1F60A

Crystal structure of the yeast elongation factor complex eef1a:eef1ba
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
440
structure length
440
Chain Sequence
GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nucleotide exchange and competition with tRNA in the yeast elongation factor complex eEF1A:eEF1Balpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords ELONGATION FACTOR EEF1A
total genus 128
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1f60A03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1f60A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f60A01
1VQ9B 4WIAA 3IBGA 4LBVA 2JEOA 1E96A 1Z6YA 2V6IA 1KDRA 3GFTA 2NTYC 3O8DA 4Q1CA 2GVDC 4PPQA 4NYMR 1M8PA 3U3JA 4N1AA 4ZV4A 3NEYA 4JT2A 1ZIOA 2IXEA 1E2MA 2IYZA 2FOLA 2J7KA 2XXAB 2BKEA 3CF0A 1E9DA 1II0A 3ZD7A 2PH1A 1Q1EA 1Q1ZA 3NWJA 4D81A 1Q44A 2ZYTX 1R5NA 1VQMB 3BE4A 3AEZA 3LLMA 1BKDR 2IL1A 3ADDA 4HLCA 4ZIRB 2FSFA 3OFND 2HUPA 4LK2A 4LHVA 1SGWA 4QHSA 3VR5A 4FCVA 1M74A 3GJ0A 3PUWA 3G6EB 2AN9A 3FFAA 5AJXA 1Z22A 1KQSB 2AD1A 5JS7A 2NIPA 4F4IA 5E3HA 1Z0AA 3WP1B 4IVRA 4N0EA 2J46A 1XXHA 3RC8A 4GSYA 5B2ZA 1EG7A 1F5NA 1FMLA 3B1XA 1IN5A 4W5JA 4XD7A 2QMOA 4BLOA 1G8YA 5EE5B 4ACBA 3BOSA 2D3WA 4B43A 2B7BA 2OBMA 3CLVA 3RNLA 4HUQB 4HUTA 2WOOA 2RGEA 2GBLA 3A1UA 4A0FA 3GJ8A 3A1VA 4V03A 1AS2A 2YWGA 4JT4A 3H0KA 2W0SA 1KDTA 1KI6A 3EWAA 2YVUA 2J41A 2BF4A 3P20A 4L15A 3WYFA 1XF9A 4A2PA 5TVKA 4AYXA 2DB3A 1QG0A 4BFWA 1T91A 3AF3A 3GQBA 3LY5A 2YJTD 3AM1A 4P3YA 1ZM4A 3LQQA 1SULA 3AB3A 1ZJ6A 4Q4JB 4P4SA 5A0FA 3QY0A 4RCZA 4RZUA 3GD7A 2RHMA 3Q3JB 5EXXA 1V43A 1VQPB 1M2OB 2BHRA 2R65A 4O0MA 1NJID 1Z2CA 4QKQA 2EIXA 1KY2A 2ZETA 3SS8A 3MMPA 3IUYA 3A1TA 4HSEA 1T8UA 1IQPA 4B4DA 3K0AB 3T5GA 3F5FA 2XX3A 3DDCA 3PITA 2JLSA 4EQ6B 2PIAA 3EXAA 1MRNA 2ONKA 2QE7A 4JLKA 4JLJA 2G1JA 1DOAA 2FFBA 4QBFA 1IHUA 2BWJA 4LY6A 1NKSA 4AWXA 4Q00A 1T3LA 4HAVA 3T12A 4XSHA 4NDZA 1FZQA 3FMFA 2ZS7A 2CVFA 1G5TA 3C8UA 3CZQA 1IONA 4M53A 1VG1A 2EFDB 2R6GA 4XH9B 4N0DA 2F1RA 2QPOA 4WAUA 3LAWA 1XWIA 1VCMA 1ZW6A 3W5HA 1D9ZA 2A2ZA 4PPNA 3AVUA 1KRHA 2HJVA 1FP6A 1R8QA 2IYTA 1E1RD 3CRMA 3TK1A 2A5DA 1X8JA 2G1KA 2H57A 4ZCLA 2IYRA 3A37A 1AGPA 4C2TA 4MYTA 2RB4A 2VH5R 3BWDD 2R6CA 2XXAA 4TT3A 3OW2B 3SI7A 1U99A 3QIAA 3Q72A 1WP9A 3KJIA 4KBGA 1I4TD 4IOJA 1QRAA 4ZGQB 3IO3A 4PSVA 1IAQA 4DLSA 1E9FA 4HZUA 4M1KA 1UBGA 4B48A 1P6XA 2ZTSA 1I2MA 3LQRA 4JBWA 2FFAA 2F9MA 4D82A 3CXCB 3L8ZA 1T3SA 3U7HB 3KQLA 8OHMA 4PQFA 3WYGA 4XJXA 2JLRA 3CIOA 3JVVA 4UKDA 3QPVA 3EA0A 4US2R 3CKLA 1J7KA 2P2LA 3EIEA 4IOLA 4R9UC 4EUNA 2NMVA 4C43A 1W0KA 5KSPA 4Q47A 5CIWA 4DDWA 2E1RA 4A36A 1OT3A 2MSCB 3NDPA 4JLBA 1TUEA 5F98A 3FKSA 2X19A 4AIIA 4KLNA 5BWMA 4PXAA 1OFTA 3RRYA 5CDFA 1A1VA 1QHXA 1R7RA 3HR7A 4BLRA 4G1UC 3EPJA 3BGWA 3TLXA 2AXNA 2F9LA 2WWHA 3CPJB 4DCTA 1NLYA 1JAIA 2NO9A 2YOFA 4B71A 5KOYA 2WAXA 1OB2A 2GA8A 2ZE7A 2GWHA 1EXMA 3WMFA 1RJ9A 2RHDA 3A1SA 1ZM7A 4DQLA 1XBTA 2A3RA 4GMXA 5CK5A 1E9CA 3C16C 4US0R 3K0CA 3RAPR 5AK0A 3ETLA 4GZMA 2ZRFA 4PQRA 2O0KA 2ANCA 3OJWA 4TQUS 5FUWA 5FTKA 1NVUQ 2QQ0A 3ICEA 2F43A 1VYVA 3RS0A 1QGAA 2XTNA 1Y3AA 3AUYA 5GJBA 1TNDA 4TTRA 4U02A 1DDGA 4QRHA 3SOPA 1W0JA 3CH5A 2OBNA 3LX8A 4K81B 2WZQA 2O5VA 1LNZA 2DBYA 2OTJB 1EFRD 4O2LA 2IC5A 2WHXA 5ELXA 1IN6A 4JYCA 1GJRA 4HLUA 2CRVA 1XMVA 3CO5A 4BFTA 4YMUA 3C5HA 4OK6A 5BYJA 1JBKA 1W5TA 2FEMA 2RGGA 3I8SA 5IK2A 2JLQA 3JQPA 4IDHA 4IEEA 1NLFA 2Q6TA 2DFLA 1W7AA 3ES9A 1L7VC 4XD7D 3RWMB 3K09A 1GL6A 1H42A 5AUOB 1NMYA 2A5YB 2WPDA 4OKSA 3TW8B 3ZIAD 3QFSA 2QBYB 1S0UA 3ASYA 3W8NA 2XZLA 3AF1A 2ZVPX 2QTHA 1OXUA 3RS4A 1N25A 1SVMA 3KTAB 5FBLB 3X2SA 3ZZ0A 2GTPA 1VG8A 4F92B 2HV8A 1KSGA 4D80A 1C4OA 1KY3A 2ZITA 2H1LA 2ODWA 4GRAA 4NCIA 4DLYA 2OILA 3SHWA 1CKEA 3QF4B 3IPXA 3WHKA 3WBKA 3MJHA 1OIVA 2AL7A 3LNCA 3L82B 2F43B 2OFXA 4G1BA 1GITA 4S2EA 2N1BA 4DC9A 4KVGA 1DADA 1KJWA 4OK3A 4TQ9A 1ZVQA 4BZPA 1LTQA 1N5LA 3QBVA 5JBQA 4OQXA 2J1LA 4OL0A 1DVRA 1CR0A 3KTAA 4FIDA 5CLQA 4CZ2A 5KSWB 2XZOA 3WNCA 1NY5A 2P5TB 1RIFA 1DG3A 2OHFA 2ZE6A 4ACAA 2JASA 4M1WA 4FN5A 3HDTA 2R6FA 3GLIB 3GJ7A 2QBYA 1IOZA 3DOEA 1GL9B 5DISB 1VQ4B 2ZUDA 1JAHA 4YAFA 4HI0E 1LB1B 3HYTA 4JLMA 3TR5A 3T5DA 1OYYA 3LWNA 4NE2A 4AC9A 4BFSA 1FPMA 1TAGA 1D5CA 1SKQA 1E2NA 2G83A 2A5GA 2JJ2D 4LYAA 3OFNA 4US1R 4KFTA 2DPXA 1L4YA 1O3YA 2FNAA 3V76A 2Q9BA 1ZD1A 4OQFA 4LBZA 3H86A 1E64A 3REGA 5DGXA 1DBSA 4DJTA 4K8OA 2C9YA 2CLDX 1ZYUA 2IYSA 3WRYC 1OIWA 2IA5A 4TLBA 4LBYA 1Z6GA 2R6HA 2UZIR 2C04A 2EW1A 4J0QA 1Z2AA 4FMCF 4XVQA 4BRUA 3F8TA 2NO1A 1CR1A 2AFHE 1XDBA 2F1JA 3LO8A 1W44A 1XTIA 4MA4A 3CRW1 1WBDA 4I1UA 4HAXA 1DTSA 4LGMA 4UXHA 4DDTA 3BB3A 4DLWA 1NIPA 2ZJBA 5J4HA 1X86B 2VNIA 3QFCA 1LFDB 4GNKA 4TL9A 2ZJAA 4M9XA 1E2HA 1XFAA 4A8JC 1FNNA 5DHFA 3WXMA 3ECCA 4W5HA 2EYQA 3ZD6A 4JKIA 4TQAA 4HB4A 3QNUA 3R20A 3ZDQA 4Q5IA 1KI2A 1GVNB 2BMEA 4WZAE 5KSOA 1W46A 4UNRA 2IT1A 1MKYA 4L4UA 1XD2A 3TBKA 3RSOA 4C7OB 2R6DA 1VQ7B 1G16A 1P72A 4IVQA 2EFCB 1N6IA 2F1IA 3LO5A 3O8RA 4U9UA 3R7WA 1CJMA 2B21A 1JECA 1S2MA 3PUYA 2FPKA 2YV5A 2OXCA 1DAFA 2H18A 5GJCA 2IYUA 2CLSA 1H8HA 2OE2A 1AKYA 2QUZA 3K0AA 1YQTA 5E7MA 