1F60A

Crystal structure of the yeast elongation factor complex eef1a:eef1ba
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
440
structure length
440
Chain Sequence
GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGATION FACTOR EEF1A
publication title Structural basis for nucleotide exchange and competition with tRNA in the yeast elongation factor complex eEF1A:eEF1Balpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 128
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1f60A03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1f60A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f60A01
1T4GA 2HLDA 1M6NA 1UBCA 1TLLA 1LW7A 1N6LA 3F8TA 2BBWA 2O8BA 4HB2A 1YZNA 2R6DA 3Q7QA 4LJ4A 1QX4A 4AF7A 3CPJB 3CZPA 2VZLA 2BMWA 3FYHA 5CITA 1QVGB 2F3RA 3I4LA 4NYMQ 2QBYB 4GP7A 2ZE5A 5GVRA 3V00A 4BLSA 5JCPA 2LKDA 2QUZA 2Q6TA 3IQXA 2W6JA 5B64A 2O8EA 3GLFA 1Z28A 2YVUA 4OJKA 2OFWA 1YIJB 1A2BA 2HJVA 3FGNA 5JWOA 3THYA 1D9ZA 1W48A 1RFLA 4JLPA 3QPVA 4MRSA 3OZWA 2CL7X 2O8FB 5J4VA 2ZJAA 3EIEA 4EQ6A 1DAEA 3EWSA 2BDTA 1HYQA 4FMCF 3LW7A 4DDTA 3ZBTA 4KXFB 3T61A 1KI7A 4HYYA 4H1VA 1I4DD 2DFTA 3O47A 2Q9CA 4M9ZA 5KHOC 1CBUA 4F93B 5DISB 5JSZB 3W5IA 4N0DA 3VKHA 3HP1A 2JIZD 2ZSAA 3KDSE 4BECA 4YMVA 1P72A 3TE6A 5DIFA 3P26A 2CE7A 4PFSA 2OM2A 1KZGB 1E62A 2ODBA 1GNPA 4FWTA 3PUXA 1W0JD 4BFZA 3LXRA 4Q4JA 4Y0VA 1QF9A 3EZFA 5GJVC 4OBEA 1DE0A 4HAXA 2QTLA 2V1UA 2BEJA 3ADDA 4DXAA 4L4UA 1JJ2B 4TQ9A 1KI9A 1KY2A 2VA8A 1Z6TA 3IKJA 3IPYA 3EPKA 3WP1B 4C43A 4HSEA 4U00A 3U5ZB 3A1TA 4KO8A 3TIFA 2WWFA 4PAQA 3C8UA 3CH5A 3FMFA 4L5BA 3AF0A 4UXHA 1G6HA 4W9MC 2J87A 1KRHA 5FI1B 3ADCA 2BMEA 1YQTA 1YZTA 1YJ9B 3LLMA 2EFDB 3QXJA 1II9A 4R7ZA 5EQTA 4Q9IA 2ZUBA 2YC4C 1VCMA 3CC2B 1E2PA 4GZMA 4JKYA 4EPWA 2PT5A 3MWLA 3R9WA 1NMXA 2FFBA 1FX0B 2GILA 3MJRA 4A8JA 4XTCS 1W36C 3CF6R 2J59A 2PX0A 4POAA 2DWQA 3PEWA 4HLUC 2CJWA 2ZR7A 3RRYA 5KO2A 1Z0KA 4TLAA 3AP3A 3RABA 2C9CA 2IT1A 4LHWA 2FX3A 3CLVA 1NIPA 1ZUHA 2LKCA 3GLHA 4I1UA 3SS8A 2WWWA 2OBMA 1OE0A 5EE1A 2QA5A 4LPSA 3W9YA 4RD1A 5SZIA 1C9KA 4EPTA 3A37A 2C04A 2IS2A 1E4VA 1FP7A 2J0UA 4MKGA 1NBMA 5SZKB 2G0NA 2RGNC 1W4AA 5BWMA 1IOZA 3U44B 3DEFA 2FU5C 1WDTA 1N2CE 4MDEA 1JI0A 3NC0C 4XH9B 1LVGA 1IY2A 5EXXA 1SQ5A 3VKWA 2OCBA 4LCBA 3H1TA 4EIWA 4TWZA 2GBLC 2VF8A 4K81B 1FUKA 5FTJA 2BSAA 1G17A 3BB1A 3EAQA 2QT0A 2QL6A 2JIZA 3RRMA 4RZXA 1UBFA 1W36B 1GL7A 1XEFA 3LWNA 4NDZA 2KBEA 4PC2A 4A92A 1GZSA 3B5JA 4TLEA 2O8FA 4AYTA 3H84A 1W0JA 3MRSA 3QE2A 3SQXA 3WNBA 1G3RA 4O2LA 4DLVA 1CRPA 4YALA 4AIIA 2XEXA 5LD2C 2RGCA 1M34E 4LJ9A 1KDRA 1T5LA 1UDWA 2YHSA 5JSZA 2PCJA 2IF2A 3GJ8A 1MO5A 3CWZA 4B74A 4YONB 2AK3A 1W36D 4OYHA 1T3HA 3THXA 3SQWA 4AYWA 2GXUA 1N5IA 2PX3A 2B5OA 5FOXA 3VKGA 3VX4A 2XNJA 4EJSB 2V4ZA 4MGIR 2QQEA 2XX3A 2PZGA 4ZI2A 4QG7A 4DVGA 1YZKA 1G5TA 2IUTA 3B1ZA 3PVSA 4DEXA 4HE6A 5KDOA 1LTQA 1M2OB 1I2DA 3IBYA 4UAJA 3LA6A 4PXAA 4XOIA 4M1TA 4C7OB 4QHTA 5DN6D 2JLXA 3K70B 1TAGA 4YDSA 3DOFA 3MHPA 3U4QA 3DKVA 2V54A 3EC2A 4ZDIA 4Q4HB 3AB3A 4IVRA 1WP9A 4D4JA 1FRNA 1NVWQ 1HUQA 2ZSBA 3M1IA 1N0WA 3HU2A 1CEEA 2VHQA 1NRJB 5KOYA 4PC7A 1NJID 4DDUA 1KHTA 2VHTA 3AF1A 3KB2A 3ZQJA 5A4JA 1NLYA 1G8YA 4O25A 5CDFA 4DB2A 3SFVA 4PAOA 2E1RA 2AHOA 3THOA 1XMVA 1FX0A 3EXAA 4AI6A 1NL3A 1KSGA 2PJRA 2FE4A 2IBMA 4S2EA 