D 1RJ9A 2XZLA 1VHTA 1F2TB 1OFIA 1ZM3A 2MMGA 3GQBA 1AQUA 3LLMA 4NE2A 1J90A 2CVFA 2WPDA 1W35A 2IYYA 2W2XA 3ZD7A 1HTWA 1P62B 1VQNB 4FMDF 3AM1A 4C0JA 5KNCA 1ZW6A 1R0WA 5K8UA 4UNRA 3IQWA 5EE5B 3KL4A 1J9ZA 4MITA 4C7OA 2HLDA 3RRYA 1RRGA 4YONB 4RVCA 4ARZA 3O47A 3QKUA 4QBHA 2IS1A 1PLLA 1KKLA 1QHIA 3THYA 1P75A 4AF7A 3EWSA 2PL3A 4PHHA 5FL3A 4D81A 3E1SA 4UXJA 3UK6A 2H7VA 4TYWA 2I1QA 2R44A 1KJWA 1COWA 1P60A 1XTSA 2ZRGA 3R8CA 3I5XA 3AQ4A 3BFXA 1KOFA 2JA1A 3PUZA 4PAMA 4JBWA 1ZINA 1E96A 3EPJA 2CHGA 5J4HA 3B5JA 1EFRD 3ZZTA 1QVGB 1WBBA 1OIXA 4M1KA 1VHLA 2CEAA 4MH0R 1ZCAA 1N5LA 4Q47A 5DE3A 1ZUHA 3W90A 3A37A 1ANKA 1JEDA 1P9RA 3SHWA 3RVBA 4UNNA 1ZC4A 1XCGB 2QMEA 4LJYA 4MYUA 3EZ6A 2DCUA 4PSVA 1D8TA 1KZ7B 4JYBA 2XJ9A 3WMFA 1N6IA 1Z0IA 4PZYA 3CCVB 3OHMA 3CPWB 1MRNA 1TQ4A 2ECKA 4B3CA 3U61B 5TVKA 2QROA 3R9XA 1S9DA 1YZTA 4V0KA 2Z5FA 1R5BA 3MJHA 4EPTA 1JPNA 4OYHA 4NCHA 3UMRA 3CF0A 2A5JA 5TARA 1B2RA 1UBFA 3NDPA 1W7AA 1YITB 3QKSA 3R7WA 3VO2A 4LV6A 4KAXA 1NI3A 3I5YA 4M9SA 2ZRDA 5KDOA 1LV7A 2ODNA 4UKDA 4JIMA 3SJCA 4BFZA 4BLRA 2VP6A 2KWIA 2Z6VA 3LBHA 3MJRA 3B8HA 5B2ZA 3CH5A 3VR3A 4LV5B 4R9UC 3T35A 1GOTA 2VHJA 3AH8A 2BC9A 2ZAOA 3GJXC 2O8CA 1CEEA 1OIVA 2Z0MA 1W0JA 4JJKA 3LX8A 2IF2A 3LBNA 4PC2A 1KDRA 2OESA 4JLOA 3U44B 5DI9A 4NP6A 5CB6A 1OLOA 1SQ5A 3THOA 5HE9A 1FZQA 5KUTA 2O8BB 2QNRA 3C4JA 4WA7A 5AK0A 5AUNB 2ZE8A 4TTPA 1OXUA 1XEWY 3WNCA 1SULA 4DC9A 3CRQA 1CJUC 1NJFA 1OJLA 5HZKA 4RKEA 1WRBA 1CJMA 3L2OB 4JLVA 3AF3A 2HUPA 3K9LA 2OTJB 3CO5A 2GEUA 4Y0AA 1XTIA 5P21A 5J4KA 4YMSA 3N70A 1R6BX 4IKEA 1G3IA 5HKKD 4AKHA 3JQQA 1QFJA 2VYQA 1E1QD 3IHLA 4RZUA 1QF9A 2QTZA 4D80A 5KHOC 4LYHA 2FZ4A 2V1XA 2ZSBA 2IYSA 3CPHA 1GZSA 1R0ZA 4PAQA 1A5TA 2DPXA 3SS8A 2GJAA 1PUIA 2W58A 4GRAA 1QVAA 3P4YA 1E0KA 5JS7A 1DAFA 2X2EA 3NIBA 1M90D 3OIVA 4OI2A 4Q1AA 1RRPA 5B58C 1E9BA 1Z2CA 2QY9A 2BVNA 5ANRB 3RS3A 4ZCLA 3QKTA 4Q4HB 3RYTC 4Z51A 4DKXA 2IYLD 3EA0A 3VU9B 5C46F 1QG4A 2B7BA 1SKQA 1EWYA 1HT2E 3VQTA 5CIWA 4DLVA 4WBSA 4TMTA 3CNLA 1UKYA 2UVQA 2ZUBA 1Z0KA 2WKPA 3MMPA 5AJVB 4Q4AA 1OFUX 2DFKB 3AF2A 3U3JA 3V00A 4L9WA 3SDZA 4B2IA 4KI0A 2DFTA 1GKYA 3CWQA 2D7DA 2WWYA 4URVR 3GJ6A 3ZBTA 3P1JA 4EDHA 2DEUA 2A5GA 5JRZA 1JQLB 3RSOA 5JRJA 1HE8B 1GNQA 3DMNA 4AYWA 4C0AC 2UZ3A 3L8YA 2KJQA 1SVSA 3O8BA 1II8B 1MKYA 2L0XA 1W4BA 2O5VA 3BRWD 4ZPXA 3EPLA 2FDCA 2G0TA 3TAUA 4DLTA 4Q01A 3JQPA 4HE6A 4DCSA 4M22A 4K46A 4QOSA 1Q7YD 3GLGB 4C2TA 3NKVA 4DEXA 5BWMA 3AF0A 2LCFA 3HU1A 4ZDWA 2J5XA 1YR7A 1NBMD 121PA 1U81A 4U02A 1E2HA 3A1WA 4JVSB 2ZE7A 1FDRA 2OAQ1 3DOEA 3TMKA 5GVRA 3FHOA 3LWNA 1VG8A 3PFIA 3FWYA 1OGJA 1UDXA 2FG5A 1OW3B 2FFAA 2A7QA 1JAHA 2IYQA 1RFLA 1K5DA 4JL6A 1XEXB 3NHBA 5FL7D 5L3SB 2R62A 3BORA 4PANA 4PTLA 4DRZA 4IEIA 3VR5A 1MO5A 3U3OA 3MCAA 2C2HA 3FGNA 4PPFA 3HWSA 1Q3TA 5EE9A 4DSOA 1WMSA 2IS2A 4G5SA 3LAWA 2C98A 4Q4LA 2RB4A 4QHTA 3CCJB 1Z0DA 1KI4A 5FR1A 4CVNA 4C30A 4KLNA 3AVQA 1Q44A 3CX6A 2VSOA 3CPEA 4Q03A 3RWMB 2ERYA 1FPMA 4PR0A 1HE1C 3SBDA 5JECA 1OH6A 1KO5A 1XPUA 4JVLA 3ASYA 4ACAA 5FOUA 4QGGA 1TEXA 1TU3A 3LBIA 2NGRA 2V7QD 3EASA 3H1TA 1QHHA 4AF6A 2C8VA 2OAP1 5H59A 1NRJB 2GETA 3HYTA 4V0NA 1E79D 3G4SB 2BIFA 2KI5A 4QNRA 5IK2D 