1D6JA 3DOFA 2CK3A 2W6ID 4PHHA 1E9AA 1MABA 4MQBA 3QOFA 4DZZA 3SN6A 1GILA 2BVNA 2F3TA 4Q9KA 3HU3A 3A8TA 3SYLA 4HZUB 5JSZA 3EZ6A 4LC0A 1QHSA 1XRJA 4RY2A 2GPJA 4RFVA 2D7CA 3U3MA 3GLFB 3FDIA 2IXGA 2YYZA 2D2EA 3N5CA 3QJYA 1XU4A 4LUCA 3RANA 1KMHA 2GEVA 3KXIA 4YQFA 3BB4A 1JR3D 1SXJD 2RGXA 1ZC4A 2ZJ2A 1XMIA 3K53A 3W2FA 1BX0A 2ZRJA 4LX0A 1U0LA 3AGQA 5HZHA 1X3SA 1T5LA 3I5YA 5DN6A 1VDZA 1XJQA 3A36A 3ZZUA 5HE8A 1QHHB 1JEEA 4LJ8A 2HDNB 3A6PC 2ZJ8A 4URWR 2W2VA 4LC1A 1W1WA 3EIQA 3BH7A 4JVSB 4AI6A 2Z4SA 1EWRA 5KPDA 1YZQA 4IFEA 1XE1A 3WRXC 1E0KA 1XEWY 4ZDIA 2NQ2C 2VQSA 1YR8A 2NGRA 3JQRA 3X1DA 1ESNA 2WJYA 2C9OA 4LRWA 1US8A 3HWSA 5FR2A 4M22A 3LVBA 2JCSA 3FHCB 1JJ2B 1JQLB 1JA0A 1F2TA 1KAOA 2CE7A 4PC3A 4PFSA 3T34A 4M9SA 4V0MA 4ZIRA 1SVWA 3NBYC 5TY0A 1LF0A 3PV0A 4D4LA 2QN6A 1XCMA 3SDZA 4DXAA 3NHAA 3TMKA 4BZQA 3BXZA 4C4PA 2YC2C 1S3GA 4AKHA 3MAAC 3OEHA 1DELA 4BLSA 1GOTA 3CM0A 3O8BA 2VSXA 2VYFA 5G53C 1G3QA 1KDOA 2W6JA 1K8AD 2V1UA 2I1VB 5LBIA 1TF7A 3MUFA 1EFCA 4NH0A 4DDUA 5AUPB 2XNDA 2YOHA 1WMSA 1Z0FA 2QMHA 3V9PA 2HMAA 2KBEA 3ND9A 2WMOB 3AP2A 1J9ZA 5HCIA 1XMJA 5D3MB 4QXAA 1KI6B 1W36D 3W3ZB 1U81A 3QPUA 3PENA 4QGAA 5GJVC 1DAMA 4F38A 2WIAA 2QM7A 4XSGA 1E2FA 1PZNA 2AK3A 1E6CA 3HYRA 5H5JA 4GFDA 4CEJB 3D31A 1XXHB 1KO5A 5EE1A 3QKRB 3SR0A 3KQUA 1EFHA 4CEHB 4AG5A 1KK0A 1E2KA 2C2HA 4KLZA 2H17A 2ZPTX 3W6NA 4JBYA 1J2JA 4P4TA 3U3RA 2V9PA 1G7CA 1Z5ZA 2KE5A 1Q21A 1IY1A 4BRWA 1F2UB 1Z28A 2W2XA 1IJFA 4LPSA 4Q18A 4NCJA 2BBSA 1FL9A 1N5IA 2QGNA 5FA6A 1TL7C 2IBMA 1GP2A 1ONBA 3U6BA 1Z0IA 3B1ZA 2CCKA 3MG9A 2QDXA 1LV7A 3FMOB 2V7QD 3PFIA 2D7DA 2BBOA 3EIHA 2JJ8A 3SU8A 3OIVA 1DAGA 5L3QB 4YHBA 4GI7A 2YWEA 1J70A 1MT0A 2GJSA 1AZTA 2JLYA 4GP6A 2BGJA 2B8WA 4IXNA 2R62A 5J4LA 3EC1A 5AR1A 3QE0A 4DBLC 2ZANA 3RWOA 4ASUA 5BW8A 4F93B 1QG4A 3O8CA 1CNFA 4C2UA 3SQXA 2BMJA 1LVGA 1LW7A 2QRZA 3LBNA 4B6FA 1KHTA 1OW3B 2Z83A 1M90D 3THYA 1HYQA 1XEXA 5JRJA 5GV7A 1HY3A 1CNEA 1GKUB 3KB2A 4YMWA 1QFJA 2O52A 2XOKA 1U90A 4Y0VA 3PR1A 5HTKA 4TYPA 3RHFA 4JL6A 3THWA 3OE7A 1ELOA 1VIAA 3A4MA 5KPJA 1G8FA 1Q1BA 2QPAA 1Z08A 2D62A 2QMUA 2EFHB 1EWYA 4M4SA 2OEPA 3IIMA 4L16A 2ONJA 3NDBB 3VTKA 2KSQA 5HPYB 5G3YA 3NC1C 4ZO4A 1Y63A 2H16A 4Q1DA 4X8LA 2ZRHA 1W35A 1Z63A 3EC2A 2GQFA 4IRUB 1E3MA 5JJLA 2G77B 4L8GA 2GDJA 2PCJA 3IHLA 4Q4HB 2B7CA 4IKEA 2ZRDA 4MYHA 2YKGA 2J0SA 1TLLA 2XB4A 1HQYE 4WXPA 3K0FB 2FH5B 1PUIA 5KYKA 3C7KA 2CK3D 3CNLA 1FQKA 2OO7A 4P6VF 2ZRKA 4IOMA 1M7BA 4TL7A 4V0NA 1QUFA 4MKFA 3RS2A 5HKKD 1K5DA 2A5FA 4OI4A 4CGZA 1OXXK 3KJGA 3FVQA 2V6JA 1UKZA 1OYWA 1VQ5B 5JEDA 5CYOA 1EFUA 4M2LA 3A4LA 4CEJA 4D25A 4DT1B 2C8VA 1FFHA 3PEUA 2GJ9A 4OI1A 3UWOA 4GOXA 5DIFA 3B1YA 1KKMA 1OLOA 3HPRA 1OXSC 2GF9A 4C0JA 5A4JA 3CCSB 4JLNA 1GSIA 3ZJYA 1DS6A 3OIWA 1KO7A 3L0OA 3LV8A 1JEDA 3OAAD 2OAP1 1QDEA 4HB2A 6Q21A 1YR7A 1QHGA 1B0UA 2WM9B 2WSSD 4QBGB 3W5JA 4A15A 3B78A 5EP1A 4D26A 1KNQA 4OK5A 5IF9A 3KXLA 5J4YA 1H8ED 1OHHD 1A5TA 2FSIA 4E03A 4DWJA 2REBA 4BE7B 3M0EA 1CBUA 2J0UB 1VCNA 3LH5A 4NL4H 1P2UA 4HATA 4UNNA 4JLAA 5EMNA 3OEED 1IBRA 1QVRA 1F2TB 1HT2E 4URVR 2REXB 3IHWA 1R5OA 1CJUC 4P0TA 3P1JA 4Q7JB 4R71A 1ANKA 1QF9A 1RYFA 4BPBA 4MGZR 2PLFA 1BIFA 1EFRA 2FJUA 2W2TA 5L3VA 2DEUA 4HYYA 4TMWA 1Z0KA 5EQTA 1GNQA 4G1VA 4EPXA 5FPSA 1NVXQ 2YOGA 2HLDA 2DETA 1AS3A 5EUMA 1HA3A 2Z6VA 4RKEA 5H1YA 3OIYA 2FWRA 1NMXA 2XNSA 1R0YA 1JR6A 2NZJA 4RSGA 3MGCA 4DKXA 1E2GA 1CULC 2IYQA 1PLLA 4Q9HA 1VECA 2QEXB 1CJKC 2ERYA 4YXWD 5DN6D 3K0EA 4CEIB 5IRCD 3EZ9A 3KUCA 4MGYR 1CXZA 5HZKA 4MYUA 1S3SA 2FE4A 2AKYA 2I4IA 2QSZA 3BK7A 4B76A 1RRCA 3E20A 5DI9A 3QE2A 1G291 3EA5A 4QGHA 4LJ4A 2XJ4A 3OZVA 1OF1A 3AVXA 4KVAA 2J0UA 3A1WA 5AUQA 1NY6A 3W9YA 4B3FX 1WRBA 4TL8A 2Q3FA 3FMIA 3T61A 1QVFB 3LX5A 4DUGD 2JLUA 1AKEA 4B35A 1G8PA 4LBWA 1XEWX 5EXPA 5GV8A 5J47A 3TGPA 4JVNA 1IM2A 4V0ME 5FTLA 3SQWA 1T0HB 2JLVA 1KAGA 2QTVB 2P65A 3PQCA 3UG7A 3RS7A 1GFIA 2OFWA 1JXOA 4QNRA 1KO8A 4GL2A 5DH9A 2BCGY 2X1VA 2WWYA 4KYUA 1FDRA 2WVJA 4MGKR 4LJ9A 1HT1E 2GAOA 4TWZA 3RABA 1JA1A 2IWHA 4TT3D 5UKDA 1WB9A 4WVFA 2QENA 1W49A 1ETUA 2GAAA 2Z0MA 5A5GA 1BOFA 2HYIC 3QKSB 3TRFA 4RD4A 2PZFA 5EZ5A 2ZSEA 5L3SB 1R10A 2OUKA 4MRSA 4L5BA 5GVRA 3THOA 4NP6A 4WBSA 2BCJQ 3CR7A 3ZZTA 4PC1A 4V02A 1U94A 1MOZA 1SXJB 2QAGB 1ZNWA 4ZKEA 5FPHA 3I4LA 2C5LA 1DO2A 1NDHA 3B6EA 4DQKA 4URYR 3V00A 1CJTC 5E95A 4CYMA 3GCGA 4B3XA 2CNDA 2BPOA 3IBYA 3CUEF 5BN4A 2OV2A 1XJCA 3FKSD 1ZNZA 1KC8D 3PCRB 1FNCA 2QTFA 1GO2A 1KYIA 1E2EA 2C99A 1Z29A 3ICQB 3B1WA 2O8CA 2ZRMA 1FP7A 1EK0A 3EAQA 4FXPA 2WSMA 1FMJA 2CLCX 5HXBA 4GMDA 4XTCS 3UIEA 5K8UA 1CU1A 4DSUA 1TEXA 4XTRA 2CL6X 4Q9JA 4E07A 1GR1A 1G8GA 5FUYA 4URZR 2ZR9A 1AS0A 2X77A 1C9KA 1TU3A 5LB2A 2FEOA 1RRPA 4ILEA 4BFYA 4B73A 5KDOA 1M7GA 4ITRC 3NHBA 1E63A 4CIDA 4Q1AA 3U3KA 5LD2B 4H1UA 2ZSBA 3CCLB 4BASA 1E0JA 4BWYA 4DT1A 5AUNB 4C0LA 3DM5A 2ZI4A 2WJIA 3QUSA 3QBTA 3DVLA 5LB4A 5JJIA 3CZPA 2JJ1D 4BGDA 1COWD 3ZLJA 2FX3A 3EZFA 1N3BA 3GJ5A 2GEUA 1GDDA 3HP1A 3KL4A 4OQLA 5CYPA 5JWRA 5EJEA 2JA1A 3CNNA 4ZCMA 3E1SA 2QROA 3C5CA 1KK2A 1HH4A 4TSFA 5FPTA 3TR0A 4NHOA 4WQMA 1VQKB 1BX1A 3CC2B 3HJNA 3K0FA 4XOIA 1OFHA 2OCYC 3ZS8A 1WA5A 1A2BA 