4DRZA 5FL3A 1L4YA 4TTQA 2XOKD 2H8KA 3HR7A 1WE2A 2OG2A 3G0HA 1OHHD 3R9XA 3X1XA 5EE9A 2QMUA 1VIAA 3UXMA 1E99A 4BEJA 1CJTC 3BERA 4DSTA 1IJEA 2JLRA 3Q7PA 4HDCA 3UANA 4X8MA 1OJLA 3B1XA 1EK0A 5KDLA 3U44A 1KMQA 1M1KD 1KZ7B 5IT5A 2X19A 1OKKA 2J45A 4ZDWA 3U7FB 1GWNA 2ZREA 5KSZA 3LD9A 1KO8A 2WWIA 2OXCA 4A6PA 1UKEA 4M9SA 1XXHB 4JMPA 3CXCB 3ZIAD 1AM4D 1YRBA 1MO3A 2ZR9A 1Y63A 3KJHA 1OH6A 3ND8A 4HI0E 2CVHA 4O2RA 4HLUA 4QJ5A 1RW4A 1ZW6A 4Q9HA 4Z54A 5G3YA 3MUFA 4IVPA 5HZHA 2IYTA 1Q1QA 2B92A 2QM7A 2ONKA 3TSOA 2ZI4A 1ZM4A 4B6FA 4Q1BA 1EXMA 5DN6A 4Y7CA 3ZZTA 2RGNA 1XEXB 4LJAA 4DEYA 2YJTD 2ZU6A 1VQMB 3BJIC 1XE1A 4H1UA 3SU8A 1S1CA 4A15A 1GSIA 1UF9A 2YINC 4GSYA 2L0XA 4JVSB 1KGDA 1DG1G 2V1XA 4CEIA 2VP0A 4DSNA 3QNUA 2A5GA 4JJZA 2GBLA 3GLGB 3CX6A 3D7MA 3TMKA 3SI7A 1DOAA 3ZH9B 1FUUA 1G41A 4HDQB 4C7OA 1S9HA 3WNCA 2GA8A 2NTYC 5J4KA 5FTKA 2VSXA 3AV0B 1KMHB 4ZGNB 5EP4A 2HV8A 4B75A 3T1OA 1H42A 1CJKC 1JAIA 1VCOA 2IYWA 1KI3A 2XOKA 2C98A 3CCLB 4Q48A 5DO9A 1XP8A 1KJYA 1QHSA 1VTKA 1G7TA 1NY5A 3K9GA 1DELA 1OHHA 1QRAA 4I1VA 2J0SA 3PJRA 4JLMA 5IHPA 2AFIE 2R6FA 4TLCA 2WJYA 4ABYA 2WAYA 1LY1A 3CNNA 4OQXA 2KBFA 4C30A 3DM9B 2DERA 4MA4A 3NHAA 1TMKA 2H18A 3TQCA 1LV7A 2MSDB 3X1ZA 4TT3D 1YHQB 1QHGA 1YZLA 5JS7A 1VG1A 3BFKA 3GJ7A 1JBKA 2FFHA 2OFXA 3G5UA 4JLNA 3W5JA 1Z3IX 5B57C 2G0TA 3K0FB 2F9LA 3WYAA 1GM5A 4UNPA 3RRNA 5EP3A 1YJ5A 1JQLB 2CK3D 3KKMA 1W2HA 5B58C 3QVVA 3TUJC 2WMNB 3AF3A 2WM9B 3AUXA 2W6ID 2CNDA 4IOKA 4RKEA 1OT3A 4CF7A 3ZIAA 2QP3A 5FA6A 2ZYWX 2QPTA 3NBXX 3C7KA 4FIDA 1XFAA 3QI2A 3QXHA 4JBYA 3IILA 2JJ1D 621PA 4D81A 1WBDA 4K1XA 2WOOA 4OHWA 1FNCA 2BPOA 4HUTA 2W83A 2GCOA 1UBGA 1KK3A 2QI9C 3E70C 4HZUB 4NL4H 4A2QA 4JVNA 1NVVQ 4LHZA 4Y9RA 3QVUA 3QF4B 3ES9A 1VQPB 4V0ME 3C41J 3W5VA 1Q1EA 2BMFA 4GRAA 1WB9A 4DLXA 2QG6A 4CEHA 1YR9A 3QKSB 4OHVA 3UG7A 5CB6A 1GITA 4NYMR 1E2IA 1E69A 4O3MA 4CGZA 2J1LA 3BB3A 1DAFA 1U0JA 4UQOA 4DBLC 2ZRJA 2G6BA 2ZPTX 5JI3E 1TF5A 1DBSA 4TMWA 3D6TB 4XD7D 4JLDA 1Z83A 3IO3A 5DYGA 3K9NA 4AKIA 5L3VA 1AIPA 4A82A 3Q3JB 1E2DA 1OIWA 4AKEA 4BLQA 4TLBA 4DSUA 1OH8A 5FUVA 4GOKA 1DEKA 2J7PD 3TAHA 3H0KA 4UXJA 3KFXA 1XWIA 4AURA 5DNYB 1SGWA 2X3UA 3L43A 3PCRB 3L82B 1RJ9B 5FPYA 1B23P 3NEJA 3QKRB 5IRCD 4KJZA 3L8YA 1CTQA 2DFLA 3A1SA 1CIPA 1ZC4A 2DPXA 2O8CA 1X3SA 1IN6A 2AN9A 4M1WA 3SN6A 2X1VA 3PEUA 2GESA 4EAQA 5BW8A 1EX7A 4NH0A 2G88A 4Q47A 4EUNA 3SOPA 4TT3A 1KI4A 1VCIA 3C5CA 4MKIA 4E09A 5JHHB 1OFUX 1EP2B 3ASYA 4YQFA 5J4LA 2C03A 4NKRA 3U3RA 3RYTC 3ZS8A 3BOSA 3RS3A 2CK3A 2GKSA 4D25A 2ECKA 1OF1A 4Q02A 1NSFA 2W6IA 1E96A 1OGIA 2OBNA 1KK0A 1K5GA 1TUEA 1W2BB 1Z08A 3T5DA 4PHHA 1H8HD 1PZNA 4E07A 3CF0A 4B32A 1AGRA 4G5RA 2JJ1A 1DDGA 3AVOA 2ZRKA 4A6XA 5KU1A 1G64A 2H5EA 4A9AA 4DLZA 1KDPA 2Q3FA 4NYIQ 2BEKA 4PZYA 3Q9LA 1EWRA 3QXXA 3TVTA 2FEOA 2IS4A 1AJEA 3VX3A 3LO8A 4ZCMA 2PJZA 2GQFA 1BX0A 1CULC 4TMZA 4LK2A 1P2SA 1AMOA 5FFMA 1OW3B 4HB0A 1SVSA 2ORVA 5JHGB 5AJWA 1WXQA 2D62A 2VYFA 2X2EA 3CRW1 4FI3C 2ORIA 2QGZA 4LYFA 4AG6A 1VG8A 2NMVA 4KFRA 2V55B 2OEPA 4DDVA 1I4LD 4RD6A 4XD7A 4KBGA 4B48A 2P5TB 3DVLA 3OZVA 2EYUA 4HZUA 1WA5A 2IXGA 1N0UA 5IF9A 4P6VF 1PLKA 3EX7C 1HA3A 1GAJA 4MKFA 2GTPA 3LQQA 3IQWA 3QUSA 4TQAA 3MCAA 4MQBA 2YOHA 3QKSA 1YRAA 1GRNA 2J7PA 1FOEB 5EUMA 4ILEA 1GUAA 1KDOA 3W2GA 2EVWX 5DI3A 4YAFA 2HF8A 2P3SA 3MWJA 