3AP1A 1ZNWA 2BHRA 3LO8A 5DO9A 1OB2A 5DISB 4JLAA 4DLYA 1G41A 2A5DA 1VQ7B 3OESA 4HB3A 3WBJA 2ANBA 4UNQA 1ZM9A 2D06A 5EXPA 3K1JA 1AN0A 2X19A 1S8FA 2YHSA 4JLBA 4LHWA 1W2BB 4HDOB 2ZRJA 3TVTA 3THXB 3GLHB 4C0QC 5IT5A 3CBQA 1JI0A 2JATA 4B4DA 4DUGD 1NLYA 2GTPA 1NBME 4ESVA 4TYYA 1KNQA 3LLUA 4B3FX 5AUQA 3GP8A 3IIKA 1S4QA 2R8RA 4QFMA 5HKKA 1QUFA 1RW4A 1KAGA 4YQFA 1F2TA 2R6CA 4OHZA 2GF9A 4RJLA 2QN6A 3K0SA 3QBVA 3EW9A 2AR7A 4A0GA 2CNDA 3T5DA 3O8RA 4IVRA 3Q72A 1KTVA 2Q3MA 2RGAA 3E2IA 1XZPA 2C77A 1WA5A 1YZQA 2PT7A 4LJ4A 4NU0A 4TT3A 1JECA 1AZSC 2XNCA 3FKQA 4LJAA 1KI1A 1IY0A 2QGZA 1BYUA 2HT1A 4PZZA 4IDHA 3T1OA 3B82A 4URWR 4TTRA 2F3TA 4MUBA 1G7RA 1P7CA 2IEZA 2NG1A 4DHEA 1KJZA 1YE8A 2HCJB 2RGCA 2ZSFA 4DCUA 2JLYA 1L4YA 4BFXA 3ZGXA 1JBKA 3T1VA 5EUMA 4PC7A 1RRCA 3QXCA 4GFDA 2JDID 4LSGA 1FMLA 5FUYA 4I99A 4DQKA 2HDNB 3SEAA 1I7PA 3BAFA 2FA9A 2ZUDA 1LS6A 2BDTA 1UKEA 1MR3F 3U60B 1E2EA 2GZAA 3K0CC 3PG5A 1G16A 3AKDA 3AV0B 1UEJA 2NO7A 4NYMQ 2E87A 2ZSEA 2RMKA 2WICA 4WQMA 1M1YE 3HPRA 3ND8A 4DT1B 1QVFB 2V3CC 4ESHA 5KNBA 2ZYUX 2HV8A 2DFLA 1P9NA 1XE1A 4L16A 3MG9A 1IY2A 3EAQA 4PX9A 221PA 2GK6A 3Q9LA 5BW8A 1X8JA 3GCGA 4C3ZA 1E2QA 3B78A 1VPLA 1SVKA 1DADA 4TLCA 4JLPA 3PV0A 1SVWA 4FCTA 3X1ZA 1QGZA 1QDEA 3ETLA 4FCWA 2VO1A 4B48A 1IOZA 1NBMA 1MO6A 1E69A 2G1KA 2NO9A 3OZXA 1NKTA 4IVPA 2VNKA 4BLQA 1SZPA 3SYNA 2PJZA 1R4AA 4TN1A 3K0CA 5CITA 4HEJA 4N3GA 2AK3A 4LHYA 1GL6A 3HDTA 2FF7A 4P4UA 2QAGB 4UNSA 3H86A 5CYOA 1PLKA 1KNXA 4EFNA 1B23P 1P72A 2G3YA 2A3RA 3EIHA 4YMWA 1VCOA 5EE1A 3OZVA 3U7HB 4MKIA 2PEZA 3ADCA 5G53C 3PEVA 4OQLA 1YHNA 3FKSD 2D7CA 2P6NA 4URUR 5JJIA 3U44A 3PENA 3TUZC 1A1VA 1IQPA 1IXRC 4EH1A 3VHXA 1OIWA 1RVDA 1WP9A 3KJIA 3P4XA 2V6IA 4Q4JB 2O8BA 2QDXA 1TADA 2SHKA 1CR2A 1VTKA 3H84A 4GDFA 1W34A 1KIMA 2KBEA 1E79A 3VNVA 5IK2A 1G5PA 4F93B 3KKPA 1QG0A 4LY6A 3GLGE 4QGAA 3REFA 2FX3A 2EFCB 2X2FA 1XMIA 2AWOA 3LA6A 4KBFA 2GJ9A 4M1WA 4BFSA 2Q6TA 4UXIA 1AZTA 2R2AA 3CRW1 1DTSA 4IRUB 2FZLA 2ZVPX 1N6KA 1G8HA 3G0HA 4QJ5A 1ESNA 3TUIC 2WSSD 1XTRA 2X3UA 4S35A 2V4ZA 1AKYA 4URZR 1T0HB 4BLSA 1Q86D 4IOLA 2OT3B 4ABYA 3EZ9A 2W2VA 4P31A 4QBIA 1YZUA 3NEYA 2IBMA 1WF3A 4M1SA 4A8JB 2WJHA 2DYKA 2RGBA 5E7MA 4ITRC 4B3XA 1QBKC 5SZHB 4ZIRB 4FXPA 4G1BA 2WWIA 1P61B 2BBOA 2BMWA 4Q1CA 4Q4HA 3Q85A 4DBLC 5CJPA 1EFTA 1UKVY 1W1WA 1S3SA 5UKDA 3CCRB 3UATA 3VU9A 3U7FB 4NZYA 3DMDA 2JLQA 2I4IA 3QXXA 1U2RA 1L8QA 3P26A 4H1VA 2OTLB 1QZXA 4HAWA 1EWRA 3AVUA 2N46A 2QRNA 2FPKA 1M1KD 1E1RD 3Q7QA 4V02A 5BN4A 1KC8D 1JQJC 2DWQA 3MD0A 3CKLA 4NL4H 2D62A 3GJ0A 2LKCA 2ODBA 3IILA 2QTFA 4DIEA 4P33A 4PQFA 2QE7A 5L3QB 2MSDB 1GITA 1TF2A 1II8A 4GOXA 1GAWA 1F3OA 1S1MA 2JLWA 3FMFA 2FFQA 3GLHE 4XVUA 4LUCA 2BGJA 4MKHA 2XTZA 3IGFA 3RRMA 3QEJA 3GLGA 1OH7A 4C0SA 2CL7X 1ZJ6A 2A9KA 1W0KD 1BJKA 1FOEB 1N3BA 3H4MA 4JLKA 2C03A 1YR9A 3L0PA 4O2RA 1ZM4A 4UXHA 3QNUA 4A6PA 2DR3A 1GM5A 1BX1A 3BB3A 3RRNA 1M34E 1KK1A 4US2R 4XVRA 2RC6A 4P32A 1GUAA 4GP7A 2ZPTX 3CONA 1TQDA 1XEXA 1L7VC 5BYJA 3KTAB 5L3SA 4RD1A 3ZBUA 1E2LA 2BF4A 2FSFA 3VHLB 1DO0A 1SXJB 4RFVA 2Z83A 2O8FB 5TXGA 1TQ6A 4PPNA 4V0ME 1ETUA 1Y63A 1OYWA 1EX7A 3CRRA 4JZKA 3QPWA 2FMXA 1SKYB 3UMSA 3I8SA 1U0LA 4JT2A 