2QT1A 1TVCA 1P9NA 2WAYA 4DUGA 4Y9UA 1ZD9A 2HEIA 3N2IA 1U9IA 1GRRA 1A82A 2IXFA 4OQNA 3ZQ6A 4C0QC 2P6UA 2PT7A 3PUVA 1G20E 3AVOA 4E22A 3SZRA 4W9MC 1UAAA 1OHHA 1SQ5A 3T35A 1XMSA 3QSYA 4OHVA 3ZBUA 4C0HA 1DPFA 1S1MA 2PLRA 5FFMA 2JJ1A 4KCGA 1AMOA 4KI0A 2IYVA 2GJKA 1Q7YD 3CF6R 4TYNA 1FNMA 3X1ZA 4RFSB 1S96A 2G3YA 4PSAA 1JB9A 1Z6TA 2ZQ5A 2FDCA 1QGZA 3F3YA 1S9DA 3FE2A 1P3JA 1IN7A 2ZYWX 4UJ5A 4NCHA 3ADKA 3OHMA 1VCIA 4PQYA 4IFBA 4KJZA 3TW4A 3VKGA 2ATVA 3SHFA 2FF7A 3AP1A 1QUEA 3DZ8A 1QHYA 1KD1D 5J5CA 2OAQ1 3LDAA 1XCPA 1T0JB 1BMFA 2AWOA 5BYKA 5JI3E 2GESA 3NG1A 1OGJA 2Q9AA 2VIIA 1VMAA 2VBCA 1VTKA 3G5UA 5L3QA 4GOKA 1JR3E 4Q7LA 2I1QA 4A0GA 3CPHA 5JWOA 3R9XA 1S1CA 3CCRB 1NBMA 1H8HD 1M1YE 4IDOA 2HXSA 4OQMA 1E94E 4B33A 2B8TA 3BRWD 3K9GA 1OFUX 3QI2A 2ZRCA 3W90A 1W4BA 4JLDA 4R2IA 4B75A 1II8A 1W36B 1G5PA 3P4XA 2B5OA 2NPIA 3DMNA 5JCPA 1HQCA 4RKFA 5FBRB 2FSHA 2O8BB 2XJ9A 1W48A 4PO9A 4TL6A 2GXSA 1ZUIA 4HDQB 1XTKA 3UG6A 5FOSA 5SZHB 4TMXA 2ZSDA 4PAQA 2RC6A 2XTZA 4M0LA 4NYIQ 2LKDA 3LBIA 3NXSA 4LJ6A 5FOXA 5B64A 2O8FB 5F2EA 2UKDA 1G41A 4C3ZA 1QGYA 1MO4A 2FSGA 2G88A 2XNJA 1OB5A 3CF2A 2VF7A 1UMKA 1CRQA 2ZVQX 1E9SA 3BH6A 1YVDA 1TQ6A 4NYIR 3SFVA 3I61A 3DO6A 1SVIA 4PANA 1ZMXA 4KSCA 3LLUA 4NONA 2WWGA 1FX0A 2F6RA 5FL7A 5JCZA 3ZVLA 2ECKA 1AA9A 2PZEA 4F4CA 1UJ2A 3M1IA 2ZE8A 3NIBA 1BYUA 1KMHB 3SFZA 5C46F 2BMFA 4Q1BA 4ON9A 1Q82D 3GEIA 2V7QA 2FFQA 4M1SA 3W2HA 5FPYA 3BC1A 4M9ZA 3T1OA 3QVVA 4TMKA 1B23P 1FNBA 4C0KA 4M9QA 4G5QA 2HJGA 3SBDA 1HUQA 1J8MF 4Y0AA 4AKIA 1CP2A 2EFEB 2RGNC 2R44A 5G41A 5JZVA 4QM7A 1JALA 3CCQB 2PL3A 3AQ4A 3T1VA 2QORA 3RS5A 4IHQA 2P5SA 3BIFA 2DWOA 2VLIA 1Z6XA 4JSYA 4PO8A 1KGDA 1EWQA 1US8B 3GFPA 3R7WB 1B2RA 2HCJB 1Q12A 1KI7A 2JJ2A 3NH6A 4Q03A 221PA 1JNYA 1N0UA 2QP4A 4JS0A 4C0BA 5KO2A 1TF2A 2F55A 2A5JA 2J9RA 1R8SA 3GLHA 5H8WA 2O8EA 3LW7A 3ZVNA 3AVQA 2CVHA 1KOFA 1WDTA 5IK2D 2JATA 2X3UA 3MFYA 4LHYA 3EPHA 4IXMA 2BM0A 3B5JA 3W2IA 2JDID 4HDOB 3CD6B 2QMEA 3M6AA 2G0NA 4TLDA 2IW3A 5AJVB 4AK9A 2XSZD 2FGKA 3L0PA 1IY2A 4RZ3A 1KI9A 1OE0A 4TLEA 3K70C 2IS4A 1TADA 4U5XA 4DLVA 4EJSA 4M1MA 2FPLA 3ZS9A 3G0HA 3TQCA 2GZDA 4MH0R 1RKBA 5JSZB 2OXRA 4LV8B 2ZM5A 2R9VA 3CONA 3SBEA 2GK6A 2C96A 1OJLA 5J40A 1MABB 3QKUA 4ESVA 4RD3A 4IDNA 1T5IA 4P32A 2IHBA 1OSNA 5TXGA 2CE2X 4RCYA 2G6BA 2QY9A 4YLGA 3E2IA 4XVRA 2IS1A 4A9AA 1G5RA 4YONB 4EPWA 3BAFA 5KNDA 4TN1A 4BUJA 3PEWA 4KAXA 4CDGA 4G5SA 2PX0A 3HR8A 4Z54A 5AJZA 121PA 4FMCB 2WKPA 3KQNA 3FPAA 3VHXA 1RFLA 2J45A 4F7WA 1QH0A 2CL0X 3KQHA 3U6KA 2C9CA 5CB8A 4B34A 4K46A 2QT0A 1G7TA 3GLIA 5LPNA 4YMTA 1S72B 1N0VC 1GKYA 2J7PA 4PPFA 4MDFA 2FFHA 4JIMA 3CC4B 1H85A 2BMDA 3EZ2A 1RW4A 1WE2A 3R9WA 1E2DA 3EARA 4OYHA 2R2AA 1OH6A 1UDXA 4QG7A 3U4QA 2WKRA 1YRAA 2ZRPA 1R2QA 3ZIAA 1F48A 2HT6A 3PG5A 4WZ6A 3ZVMA 2QRNA 3CX7A 3I5XA 1IXZA 4NMMA 4ZDWA 3TSOA 3TUZC 3LVQE 2RKOA 1W2BB 1E2IA 3VMFA 2E87A 2OESA 3MJRA 5SZIA 1T3HA 3LBHA 3TVDA 3THXA 3P27A 1U8ZA 1BS1A 1ZC3A 2HCBA 2REOA 2D4HA 3DZDA 3OZXA 4OHXA 4DLRA 3VO1A 1MV5A 1NP6A 3IIJA 4MRRA 1U8YA 5J4KA 1SVLA 2YC4C 3UWKA 3ND8A 1G18A 4NYJQ 5JJKA 4EH1A 1BJKA 2Q3HA 1DE0A 3B9QA 2CNWD 3EZ7A 3GJ3A 3IPYA 4LYFA 5DI3B 5EXSA 2A9KA 4LYJA 1CJVC 1NN3A 2R6AA 4B2IA 1GWNA 1Z8FA 3FPKA 1RZ3A 1Q86D 1J90A 1K6MA 3Q9LA 3AKEA 3MD0A 1R0ZA 1T9HA 3UANA 3AF4A 3G4SB 3NBFA 4PZZA 4MKGA 3U7GA 3RSLA 3KXKA 1SXJC 2QAGC 5J4VA 3VQTA 5GADl 5IHPA 1E9EA 2ASEA 1AK2A 1E1RA 3Q5EA 2ZIAA 3KB1A 4TYQA 5G40A 4EIWA 3CWZA 2XITA 1G4UR 1L8QA 1M34E 4A4DA 5FTJA 2FMXA 5DI3A 1R0WA 2LWIA 5BXQC 3MCAA 3QFTA 1II9A 1AZSC 3SYNA 4FINA 2CMKA 4CT5A 4JYBA 2QSYA 1W2GA 1YJ5A 4YMSA 1TMKA 2GRJA 2N46A 4JVMA 3X1YA 5HR5A 4JL8A 2VP9A 2ORWA 4LJ5A 1RRFA 1QVAA 2HF8A 3FYHA 3GJXC 4NYJR 2IUUA 5C4MA 2A7QA 2WJVA 5H68A 5F9FA 5K8IA 3ADBA 1GTVA 3CRZA 4W5WA 1YRBA 1R6BX 2PMDA 4B3DA 4FD2A 4ZDJA 2ZROA 3W34A 3MLEA 4KBFA 2QQEA 3LFUA 3UMRA 1UPTA 2ZSFA 2ODBA 2WWFA 5AN9A 1YR6A 5DSZA 1GG2A 1KJYA 4Q7MB 4Q19A 4Q1EA 2K5UA 4XWAA 2FA9A 4Q21A 1G7SA 4XVUA 1YZKA 2JLWA 1NBME 2MMCA 3CCVB 4CEHA 4YMVA 3K70D 3QKRA 1FTNA 5KDDA 1E69A 2VP0A 5JRZA 3QXJA 5KSYA 3AVPA 2LKCA 3NEJA 5FUXA 2VHUA 5TV2A 2GXQA 2WJHA 4NBSA 5HE9A 3B1VA 1P5ZB 3EW9A 4I4LA 5FBVB 1ODFA 1FOEB 1JJ7A 1W36C 3V4FA 3CMAB 4M1TA 5EE9A 2HF9A 3JQQA 4O3MA 1P2VA 1P7CA 1QX4A 1KKLA 1K9MD 2IK8A 2UVQA 1NIJA 3IKJA 4EQ6A 1M6NA 2ERXA 3AKDA 4DLZA 2KI5A 2O8DA 1ZCAA 2I3BA 2GZHA 1I2DA 4A92A 3GLGE 3Q8XB 3CRRA 4EJSB 1YIJB 5EZ6B 2QG6A 2OT3B 1MR3F 5FOWA 3SNHA 2VEDA 1YHQB 4K1XA 1KO1A 3U4QB 1MRSA 2V3CC 3GP8A 2ZS9A 1GNPA 1GIAA 5LDDC 2H92A 1YE8A 3H1TA 4I81A 4LZZA 4PHGA 4CRWB 2FV8A 2KWIA 2W6IA 3KDSE 4RVCA 3VFDA 1CF4A 3QG5A 4W7SA 3VKHA 4G3XA 4PR0A 4P31A 2EYUA 2CHVA 4PHTA 1ZIPA 3WNDA 4PTLA 3GLFE 1FUKA 1BYIA 3VR1A 1G17A 3GLHB 3VU9B 1YZTA 1QZXA 5C1BA 2FN4A 2Z43A 3RYTC 4I1VA 3LXRA 4FWIB 4XIGS 5B30A 3MSXA 1PLKA 5AJYA 3CW2A 5FI0B 2CCJA 2AWNA 5JHGB 1VCOA 1ZINA 4L9SA 4LOAA 4A82A 4OJQA 2G0TA 4NU0A 4M21A 1E2JA 2QP9X 4GPTA 4RZXA 1UKEA 1N6NA 1UBFA 1EX6A 2WWIA 4H9GA 3BFXA 3HPQA 4F4JA 2BM1A 3EG5A 2NPFA 3GLHE 3FGNA 4PC7A 2OCBA 3TVTA 1NF3A 3K1JA 4Q4JA 2RH5A 4F91B 2EU8A 2VA8A 1SVSA 1UBEA 3C4JA 1KSHA 2GF0A 4NCNA 3CPEA 