5EUQB 2RGDA 2OV2A 2WJGA 2ZI3A 2CHGA 3TKLA 4PC6A 4C0KA 1OYWA 2GETA 2PL3A 1ZM9A 3K0CC 5FBRB 4AD8A 1P61B 1G9XA 1J9ZA 1KKLA 4II7A 3LY5A 2D2EA 4JL8A 4LDJA 4KFTA 5FUXA 4LPKA 4B2PA 4UNRA 1A1VA 3TR5A 4AC9A 1ONBA 4LBVA 4IXNA 4IFBA 1N6KA 1E9BA 2CBZA 3CONA 4QGGA 4NPHA 4KFUA 4LY6A 3U7EB 1OGJA 4D0LB 4OQLA 3DZDA 2HYDA 3SYLA 1IB0A 4N3NA 1GG2A 1OXUA 4NCKA 4NBSA 3EC1A 2WSMA 4D4LA 1NN0A 1Q81D 1P73A 1NBME 1RJ9A 3AKYA 1KJWA 4ZDKA 1EGAA 2A78A 1LNZA 2F6RA 2GEVA 3C16C 4YMUA 5UKDA 4P4SA 3SBDA 2ANBA 1TQDA 5BN3A 1GIAA 2XITA 3UMRA 1Z0AA 1AKYA 2YWGA 2VPPA 3BIFA 3TW8B 5EE5B 3SR0A 1H8HA 2X8AA 1BYUA 1ZP6A 3VU9A 3WMGA 3T12A 1Q20A 4Q1CA 1BO6A 4OK3A 4YMSA 2REOA 3FKQA 2CHQA 1K8AD 2FJUA 3X2SA 3QFTA 5G40A 4JJKA 5KPDA 2HF9A 4DQLA 1JNYA 5E3HA 1DAKA 1AQUA 2O8EB 3GLFB 1D8TA 2WJIA 2W2XA 1EFCA 4BUJA 3THYB 1NVXQ 3FKSD 1G3QA 4BFXA 3MLEA 1R0ZA 5FH9A 4J0QA 1QDEA 5EXPA 2V6IA 4BZPA 1HH4A 3WXMA 2I1VB 1FL9A 5CM8B 721PA 4EQ6B 2ZRBA 4OI2A 1ZNZA 1TNDA 1QVFB 5AUPB 3G82C 4GFDA 1DO2A 1F2TA 3QFRA 3T35A 3B13B 2VBCA 4KV9A 4UJ5A 1TVCA 2AKYA 4JLOA 3TVDA 1P5ZB 4PC1A 2JA1A 2YNMA 4JT2A 4LV5B 2QMHA 1MRSA 4DT1A 2HJGA 2VEDA 3PUVA 5HCIA 2JEOA 1KSFX 2FSGA 2JLWA 1U8ZA 4IDNA 3EPJA 4RD4A 4IW3B 3KQHA 2BMJA 4OHZA 2OTLB 1GVHA 4LSGA 2Z0MA 3EASA 1V43A 1J7KA 2TMKA 3O8BA 1VCNA 4Q4JB 3OF5A 4Q1DA 2GF0A 3QFSA 4M4SA 4R71A 1JJ7A 1LF0A 3M4YA 2PH1A 2RCNA 1VHLA 2O8DA 6Q21A 1ZNWA 4QM6A 1EFHA 4JLBA 4ZCLA 3VR6A 1O87A 3IIJA 4NYJQ 2ZROA 3OZUA 1YHNA 1S72B 4US1R 2FMXA 4G1BA 1M7GA 2GXQA 3C14C 3CWQA 3FFAA 3SYKA 4BFVA 4B2LA 5HE9A 1ZMXA 2CE2X 3P20A 1M7HA 3QBVA 5EE3A 4B43A 4YLGA 1LFDB 4DCSA 2RC5A 3JZMA 3B7GA 2F3TA 4EDHA 1EWQA 5CDFE 2WTUA 1MRNA 3BH0A 1Z8FA 4HLDA 4WZ6A 4A0RA 1HE1C 4US0R 2G1KA 3HYRA 2ZS9A 3VR5A 4Q66C 3NBFA 5FOSA 2FGKA 4E22A 3N2EA 4IEIA 5J5CA 2BGJA 2WAXA 4P4TA 2OE2A 5FTNA 2BWJA 2ZSFA 1E2EA 1NSTA 4FCWA 5P21A 2ZQ5A 3CKLA 3V9PA 4KAXA 4B35A 1E2JA 5AJVB 5FOUA 2P6UA 2XTMA 1Z2CA 3GLHB 1GTVA 5C18A 2BBOA 2VP6A 4DLWA 4PC3A 1Z6GA 1PV4A 1BOFA 1IN7A 3OHMA 1Z63A 2QPAA 3FKSA 2J0UB 2CNWD 2OCAA 1FMJA 2ZRDA 1E32A 2ZR0A 1KJZA 3P4YA 5TXGA 1QGZA 3IHWA 1F3OA 2ZRCA 2HEIA 3KJIA 3JVVA 5DYIA 4CVNA 4BFWA 3K8YA 4RCZA 5FR2A 2JLYA 3VR1A 2J0QA 2BN4A 2RGEA 3MFYA 1XPRA 3K0CA 1SXJC 2VTKA 1PUIA 3SDZA 4URZR 3U3OA 1ZD8A 2XNDD 4LUCA 3NH9A 5FOVA 3TBKA 3NIBA 1RC8A 2DHRA 4B3BA 2NO7A 1RRCA 1QFYA 1U94A 1R6BX 1LS1A 1R0XA 3LQRA 1ZU4A 5ELXA 3AP2A 3FPKA 3P4XA 4LOAA 4HAUA 4YAOA 1JB1A 1XMSA 1RYHA 3CCJB 1MT0A 3UMSA 4DWJA 1ZYUA 3G6EB 1AN0A 1KOFA 2HCJB 3IEVA 4D4MA 1K5DA 2CL6X 2YOGA 4DLSA 2QNRA 1KO4A 4HAVA 2PT7A 5AJYA 1Q86D 3BH6A 3GJ4A 5TY0A 1IY0A 4K46A 4DCUA 1W5SA 3ICQB 3VNVA 4IVQA 3LX8A 2C99A 3QFCA 2PIAA 1WRBA 5H1YA 3CCQB 1Q1ZA 3OIUA 4IRUB 4DDWA 3THXB 4TYYA 5TR9A 4OI4A 1EESA 4L8GA 3WBKA 5EMNA 2JGNA 4TSFD 3QXSA 2IWHA 1A8PA 4BPBA 4BEBA 1Z22A 1ZINA 2ZRHA 2WV9A 4HEJA 2J7KA 3PV0A 1ZVQA 4URYR 5GV7A 1E9FA 1VIYA 2MSEB 3U7GA 1SVLA 3FTQA 1DS6A 1M1YE 3U4QB 1Z0DA 3LVRE 2NQ2C 5JECA 3VFDA 4BLPA 4AY2A 1KI2A 1P9NA 1NVVR 5FBVB 5CJPA 2C95A 2DETA 1XTJA 4IOLA 2GJSA 4PO9A 1XX6A 2XZPA 5AR1A 1EG7A 1V5WA 1X8JA 1E2NA 2QDXA 2ZUDA 4MYCA 1SXJD 1S96A 2FSIA 4D0GA 3SJAA 5FPSA 3RS2A 1Q44A 2CNWA 2ERYA 4MH0R 1VQ4B 2Z5FA 5L3SA 3RC8A 4LBWA 5KSPA 4BASA 1FNMA 1JR3E 1XCPA 4KVGA 5CLLA 2NO1A 2ERXA 2CHVA 3SZRA 3BK7A 1B0UA 3B6EA 