1NY6A 1F20A 5FOTA 1MABB 3TW4A 2GJ8A 4KODA 4CEHB 1YZNA 2XNDD 4QHSA 4A2WA 3IDQA 5FTNA 2ZANA 4KXFB 1CR0A 1W2HA 2JIZA 3FKSA 2D2FA 2F55A 3PITA 4TMZA 1ZAKA 1W4CA 3F5FA 3PUYA 2CHVA 4Q9LA 3JZAA 2BCGY 2BCJQ 3BH0A 4CDGA 1NJID 2AN9A 4GSYA 4RD3A 2CLSA 3ICEA 2HJGA 5FI0B 5F9HA 3LVQE 2A5YB 4D82A 3MWJA 3I55B 1GFIA 4I1UA 1GRRA 3AKYA 3BC1A 4Q18A 3THXA 1CLUA 3GLHA 2H1LA 2YC4C 4IOJA 1YZLA 2GVZC 2V55B 2HMAA 2W00A 2O0KA 3IQXA 1E9SA 1JJVA 1RYHA 3FDIA 4FMCB 2GZDA 3OJXA 1IAQA 3SOPA 3VX3A 5DNYB 4B43A 1G3MA 1XD8A 4WIAA 1QGYA 2AL7A 3GFPA 2QP3A 4ZDJA 3T1TA 2WSSA 4L8GA 1Z5ZA 3DKPA 4NCNA 2ORVA 5FH9A 1FFHA 3ZJYA 2JLUA 1OKKD 4JSTA 3SBEA 1XRJA 3DVLA 5EMNA 1CP2A 5A5GA 3FPKA 4YMTA 2J9RA 2GEVA 4BRUA 1G4UR 1ZIOA 2B8TA 3AP2A 2QEXB 4V0MA 4YAUA 2GJKA 2IYVA 4B76A 1KI8A 2OCYC 2ZR7A 2NZ8A 4HZUB 2VZLA 4IXNA 1SM4A 1L2TA 3OIUA 2H8KA 3WRXC 1U98A 1WXQA 3L8ZA 2J7PD 1DE0A 2QI9C 1M8PA 1KMQA 4US1R 1I2DA 2J3EA 3X2SA 4EPXA 4ZDKA 3QQ5A 5M04A 3AGPA 1II0A 1XXHB 1Z6YA 1MH1A 4HLQB 5KDLA 1IN4A 3UMFA 3VKGA 4B47A 1E1RA 1H8HD 2W0SA 4QJ3A 3JQRA 3A36A 1N0VC 5GADl 5H8WA 2AFIE 4EQ6B 3BH6A 3BOSA 1TL7C 4DT1A 3P32A 3TSOA 4ZI3A 4K8OA 3OW2B 2QAGC 1C9KA 2QTVB 4EAQA 5JWOA 2HXSA 3THWB 3TQFA 3AKCA 1YJNB 3REGA 1MOZA 2OEPA 3BK7A 2RGGA 4Z1MA 5AWFC 5F98A 2BMDA 3B1ZA 4QBGB 4PPQA 1LF5A 2V6JA 2WJIA 5EE0A 3CCSB 1K9MD 1ZBDA 1ONBA 1NL3A 1AQYA 1KI6B 5G41A 2ZTSA 1U94A 1W0KA 1KK0A 4DZZA 4FN5A 2EW1A 2IUSA 1YZGA 4DWJA 2DY1A 5JSZB 2Q9CA 2VSXA 3OZUA 2NOAA 4P0TA 5FPKA 1SXJD 3RC3A 3TRFA 1G1MA 2QSYA 1BOFA 5JJKA 1Z47A 2GCNA 3LNCA 2OK7A 4B3BA 1J99A 2CLDX 1N0WA 2F1RA 2HF8A 3KB1A 3LX5A 4PSAA 3BFKA 4Z8YA 5KSZA 4MGYR 1MO3A 2NMVA 2VP5A 3CC2B 4ON9A 2QAGA 3FE2A 4LV8B 3B1VA 3PR1A 2DWPA 4ZI2A 2X1VA 2WBLC 3BGWA 3B9QA 3FPAA 4WXPA 2H18A 1XB2A 3D31A 1G8GA 2B6HA 2GDJA 1AA9A 2ZR9A 4PC3A 4Q7LA 2HYIC 3JVVA 2OXCA 2D74A 4N0DA 1QHYA 2F6RA 1P9WA 3NXSA 1GL9B 3R9IA 3NBZC 3RS4A 3PQCA 5B64A 1CKEA 4Q4JA 4A8JC 1SVIA 2QP4A 2ZRIA 5FA6A 4JSYA 2Z43A 5BQ5A 2H57A 4MRPA 5JWHA 3B2EA 4AC9A 1DDIA 1NMZA 4U7DA 2OCPA 2QGNA 3MRSA 5LB4A 3LDAA 1G291 3SN6A 1P6XA 5EQTA 3CX7A 1AS2A 1GVHA 1JB1A 1E2PA 5JJLA 2CRVA 3CWZA 5KPJA 4BFVA 1HURA 3KQHA 4TYQA 3KKQA 2BJVA 4I1OA 4RZXA 3W2EA 3Q5DA 4A6XA 4BRWA 4KU4A 2ODWA 4YMVA 2QZ4A 1EFUA 3MGCA 2GXQA 1D2EA 3IO5A 1TU4A 3D7MA 3UWOA 2B21A 1NLZA 2GQFA 2ASEA 4KYUA 2YYZA 4TLAA 2Q21A 5FTJA 2NO6A 4Q9KA 3ZZUA 2C96A 2WJJA 3JZMA 3ZH9B 4A8JA 1TMKA 4C4PA 3U4QB 1SXJE 4HLDA 2QP9X 1GAQA 3W5HA 4ZIRA 3A4LA 1KDTA 3GFTA 3KKMA 3SNHA 2BMJA 1SKYE 2EYQA 2ZI5A 2ZSAA 1U8YA 5EP1A 2QL6A 5TB5A 3TJZA 4BASA 2O8EB 1LS1A 3BIFA 2F3RA 3GFOA 4I81A 2QMUA 3M0EA 4GPTA 1KYIA 4OQFA 4QHYA 1SGWA 5JCPA 1YVDA 3IHWA 2CE2X 3W2GA 3B60A 4G5RA 1BX0A 2IK8A
chains in the Genus database with same CATH superfamily