3DHWC 1ZM3A 2CEAA 2VHQA 2P6NA 4QBHA 3AUXA 4WA7A 1W5SA 2A78A 2Z5FA 3FTQA 1BQEA 1TUIA 2NOAA 3AV0B 1U0JA 1EGAA 5E7JA 3K0SA 1RPZA 4IW3B 1OGIA 3CCJB 3NC0C 5CB6A 1RE0A 3LRPA 1GNRA 2W83A 3TH5A 3EX7C 2ZRIA 1L4UA 2F3RA 3GLGB 1CLUA 2DERA 4HAWA 1VQOB 5KU1A 4B3CA 3T1TA 1P2TA 1P75A 3MWLA 4HUQA 2CJWA 4D2IA 3LA6A 2GK7A 2AK2A 1KJZA 2O8EB 2GJAA 1AGRA 2IF0A 3B2EA 3NVAA 4NCKA 2VZLA 4BFZA 1VKJA 2V55B 1UF9A 1ZM2A 4I1OA 5H70A 1VG0B 1XD2B 3GEEA 1XZPA 1Q81D 2YNMA 5DNYB 1KDPA 4JLOA 4JLVA 2RAPA 1NN5A 5IT5A 1NVVQ 3WBJA 3KKQA 4KYIB 3IEVA 4DCNA 1EX7A 1F6BA 4LHWA 4X8HA 4L9WA 1GUAA 5DLQC 421PA 4EDHA 4URXR 3CNOA 2GETA 5G3ZA 1VQ8B 4TMZA 4ZGNB 5C18A 1LS6A 1XX6A 3R8CA 3FHTA 4UAJA 3QXSA 4JMPA 5FPKA 4P4SB 2BBWA 1NG9A 4GOJA 3SJCA 2DWQA 1G6HA 4A6XA 3CX8A 2WJJA 3AGPA 1FX0B 1TPZA 3M4YA 3GLIE 3BFVA 2VO1A 4EPVA 2QAJA 2C03A 2VNKA 3H4MA 1GRQA 3GFOA 2VL7A 2P6RA 3AKYA 2BDTA 4NZYA 5HCNA 5IDVA 4Q48A 4ERNA 3QEOA 4S35A 3K0CC 2J59A 2V8OA 4JVLA 5TR9A 1KTVA 3I73A 2IHYA 2PJZA 1U0HC 5BN5A 4ZDKA 1E32A 4ZI2A 1YJWB 4DSNA 1D8TA 2ZR7A 2ZRLA 5K8LA 3VU9A 2XSZA 1YZLA 3U44B 3LW8A 5EUQB 2W58A 2IYWA 3B13B 1E79D 1VYTA 2GCOA 1OPXA 3TKLA 1N6KA 4Z1MD 3BFKA 2ZR0A 2GILA 2OBLA 2EFGA 4OI2A 4KFRA 1XTRA 4B3BA 3DKPA 3AVTA 2RGDA 2QL6A 1D2MA 4Q9LA 3VX4A 1BH2A 4BPRA 1G6OA 2XOKD 5CJ2A 1ZNYA 2ORIA 5SZKB 5BN3A 4AKEA 3ADCA 2Q3MA 1AIPA 5D3QA 2ZI9A 4AY2A 1G3RA 2ZJOA 2VP4A 1IB0A 3F0TA 1OH8A 2TMKA 1ZP6A 1E98A 1NMZA 4DLTA 2AD5A 1XPUA 3L8YA 4BEBA 3QF4A 3J81k 1COWA 2BKUA 1GVHA 1KK3A 1E2QA 3QPWA 4EFMA 5K8TA 1N6PA 5KNCA 4I1SA 2OCPA 4OBEA 2ZU6A 4DIEA 4KHZA 1QG2A 2X8AA 1NLZA 4HAYA 3AVWA 1UEIA 4G0NA 4M8NE 4TTPA 4UNQA 2X2FA 4HE6A 4HLQB 3OIUA 4C30A 2DY1A 4BECA 1SVKA 3GPLA 2RGAA 3TSWA 3PXGA 3TUJC 2VP5A 5CM9C 5FOTA 3HU2A 2C95A 1UBCA 4RFSA 2IUTA 4EPTA 2RGBA 2FG5A 2NO6A 3FMPB 5E7IA 4NPHA 2JGNA 1ESMA 1WBBA 2ZRBA 2GKSA 2VP2A 5KDLA 4ARZB 2FZLA 2J0QA 2PMKA 1YHNA 2ZUBA 2XGJA 1D2EA 1WF3A 1PUJA 3VHLB 5SZJA 2ZAMA 5CIQA 1G7RA 1DAIA 1XTSA 4G5RA 3W3AA 3TSZA 4P4UA 1W0JD 4C9BA 1KIMA 4QGFA 3P26A 2UZ3A 2YINC 2OLKA 3UMFA 3X1XA 2WICA 4HAZA 2E9SA 1Z6AA 4O25A 3W2EA 2JIZD 1DG1G 2CNWA 4MRPA 3THXB 2CCGA 3IEUA 1XB2A 5CK4A 2OCAA 2VF8A 5FL7D 4PZLA 4FMDB 1J99A 2J3EA 4Q4AA 4CVNA 3CWQA 5CITA 3UKDA 4HB3A 5JFGA 4KO8A 5FI1B 2XB2A 4IEIA 2WBLC 2ZRNA 4V0LA 1ZNXA 1X6VA 4JKYA 4EPYA 2IX3A 2KB0A 2FPMA 2QA5A 1CQXA 3OZWA 4PAOA 4MYCA 3C41J 1E1QD 2WJGA 3VR3A 4DEXA 2H8KA 1SXJA 1ZU5A 2P3SA 1XEFA 2QAGA 1P4SA 2IEZA 1Q0UA 4QOSA 1W4AA 2RCNA 1AJEA 3ZBTA 3VR4A 1Q3HA 1T8TA 2L0XA 3B7GA 4QL3A 4E5UA 4D4KA 1E4VA 3I56B 4PO1A 5FUVA 1KO4A 1NG1A 2AX4A 2DCUA 1Z06A 1GAWA 1TQ2A 3KKOA 3TAHA 1HV8A 1FTSA 2LCFA 4IVPA 3TNFA 1NBMD 2QGZA 3IGFA 2OZEA 3MWKA 1EFTA 3T15A 4MGIR 2ZYUX 2CBZA 1NSFA 3SEAA 4Z1MA 4FWTA 1YZNA 3CPWB 3OESA 1IXRC 4QJ3A 4LV5B 3OZUA 2BEJA 3IO5A 5DE3A 2C98A 1P62B 5EP2A 3THYB 1ZM9A 4AF6A 2DFNA 4DB2A 5FOVA 4HE5A 1X8LA 2DFTA 3K9LA 3IDQA 1ZUNB 4GP7A 3U2QA 1W47A 4G5OA 4QNMA 4TLAA 3ZQJA 1DO0A 3FB4A 1QHNA 1RRGA 1XZQA 4YAOA 1ZUHA 3CRVA 2BBTA 2VHJA 2Q21A 1NL3A 3CBQA 1CTQA 3C15C 4YXWA 5ANRB 4KODA 3SJBA 1NVWQ 1QVGB 3X1WA 4AYWA 3OEHD 5KNBA 4BLPA 2GNOA 4B47A 1IXSB 1Q20A 1Z0JA 4PHFA 4URUR 4CEIA 2ZJYA 2XNDD 4HZIA 3I8XA 1SZPA 2GXUA 2W00A 3NKVA 1VG9B 3KJHA 1X1SA 4DEYA 2WOJA 1XCGB 4U7DA 2ORVA 3OE7D 2IYXA 4XWKA 3KKNA 1W34A 2AHOA 4DCVA 1G9XA 3QKSA 2MSEB 3E70C 1Q1QA 3D8BA 3TE6A 3HU1A 1O87A 1UKVY 5E4FA 3AH8A 2RGNA 4Q01A 3B8HA 1JR3A 2IF2A 4FI3C 2PEYA 2NG1A 1OFIA 2VP6A 3PEVA 3QEJA 3VX3A 3OEEA 2CL7X 4X8OA 2AKAB 1UKYA 2AXPA 4FCTA 3I92A 4M1YA 3W5IA 2Q9CA 3KKPA 1LF5A 3JZMA 1JJVA 4KSBA 3AF2A 3EPKA 1MO6A 4KXFB 1P2SA 2OK7A 1GL7A 2QE7D 1VQ6B 1G3MA 1M1KD 3GJ4A 4N3GA 2JIZA 2OG2A 3P32A 5CDFE 1V5WA 4A2QA 4TTQA 2GCPA 3WP0A 2QA4B 4Q02A 5FBQB 1GAJA 2QI9C 1UEJA 1XD9A 5HKKA 3EPLA 2X2EA 2N42A 1N0WA 2ZYVX 4LPKA 4LHXA 2OFOA 1K5GA 3UMSA 4PX9A 1GZSA 2YWFA 1KK1A 5TMPA 3V4RA 3KX2A 5EE3A 1E0AA 2HYDA 2Q0HA 2V4ZA 3B82A 5KHOC 1W4RA 1YZGA 1TQDA 2ZI7A 4LJYA 1W2HA 5C4GB 2BSAA 4AURA 4IOKA 1G19A 1VPLA 1TU4A 2ZRAA 4OHWA 5FBWB 5FOUA 3SJZA 1N6LA 821PA 1ZCBA 4Q9IA 3DKVA 3D3QA 3W8RA 1XTJA 3FOZA 3B9PA 5F3WB 3Q7PA 3I72A 4P33A 4POAA 1RVDA 1VQNB 2KBFA 2GEDA 721PA 2RMKA 2B92A 2VHCA 2O8BA 3VR2A 1LS1A 1HE1C 3D6TB 3WHLA 1XD8A 1J8YF 4UXJA 4LI0A 4YDHB 3SE0A 4NKRA 2BMWA 2C77A 1E2PA 1KI8A 2RGCA 4UXIA 3T06B 1GM5A 4DLUA 1NVVR 3RLFA 3MWJA 2DFKB 4TMTA 1RYHA 4EFLA 2IYYA 2ANBA 2QP3A 3RS3A 2CDNA 4RD1A 3PEYA 4AKGA 4YDSA 1XP8A 3E1YE 3MRSA 1YITB 1OH5A 1DARA 2ZI6A 3T1QA 4TZ0A 3FJOA 2GHIA 5M04A 1UFQA 5GJWC 4LSGA 3WNBA 5TARA 1KZ7B 4O2RA 4YAWA 2C78A 1X1RA 3AF0A 3GEHA 4JLPA 2QZ4A 3Q5DA 3I62A 3VR6A 2ZI5A 4B3GA 1S8FA 1U9IC 4TSFD 4C0SA 2XNCA 2OTLB 3CCEB 2SHKA 3NTUA 3DL0A 1YKSA 3ONWA 2ZUCA 1A7JA 3L0SA 4OJKA 3WMEA 1FUUA 3K8YA 2NO0A 3N2EA 4NYMQ 1IN4A 5KUTA 3N70A 2ZU0C 1Q22A 1YJ9B 1Z07A 3W5VA 3AKCA 4HAUA 5CLLA 2O8FA 4XWOA 3SJAA 1S9HA 1Z3IX 3I55B 2PT5A 4EAQA 3EASA 2PBRA 3LVRE 1G21E 4KU4A 4CT4B 2A30A 1CEEA 4DCUA 4EJSC 4ASUD 1YU9A 1HTWA 2FGJA 3VKWA 1YZUA 3CMEB 5THXA 3TUIC 1JQJC 4LJ7A 4Z51A 1OKKD 1E99A 2XAUA 1II8B 1A2KC 4HLUC 3ZH9B 3QXCA 1OH7A 4F7DA 3B60A 3TJZA 1IJEA 1K8RA 1NN0A 