4UNSA 5AUQA 1E63A 2W2VA 2FEMA 5KSWB 2C78A 3L0PA 4JSTA 2A5DA 1VKJA 4QGFA 2REXB 2XNDA 3CPEA 1E98A 3HPRA 1NVUQ 2R2AA 2FZLA 3HWSA 2H7VA 1X86B 3W6PA 1E1RD 5JLJA 4Q4AA 1E3MA 2IYUA 4PZLA 1QG4A 4V0NA 3B78A 1FTSA 1YJNB 1Q82D 4QBFA 5K8LA 2ZJZA 3ECCA 1D6JA 4TTPA 4DCVA 5BXQC 4L16A 1XCGB 1XXHE 2AKAB 2YWHA 3PR1A 3VHLB 3DHWC 4Q1EA 5GJWC 1VMAA 4L9WA 3KZ1E 2GVDC 2VNIA 1BS1A 3BGWA 5GADl 2QAJA 1FTNA 3U60B 1VQKB 1VQ7B 1EFRD 4P3YA 4A2PA 4PSKA 3AP1A 5EZ5A 3Q72A 2G9NA 2VNKA 3TGPA 3FMIA 2ZRAA 3CRMA 4TYNA 4BLRA 3GJ3A 3NG1A 2ZJBA 2OUKA 4RZ3A 4TSFA 5LDDC 1P4SA 1OLOA 2RC6A 1ZCAA 5AUNB 2DEUA 5LB4A 3I92A 4TMTA 4B6EA 1OFHA 2ODWA 5L8VA 3A6PC 3CMEB 3BXZA 5C1BA 3ZD6A 3FHCB 2CL0X 2BM1A 1XF9A 2ZE6A 3P1JA 1IY1A 3SEAA 4Z8XA 2H92A 2ZI9A 2V8OA 4NYIR 4ON9A 3GLGE 1G7RA 1ZU5A 1E2KA 2N1BA 2ZETA 1HT2E 1DAMA 4WIAA 4CEIB 2AL7A 4FCVA 2N46A 3LVQE 4KU4A 4P32A 4Z8YA 4C0LA 1SXJA 4Q4LA 4F4CA 2GJKA 2V3CC 1S2MA 5H70A 2OAP1 4Y0AA 1KTVA 1E9CA 5AN9A 3BFXA 3REFA 1U2RA 3EA0A 3BFVA 4RZ2A 5CIQA 3UKDA 4B73A 3GJ0A 2GZDA 4JVLA 2DWPA 3TR0A 1M8PA 4C0HA 1GKYA 4CIDA 1IONA 2PLFA 2WKRA 3EPLA 5LD2B 1QH0A 1XZPA 2ANCA 3IIMA 4M21A 3OIYA 4YC7A 3WHLA 1YE8A 4X8HA 4WXRA 3SHFA 1E1RA 1YZUA 3EZ9A 3R7WA 1I4TD 1XPUA 1SVMA 4HB4A 2OBLA 1P75A 1ZD9A 2AD1A 1FPMA 2IYQA 1VHTA 2R44A 3AEZA 2NZ8A 3QY0A 1E2HA 1FNNA 5FUWA 4CYMA 3VR3A 4XVRA 4M1MA 4M1SA 2J9RA 2VP2A 1AS0A 4LC1A 4V0KA 5F2EA 3TSZA 3U3MA 3B1VA 3BBPA 3H4MA 3OEED 4TQUS 4CDGA 2ZTSA 2H57A 4LYAA 2C96A 1P62B 4UNNA 1NN1A 2CCKA 3C15C 2BBSA 1EFRA 4GZLA 4B44A 2A3RA 2W58A 1G8PA 1TF2A 1KI1A 2IYYA 1DAIA 3FVQA 1KI6A 3MMPA 5THXA 1AS3A 2OAQ1 2GK7A 1JECA 4R98A 2VYQA 3J81k 3A58B 2UKDA 2WWYA 5TVKA 2MMCA 4DKXA 4KLZA 2GCOB 1I7PA 1IN4A 2G3YA 2MMGA 2QT1A 2WOJA 3CX8A 3QENA 4PSVA 2QTZA 1HURA 5FPHA 3I5YA 4C2TA 4A36A 1VQ6B 1NP6A 1IBRA 3ZC3A 2IL1A 1M7BA 3U3JA 3QSYA 4C4PA 1OB2A 4CEHB 1JB9A 2QM8A 5BN5A 5K8TA 5KTYA 1Z0FA 1KY3A 3RSOA 1G7CA 1HEIA 3V76A 1ESMA 4A1FA 3GQBA 4JS0A 2RAPA 2B6HA 1ZM3A 1G20E 5E7MA 3G4SB 1P60A 4B33A 4EPRA 1FRQA 2ZXUA 1XTRA 3TH5A 4W5JA 1S3SA 1N5JA 1CLUA 4LV6A 1VQOB 3UIEA 1G4UR 4O0MA 2AXPA 2Q9BA 4JZKA 1TF7A 1XEWX 3EZ6A 3NBZC 3WMFA 3THWB 1JR6A 1P2VA 1R7RA 1W2GA 4GBMA 4XJXA 1P3JA 4B3DA 1CP2A 4PGOA 3H2YA 4EKDA 2RGXA 2A9KA 2PZFA 1TX4B 3VO2A 4QNRA 1WCV1 3A1VA 1Y3AA 2QENA 3DMDA 2ODEA 5DHFA 3CCSB 2O8CB 2QROA 2GXAA 5ANRB 3W5HA 4AYXA 5DLQC 4ARZA 1XD2A 4BFYA 1IXRC 4HLCA 4YMTA 1SULA 1N8RD 4Q19A 1TU3A 4BE7B 1E2LA 5GV8A 2BC9A 4MRNA 4QRHA 3GJ6A 3MWKA 5M04A 3PQCA 4NYJR 1GAWA 2OLKA 3OEEA 2ASEA 3QPWA 3LNCA 3W5UA 4TN1A 1OH7A 1FQKA 5JRZA 3HYTA 1CNEA 4M1KA 5CYOA 3T15A 1S3GA 1AZTA 1MV5A 1T0JB 2QTHA 4DLUA 3SJBA 4NCHA 4S35A 1BH2A 1QGAA 4CT5A 4GMDA 2QEXB 3VNUA 3E5HA 3R20A 3TK1A 1TQ2A 2IYXA 1GILA 2GCNA 2HCBA 3VQTA 3I62A 2ZJOA 4U02A 2GEUA 3CC4B 1IJFA 3HPQA 5AK0A 3ZLJA 2R8RA 2B7CA 2QGNA 4MRVA 1X8LA 4P0TA 3W90A 4A2WA 4EFMA 4F4IA 3W8NA 2OZEA 2ZS8A 3K0EA 3W3AA 5EJEA 1H8ED 4F91B 2OO7A 1IQPA 2NPFA 2FSHA 4D4KA 1QVRA 521PA 3PEYA 3AGQA 5JWRA 2ZJ8A 4C9BA 2EU8A 1KQSB 4WBSA 2C9YA 3KJEA 3UMFA 5FBQB 3ZVNA 1E6CA 1Q22A 3G71B 2J46A 4RCYA 5H59A 1J99A 1SKQA 4IFEA 4LHXA 1IAQA 1NKTA 5TARA 3A36A 4JYBA 1S1MA 1Z0JA 4PO1A 3QOFA 3KFVA 1JPNA 2EFEB 3N5CA 1HE8B 1YR6A 3NEYA 2FWRA 2IYZA 1UMKA 3CNLA 5DI3B 5F9HA 4XWKA 2JLQA 1F5NA 3F0TA 4M22A 4X8OA 4XWOA 