3A1TA 2LNDA 2V0GA 4WZAB 5HIIA 4ICIA 1QPZA 2VRNA 3P2YA 4LNAA 4PX2A 3O3NB 4YRNA 2NTVA 3G2JA 5LXTF 3WGKA 4DIUA 3O38A 2GNAA 1QAMA 4RSMA 2IPLA 1BO6A 2ZW9A 2IITA 4X3OA 3OZRA 5EG5A 1USIA 2C2GA 4HGNA 4Y2VA 5LDHA 1J7KA 4FILA 1M2NA 2P9ZA 1S0UA 2CKDA 4ITVA 1BGVA 2IZ6A 3CJQA 1V26A 1J0EA 3O0TA 4MW5A 1SXJC 3CH4B 3IV7A 1H8HA 2W6CX 2XPCA 3QLEA 4G0XA 4NHEA 5D2CA 1LZLA 1IBRA 1KO7A 4NOMA 5D01A 3KQMA 1KHTA 2IX9A 4IFEA 5JMTA 2B0JA 2H17A 2L19A 4E5VA 3G9TA 4N7RA 4N41A 3UXYA 4C04A 4GQAA 1CR6A 3NHYA 1VI6A 1ZH8A 4OIFA 3P97A 4FONA 5BSVA 3EGOA 5K0FA 2ORYA 1V43A 4E5PA 3L0DA 4CN9A 3HYRA 5CNJA 1PN3A 2IUYA 2IOYA 2QLJA 2RGNA 4JFRA 4TT8A 4XVQA 3RQSA 4P6VF 2C9DA 3DLIA 4X8MA 3ZV6A 2W6ID 4PLZA 1MEEA 2B1GA 1KMHB 2OYSA 2WSMA 3CKYA 4M1EA 2ATXA 4MHSA 1N7GA 4PIMA 3TMKA 1C1YA 3IAS1 2IEIA 2PA3A 4QLOA 3UB4A 4EECA 5DP1A 2IH5A 1C8BA 3T94A 3WB0A 3LY5A 3OZWA 4KSCA 5KTPA 4LE0A 4C9BA 5EKSA 1ZH2A 4PX5A 4MS4B 3UWDA 4CRWB 1CR1A 3MELA 5EA2A 5DBHX 4EWLA 1Z68A 3NB0A 2AQ8A 3JQGB 4DJEC 4IDOA 3BGOS 4XNFA 1WLYA 2J3HA 1M6NA 2I2DA 3I2KA 4MUHA 4AJPA 2ESRA 1GFZA 4NYIR 3M3DA 4CEHA 1NWHA 1S96A 4KDRA 4ONEA 4AX8A 5BYKA 1R10A 1IVYA 4FFPA 4TL6A 1XXHE 1PKEA 1J2YA 3K73O 4EQZA 1THGA 1DQRA 1ECLA 2D1YA 5AH0A 1KVQA 2WD8A 1KY2A 3DXFA 4PN7A 1RIFA 1QBGA 2QRHA 3OJFA 2ZJFA 2JHAA 1YULA 1UBEA 1FS5A 4RVOA 3TR0A 4BP9A 2GYWA 1NVVR 3ND6A 3KQLA 2PGXA 1U8AA 4MUIA 3TNFA 2TS1A 1GQSA 2C5HA 3PVDA 2GEDA 1J0BA 1KQGA 1M0TA 1QORA 2PBRA 3SM3A 3UG7A 3A1UA 4UQPA 2REXB 5EXXA 4R1TA 1NDUA 2BMFA 1OWOA 4TRJA 3KBBA 3C3XA 2RHLA 4XARA 4N0MA 4S1WA 5LJLA 3ZVLA 2Q6VA 2FYTA 3RYIA 4E22A 1GA1A 4NIMA 3VDNB 2GN2A 4CQMB 2X8WA 2COUA 2YR0A 1M0WA 1AO3A 3DLAA 4L9AA 4NPHA 3O4HA 1GO2A 3EXHC 4LXHA 4G1VA 1SIUA 1AF7A 1BAPA 4OQZA 1T2EA 1F12A 3CW8X 2IZ5A 1XAGA 1ZDMA 5C32A 1A9XA 2DPMA 2Q2QA 4CM4A 5IJZA 5DCYA 3Q8KA 2A9FA 2HJHA 2RHGB 4X94A 1WHTA 1CJKC 1R4MA 1E3EA 3HP7A 3QWFA 4WCFB 1FCJA 1UQTA 2QXTA 5KOJB 2OBNA 5EXEA 3K2BA 1UMKA 2KB0A 2O1XA 1TM4E 3CSSA 3JAKA 1OBFO 1W2WB 1W87A 3QP9A 4L4SA 4CF7A 3A0RB 4R16A 3TMYA 3CEPB 1OAAA 2EP8A 3PGKA 4IF6A 1I4LD 2H7XA 4FMBB 4UEQA 4XD7D 3ZLTA 1EKXA 3UQZA 2HHJA 3VOTA 1L4HA 2PT5A 4FLEA 3B3AA 4ZK2A 3WMEA 1TK2A 4IHKA 3WWDA 3ZGLA 5AW3A 4TSFD 1EX9A 3ZVNA 1PR2A 2QZZA 3ML1A 2JI8A 4Z4SA 3R3YA 4AMBA 3RWOA 5G40A 5LMZA 4ERXA 1NDHA 5HOEA 5DXJA 1EAMA 1XO1A 5H68A 4DIOA 1QH1B 2BISA 3H05A 4IILA 3N86A 4IUDS 5FQOA 1JVSA 4HRXA 1PAUA 2N1MA 4PS1A 3BKXA 1Q92A 5A3VA 2FSGA 1RJGA 1W4RA 1XCOA 2PJUA 3EG5A 3PGXA 4IDNA 1R2QA 4WOPA 2PYZA 5CCXA 5KYVA 1MQ9A 4AECA 1QMGA 2ZIXB 3LDHA 4XKVA 1U2GA 4ZQEA 4E21A 2LWIA 5CXXA 1GQQA 2QTVA 3DW1X 1FC0A 1OTYA 5ADVA 3WLQA 3MTAA 4O2AB 1RWPA 3BDAA 3TLEA 4N5MA 1EFAA 1KEVA 1JS1X 2P7HA 1LI4A 4IG9A 4DLWA 1EHCA 4JODA 1I3OA 5GZ6A 1X7DA 2IXTA 2JKZA 3ASSA 2VDJA 3H42B 4FFBA 4YP6A 4BGVA 5C8YB 2EBUA 2HNAA 3FRJA 4UZUA 5EHIA 3T51B 2PKWA 3NC4A 4CL8A 2QWXA 5JCZA 4P5DA 7ADHA 5I9TA 3WNBA 1IZYA 2NSDA 2YH2A 1WLSA 3C74A 3CNNA 4RLQA 2CSXA 5H9WA 3OWOA 2KQUA 4Z0PA 1PJ3A 3W9UA 4IUYA 4WESA 5BWOA 2NSLA 2GREA 3AWIA 3DDUA 4EKYA 1XZMA 2MCFA 3SDSA 4RPJA 2WY2D 3I6BA 1R0LA 1H85A 5GJWC 1VHOA 5JJ5A 3EG9A 4J91A 4BLVA 2VJOA 4PBRA 2ZDGA 3AL2A 4HOYA 5CPFA 2AXPA 3M4ZA 4NICA 1N2OA 1KO8A 2QDKA 3Q7IA 3GPLA 1DXYA 1UJNA 3AERA 4YMIA 2I54A 5ERXA 2HBYA 1VQ9B 2VPPA 5YASA 4NCKA 3WXMA 1WVIA 2BR3A 2NNLD 3PQDA 2N47A 3T7EA 4UAVA 1U2SA 3DOHA 2ATIA 3ZHYA 3D8SA 3JQ8B 2VHEA 3U4DA 3PR3A 1JSLA 2ICAA 4RABA 1M1NB 1WSBA 2FN9A 3P9PA 4ALNA 2HWYA 1YE3A 1JJ7A 2VDKB 2O3QA 2D2EA 1E1QA 2HSEA 3QE0A 5IP5A 2ILVA 4KZKA 3MQFA 2VK1A 3A28A 4FWTA 1QLHA 3KHTA 2PVCA 1Q57A 2OA0A 1P1FA 