3QXHA 4BZXA 3CH4B 3Q7QA 2GZAA 4EPRA 1G1MA 2ZRGA 4PSKA 3TAUA 1E9RA 3U3OA 1NI3A 1BMFD 5JEEA 1JI0A 4AG6A 1X8KA 3FKQA 3H84A 4Q66C 2ATXA 1GAQA 1TEVA 5FTMA 3UK6A 3CX6A 3U7EB 4DSOA 2WV9A 3WY9A 4U00A 4B6EA 1UM8A 2EQBA 3TQFA 3QKTA 4YALA 4IJMA 5DYIA 2GVZC 1TF5A 4RD2A 1VHLA 4Q1FA 4WW0A 1TQ4A 5JI2E 1RC8A 3K70B 1MO5A 4OHYA 5KTYA 3W6OA 3Q85A 4E09A 2QNRA 4FW9A 4QM6A 2GCNA 4WOPA 4TYWA 2EWVA 4BQSA 2F7SA 1NNEA 4TZ6A 1PJRA 1OIXA 1TTTA 4LCBA 3REFA 2HLDD 4Q4LA 1SXJE 4MRVA 4WZBE 4MUBA 2ZXUA 2R8RA 3QF7A 5D3MA 3NBXX 2V1XA 1W87A 4R7ZA 5EXTA 1E9BA 3VNUA 2FU5C 3GJ6A 3G82C 1ZD8A 3MHPA 2WWWA 4ESHA 3WYAA 4Q7KA 3SYKA 3GMTA 3W2GA 5AJWA 3KQKA 2HXYA 1N6HA 1ZAKA 1F3OA 5DO9A 2W6JD 4PGOA 1JPJA 1C1YA 1XPRA 3D7MA 2VTKA 4PAMA 3NH9A 5EP3A 2H7VA 2BJVA 2ZE5A 2O8CB 2WTUA 4HEJA 5B58C 2QM8A 2J5XA 3L0IB 1OXTA 1JPNA 4KV9A 3RRNA 1I7PA 4EKDA 3OAAA 3OJXA 3U61B 3FWYA 2P0EA 1F2UA 4KITB 2BN4A 4G01B 2WWXA 4JSTA 4OHZA 1OV4A 2ODNA 1WXQA 4MKIA 2GCOB 2O0JA 4OI0A 2WPDD 4ZCIA 1DEKA 2ZS8A 4DDVA 1W0KD 1N8RD 1N5KA 2XZPA 2OSBA 2YHSA 3UPUA 3ZC3A 3S1AA 3A58B 4QHYA 1UDWA 2Z4RA 3JVUA 5FTNA 2OM2A 1BO6A 1F20A 2IUSA 5L3SA 4R98A 1P73A 3TIFA 4RJLA 1AQYA 4PPGA 4FMDF 3ASZA 3K09C 2VYQA 1Z83A 5JWHA 1U8AA 4MKHA 4AYTA 2DR3A 1VIYA 2F1HA 1AM4D 4M1OA 5TDHA 3E5HA 4DSTA 4MUAA 1ZRHA 4QC2A 1EP2B 4TMVA 4II7A 2ODEA 1I4LD 1WCV1 3PJRA 1KSFX 3BS4A 4GZLA 5JHHB 2RC5A 3CC7B 2JLXA 1KNXA 5L3RA 4DB4A 2PX3A 1N2CE 1DAKA 4BFUA 1VQLB 2WMNB 2XTMA 1H65A 3NBZC 1N5JA 4R2HA 3BERA 4ZI3A 4V0OA 5JLJA 4A8JB 3RDPA 1I4DD 3QFRA 4D0NA 4QGGA 2VSFA 1XXHE 2JDIA 4FK8A 1M7HA 3U7FB 5AWFC 1PLJA 2NZ8A 2ZI3A 4B32A 5FR1A 4DLXA 2AFIE 5JS8A 1FQJA 1QHIA 5FH9A 3U60B 1NSTA 1IY0A 4QFMA 3FFBA 4LYHA 4BFXA 3W5UA 2D06A 5LD2C 2BOVA 3SC3A 1TX4B 1G4AE 3CCMB 3C14C 1KSJA 1HURA 5P21A 3CR8A 1DAEA 2FZ4A 2BC9A 4MRNA 1QBKC 3AP3A 2CJWB 4MDEA 2BGIA 4RZ2A 3A4NA 2O0HA 4Z8YA 4DHEA 4TLCA 4LHZA 1QHHA 5DHAA 3ZGXA 3GLGA 2PEZA 1NJGA 2VPPA 2VRWA 2IEYA 4IDQA 1DDIA 5B57C 2OK8A 5FL3A 1LY1A 1FRNA 2DHRA 1N6OA 4V0KA 5KSZA 3PIRA 3RRMA 3IQWA 2IWRA 2NO7A 1CR4A 1G3UA 3W6PA 3CB4A 4DCSA 3P4YA 1MO3A 3KZ1E 1SHKA 4UQOA 4JJZA 4UJ3A 3GLFA 3VAAA 2JLZA 1E2LA 3BJIC 3RC3A 3G71B 4A8JA 1G8HA 4Y7CA 2CHQA 4JZKA 2BV3A 4A2WA 2H5EA 3B85A 1YR9A 1AQUA 3KFVA 4BFVA 1FRQA 4Z8XA 4BLTA 4N3NA 4ZKDA 1KZGB 2J7PD 5TB5A 3UATA 3KUDA 2ZAOA 4I99A 5EE0A 521PA 4HB0A 3U5ZB 1P9WA 4KFUA 3ZYCA 4A0HA 3IIKA 1F60A 1R5BA 3KKMA 2J0VA 1D1NA 2BEKA 2QTZA 4G5GA 2J87A 3DM9B 4QBIA 4LV6A 2MSDB 1UADA 4AD8A 1U2RA 1E0SA 1R4AA 3BBPA 3QXXA 2QTLA 1XJ0A 5EP4A 4C7OA 2AR7A 2PJRA 2YWHA 5DYGA 3DPUA 4QHTA 3QQ5A 1D2NA 1R0XA 1QFYA 2GBLC 4FMBB 4YC7A 4JJKA 4KFSA 3S1AB 1AN0A 2P67A 2VSOA 2YZ2A 1VHTA 2XEXA 2V54A 2D74A 2WSSA 3FHOA 3QENA 4JL5A 4BLQA 1CS4C 2QEQA 1QFZA 4AF7A 1NRJB 1SHZA 1FNDA 2HT1A 4ZPXA 3I3SR 2ZEJA 4D4JA 1H8EA 4DIDA 3RRZA 4DRZA 1KMQA 1DAHA 1SKYB 1T4GA 4HDCA 4Q4AB 1NKTA 4IDPA 2O8DB 2IS2A 3QG1A 4X8MA 1KI4A 1P9RA 2EWWA 3KFXA 4H1VA 1HE8B 2VNJA 2GJ8A 2GXAA 3R8FA 1YJNB 4A1FA 1PV4A 1E62A 3LD9A 3BORA 5CJPA 3BH0A 4LDJA 1G64A 2PZGA 1XNJA 1K73D 2IYLD 3LXXA 4RD0A 3BD9A 3PVSA 3VNVA 3RVBA 1GKIA 1W4CA 4UNPA 4ARZA 1S4QA 2PCLA 4D0LB 3MWYW 2IS6A 4CF7A 4C0AC 4FCWA 1P61B 1Z47A 5H59A 2JAQA 1EESA 1IN8A 2BIFA 2OLJA 2WKQA 4HLDA 1A8PA 3R9IA 4ABYA 1WQ1R 1PVOA 3PUXA 1SVOA 4D4MA 3VO2A 4D0GA 4TYYA 2D2FA 1FW6A 2Y8EA 1XEXB 1YI2B 4Y9RA 4CW7A 5C2JB 3BB1A 3K9HA 3I32A 4NTZA 4B74A 3DEFA 4GBMA 4UNSA 1VYUA 5JECA 1XTQA 1KI3A 2QU8A 1CRPA 4GT1A 4JBXA 4RD6A 4GDFA 4B2PA 2VHTA 1A4RA 3CCUB 4A0RA 3I1FA 3OF5A 2CXXA 1NJFA 5F9HA 4LJAA 3WMGA 3AVYA 4QJ5A 1NN1A 5JMTA 1ZBDA 1EP3B 3JZAA 1JB1A 1U98A 1ZU4A 4BEJA 5L8VA 1T6NA 2DYKA 3AVVA 4Q4HA 2VNHA 4YAUA 1D9XA 1Q57A 5CM8B 1G3IA 3QVUA 1SM4A 2EVWX 1RJ9B 3L43A 1CR2A 2CHGA 1GRNA 1Z0DA 2ZJZA 3PUZA 5BQ5A 1XPOA 3UXMA 1P60A 1KI1A 2KJQA 2ZREA 4PC6A 3IQXA 2WIBA 3EWSA 4B2LA 4B44A 3H2YA 3KJEA 1E79A 2W0MA 3IILA 3U44A 4MITA 4LWZA 4QJ4A 3O47A 1JXMA 3DMDA 4PZYA 4D6PA 621PA 1OKKA 3THWB 1MH1A 1E4YA 1EP1B 3CRQA 3L2OB 1SKYE 1L2TA 1N6RA 2QPTA 4WXRA 4PC2A 5GVSA 2BJWA 1Q3TA 1HEIA 3K9NA 2G9NA 4EFNA 4A6PA 1CIPA 3ZVRA 2MMGA 2ZJ5A 2DWPA 2B6HA 1E1QA 1OXVA 2ZSAA 4DVGA
chains in the Genus database with same CATH superfamily
1SBTA 3C87A 3L46A 1RAAA 4WIAA 2EKBA 2Q49A 2JEOA 3GFTA 1UPBA 4EVSA 3WYEA 2SKCA 3Q3EA 4Q1CA 1HRKA 4C4XA 4W9RA 3B6MA 2OMKA 1I3CA 4N1AA 4ZV4A 3ICWA 3L02A 3KEFA 5DCUA 1ZUWA 2E1PA 5E4JA 1AZWA 4QGBA 2KYRA 1YR3A 4COKA 2LE0A 1DIAA 2J7KA 3IS3A 2BKEA 3ZD7A 2PH1A 2FQQA 4UEQA 5DWVA 3NWJA 2HJHA 4D81A 3KOWA 4C5AA 4Y1RA 4HWOA 2JFOA 3KEWA 1MIOA 2VCHA 2PBLA 2AYZA 2JFBA 2QG4A 1K3TA 1VA4A 3E9YA 4LDZA 1BKDR 2J9FA 4NV0A 2FSFA 2HUPA 2PQ0A 1WF6A 2GYYA 5EL0A 3SS7X 1XZCA 2JANA 1M74A 1Q84A 1X7GA 1WU7A 1A8SA 1T5TA 5AJXA 1NW5A 5FBZA 3H9CA 2ZAIA 4AMGA 4DS3A 1Z0AA 4KQHA 5DTQA 4ROXA 2IOYA 4FMPA 5NULA 1CY4A 2PTGA 4GSYA 5B2ZA 3B1XA 4IDDA 1IN5A 2I6TA 2OV4A 4FFRA 1WHTB 4FT2A 5HP4A 4ACBA 3BOSA 5I7FA 2D3WA 2OBMA 5EMKA 3UAOA 4D3YA 2QRPA 2AZDA 4EMBA 2WOOA 2AJ8A 4INAA 1C29B 3H83A 1AS2A 4LNUB 4NZOA 4XUCA 1N77A 1P5FA 2NW6A 2YWGA 1GPDG 1V8FA 5IMSA 3H9QA 2FWAA 1YQ9A 1KDTA 3F47A 3BTSA 3UGKA 1KI6A 3GNLA 