1KK1A 2CDNA 4Q9KA 1SHZA 1T6NA 4ACAA 2OK7A 1SKYB 1JALA 3KTAB 4C0BA 3CMAB 1I2MA 3V4RA 1NNEA 3LBIA 4K8OA 3ZGXA 4TZ6A 1NF3A 4JIMA 4P33A 2GXSA 5CJ2A 1KSHA 2JLVA 5B2ZA 2RGGA 4NP6A 3THWA 1Q12A 3I1FA 1T0HB 3VAAA 2NPIA 2RGBA 1VQ9B 1GL6A 1Z06A 2J3EA 1QHIA 2ZRLA 4CEJB 1ETUA 4WQMA 1A4RA 3LH5A 5HCNA 5J40A 4MYHA 4I99A 1R4AA 2R6AA 3RANA 1YR7A 3DOEA 4TL7A 2KWIA 2KI5A 1W1WA 1G291 4C3ZA 2SHKA 3EARA 1II8B 2JAQA 2O0JA 4M1OA 4P4SB 3ASZA 3CPWB 2ODNA 2ZJ5A 3AVYA 4MGZR 2P67A 5CIWA 1US8A 2ZVQX 1E2QA 2V7QD 4LV8B 3UK6A 4WAUA 4LJ8A 3OIVA 4MRRA 1J2JA 2KJQA 4Q1AA 3VU9B 3QJYA 3SFZA 4BFUA 3GLFE 1TEVA 4KYUA 3K9HA 3SJZA 1PLJA 3K9LA 5HKKD 3CRZA 4LBZA 3E2IA 3I72A 2GCPA 3N2IA 3B85A 5F98A 1QHYA 2FH5B 1RYFA 3HJNA 1OXTA 2BMDA 2B7BA 3OE7D 3L0IB 2DFNA 1GKUB 2VP9A 3BS4A 2ZE7A 3CX7A 3A4MA 2A7QA 1GDDA 1H8EA 4PPNA 4IDPA 4WW0A 1W87A 4DCTA 3KXIA 1XTIA 3IO5A 2Z4SA 4JYCA 1MO6A 2GRJA 2RGAA 3GJ5A 3TUZC 1IN8A 2DFKB 3PFIA 1OFIA 5JEDA 3B60A 3CCRB 2QMEA 1E1QD 3EG5A 1F2TB 3CCEB 2D74A 2QA4B 2EFCB 3QXCA 4RSGA 4N1AA 3T06B 1M90D 3MWYW 2GAAA 1KI8A 1NLFA 5JJLA 2CLCX 4DT1B 2EWVA 5JJKA 4PQYA 4DB4A 2A5YB 3JQPA 4MYTA 4Q01A 4TL8A 4B34A 2O0KA 4CRWB 3P32A 5DI9A 3B1WA 2B21A 3EZ2A 1D1NA 3LX5A 4YAWA 4PHTA 5IK2D 1XJCA 4PTLA 2BJVA 1NN5A 4YXWD 3B8HA 4MGYR 2D7CA 1XPOA 5LPNA 2WJHA 3C5HA 3CZQA 2WHXA 1R2QA 2O8DB 4LBYA 2FPMA 1NI3A 2JATA 4B3GA 1SVIA 5E95A 2BBTA 4QC2A 3RDPA 5FTMA 1HQYE 2I1QA 4RZUA 5FPKA 2EFHB 2EIXA 4RJLA 1GFIA 1NJFA 1W4CA 2Z4RA 3PUZA 3CIOA 3T1QA 4BFTA 4MDFA 1BMFD 4QBHA 5H68A 5J4HA 1VECA 4KSCA 3RSLA 1XEWY 2IEZA 4ITRC 2ZJ2A 2GJ9A 2AR7A 5TB5A 1TUIA 1QVAA 1DPFA 821PA 2X77A 4QNMA 1X8KA 2BIFA 3AKEA 4ZI3A 2GNOA 3KTAA 2IS1A 1M74A 2CCGA 2G77B 1S4QA 4KLNA 5FOTA 2V7QA 3GLHE 4AKHA 4P4UA 1K8RA 5DHAA 221PA 2D2FA 4NCJA 1J8MF 2IHYA 2IF0A 1CJMA 4GPTA 4R2IA 4CEJA 1E0SA 4LC0A 2FZ4A 5FBWB 3TLXA 5C2JB 5HKKA 3QE0A 2P0EA 1G3MA 3CB4A 3DL0A 4V0LA 1VQLB 1H65A 3OE7A 1L4UA 3AGPA 4YDHB 3FHOA 1II8A 5L3RA 3TQFA 3I56B 1D5CA 1G3IA 2H17A 2IK8A 2WBLC 3NDPA 3I32A 5FOWA 4KSBA 1P7CA 1G5RA 1T8TA 2QEQA 4B71A 3HR8A 4B47A 5KDDA 2A5JA 1QUFA 5FPTA 2HXSA 3WP0A 1E1QA 4HAZA 5LB2A 4JLKA 3W8RA 1VPLA 1QHHA 3BC1A 3T1TA 3CCUB 3FB4A 1UDXA 1KNQA 3FWYA 1SVOA 4DIEA 3PUWA 2QN6A 5G41A 1YITB 8OHMA 3KQKA 1Z0IA 1R5NA 1HQCA 5A0FA 4N0EA 3B2EA 1KAOA 5EXTA 1E64A 4Q7LA 4OHYA 2OSBA 3B1YA 5IK2A 3RS4A 1TL7C 5JEEA 4YXWA 4X8LA 1ZUNB 4GNKA 3L0OA 1YZQA 4OQMA 4CW7A 3FDIA 3MGCA 2C2HA 4QKQA 4XWAA 1KNXA 4RFSA 4FN5A 3KUDA 1UEIA 3Q5EA 4I1OA 1UPTA 1JQJC 1SHKA 3MG9A 1SXJE 3E1YE 3A1UA 4F7WA 1NLZA 1BMFA 1XMIA 1XMJA 2OT3B 4M8NE 1QFJA 4PZZA 1Z5ZA 3CR8A 2IHBA 4H9GA 2IW3A 1FNBA 1YJWB 3OJWA 1VYVA 3I61A 2RKOA 1G19A 3ZVMA 5F3WB 2XNCA 1BJKA 4F4JA 4G01B 3QPUA 4M2LA 1G8HA 4B4DA 4RKFA 3GFTA 2NG1A 4D82A 3VR2A 2BGIA 1GVNB 2QQ0A 4V03A 4Q9LA 1NG9A 2JJ8A 1UM8A 2F9MA 2PBRA 4B3XA 1NKSA 4NONA 4RFVA 3GFPA 3BWDD 4QJ4A 3GEEA 2QU8A 2P6RA 4LX0A 2HYIC 4MITA 2VIIA 2W00A 2RMKA 4PPGA 2OXRA 2ATXA 5H8WA 3LO5A 1W49A 2D4HA 5JS8A 3B82A 5L3SB 1KO5A 4FMDF 1L8QA 1P2TA 2NO6A 2QPOA 1FMLA 5JWHA 2NIPA 4MKHA 3NHBA 4OL0A 1XU4A 2FGJA 4L9SA 1RRPA 2N42A 1OPXA 5FI0B 2HMAA 1DDIA 2BKEA 4GL2A 4Q7JB 4M9QA 1QZXA 1DAHA 3K0SA 3IGFA 2J41A 2AWNA 1CR2A 4JL5A 3VTKA 1AA9A 2OHFA 2QP4A 2GZAA 3CRQA 3IDQA 4Q00A 1OSNA 3KX2A 4GMXA 4Q4AB 4DJTA 2P6NA 3CNOA 2JLUA 