5AW8A 5C4MA 4N7JA 2PXAA 3RS5A 4OFXA 2QORA 4Z9FA 4H9GA 4N4AA 1S3IA 3BCUA 1GSOA 3KSMA 3PLAE 4B4VA 4Y2RA 1GAJA 2Y1GA 4FGZA 3K1AA 5EAIA 4JEMA 3DD1A 4RACA 3VX4A 5M29A 4C89A 4XSGA 4LHVA 3QY9A 4MP6A 2A5LA 1K8AD 2A1TS 3RJZA 3R3VA 3MLBA 5DOZA 4BKMA 5AYVA 1SCJA 2F43B 1CUHA 3UBTA 1UD3A 1UJ2A 3BH7A 3KG2A 5EIOA 4BEJA 3OZIA 3K53A 1Z07A 5JEEA 3KK0A 5KREA 1CQJB 1L8XA 2MR5A 2WU4A 3A7EA 2ZIAA 5AHXA 2JAXA 3IAAA 1SIBE 4O3FA 1MBZA 1QFYA 1AE1A 4DCMA 2PD4A 4Q7MB 4L2IB 4BDTA 5DTIA 3BA6A 4UHEA 1EXMA 2O54A 1E63A 1M6WA 5HK9A 1ACMA 3OQ6A 1C1XA 5AVTA 2RK4A 1X42A 3C1TA 3SE0A 2FN7A 1DRUA 4XPIA 4BRZA 4HDMA 1KOJA 3OQIB 4MB6A 4DDUA 5K8IA 3CMCO 1LFAA 3IODA 2ZAMA 3LBAA 4M21A 3EWAA 4QREA 3T4EA 2BJWA 2PSEA 3O1IC 1QCZA 5HKOA 2ETVA 1BDBA 4MPTA 1YFJA 2HHCA 2I5PO 5JI2E 3F3KA 1BEEA 4ZJYA 4KFRA 5LIPA 2Y9MB 1EXWA 1TVKB 2XCIA 3GYBA 1YL7A 3T12A 2O7SA 3W5SA 3NAZA 1QHGA 1WW2A 4MQFB 4G5XA 3FLAA 2AFRA 1I2AA 1NW7A 2PH1A 5J4VA 3K2QA 1L5WA 1O5IA 4UUPA 3CU5A 5AO9A 2EW2A 1R3DA 1VLVA 4FJ0A 1OVGA 3BBPA 4FZRA 4MYCA 2R65A 3MLEA 4IX9A 4DV6B 2I9KA 4B74A 2FZVA 3DOJA 1QZTA 1WM1A 3LY8A 2PRKA 5FTKA 3A9RA 3E3LA 5BN1A 2G07A 3ZDFA 1C3OB 4EITA 4F86A 3IBYA 3JCZA 1JG2A 1HWYA 1H69A 3UJHA 4XM0A 3OIWA 4DN6A 2PGJA 3HDGA 5AXDA 3A9SA 5EMMA 4ALKA 1HEUA 5C81A 4B0PA 3WI7A 3IT2A 5EIEA 3ON5A 4OUDB 8AT1A 5I7HA 4CDMA 2C95A 2H00A 2H4WA 1CUIA 3A1CA 3UW3A 3DF9A 4DLRA 1TEVA 3KAPA 4D4GA 2B94A 2R4UA 2D4HA 1L9XA 1YDFA 3WLKX 2WE7A 3WRYA 4CM7A 1X1AA 1S1CA 1XI2A 1EUZA 2FP4A 3FYCA 1GNRA 4D4KA 2J6BA 1NATA 4ZOLB 4ARAA 3DE1X 3TE6A 1FLDA 1LI5A 3Q98A 5EXSA 3WKBA 1AMUA 3OD5A 4YO8A 3RVOA 4AWXA 2J0UA 1B7GO 4KACA 4XN3A 4C14A 1FTSA 4DK0A 2WZBA 2PSFA 2BTOA 4A03A 4CTKA 5AHWA 1FQKA 3DTYA 1DTWB 3I56B 3DE6X 4KVGA 5E8RA 1U0OC 2ONZA 1UPTA 4CDRA 5JC1A 1VLZA 5LL6P 1QVWA 4YH1A 1U1FA 4WKNA 1SHKA 3TVYA 4OX9B 4BVAA 4QYIA 2OBBA 3CRNA 4D9BA 5CVTA 2P9GA 1V16B 3F73A 2C2MA 1RRKA 3ESRA 2XT9A 1A82A 4RGBA 3VR6D 5IT9A 3J81A 2C5BA 4N82A 4B6EA 2CGEA 1AKVA 1E6KA 3PU6A 1JHZA 4Z4QA 1UJ5A 3VZRA 5HRAA 2W2KB 3WJAA 6Q21A 1LW6E 2FU5C 2I67A 3RVKA 3V2GA 2V0CA 3L3BA 2Z5VA 2WM8A 2IL1A 3P9KA 3RUIA 3TIXB 3TJRA 4XR4A 3RT1A 3MJDA 1GUZA 1K2VN 1CRQA 4OBWA 1R9MA 4JOQA 3OY2A 4X6YA 3MIZA 4A2CA 4KAJA 1L7XA 2ABWA 4JELA 4JD5A 1O5OA 3MMXA 3D3JA 4JYPA 4YRPA 4KQMA 2HQRA 3TW8A 1FEZA 4BUJA 3AI1A 1JFFA 4QBTA 4MXDA 4XX0A 4QXPA 2WD9A 3OOJA 2G80A 2HY7A 3DBLA 4CNBA 4X44A 2BZSA 1DG9A 1ZNZA 1YX2A 2H1FA 3EXG1 4DPLA 3DM9B 3EBOA 2YUTA 3KJFA 3M3HA 1Z7BA 3P45A 4JB3A 5D7BA 3C39A 2EFDB 1ZNQO 1YQQA 3PQ7A 1DI0A 5F33A 3W1VA 3W5AA 5LOVB 3OZ7A 4GI5A 2G1PA 3O9ZA 2P65A 4KIUA 4OEHA 2JDIA 3ZDRA 5DGDA 4B9EA 1ZXXA 1EU1A 2IUTA 1NJGA 1RMTA 4R0VA 2J30A 2NZJA 1G1AA 3DO8A 4PWZA 3ZD8A 5K45A 1R88A 3LFHA 2OV3A 1ST2A 5CM8B 3VC7A 5KYKA 4QXAA 4YS6A 3CD6B 9MHTA 3PGA1 4KTTE 3HJHA 2GA8A 1JXQA 3K0AA 3W3AD 2A14A 1SO8A 2EBFX 3P27A 1GDHA 1SCAA 1YK1A 2C7QA 1KEWA 2CF4A 2O48X 4Z4WA 1F14A 1G20E 2QX9A 1SCQA 1RC0A 2W6MA 3DHYA 3IQZA 4CTMA 1MIOA 5JBIA 3RYFB 1OLUA 4GR4A 5BPFA 4HI0E 3TO5A 5H1YA 2GJ4A 3P94A 4QDOA 3TL6A 4CQNA 1EI9A 1TT5B 1PX0A 3N0RA 3P9NA 3MB5A 2YS7A 2DERA 3O73A 4Z54A 1ZCJA 2A92A 3PQFA 3WWCA 2ZJZA 3LP8A 1ZIYA 1GA4A 4ZEOA 3K6SB 