4D79A 2YVUA 4MS1A 4NBNA 3ADOA 2J41A 3GT0A 4X1YB 4P0PB 3PWTA 4PQGA 5YASA 4A2PA 5TVKA 4AYXA 3Q7IA 3AFNA 1FLAA 4KMRA 1THTA 4BFWA 1QYRA 1M2OA 2P2NA 3GQBA 4QREA 3AM1A 2I7XA 3TPZA 5LQSA 4RGVA 1XHLA 5KQLA 1BFDA 4OMUA 3HUFA 1G8KA 4W5OA 1IFXA 4HMPA 5EXXA 3ONUA 2QTGA 2R65A 4O0MA 4PAGA 4GGMX 1FXUA 3WAGA 2V0NA 1J2EA 4PN7A 4DJAA 1GZHB 3MMPA 2ZRQA 2J9ZB 3SS8A 3TLEA 4EHIA 4PZ0A 1JQEA 4P4LA 2B4YA 1I30A 3V8BA 2VJBA 5KTOA 1T8UA 2QRGA 1IU9A 4B4DA 2AFIB 3F5FA 4HVCA 2XX3A 3VPHA 1LK5A 3AM5A 1RP7A 4XX0A 2QE7A 4PZCA 3OJEA 2G1JA 1DLIA 4N54A 4J6EA 2BWJA 5B7QA 4LY6A 4U8HA 4AWXA 3LUAA 1T3LA 3OO0A 4OAPA 1Z16A 3SSNA 4IXTA 4O5OA 3SLKA 4ER5A 4E3WA 1I7SB 2ZS7A 2JFNA 4IX9A 2NN3C 4AY6A 1J0EA 4N0DA 4WAUA 4Z4IA 3D43A 1YRYE 3V6MA 1VCMA 2XYQA 2A2ZA 4L07A 1SG9A 2J85A 3MVEA 4CQJA 1DWQA 1UP6A 3ESQA 4CIBA 3I6BA 3F5DA 2QUIA 3TTSA 1X8JA 1LQ2A 4ZCLA 3F6SA 1P80A 5DGHA 4DHWA 3VDQA 1CLEA 4D97A 2RB4A 3D3JA 3PHBE 1V7CA 1YR2A 1UIRA 1EVKA 1L1EA 4LZAA 4AM8A 3T1HB 2VF4X 4MRVA 1LTKA 2AZ4A 1ZD2P 4KBGA 3QELB 3W5SA 3IO3A 2P9TA 5A02A 3CKMA 1FMTA 1Q7RA 2VXCA 4HZUA 1UBGA 1T3GA 4XDZA 5DW3A 2A0KA 2E4YA 4WLEA 5L7WA 3MCZA 4FYKA 2ZT8A 1H2XA 3L8ZA 1FVFA 2QLFA 4AO8A 3U4DA 1JMKC 3D4PA 3QHAA 4ND8A 3SBXA 4NBLA 1A7AA 2RAFA 4PQFA 1LI4A 4DLNA 1JFVA 5B4VA 3WLIA 1QRUA 2H4XA 2HOQA 2DU8A 2OQIA 2PG3A 1J7KA 4NV3A 4MI1A 4R9UC 1L5KA 3VSEA 2P35A 2NMVA 4Q47A 4ZCSA 4DDWA 1W4ZA 2GRAA 4QU8A 5TJHA 4AJLA 3NDPA 4DMKA 2PXAA 1H3NA 1TUEA 5F98A 3FKSA 1RYDA 3CG4A 5BWMA 1OFTA 1YS2X 3RRYA 4KDEA 4MLCA 4PYJA 2E5WA 5I9MA 4BLRA 3TLXA 3U40A 3T9DA 4R1NA 4EUFA 5HKOA 3TPCA 2XNKA 2VYND 1NASA 3OJLA 1FP1D 5EWLB 3WJ1A 1PJ7A 1V3TA 3PNBA 4DCTA 4FDTA 4J9VA 5AOBA 3UUGA 1FP4A 4DMGA 2GA8A 5REQA 3V7NA 5A5EA 4YY3B 3MBIA 3PQ8A 2PV7A 3RJ9A 1JIUA 3BL8A 1JAYA 1RE1A 1XBTA 3GZJA 3O2SB 4UHJA 1XI2A 2F90A 4GMXA 5CK5A 3VDXA 3W77A 4XQ0A 4AULA 4YR7A 3VVLA 4HX9A 5K8VA 1C9EA 2ZXFA 4EHLA 2NP6A 2Q3DA 5ISMA 3B36A 3UT6A 2ZRFA 1REQA 2YV3A 2ZSUA 4GPZA 3GSIA 3B7WA 3JAWA 4PQRA 1F14A 4UU7A 3SG0A 4DQUA 5K6AC 3AR7A 4TQUS 3DDSA 1YXMA 4WPGA 4GYYA 3ICEA 4X7DA 1JFFA 2F43A 3RVDA 3RS0A 2QTAA 3FPGA 5CGZA 2XTNA 1Y3AA 4YRFA 3H7IA 4NF2A 4N5LA 5GJBA 5KEIA 2IYEA 2R8XA 1RBZA 3L9WA 2YMMA 2Q3CA 1UOOA 3NDIA 4DJ5X 3PZRA 4FEGA 4C0WA 3KZKA 4Z4WA 3SOPA 5T6BA 1Y5IA 2IXDA 2PR7A 4EJ0A 5ELXA 1IXYA 2HIAA 2WR8A 4P3IA 3CO5A 5B12A 4BFTA 2F1LA 3WGGA 5BNZA 2FHPA 2VXOA 4RYDA 5COBA 3DBLB 2FEMA 2Q2OA 2XDAA 4H59A 2WFZA 3I8SA 4FZVA 1HZEA 2JLQA 4IDHA 2YNMC 2Q6TA 2Z2KA 4IEEA 3D3EA 2DFLA 3VZBA 3D7SA 2A9JA 5B7GA 2HRQA 1W8DA 2TSYB 2A5YB 5AM2A 5TQVA 1ID1A 4CLXA 3AEYA 1GCUA 3G0GA 3HZOA 1S0UA 3LC1O 5DKFA 2XZLA 5EFZA 1C0IA 3S3TA 3UFBA 2I8LA 4C6SA 1Y7TA 3AK4A 1N25A 1ZCFA 2WAMA 3IHKA 3A3PA 2SECE 1U9YA 3OX4A 2FMUA 2HK8A 3KV1A 1BG6A 4F92B 1KSGA 1K2WA 1KY3A 4KV7A 1WXIA 2ODWA 3EDYA 3HY3A 1MB9A 1PYOA 3G85A 2TRSB 4GRAA 2Y9PB 4OBXA 3SHWA 3STUA 3PQ2A 3WOHA 1RZVA 2YIVX 3IPXA 1BPLA 2VZ0A 1OIVA 4RK1A 1Z5WA 5LP6A 3GVIA 3L3BA 3OPNA 3DLBA 3E35A 5T8KA 2F43B 3HN6A 1P1IA 3ZDZB 3ZHSA 1GITA 2IODA 3R5SA 1WABA 1U3VA 1X1EA 2B25A 2JCGA 2QX6A 3Q6QA 3MLBA 3OQPA 4YJ2F 3IKTA 4OK3A 3SKVA 4BZPA 1N5LA 1E7RA 2P62A 1YIDA 2J1LA 1FMFA 1Y9EA 4X6LA 1CR0A 2XUFA 3KTAA 4D6XA 2Q3LA 1TKBA 1XWFA 1YRLA 2O6HA 1NY5A 3WQSB 4O2AA 1N57A 4B4UA 4CIXA 1EUZA 1E6LA 2JASA 3K32A 4YUWA 5LBTA 1Z0UA 3PL1A 5L9AA 1IOZA 2VT3A 3L1IA 1NR1A 1V0FA 5CA0A 2ZUDA 1JAHA 2VHEA 4LF4B 4YAFA 4Y67A 1GEEA 3DEYX 3HYTA 4C22A 4QLOA 1PDWA 1C50A 4GQNA 5AVOA 1W8IA 1KFEB 1ZISA 2Y2VA 4BFSA 5AW4A 4F46A 1D5CA 1SKQA 1E2NA 2G83A 4D99A 3K9WA 2ZJ3A 2JJ2D 4LYAA 2AOXA 4US1R 1C30B 2FNAA 2XWQA 3NTXA 3H86A 2JD0A 4FDLA 4OGGA 2XTJA 1QH8B 1I0ZA 5DGXA 3HV0A 1GG5A 2IOFA 4K8OA 4DJTA 5I51A 1Y3BE 3RTBA 2IYSA 1ESZA 2M32A 1N2GA 5A62A 4OATA 4KE8A 3I6MA 3K8QA 3PF9A 5H02A 1WV0A 2NO1A 4UHFA 1XIVA 4FLMA 4EHAA 2YDXA 2O2DA 1W44A 4MB6A 5DWQA 5IC6A 1R3UA 4EYGA 3IP8A 4Z4GA 1G21B 4HAXA 4IIJF 4LGMA 4HSGA 4UXHA 3EWIA 5KOHA 3KJQA 3PXUA 4E94A 1Z7YA 4XN3A 1NIPA 1ODJA 4BE4A 4CKWB 1YVPA 4GL4A 4E6PA 3H42B 5EG5A 1ISIA 2VNIA 1FFWA 2V45A 1YTUA 4BTLA 1FU8A 3G9QA 1W9HA 4YP6A 3T7JA 5DM4A 4A8JC 4BN5A 1FNNA 1FFXA 5DHFA 3ECCA 3FWHA 1BVRA 1GCIA 5GZ3A 1W9XA 1W5AA 1M75A 3ZD6A 2P2ZA 2FSVC 3KLBA 4L8WB 4B5LA 4BE9A 1UJ5A 1VSVA 4PXYA 2MHCA 2O50A 2HRZA 1DUIA 1AURA 1Z39A 1JI3A 3VHXB 1JT2A 5KSOA 2IT1A 1ICEA 1T2UA 2AFRA 2Q7XA 3C3EA 3ZZ1A 3QU2A 3TBKA 1HLGA 1TC1A 4QYWA 1L7NA 5B58T 3RSOA 3KJZA 1VQ7B 4O0LA 3ZWQA 4IVQA 4MUKA 3PD1A 5CVCA 1F2VA 3EBOA 3LO5A 2LDBA 2XRMA 2B21A 3E82A 5LA6A 5JSYA 2VOEA 2YV5A 2NUTA 2EGUA 1A69A 4RGBA 5DHTA 1Q1GA 1DAFA 2H18A 3MA0A 4NCXA 3ZK9A 1G5HA 3CUWA 1E9VA 1KU6A 1XO1A 3JQ6A 3OURA 5EJIA 4H16A 3HYSA 2QUZA 3K0AA 5E9AA 3GXBA 4U8GA 3W4KA 3OLQA 5KW9A 1G8JA 1PQ4A 4H6WA 4PHHA 1E9AA 1U0GA 1MABA 2O59A 3QOFA 1BD3A 4DZZA 3SN6A 4LY9A 2JHFA 1T8PA 1JFSA 3LQFA 3E3MA 3G17A 3MGGA 5KVVA 1NUTA 3PXBA 3Q9SA 4QWMA 1TXGA 4TTVA 5L51A 2C2MA 4HZUB 1OWOA 2I3AA 5LVAA 1YZVA 3W1WA 1HGXA 3VJMA 2GPJA 3MWGA 1UBLS 4WFIA 5FUBA 1WD5A 4KO2S 2G17A 3N5CA 2D2EA 4CLRB 4ZVKA 5KX5F 5CH8A 1USWA 1EHIA 3A2NA 3BB4A 1JR3D 1CDZA 1SXJD 4P54A 1FC0A 2ZJ2A 4W5NA 2AXQA 3K53A 2C5BA 3GT7A 