4QJ3A 3DPUA 2FG5A 1RIFA 2FDCA 4IOJA 1EX6A 4FK8A 3PXGA 5E7IA 3WYGA 3B9PA 5HTKA 2F1RA 2VHJA 1SVKA 2ZU0C 2F7SA 2XZOA 5EZ6B 2AFHE 3ADKA 3NC1C 4JL6A 4OI0A 3I73A 3TUIC 4BRUA 1AK2A 2Q3MA 2AXNA 2OTJB 2JASA 5HPYB 4G5OA 4KCGA 4EPVA 4QFMA 3WY9A 3AVWA 2XSZD 4RY2A 3AKCA 2ZRFA 1CNFA 4M1YA 3ZBUA 4F7DA 3QEOA 3C4JA 4PPFA 4DC9A 3DKPA 2W0MA 3FMPB 3GJXC 1JAHA 2FPKA 5E7JA 2ZUCA 1PLLA 3OFND 3KKNA 1XJ0A 2VHCA 3EZ7A 2H16A 4Q9JA 2JLSA 1CF4A 3A4NA 2OILA 3SBEA 2IEYA 2W2TA 2GVZC 4NE2A 4ESVA 1G1MA 3HDTA 1Z2AA 3DO6A 1NBMD 5GVSA 2B8TA 4TLDA 3QG1A 3DDCA 2FSFA 1X1RA 2BCJQ 2XB4A 3U2QA 2WPDD 1N6RA 4ACBA 2GPJA 1R8QA 1KD1D 1SXJB 2KB0A 1P2UA 1G6OA 2DYKA 3W2FA 2WIBA 3GLIA 2GEDA 4BWYA 1JPJA 4NCIA 4DUGD 4TMVA 2B8WA 1VDZA 2RH5A 4I4LA 1J8YF 2AK2A 4AG5A 4BLTA 1ANKA 4URVR 1Z07A 2OCYC 4G3XA 2YOFA 4PR0A 1TTTA 3RHFA 2GF9A 1U8AA 5AJXA 4V0OA 4WOPA 1YKSA 4TTRA 2DCUA 1YR8A 1G7SA 1FW6A 2BCGY 5D3MA 1EWYA 2IUSA 2WWHA 4LGMA 4OHXA 4QXAA 1KIMA 4US2R 3FHTA 3KXKA 1SZPA 3LLUA 2WIAA 4ASUD 4YAUA 2WZQA 4PAMA 3TJZA 1W0KD 4BZQA 1Q1BA 5SZJA 2WICA 3ICEA 3KL4A 2VNHA 3NXSA 3R7WB 1ZRHA 1RZ3A 3GMTA 4BQSA 2F1HA 3CR7A 1MABB 2IYVA 1JXMA 3KXLA 1U0HC 3LFUA 1IXZA 1TU4A 4IOMA 1FP6A 1Z29A 4URUR 3CRRA 4CT4B 2QE7D 2CLSA 2BOVA 1COWD 1JEDA 1N6HA 3DMNA 3KKPA 4JVMA 3CUEF 1ZIPA 3GCGA 3ONWA 4HZIA 2A5FA 1GNQA 1UKVY 3U6BA 1XNJA 1KI6B 3KKQA 2XSZA 2AWOA 1W34A 1D2NA 3O8DA 5J47A 3CCMB 4DLTA 1A82A 2Q9AA 3QF7A 5KYKA 3K09C 5DGXA 1E2GA 2QP9X 2VF7A 3CCVB 3OFNA 1GRQA 1WF3A 2CVFA 3X1WA 2C77A 4B3FX 2QTFA 4C2UA 1OYYA 3LDAA 4URWR 3AF4A 1UAAA 3M0EA 4I1SA 2XXAA 1NDHA 2HT6A 5EP1A 2ZYTX 1BKDR 1QHNA 1FQJA 3CH4B 1SM4A 3FE2A 1QFZA 1ZUIA 1PUJA 4Q18A 5K8IA 2OK8A 2E87A 2WPDA 1J90A 5KPJA 1XD9A 3KB1A 4D0NA 3WYFA 3EIQA 4JKIA 2XJ4A 3L2OB 1BIFA 1B2RA 2QBYA 4A0FA 3RS5A 4EJSC 3CRVA 4FMDB 2JJ2D 3AVVA 2EW1A 2GK6A 3AVXA 1UKZA 4DUGA 4WZBE 4KVAA 1G5PA 2GAOA 4QBIA 3PIRA 3NBYC 3TNFA 3DM5A 1E0AA 2XB2A 4C0AC 1TPZA 3OESA 4LJ5A 3KQUA 2F43B 2RB4A 2XAUA 1GAQA 2V6JA 1VYTA 4KITB 5KNBA 1CQXA 3TAUA 4KODA 1FNDA 1X1SA 4ZIRB 1OKKD 1RPZA 2VP4A 4ASUA 2EWWA 3W3ZB 3T1VA 2DY1A 1W0KA 3ZZUA 4Q21A 4LJ6A 4XVQA 1VG0B 4JLAA 4M53A 1RE0A 2H1LA 2JDID 4G1UC 1XD2B 4JBXA 2EQBA 4ARZB 4TYPA 1UJ2A 2KE5A 5AUOB 4U7DA 4PHFA 3QEJA 2CEAA 3AVPA 1IXSB 4QL3A 2VQSA 4W5WA 2VSOA 3GPLA 3DZ8A 5JMTA 1CS4C 3BH7A 4NMMA 4RD3A 1E0JA 1E9SA 1HT1E 4HDOB 1T9HA 1E94E 2UVQA 1QHXA 2QE7A 2F55A 1R0YA 1COWA 2XNSA 1UFQA 1U98A 4ZV4A 5GJCA 1GOTA 1VG9B 1DG3A 1RKBA 3NKVA 2QRZA 1PJRA 1NMYA 3OEHD 3RS7A 1D2MA 4BGDA 4B76A 2JCSA 1Z47A 3SYNA 5A5GA 3SHWA 1BQEA 1VQ8B 5BN4A 3ADBA 3ZVLA 1MABA 3OAAD 3AM1A 4JLJA 4Q5IA 1FFHA 1TQ4A 4MRPA 3I8XA 1GJRA 3W6OA 1IM2A 4ZDJA 1CR0A 1GR1A 4L15A 2ONJA 2IX3A 4U5XA 3ZD7A 3AVUA 1W4RA 5HXBA 1HY3A 2FOLA 4E03A 2RHMA 2WVJA 1IHUA 4QOSA 4TYWA 3OW2B 2C8VA 1HTWA 3T5GA 3U6KA 4D2IA 1UKYA 4ESHA 1E2FA 1AQYA 1ZM2A 4DZZA 4FMCB 5HZKA 2CRVA 2ZJYA 1NIJA 5IDVA 3BAFA 3H86A 1YZGA 4D26A 1YVDA 1CXZA 5AJZA 4TYQA 1VQ5B 2AX4A 2JJ2A 3QBTA 4LJYA 2IS6A 3Q8XB 2DR3A 1N3BA 5TV2A 4GP6A 1W7AA 4IKEA 3NH6A 3CF2A 3FJOA 3E1SA 1OIVA 3BORA 3U7HB 2MSCB 3D3QA 1T3LA 3QG5A 2ZM5A 2ZS7A 2R6HA 4MYUA 5E4FA 3RC3A 1DO0A 4V02A 3EA5A 2QORA 1SKYE 1U8YA 3JZAA 4UJ3A 2FF7A 3GFOA 5CLQA 1GP2A 3SNHA 4LHVA 1G18A 4TMXA 3AKDA 1OXSC 4WXPA 4FWIB 3JQRA 1QUEA 1D2EA 2C9OA 4LYJA 4XVUA 