1X6VA 2MJLA 3DBRB 5AT1A 4KJXA 1T8RA 3L1UA 2EZ9A 2J67A 1A5SB 2ZYWX 4PLCA 2XSZA 3N8DA 2HRZA 4KUGA 3UMJA 3G8CA 2GCPA 1AM4D 2OOSA 5FAKA 1JEQA 1WXFA 2BP7A 2FEMA 3HTXA 1K88A 4MGIR 1E7RA 4ENSA 2R47A 4QGFA 2I2FA 2PKQP 3YASA 5AQ1A 1VDZA 3RRFA 4EIWA 4NENA 4OHYA 1FNBA 2PT6A 3TX2A 1ZW1A 5JXHA 1NR7A 1ZD1A 2B92A 4B33A 4Q1DA 2DAPA 1WETA 3H7AA 3LUBA 1G3UA 4MWGA 5E38A 4L9SA 1YQEA 1F8YA 4MWZA 1Y3CE 3NH6A 4XASA 4YUVA 4PRZA 4AZ3B 4IVQA 4EYQA 2O2ZA 4BO6A 2YIVX 4HP8A 4B3SB 1P7ZA 1ZGAA 3R3UA 5ADUS 1PFVA 4RTOA 5COQA 5AKIA 3H87A 3KZ1E 5KDOA 4TV8F 4IP0A 13PKA 2IDKA 1Q9SA 1EVKA 4O29A 4H3SA 4B75A 4CKCB 5JZ9A 3FUXA 4AXXA 1Q0TA 1YJ9B 1A4RA 1RI3A 1SXHA 1MRSA 2QZ9A 4KE8A 4RD4A 3SJZA 4BFWA 4DLAA 2B1IA 4G84A 2XQVA 1FUYB 4G1EB 3VNAA 5C3MA 5HIKA 3C5VA 2D0OB 4L73A 2QUIA 2WHQA 2FPPB 1MFZA 3F8WA 1UEXC 4HWTA 2W70A 3RTCA 5GV8A 4FU0A 1JKFA 3ZUPA 4BHTA 3C15C 4EJSC 5K20A 4BKUA 3PEWA 3FYUA 2CJWB 3M2PA 3PC6A 4MSUA 4YJKA 2AX4A 4KN9S 1KDPA 1ETHA 2Z95A 2XT6A 3MUFA 4ML3A 1LSOA 1Y9AA 5AKGA 1JEOA 1EFKA 4OQPA 3A05A 4MA5A 4ZJPA 2HLDD 1XQWA 2JGNA 2Q5CA 3N5KA 4TV9A 4P1ZA 3BJMA 4WZBB 5H80A 4RIHA 4NMHA 5B57C 4L8LA 1C3XA 3DYBA 1RP1A 4Q21A 3WK8A 4ZMRA 2DWUA 3KU1A 1PYDA 4HSGA 2JAUA 1K3UB 3CURA 1ZM7A 3Q15C 3CRVA 3BWBA 1QF7A 4LZPA 2KLBA 2AI2A 1FYFA 2ORIA 3DS8A 4HYYA 1FTGA 2O59A 3RC8A 3GJ7A 5DYIA 2ZBPA 2AFHB 4J9UE 4UTZA 4R40A 4TM8A 4QX6A 2C9OA 2H1VA 4Q7KA 4IG4A 4B34A 1P31A 5IWCA 3Q12A 1OLSA 3OPXA 3F74A 3OW7A 3F5MA 4N03A 4FLFA 3CCUB 4ND8B 4OQ4A 4RWZA 5HZHA 5LLDA 4JP8A 1DUSA 2W11A 1V8BA 2N75A 3ED5A 1T9KA 3BDVA 1ECGA 3PUKA 4XTRA 3GR6A 3AVPA 4UE6A 4BQEA 2QF7A 4ZCPA 5DULA 5GVSA 4DB4A 4LRWA 2V7XA 1ZFNA 3STYA 1CQPA 1GYPA 1Q7TA 4DB2A 2O3UA 2HIHA 2C8KA 3EGXB 2YQ5A 3HDYA 4BEVA 3L4JA 2FP3A 3C98A 2GI4A 3DV9A 3GRKA 3E3NA 4WXMA 4FR2A 2BOVA 2ZXUA 1KTIA 3ESZA 3GPBA 1AZWA 3AUSA 3LW7A 4IY1A 2YKGA 4KPEC 1E5DA 2JFYA 1QS0B 4XWKA 2IY9A 2REQA 3L0ZA 1K08A 2DLDA 4TTIA 5CFZA 3TECE 3KOUA 2PWZA 4BU0A 1GPH1 1XLWA 2PZEA 4WE3A 5J9FA 4HUQB 1R5NA 1TQ8A 1RLJA 2OO3A 2X3YA 3A4TA 3M6MD 1V4VA 3QUAA 3L0OA 4QEZA 4UE2A 4ZYVA 5KNDA 5HIJA 4MYSA 3UHOA 5KTKA 3QNMA 3RY8A 3SD7A 5BRNA 2VDUE 5B3LA 1RWMA 3HYLA 1OR8A 3FVWA 2AZMA 1TT7A 1JA0A 2I3GA 4FNMA 4LC9A 3CUSA 4BX0A 1X7ZB 1R15A 1V3QE 3ORHA 2XGJA 1BEUB 3EA5A 3LUDA 4QWMA 3IDFA 3WJ1A 1AHPA 2Z6AA 3F0TA 3X2EA 5JO9A 2AUMA 2XWPA 4PNZA 3GLIA 4DCNA 4E5MA 1L5KA 2FOIA 3P5BA 1I0IA 4CQLA 3UJ3X 4EB6B 1WTAA 3QEAZ 2MSNA 1YE5A 3H5WA 1I4WA 3DO6A 3EEBA 4NS4A 4LCBA 1GR0A 2FUG6 1UDWA 3BWVA 2IYNA 3RC7A 3UGKA 1E2BA 1Z28A 1MX5A 1P1JA 3EPPA 3MWDB 3BL6A 1MIHA 1WY5A 1Z35A 1DV1A 2O4CA 2RB5A 3W8FA 3ZZ1A 2F48A 2M1ZA 2EF1A 4B4UA 5BN3A 4AICA 5EJAA 3D6TB 1TYZA 4OOEA 1LLFA 3VR2D 1JHAA 3ZK8A 1UL1X 2RCYA 4FFVA 4Y2PA 4JK3A 3RD5A 4L5JA 4ASUA 1QB8A 1XFAA 1GN9A 1JSZA 4BECA 3ONEA 2CNLA 2X4DA 5FFNA 1VYHA 4IJ6A 3ASTA 3W0LB 1NXXA 5I48A 2VEDA 2QK4A 1W5SA 2R66A 4MS1A 4HYQA 2VIIA 3VKUA 2MYNA 1GQYA 1K27A 4F9FA 4L3WA 1P4AA 4Z86A 5FNVA 5TDHA 5TMBA 5I7EA 2E1RA 3VGJA 5KNCH 4A9AA 3ITNA 3UT6A 3GA7A 3VKWA 3A1DA 1V8FA 2UYOA 1O95D 1B3BA 4E30A 3KSBC 4DKJA 1KYWA 3K5WA 3AP3A 3INNA 4YRQA 1YC5A 4H4DA 3LUKA 3N8GA 4J0IA 3PQ8A 4JT8A 2HRQA 3HFRA 2YOGA 3JQFC 