1PHPA 2ZXUA 1NBHA 5LU9A 1LK7A 4OUDB 5CT6A 1ZPDA 4XYGA 2ZRJA 2Q4DA 4JLSA 3VDRA 2I8AA 2FKAA 4CUJA 1WPQA 1RXIA 2A86A 2VN8A 3IMCA 1U2GA 4ZHQF 2PZJA 1JEEA 3N76A 4V1CA 5KHLB 3A6PC 4URWR 3ZCUA 1D2GA 2I3GA 2AJDA 3GA7A 5G02A 5JG7A 4AI6A 4WERA 1WHTA 1EWRA 2Z4SA 4CFZA 4I4TF 2WZPP 1ZONA 3T7AA 2NQ2C 2C4TA 4KX5A 4MEBA 3E1GA 4G7XA 1YA6A 3AEUA 4K2AA 4UULA 2YHIB 4M0KA 4F9GA 5I7VA 1WS6A 1C9JA 1TB4A 1RLOA 1GYPA 1GRCA 2XQIA 4FYMA 4XX0B 3FHCB 5JLAA 1JJ2B 4BKPA 1F2TA 1KAOA 3T34A 1QZTA 3BN3A 1GR0A 3E7FA 5K9ZA 3K6JA 4I9HA 2H2FA 2H8GA 4P83A 3NBYC 3VPXA 1J49A 1NPTO 4L4YA 1U2EA 4YRQA 1WW3A 4BZQA 4YV0A 4YB8A 4C4PA 1ZD4A 4B3IA 2YC2C 1S3GA 3D8RA 5I7WA 1QQ5A 2OCKA 3AI3A 3DTVA 3H9JA 4G8CA 1DELA 2W71A 3IB6A 3CM0A 3T41A 1OXMA 1QIEA 3GH1A 1FJ2A 4L7VA 2J9YB 3KE8A 3NHJA 4C2BA 1CQJB 2I1VB 3FJ1A 2V1UA 4YCLA 2CZCA 4NH0A 3JYNA 1S2GA 1TFRA 3PHCA 4WECA 4HV4A 1Z0FA 4Z3KA 3KD3A 2RHJA 2JFPA 3E22A 3ND9A 3BIOA 1GZ7A 1UXIA 2QLTA 1XMJA 3V48A 4NNPA 4CF4A 5JPDA 4QFCA 2J8ZA 3DFIA 2G9VA 3NORA 1X9HA 1IVYA 2FR1A 3DH0A 5H80A 5HRUA 3HVRA 1RKXA 4PNHA 4QGAA 4AICA 5GJVC 3ZCQA 3VISA 1PJ5A 2OR3A 1UD8A 1U9ZA 4XSGA 5C51B 3OFVA 3ROEA 1CUXA 1PYGA 1M6WA 4E13A 1B73A 4UHDA 3OFKA 5ILQA 5F2OA 5H5JA 1EINA 1PT9A 3KSBC 4E2YA 2ID7A 4NCBA 4CEHB 4KXXA 1A8HA 4MUMA 5HBRA 5EJFA 3RBVA 1Y0BA 3PNKA 5ULLA 4ESEA 1TGYA 3W9BA 1KFKB 3QEKA 5G0WA 5KJCA 4P4TA 4DBVO 3U3RA 1J1IA 2KE5A 4EBBA 1OXKB 1IY1A 4BRWA 2HL6A 1Z28A 4J90A 5LA6F 5LIRA 1X7XB 2QGNA 5FA6A 1GP2A 5ED4A 4D3DA 2Q7OE 1E3ZA 4IHAA 4LISA 4D4HA 4MS4A 2QDXA 4LHSA 5A4AA 2V7QD 2QJOA 1MPXA 4LY0A 2X4LA 1OLUB 4HNSA 4YHBA 3HXQA 2GJ4A 4L2IA 3L7OA 1NDUA 2JLYA 4GP6A 4C6HA 2B8WA 4K6MA 1GSOA 1Z2EA 4OYRA 1WY7A 5JAPA 5J4LA 5TSDA 3EC1A 3JWHA 3N2KB 4CV1A 4ASUA 2QTWB 1EWTA 1AN9A 1BFUA 2CXOA 4FDUA 4XZ3A 3TIGA 3GUYA 1PSWA 3TXAA 4B8WA 3LBNA 1TE2A 2QRZA 4I7EA 4IS3A 4RY0A 4B6FA 3F9RA 1W96A 4FCCA 2PU5A 3QU4A 3NUGA 3HLTA 1H2AS 4MUEA 3C5VA 4OA5A 4M88A 3UB3A 1MUUA 5IAAA 3HI4A 4GDMA 4Y2JA 1X13A 3LT4A 1HY3A 1B15A 4IDFA 4QO7A 1GARA 3R7BA 4HVLA 5HTKA 4CM9A 3REQB 3C7DB 3ZDEA 4X6YA 2I4LA 3O74A 3A4MA 4N01A 5J59A 1EZ4A 4DEXA 4WCFC 1G8FA 4MB2A 1Q0LA 3VVCA 4X7CA 1IDN1 2HI0A 4G41A 2D62A 2IJGX 5B3AA 3DOUA 1X77A 5TGTA 3VTKA 1P2GA 1M2FA 4X63A 4TUYB 5ADWA 4ZO4A 3V32A 1Y63A 4EF4A 2OKCA 1QQ7A 3M2PA 2ZRHA 4MW0A 4KPFC 4EMTA 2X6XA 3X43A 2GQFA 3NGMA 3JATA 5LKAA 5K0GA 2G77B 3OQIA 2NZUG 1XF1A 2NYVA 1YB6A 2PCJA 3IHLA 2KMLA 5B53A 2XGOA 4IKEA 3CLTD 1AHHA 3WRWA 4Z4ZA 1ZOPA 1RYMA 1T9DA 5BWNA 1USGA 3K0FB 3BWYA 1ZKDA 4KIGA 1PUIA 1ILEA 1XDZA 3DS8A 3U7QA 2CK3D 4LZLA 2Q8QA 2OO7A 4LVNA 1QIFA 4WWHA 3MINA 4CQLB 1Y6JA 4V0NA 3JQ8B 2A9VA 2P1DA 5AYVA 4HXYA 1E92A 1NNLA 1P0FA 3HR4A 3PEFA 4WD3A 1MIHA 2RCYA 3TQQA 4RM3A 3JVDA 4CV0A 5KOJA 1HFWA 3S55A 1Y89A 1VB3A 4BWGA 2JGMA 3WGMA 5K4HA 2Y0DA 2G67A 3INTA 4CEJA 1XE3A 4RTPA 4IIHA 5DM0A 2C8VA 1H1DA 1VSTA 1FFHA 4OI1A 4YV2A 5E1DA 3N7UA 4GOXA 3SQNA 4AN1A 3B1YA 5B2FA 2VTDA 4HAIA 1OXSC 4JMQA 4ZMBA 2VBIA 5A4JA 3CCSB 1YV9A 4IIGA 5BWOA 3M1LA 1TYBE 4JI2B 3IMEA 1XAGA 2IHNA 3MCWA 1JN0A 3M83A 3OF3A 1MX1A 2CLFB 4HB2A 2RHLA 1YR7A 2VDRB 1QAOA 4KPUB 1B0UA 1UFKA 1CUJA 1NVEA 2EL9A 4QBGB 1DP4A 4W1QA 4FDMA 3W5JA 1N05A 2QVBA 1KNQA 3D8TA 2CEKA 3DZJA 2H1VA 1H8ED 3O1LA 3OG9A 4COOA 1LRKA 1R8YA 1MJGM 1UMBB 3I2KA 3KHKA 3FAZA 3FFWA 1MOQA 3DR5A 3E8XA 1P4HA 3GFVA 3IVRA 5F5LA 4F3YA 4BE7B 4GD3Q 1KRXA 3MFQA 3DZHA 1UD4A 3M0EA 4BQOA 2HC9A 1SBYA 3L1VA 1OAOA 3JQBA 1P2UA 3LH5A 4OHPA 4KC0A 1OU0A 4UNNA 4ATNA 3EGDA 1OA1A 4CG3A 4DM4A 1ZSVA 4WLFA 2REXB 1NAHA 2OQVA 1DJMA 1XNGA 1RYFA 3QX8A 5K2MA 4UBMA 4MGZR 1WR8A 4WA8A 2JI8A 2NUAB 3AEUB 5AHXA 3SVTA 1FDTA 2FJUA 4HHEA 3HC7A 4P2BA 4Q9NA 4O2AF 2VPXA 5AI4A 4MOWA 2RD2A 5EQTA 2P5YA 1SUWA 2GR9A 5ICCA 1QXSA 2HLDA 2X1HA 1RI4A 5EUMA 2Z6VA 4BJ3A 1RLMA 2O5RA 2A5LA 5CYGA 1EXNA 5LWQA 2XNSA 3RS8A 2NZJA 3WNZA 4F3CA 2MDTA 3RVLA 2HD4A 4DKXA 4Q9HA 3N8HA 2NUAA 1SELA 4EHHA 1TKAA 3R74A 1CXZA 3AL2A 1QV7A 4IV0A 1IEWA 3AUSA 1ULZA 2FE4A 5AW6A 2AKYA 3BK7A 5J2TF 4RLZA 4C0XA 3EA5A 2VK8A 2OCDA 4OXXA 2FWJA 4QGHA 5GOTA 2NU8A 3G49A 1DC6A 3HB9A 2C5FA 3DDWA 4MMZB 3C74A 1OF1A 4J7AA 1RACA 5CLJA 3PNOA 3ZWMA 2B6NA 1CUSA 3BICA 4CTOA 5CX4A 1U4OA 1GZ4A 4ZYLA 3FMIA 1N1MA 2XLCA 1D6MA 1RQLA 2I29A 1QVFB 3KHUA 1AKEA 4B9EA 5D85A 3TGPA 3K3PA 2Q2VA 2O57A 4JVNA 3QE9Y 4MQ6A 3BTUA 1T0HB 5IP5A 4KPUA 2P65A 3PQCA 5JXWA 2DXIA 3BF8A 2O07A 2OFWA 3RS7A 1H6DA 1JXOA 3G9ZA 5ALXA 1K6IA 1Q6YA 1XZ8A 1FLNA 1W25A 4JBHA 3R6DA 3FNHA 1M73E 5UKDA 4M38A 4JGBA 2IWHA 1GL3A 4D42A 1KTIA 2OO3A 4WVFA 4RV4A 3HWWA 1W49A 2GAAA 2HYIC 2Z0MA 1GLVA 4DR6B 4X9XA 3ACCA 5TGZA 5ALTA 4BNXA 4RD4A 2PZFA 1I5RA 3BCSA 1H5QA 5DM1A 4K6KA 5EZYA 1FYXA 3D6UA 4UM5A 3NVKI 1U0SY 1U4NA 5GVRA 4NP6A 4Q3OA 4QUAA 3W5DA 5HNKA 5F4ZA 2BCJQ 3CR7A 1MTOA 4PC1A 3WMXA 1MOZA 1SXJB 2B35A 4V3BA 1U28A 4ZKEA 3B51X 5C81A 1O54A 2C5LA 4GBED 3KQWA 4OHBA 1RWQA 4WEQA 3UZUA 4EPRA 5AVRA 4CKBB 3X1KA 4CYMA 3V9AA 4BLVA 4P5DA 1KYQA 1SN7A 1QPBA 5BN4A 1XJCA 3FKSD 1IB6A 1ZNZA 4I4IA 3EUEA 2C7QA 1GO2A 1E2EA 3S2ZA 2IZZA 3B1WA 1AXEA 2FUNB 2ZRMA 4GPEA 3K8ZA 4B4VA 2PRJA 1EK0A 2OM6A 1FMJA 2Q2WA 3LT5A 3GBVA 1LLCA 2XCSB 2VAMA 