5HR5A 2JDIA 4HATA 1NN3A 2DBYA 1JR3D 1MKYA 4OQNA 5AWFC 3FPAA 4NU0A 2Q21A 1KK2A 1MO4A 2Z43A 1Q3HA 3BE4A 5DE3A 1WBBA 1G16A 2F43A 2ZI7A 2XGJA 2VNJA 1AZSC 4KBFA 4G0NA 4FXPA 3AH8A 2FV8A 3K09A 2FPLA 1K6MA 4A0GA 4BPRA 2Z6VA 3U61B 4ZIRA 3ZDQA 1T91A 1Q57A 3RNLA 1JXOA 3P27A 5FUYA 4EFLA 4JBWA 2O52A 3ND9A 3AUYA 1E4YA 2QSZA 5BYJA 2ZAOA 3LVBA 1US8B 3W2EA 2ZI6A 3OEHA 2XTNA 4KFSA 3ZJYA 4BRWA 1WMSA 2ZE8A 5BQ5A 3U3KA 2IYRA 4GOXA 3OJXA 3ZYCA 5JFGA 1T5IA 4GOJA 3I55B 3CD6B 3OAAA 3K70C 1JA0A 3RRZA 1XD8A 3UWKA 1U90A 5KSYA 2XTZA 2P2LA 2ZRMA 1F20A 1Z6XA 1G8FA 2PCLA 5KNDA 2QSYA 1E0KA 3LRPA 2NZJA 2IA5A 2P65A 3GD7A 3WMEA 4R2HA 4EJSA 3AVTA 3BB4A 2ZYUX 1ELOA 1CJUC 3CPHA 2Z83A 1DVRA 2C5LA 2GZHA 3IPXA 2ZIAA 1CU1A 3MD0A 3LBHA 3O8RA 4IDHA 3KJGA 3W34A 3F3YA 3A8TA 1L7VC 3Q85A 3FFBA 5C4MA 4ZO4A 5C4GB 4TMKA 1F6BA 5EP2A 3PITA 1Z6YA 2BV3A 3K53A 4Q4HA 3ZVRA 5EXSA 1MOZA 4B2IA 3GEIA 1N25A 4IXMA 2KSQA 4D80A 3CBQA 1AS2A 1ZJ6A 2BF4A 2BVNA 4G5QA 2K5UA 1GRRA 1L2TA 3RWMB 3QQ5A 1XTKA 2ZITA 2E9SA 2UZIR 4DLRA 3D8BA 4Y9UA 4UXIA 2PZEA 1KDTA 1W44A 5CM9C 2BM0A 3VR4A 4PHGA 1ZAKA 1XTQA 5KNCA 1E9RA 1P9WA 2PLRA 4M9XA 3REGA 1Q0UA 3NVAA 2XZLA 1ZM7A 1W46A 3PEVA 3R8CA 4PQFA 2VO1A 2GHIA 1ZNYA 1JR3A 1E9AA 3AVQA 1E9DA 3GEHA 3MJHA 2I4IA 1NJGA 4GT1A 2D06A 4EPXA 1K73D 3PG5A 1ZC3A 2YZ2A 3K70D 2PEYA 2Y8EA 2FN4A 5G3ZA 2FFAA 2QRNA 1G21E 4EFNA 1N6OA 3BD9A 2HXYA 4OK5A 3L0SA 1N5KA 1E2MA 1DTSA 1YI2B 5JCZA 4Z1MD 1ZD1A 2A2ZA 1OXVA 3RVBA 2R6GA 4Q03A 4TZ0A 3NTUA 5SZHB 3JVUA 1XXHA 1EP3B 1QG0A 2DB3A 3KQNA 1XB2A 2WWXA 3I8SA 4DIDA 2NGRA 4PO8A 4FW9A 4HB3A 1A7JA 4DSOA 4LJ7A 2GJAA 4YHBA 1U9IC 1X6VA 1VQNB 4RVCA 1N6IA 3B9QA 2FA9A 4W7SA 2VRWA 1NY6A 2CMKA 3VMFA 4MUAA 4UNQA 1WQ1R 2Q0HA 3LV8A 3ZS9A 1HV8A 1NG1A 2XJ9A 1Q7YD 1XTSA 4G1VA 4QGHA 1XJQA 1RRFA 1XCMA 3ETLA 4HE5A 4YMWA 1XEXA 5CYPA 4Z51A 1TQ6A 3AF2A 2G83A 1LB1B 3X1DA 1QHHB 4KHZA 3PENA 4PX9A 5G53C 1OXXK 2O0HA 4Q7KA 5J4YA 2ZRIA 1UEJA 2UZ3A 2VLIA 2VH5R 3WHKA 4FINA 3MAAC 3W6NA 2HUPA 3RLFA 2WMOB 5F9FA 1OB5A 3K0AB 3GLGA 2IC5A 2VHUA 3BRWD 2LCFA 4QHSA 3X1YA 4DLYA 3CM0A 2DWOA 2VSFA 1DAGA 1FDRA 1O3YA 4JLVA 1KMHA 5TMPA 1CR1A 2HDNB 4LWZA 4FCTA 1QBKC 4EPYA 1R8SA 4OJQA 4RFSB 3V4FA 2Q3HA 2HT1A 1KO7A 4FD2A 3KQLA 4ERNA 3IIKA 3WNDA 4LRWA 1S0UA 1P9RA 3OIWA 3RAPR 2R62A 4E5UA 421PA 3IBGA 1R5BA 5FBLB 1N5LA 2ZYVX 3L8ZA 3GLIE 2V9PA 3LAWA 1JJVA 2WKQA 3S1AB 4WZAE 3LXXA 3A1WA 2NO9A 1G4AE 3RWOA 4LI0A 1GL9B 1Q3TA 3RS0A 2YKGA 4BLOA 2YYZA 1H85A 4QM7A 3HU3A 2WJVA 4G5GA 3K0FA 4DHEA 4UKDA 1C4OA 1R10A 4Z1MA 4PQRA 1OH5A 1N6PA 1YU9A 2IXFA 3TRFA 3CW2A 4HUQB 4HAWA 3IEUA 5K8UA 2FNAA 3K1JA 3QIAA 5H5JA 1JEEA 1ZBDA 1QG2A 2OCPA 5L3QB 4AF6A 1R0WA 4R9UC 4A0HA 2QY9A 2P5SA 3IHLA 1F2UB 4D6PA 2R9VA 5KUTA 3O8CA 4NTZA 3ZZ0A 1W47A 4RD0A 1N6NA 4NZYA 4ZPXA 2ZSEA 5FR1A 2QAGC 3FMOB 2IXEA 2J0VA 2R6CA 3QF4A 4JSYA 2QZ4A 3JQQA 5FL7D 3KKOA 3F5FA 1Q21A 1KC8D 4P31A 4PSAA 2OFOA 2PEZA 4LZZA 2ZANA 1XDBA 2PMKA 1XBTA 4PPQA 3IUYA 3I5XA 4KYIB 4Q7MB 1CKEA 2YC2C 1D9XA 3NDBB 1KO1A 1OV4A 5FTLA 1W5TA 3VO1A 4EH1A 3QKTA 1A5TA 4PANA 4QBGB 4BZXA 1CJVC 1N0VC 2ATVA 4RD2A 2YWEA 1RVDA 2YV5A 4XIGS 3UWOA 4N3GA 1C1YA 2BKUA 1J70A 2IWRA 2W0SA 3NWJA 2WWGA 4HAYA 2ZEJA 5CK5A 4GDFA 2ZAMA 4BFSA 2IUUA 3EIHA 1E79D 3D31A 2EFGA 2X2FA 2QTVB 1UADA 2EYQA 1Z6AA 3QKRA 4OK6A 1G8GA 2J5XA 1W4BA 