2VAPA 1VLYA 3NYQA 2YX1A 2R97A 3EIXA 4K87A 4A0HA 5I7RA 3ZIAA 3WHKA 1RE1A 2J3IA 2YJNA 5I9BA 2BJHA 4FYIA 4HRVA 1JEYB 2BKVA 4XUCA 1PR6A 1VECA 2FPLA 3E9DA 5JLJA 2BGGA 1Y4SA 4LRXA 1M6VB 3O1LA 3EEQA 4P92A 2P1DA 5E6SB 1GGKA 4FHGA 5AMXA 2F3SA 4HFNA 3KEGA 3TINA 1F0NA 1X7HA 3UV7A 2KM1A 3IMFA 1IG3A 3M5PA 5A3RA 2ZUVA 4PRKA 4YJDA 2G9NA 4F5WA 3W5CA 3CMEB 2WYWA 3G0BA 2PU7A 4OVKA 4Q15A 3GLFB 2GPSA 3UGQA 1B16A 4L51A 4IXMA 3RSZA 1WUYA 4YCLA 1ZRMA 3VI4B 3RUEA 1R74A 1TO2E 3UAGA 3L7KA 3TRHA 3U0BA 5C18A 3O1HB 5TLSA 3FLMA 3KDAA 3N05A 2XGSA 4W5WA 4EGCB 2CDAA 3KYIB 2R8XA 4IGEA 5IAJA 4ZYUA 2IZOA 3TZKA 4Y9SA 1JIJA 2BFFA 1BXRB 3LCMA 3C0KA 3R41A 4JIGA 2B2XA 5B58T 5DHUA 2NU9B 5EIWA 1YIAA 1I51A 2OWEA 4LJ5A 1Z2DA 1II9A 4C5BA 1HT1E 1REQA 2BTQA 4UHKA 4F38A 1HORA 3DDNA 3USCS 1T35A 1ZWLA 2C29D 4D8VA 3PDWA 5CNKA 4MDHA 1DEKA 3KOOA 1CBUA 2DC1A 2P79A 4O1MA 1ZBQA 4CUZA 4C6TA 1SU7A 1VIDA 4LNUA 5AXBA 1U2ZA 2FEOA 4M8KA 2PV0A 4I4LA 2WIBA 5FEMA 2C2YA 2UXDB 2RGEA 3OJWA 1DPFA 3K31A 3T9AA 5ALQA 2QX6A 3WLMA 3OEWA 1XJQA 4EHIA 4HAXA 5M34A 4ZQIA 3CSDA 1ZGZA 1DC7A 3D0KA 3RB8A 1T6YA 3AO0B 3KUUA 1PZEA 5JALA 3S8EA 1RZRA 2O6HA 3GPCA 2HA3A 2Q7XA 3DKKA 3HJTA 3G82C 3KWFA 4LFBB 3KXKA 1ZWKA 2DZDA 1XEAA 2FW9A 5CDTA 1QRDA 3EUWA 1X38A 2XTMA 4QLAA 5JATA 4I1RA 4KMRA 1R8SA 3G9XA 4MEJA 1M33A 1N6HA 3FTPA 4ID3A 1Z0AA 2D54A 3GI1A 2FUG1 3AJ9A 2Q2WA 3RSLA 1CFZA 3SJ7A 3W6OA 5K03A 2JAWA 3AFHA 5DCUA 2OMEA 1K8QA 4QODA 2IXGA 4FNOA 4E2YA 1NF8A 1O95C 1U4NA 5KKNB 2F1JA 2XOEA 4IV0A 2N0SA 4OJKA 5CA1B 4JI7B 3R7BA 4EJMA 1RZ3A 1VJRA 3DZCA 1FYVA 1V1RA 2W71A 2J9YB 2V7PA 3HADA 1F2UA 3ENQA 3ZHQA 3ZQJA 1GRNA 1O94C 4U7FA 3MVEA 4R9SA 2C4UA 5FFFA 3WHLA 4E2ZA 3F4KA 3F5DA 5G3YA 4X8IA 5JTUA 3B7GA 1J24A 3I3SR 1VKJA 3QF4A 4GECA 3SSMA 3DTTA 4E4RA 1A95A 4INPA 3TDKA 2FMHA 3VTKA 1CQWA 1Q84A 2BELA 3BY2A 2C9YA 3QUBA 4MUGA 4YRGA 4AY6A 2GBIA 3ECCA 2ZYTX 3RVNA 3AI7A 1M2EA 2JEZA 1D9ZA 1C50A 4JP3A 5B30A 1UOQA 4LBZA 4E46A 3N7UA 2WSIA 3M1AA 4EDHA 1R50A 4MR8B 1C1DB 4JEHA 3TQQA 2VZ8A 3TLZA 2VDWA 3HXMA 3C41J 2UUPA 3QWHA 5AIAA 1DARA 3I01A 4TVBA 2V9PA 3RRBA 2QY6A 1TB4A 1VCMA 2ADFA 5FYDA 2IJGX 2AZDA 3WIEA 1XQYA 4PG7A 4PN3A 5BW4A 5DV9A 1NQTA 2ZQ5A 3EA4A 1Z16A 5CLQA 4P36A 4B3HA 2QJOA 4K6MA 4UVEA 3ZHVA 4OG2A 1IJFA 4R98A 2WJVA 4F21A 1NQWA 4PO8A 4NZNA 1Z6PA 3T8YA 3BS4A 4OQXA 4RLZA 3VMFA 1SVOA 3KD3A 5CFQA 1PNOA 2A6PA 3TCKA 3QYJA 5A0VA 1TYBE 2GBCA 5KS2A 3H8SA 1HY3A 3PJFA 3SY8A 4DG8A 4DSNA 1CCWA 2X22A 1X15A 4RV5A 1HQDA 3A04A 4NKRA 1T24A 1CQZA 2OO7A 4WSOA 4LI0A 4J49A 5CT6A 4AROA 2VTKA 3MBIA 1DCKA 1UEIA 4U1RA 4PGGA 3TAHA 3TUJC 5KNBD 4XWAA 4TQAA 4NY1A 4CFYA 4A1FA 2QE6A 1K8ZB 1ORTA 3TX6A 2GHRA 1E2IA 2EL7A 4YMLA 4X3CA 2O6LA 1CZRA 3EIEA 1KRWA 4FDVA 4JQCA 1RR6A 2J3KA 2RIPA 2LZ0A 3QEOA 4LXUA 2QIOA 2PVSA 1YA6A 4X6XA 5F9MA 2W6JD 1Y81A 5IC6A 2O23A 2UYQA 4GOOD 3WL8A 2ANCA 2JJQA 1JR6A 1F6BA 4P0QB 1VPTA 2IGTA 2GM3A 3Q9UA 3TTTA 4FOPA 4LBVA 3EVGA 1JHDA 4B32A 4CM3A 1I5RA 2YDYA 3VR5H 1XF9A 1T5LA 1UIRA 2QB5A 2ISSD 1TAQA 1ADGA 2NZ2A 2EEZA 2PMWB 1Q11A 2CLIB 2VDOB 3KD2A 4OFWA 5G1PA 3SC4A 3UCEA 5B3KA 1E3WA 3KHKA 3ETHA 3LRXA 5AJHA 2AJDA 2E49A 4K81B 1V95A 2RKBA 5CM9C 5F7ZA 4P82A 4CR8A 