1I6LA 1CJCA 1WKCA 2QX7A 1VL2A 4E07A 1Z3CA 3USZA 3FOFC 2FMHA 1X2BA 2W9XA 3IURA 4REQB 4UHBA 1E2BA 1K88A 1TEHA 4UBLA 2VS1A 4BX9A 2V59A 2QTMA 3NI2A 1N7JA 4ILEA 3H9EO 1H0SA 1M7GA 2PUJA 4ITRC 5ENZA 1IHOA 1U28C 4Q1AA 5IM5A 5LD2B 3GFBA 2ZBDA 1V45E 1ADFA 2HDHA 4L0MA 4U7FA 2MJLA 2ZSBA 3CCLB 3H5TA 3G2JA 3HVHA 1MTZA 5DYYA 1P5RA 1JXQA 4I3FA 2EERA 3OETA 5H3HA 3DVLA 3ELYA 3O2NA 2FOIA 2SCUA 4F3KA 2H4FA 4KH1A 3KEQA 1PWXA 3WKCA 1XZIA 3RNOA 3MTEA 1YFKA 3R8XA 3ZLJA 2FX3A 1QB7A 1GDDA 3DAOA 2V6BA 3BIXA 4R83A 2ACVA 4AUKA 5EJEA 5CRIA 4Z9YA 3HMQA 2A1TR 4MQFA 1Z34A 3V4ZA 1Y8QA 3C5CA 4Z9FA 3QVSA 4CQLA 4NHOA 1J33A 2B1GA 2AN4A 4RQAA 5HIMA 5J1TB 3CC2B 3HJNA 2AMVA 5BSRA 3K0FA 4MLPA 1T6ZA 4Y1GA 5TEWA 1VM6A 1OFHA 2O7VA 1WA5A 1A2BA 4EZEA 3FAKA 2P9EA 1OBVA 3MIZA 1JKFA 1MHTA 2HR1A 1P4JA 4TKUB 3SHOA 5CGQB 4DUGA 1OZ0A 5AKXA 2CF5A 1UDAA 1U9IA 1N07A 2IXFA 4EL5A 4KREA 3PUVA 1G20E 4Y2RA 1P7PA 5MHTA 3JU4A 4IY1A 5KBYA 4W9MC 1C1DA 2FSUA 4MLDA 4IV8A 4IR7A 3RRJA 1H9BA 3WTCA 4MPJA 4WESA 3MBOA 1ISSA 1FFDA 2EZUA 3A6EA 3EOZA 2PJDA 2GJKA 4KI0A 4QDJA 4X20B 2FRXA 5EXDA 3ZWAA 4EJ6A 2V7GA 1RTKA 3CF6R 4WKGA 1CYEA 3X1ZA 2VJLA 4RIHA 3F8SA 3GH3A 1K7YA 1NWCA 3B3AA 3D8SA 2FPIB 2P4EA 5EWJB 4HPXB 4PZAA 3MBKA 2FDCA 3TB4A 4YT5A 2DLCX 3PPXA 1VHEA 3OQVA 5M04A 1R0SA 2EWMA 4ENRA 2QRMA 2QL5A 5EA2A 1VCIA 3I52A 2KPOA 5KJEA 1YA8A 3F1KA 3O91A 4RM2A 1TVEA 4WNAA 3SHFA 1WDWB 2H1HA 1QUEA 2SBTA 2V9CA 3SS9X 3PFNA 3LCCA 3LDAA 3KS9A 5BUCA 2Q3BA 1D6NA 5ICSA 2WF7A 4KIWA 5AVJA 1R64A 4HYEA 3TZLA 5HMMA 3RYIA 2VBCA 1E1MA 1NW8A 1JR3E 4GOKA 2WWRA 4Q7LA 1PZXA 2I1QA 3PDIB 1O5OA 4A0GA 1S1CA 1KH3A 3NHRA 3CCRB 4OQMA 4Z4RA 2G07A 3VU8A 2HXSA 7GPBA 2WJZB 4XL9A 5A3QA 4ZT5A 2ZBPA 5HIJA 4FOSA 1RCFA 2MINB 5EIFA 4JLDA 5T3UA 5A06A 5B1DA 3W9SA 3K1AA 3IQZA 1Y9JA 3STTA 4E33A 5LZ2A 4ENVA 3V8MA 4RC9A 3Q12A 2V5UA 1OAKA 3G2PA 4LF6B 4MV4A 1UZLA 1W48A 4IMPA 4PO9A 4TL6A 5K3FA 3FPCA 4BNKA 1WZ2A 2FPPB 1Y8AA 3NYIA 2LW7A 3DVRX 4TMXA 4PAQA 2VJMA 3ZGNA 1UD3A 1GHTA 3AETB 1D0SA 4M0LA 1SBNE 5FOXA 1NPDA 2BDUA 3ILHA 5JASA 1LGYA 2UKDA 3O8OB 4C3ZA 3BMQB 1VI6A 3HBMA 2C8LA 2G88A 5DLPA 3BQNB 3K5WA 3V1LA 2B7LA 3HSKA 4ZVSA 3UUWA 2Q45A 1CRQA 3QVXA 4GX5A 4BKRA 4IDAA 1DFIA 3BH6A 2MCFA 1YVDA 1RRMA 2C2BA 4Q39A 4O1HA 2OQ2A 3RFCA 1U3GA 3I9V6 4GEKA 4QAQA 1ZMXA 4CE6A 3I61A 4JBLA 4NONA 4ZRNA 2LDXA 5FP0A 5FL7A 4GVLA 2YIJA 4F4CA 1PJ3A 4B4WA 4Q1BA 5C1DA 2J33A 2FFQA 5CH3A 3W2HA 3T1OA 3BC1A 1NJ6A 1F0NA 4RPCA 3SKBA 3P52A 3LCVB 2RARA 3N3BC 3WICA 4K6GA 3QFHA 2ZIXB 3NW9A 3SBDA 1H94A 3CGWA 5JD6A 1J8MF 2I7CA 4Y0AA 2EFEB 2JS7A 3FBGA 1J8FA 2R44A 3IA2A 4PYRA 3URMA 3BWBA 3FZGA 2HBQA 1Y8RB 2QORA 1TAQA 4IHQA 4MI6A 2P5SA 3JQ7A 4DZRA 2VTEA 2EJUA 2CB0A 3KKKA 1EGQA 5HQ3A 3PX7A 3KC2A 4LNAA 3WQQA 4RPJA 4AJHA 2Q6OA 4YJ3B 5AJUA 1K6EA 4RMGA 2IHZA 1YE3A 1HNWB 3DL2A 4BNYA 3NPAA 4C0BA 4Q03A 5K4AA 1SXHA 5KO2A 1PEYA 1EZZA 2A5JA 3RROA 3BMCB 3R5FA 2AF4C 3FOCA 3TQTA 2O4CA 4HADA 3R4VA 2WYRA 2G72A 3GDWA 3O93A 5IK2D 4Z99A 4E5KA 4LHYA 3EPHA 4BGIA 2ECPA 3ASUA 3LHIA 3M6VA 3QX9A 3B5JA 3HA5A 3W2IA 1RFGE 3O94A 4JEMA 2ASVA 2E0IA 4E1VA 3TB6A 4Q3AA 4U7TB 4R2LA 5I3ZA 2G0NA 1FFXB 1Z2NX 3DPIA 1EUCA 1M76A 2EZTA 3C7AA 3JAKB 2JHCA 3H2BA 4L6CA 4KK3A 4Q15A 4WK2B 5EIXA 3FY4A 1Z0SA 1NQTA 2YJNA 3DOIA 3QYJA 4RZ3A 1TZBA 1OE0A 3K4PA 3KQOA 3WYBA 5B7NA 3EGDB 3R0ZA 3EZGA 4GZ6A 1DCKA 1UK6A 2XIQA 1JLMA 3MUNA 3SX0A 5CDUA 2FPLA 2HSDA 3TF5A 1PW5A 4GI1A 2JAWA 4GXNA 4EGSA 3ZJVA 4YRIA 5JSZB 2OXRA 4LV8B 5FFNA 3MT8A 4F3TA 1RRVA 3FUCA 4PGGA 1S4MA 4KAAA 5AW5A 3IV6A 4AJOA 3QOXA 1C7RA 3GVLA 5A7FA 3QKUA 3N0TA 4ESVA 3CNBA 2OHXA 1M8FA 4IDNA 4DDHA 4RHYA 3ER9A 4ESOA 1RQ2A 1OSNA 3S29A 1V37A 2XVZA 3PSAA 2NUPA 2G6BA 4GOLD 4OVKA 3E2IA 3PA6A 4LE0A 3WA7A 2JFXA 3C3KA 3E8SA 2RJ3A 4G5HA 1IMOA 1XDUA 4WN9B 4F72A 3BAFA 2QUHA 3DF7A 5B3JC 1ORIA 4TXLA 1NKVA 1KAHA 3JSXA 4OIMA 3WG9A 4JNCA 5L4LA 3GLQA 3BJMA 1AOXA 3ZU2A 4MWBA 4FMCB 2PUTA 3FPAA 3IVXA 5KVAA 3PGKA 5D01A 1A4IA 2J45A 4F7WA 4YRZA 1UBUS 3OTOB 4HMOA 3EE6A 3TCNA 3LT2A 4B34A 5E6SB 3GLIA 2BKVA 5F21A 1DU4A 4MLZA 1GKYA 3IRUA 2J7PA 4PPFA 5GM1A 4AN0A 2QYSA 3CC4B 1H85A 2BMDA 3EZ2A 4KXUA 1Z2PX 2FAXA 1SA0A 1M5TA 1F5SA 1UDXA 2YRWA 1GNLA 2EJTA 2JHGA 3BUSA 3GJZA 3OQJA 4KXWA 1IYZA 4MGEA 4PBSA 1R2QA 3ZIAA 2OGZA 4LCEA 4A8TA 1F48A 2HT6A 3RBZA 4CF5A 3Q8MA 2QRNA 3CX7A 4B6OA 1IXKA 1K1EA 1Y5NA 3D5QA 2W2NA 3TX6A 2FN7A 3L79A 1QWOA 2RKOA 4H6XA 4X0EA 1P3DA 5DHUA 3ACDA 2OESA 4J7CA 3PNPA 4WBNF 1VKHA 3LBHA 3P27A 2QLNA 2HCBA 2REOA 1GQQA 3HHEA 1U1CA 4OHXA 3IIJA 4A7PA 2WFLA 4M0EA 2VH1A 1SVLA 3OVMA 4P4GA 1VPEA 2VBGA 2QRQA 3QA3E 1ECBA 5EKDA 3G2IA 3IE1A 4J1NA 2Z09A 4ZFNA 5JD4A 1CDDA 3UAZA 3FHLA 4QYSA 4EIWA 1H23A 2CNWD 5JFTA 3MJVA 1CVIA 4LYJA 5EXSA 1JS1X 1K06A 3EWNA 4BP9A 2DT5A 3IA7A 4B3HA 3OJOA 5F9MA 3C48A 4KQMA 4BAGA 3AKEA 1YCGA 3MD0A 4UREA 5A3SA 4PABA 3AUTA 3IKVA 3UANA 5FJJA 3AF4A 2BSQA 3KCNA 1C9DB 2DH6A 4BGVA 4EKEA 1SXJC 3QNMA 4UTZA 3VH2A 1H05A 3GPIA 1G20A 3KEMA 5BV0A 2XODA 5IHPA 5C8YF 5MF6A 3N59A 3O4VA 1DFGA 1E9EA 2ASEA 1E1RA 2AW5A 2XF2A 3KB1A 3Q5EA 4TYQA 5G40A 3V2IA 4YMHA 4ZQHA 1F8GA 2ESRA 2XMQA 1JKIA 3RBAA 2WHYA 1L8QA 2XMGA 4DA4A 1R0WA