3WY9A 2BZGA 2PVPA 2ENWA 4TYMA 3FCXA 5G1OA 5HW0A 1ESZA 5MHTA 1Q95A 3GYGA 1XZHA 4OHVA 5FPTA 1XZDA 1N5JA 2JG3A 1ADCA 1G3RA 4KDFA 1SUFA 2HRBA 4E33A 3SWWA 1VSUA 2HIAA 3VNBA 3DM5A 3DE7X 1P2TA 3GF4A 4NAHA 3OTQA 2RD2A 3IESA 2JJ2A 3HJRA 1P7WA 1YR2A 1DB3A 2ZSKA 3A6DA 5B1SA 3PCTA 5ICFA 2ZVDA 3R0VA 1QQTA 5AI0A 5ALTA 2F64A 2NXWA 3ZHOA 5DGHA 1E4YA 4C0LA 4JLNA 2V9ZA 3OFJA 4KUHA 1UKZA 1TCAA 3KUXA 2HJWA 1IAVA 1B6RA 1HUQA 3QKRB 3AVXA 4Z3DA 4D43A 3ABRB 1RS0A 3INGA 4G5OA 1XMOB 4QT0A 1SVNA 4WBXC 5B3JA 3Q38A 3BJEA 2IHYA 1GZHB 2CMDA 2P4UA 2M6RA 3I58A 1X86B 3IEPA 1CY0A 1M8KA 4NX2A 2YNMD 2RHHA 3ORRA 4FSDA 4AZ0B 4UM5A 2Q8QA 3HP1A 3LKBA 1TAGA 4DFDA 1WSDA 4EFNA 4RPCA 2WVGA 3IVXA 5DM60 3G49A 4Y1EA 4EHDA 3LKVA 1UQUA 3Q7TA 1X1RA 5KYYA 3GGJA 1Y4UA 1QIHA 3KYCB 4QYMA 4XWYA 4TVKA 1CR4A 3VDMA 5IT0A 1E9EA 2ZS9A 3E7WA 2AXEA 4XCXA 4XGIA 5CT4A 1KVSA 2EOAA 4YGYA 3K70D 4AWBA 1KU0A 2BM9A 4TKUB 4NBVA 1F1BA 2I8AA 2NV0A 2XMDA 4EG6A 3AIKA 3VC2A 3DDSA 1WSWA 4P4GA 4CMIB 3KQYA 1E2NA 3A9VA 2ATVA 3NPMA 3ROTA 3TNDA 3VOAA 5CTAA 3A35A 4O02B 4NBTA 4R3WA 2W2PA 2WRZA 4B6GA 4EEKA 3CWCA 3ANXA 3U3MA 1RLOA 1PRYA 3SC3A 5C8ZA 2X6YA 2BFBB 1DKNA 2XODA 1NX9A 2RH8A 1Q74A 4PAAA 3F8TA 2FK8A 3PXXA 2KS6A 1KO1A 3R3JA 4YECA 4EKEA 4L8JA 4FIDA 1QJ4A 4BPBA 1BXGB 3JARB 2BH9A 3UJ9A 2UV8A 5ICEA 3JV7A 3WYCA 2NZUG 1GUYA 3OZTA 3DZ8A 1M5UA 3V4RA 3O8OB 3Q4GA 1TO1E 5H4HA 1XPOA 2R6FA 3H5IA 1C29B 4OMDA 4RHUA 1W46A 3FFWA 4I0WB 3RWBA 1ISSA 1QO0D 3S2ZA 1DDOA 2W6NA 2Q9AA 3AJEA 3NGLA 1J8QA 2PUGA 4UEWA 2BN4A 1PWZA 1RAGA 4BB9A 3PFBA 3TIFA 2I2BA 1F51E 1GCGA 5CCEA 4N65A 3VAAA 3X1MA 2JB9A 1WQ1R 2OO5A 1GDDA 3AONB 6PFKA 2GA9A 2P1RA 1H2WA 4HAOA 1JX6A 4BMXA 1T2NA 2AG5A 2Y0DA 3QV2A 3SPXA 3KUCA 1BA3A 1Q1BA 1J5XA 4Q34A 3MS2A 2IY7A 2GPNA 1EMDA 4JX9A 3IIMA 5TQ0A 1FNCA 2H16A 3DQQA 3TZLA 9GPBA 3ASVA 4NCAA 2P9YA 2WWGA 3BYZA 4QVKA 1M8FA 1UD6A 4UDNA 1VJDA 5HCNA 1R5JA 4BNMA 3L6BA 1PR5A 5JZVA 1QHNA 4GM4A 2UXBB 4CV1A 1AG9A 5CD1A 1OJ7A 4TV9F 5JH7A 5LJIA 1V39A 1Y1QA 1OC2A 1MAUA 3B9RA 3OPNA 2R60A 3M6AA 4AP6A 4DNXA 5TVGA 1N1DA 4ACBA 5JDCA 3OQPA 2AXNA 3VZPA 2E4WA 1KOGA 3ADOA 4QXMA 2VDQB 4KO4S 3AR3A 5SICE 4OP7A 3LU1A 3S28A 3LQ2A 1D5CA 5KOHA 5IJAA 3U62A 4M55A 3I76A 1V71A 2RAPA 4G7XA 2YNMC 3KJEA 2IX3A 1YSCA 3D6UA 1CK4A 5I4IA 4CF3A 1YGYA 4IGIA 3JATB 3EUFA 5IBPA 3DBVO 1UT8A 3QQPA 1KAMA 5IW8A 1O08A 4DDWA 1J0DA 1QHSA 1NG1A 2NZVG 3RANA 3B20A 1WOOA 1MVNA 3DWGA 3RTGA 3UWSA 1VBNA 4GVXA 4OK6A 2R4QA 4ZT7A 5EY5B 5JMOA 1VDMA 5HPYB 4L07A 1MC4A 3K70C 2GS9A 1D03A 3NHPA 3B1FA 3R6KA 4ALLA 4ZYTA 3DCYA 3ISJA 2AN4A 4G36A 4KPFC 1A8QA 4CUJA 4AZWA 4D99A 2J4DA 4HG2A 1ILEA 3WMGA 4ZO4A 5C5DA 1XD9A 1KL7A 4PGOA 3F6RA 1OWNA 2IIQA 6REQB 1CE8B 3D7LA 5ENDA 2DQKA 1AQNA 1NONA 4JY7A 5CUQA 1Y6FA 3K8QA 4HO1X 1P7YA 3KR0A 4JMLA 3S29A 1WKBA 3SJUA 3NWJA 1EE9A 3ZHBA 1UMBB 4MWOA 4G09A 5KJ6A 1XVVA 4M9ZA 1MT3A 3IC5A 2AOTA 3CXCB 2F59A 4I4TB 1N2GA 3O2QB 4H7PA 3OZCA 1TF5A 1VHWA 4UHJA 2H51A 1UM9B 3EZLA 3QITA 4NYJR 4LFAB 1TUBB 2QN1A 3ICPA 1K6EA 4TZTA 1N2CA 2QXYA 2WDZA 4ZANA 3FFBA 1L3IA 4OOSA 2PXXA 2VR1A 4GMXA 3EMDA 2VUHB 3H2SA 2P9FA 2YZ2A 3A70A 2XH8A 2VUSA 1C9DB 2CXOA 1ACLA 4TMWA 3FIJA 4FKMA 2CV1A 3A3G