5LBIA 1IN5A 2QAGB 4HLQB 1BYIA 1DADA 2D3WA 1II0A 1OIXA 4W5HA 4DCNA 4ZKDA 2I3BA 1FZQA 3OZXA 5EE0A 3K0AA 3WRXC 1LS6A 5JJIA 1KYIA 5JZVA 3SJCA 2ORWA 4KI0A 5HE8A 1K9MD 2O8BB 3M6AA 4M0LA 4Q1FA 5D3QA 1KAGA 4AK9A 3WRYC 1XRJA 3PUYA 1U0LA 4TL9A 1U9IA 2ZRGA 4DQKA 1T8UA 2WSSD 4OKSA 5CB8A 3R9IA 5DH9A 1SVWA 3SC3A 1MH1A 2ZVPX 4AWXA 2LWIA 4NHOA 1NMZA 2VP5A 2WJJA 2F1JA 1GO2A 2CXXA 1GKIA 1ZNXA 2HLDD 1ZIOA 1ZCBA 4JT4A 4MGKR 4F92B 3S1AA 2BJWA 1U99A 1P6XA 3EWAA 2YWFA 4IDQA 4ZGQB 2D7DA 3E20A 2ZRPA 1BX1A 3AQ4A 4IHQA 2IYSA 3R8FA 4C0QC 1XZQA 3GLIB 1S8FA 1F48A 4B3CA 5BYKA 4IDOA 1PVOA 2REBA 3LBNA 3Q5DA 3UPUA 2R65A 2W6JD 1KKMA 5FL7A 4LYHA 2GWHA 3W2IA 1GNRA 4HUQA 3SE0A 1TEXA 1JA1A 1QGYA 4QHYA 4GI7A 1CR4A 4A8JC 121PA 5TDHA 2A30A 2BHRA 5JBQA 2ZRNA 4FMBB 3CO5A 5L3QA 5D3MB 2GJ8A 3HU1A 5C46F 1F60A 1AGPA 1EFTA 1VYUA 3KUCA 4G5SA 3CC7B 1EP1B 1F2UA 1RRGA 1ESNA 1LF5A 1KSJA 4WA7A 4A4DA 3A4LA 4OI1A 4NCNA 4ZCIA 1W35A 1G3UA 3TSWA 3ZQ6A 3W2HA 1OFTA 2CLDX 4LHYA 3GP8A 1S9DA 2G1JA 2NOAA 4U9UA 1E9EA 1R5OA 1T3SA 2GDJA 2AD5A 1AKEA 2RHDA 4IEEA 4F38A 1E79A 2O5VA 1DARA 1TADA 4V0MA 4XSHA 5DSZA 1A2KC 1UBEA 1CRQA 5CK4A 3I3SR 3UG6A 3T34A 4C0SA 2ZSDA 3N70A 5GJBA 2ZI5A 4WVFA 4URXR 2JLZA 5KSOA 2OESA 3VHXA 3MSXA 2F1IA 4TL6A 4XSGA 4A8JB 4CZ2A 4IJMA 4AKGA 3LW8A 4XTRA 4ZKEA 3EW9A 2NO0A 2OLJA 1U81A 4QGAA 5JRJA 1MR3F 2IYLD 2CJWB 3TW4A 1ODFA 2WKPA 3UATA 4MUBA 2FFQA 3EPHA 2WSSA 4OQFA 5B30A 1EFUA 2PMDA 2VL7A 4C0JA 3QKUA 5JI2E 3WBJA 2QAGA 4I81A 2QMOA 3FOZA 2XXAB 2CCJA
chains in the Genus database with same CATH superfamily
3ZWOA 1QIDA 3IJRA 4JJIA 1N6LA 3V9AA 3F8TA 4Z4CA 4DMUB 4D6XA 4AXBA 1T1GA 2G5CA 2PR2A 1YZNA 2R6DA 3Q7QA 3DAYA 4AF7A 5K3BA 1T2EA 2B61A 4P9NA 5ENVA 1PEKE 5CITA 2F3RA 4YV7A 2QBYB 3U39A 3GRFA 5GVRA 1WO8A 3UGTA 4ISBA 3UHJA 1PYOA 4BLSA 4CMGA 1T10A 1WOMA 2AG6A 2QUZA 4ZMBA 1Z7GA 1N05A 3IQXA 5KTRA 2BFFB 1OZFA 4KPYA 4EB0A 4LE0A 2KMLA 1Z28A 2WMDA 4IO1A 1OZ0A 3E0XA 3B38A 1YIJB 4L8VA 2RAVA 5JWOA 4RHUA 5DLPA 2QK4A 3NBQA 1JG1A 3ESZA 4TM8A 2HIAA 3O7WA 4NG4A 2ZJAA 3PHIA 2QJOA 3ZK9A 4ND5A 3U4CA 1N2HA 2GCIA 2I4TA 3EIEA 2X5JO 4XR9A 3UK2A 1H3FA 2BDTA 1Y5RA 4L0QA 4M8IA 4QUZA 1HLFA 5U9CA 1SK8A 2R7MA 3HO6A 5EZSA 3ZBTA 1A9ZA 5CLIA 4CR7A 5M34A 2HSZA 4BVGA 4HYYA 3BGDA 3DKKA 3BC9A 3HVIA 1I8DA 2GHTA 3EMDA 4OXXA 5ALTA 5IJ9A 1CBUA 1GV1A 3COWA 3DDSA 3IB6A 5F2OA 1RWBA 3UM9A 3WKAA 3WRXA 5C35A 5JSZB 4N0DA 4WCVA 2ZCJA 3VKHA 2R8BA 3T7KA 2WP8J 5I7AA 2PS0A 4BECA 1BU5A 3KDSE 4M86A 1E61A 3J81A 3ZV5A 3ZWBA 4PFSA 4TM7A 1KE2A 3PUXA 4J07A 1W0JD 4BFZA 4DR5B 1ECGA 3LXRA 4Q4JA 1KIFA 2ETXA 5AVSA 5HZMA 1RCTE 4RJKA 1MAHA 4ZEXA 1JG4A 2ZUTA 1A71A 3HACA 2PGNA 3CEAA 2XUJA 1L4KA 1KY2A 3FSRA 1Z6TA 1IY9A 3OTIA 4HQKA 4XX0A 1W30A 3WP1B 3EPKA 3STVA 2WU4A 5J35A 2L69A 4QOJA 1C4KA 4FDUA 1AN9A 3K9FC 3U5ZB 1PSZA 1W1IA 1VLVA 2WM3A 3L77A 4IUCS 3RW9A 2GX6A 3DBHA 3DZFA 4UQLA 1YOVA 3OMXA 4X3PA 4PAQA 5A7FA 1KMIY 3E23A 3ESCA 5ELMA 3GLQA 1PRYA 1PVVA 2J87A 3WFJA 3ADCA 1FYXA 2BMEA 2C0CA 3GGOA 3D7RA 2YV2A 1AXEA 1N2ZA 1YQTA 4BP3A 3LLMA 2C58A 2EFDB 5BRAA 4CGYA 4DCGA 1T1SA 1K97A 2NUBA 3LBFA 3T4XA 3L8CA 2HGSA 3GJRA 4EG3A 5L95A 1GSAA 1T8YA 3E5MA 2WAOA 2WP0A 3MWEB 4JOBA 4OEHA 3R7FA 3ZZMA 3PTAA 4LHSA 2HLHA 3ROPA 2VA9A 4D4IA 5CB4A 3PUJA 1NMXA 2FFBA 4DBVO 3OKCA 3MJRA 5IS2A 3QV2A 2J59A 3JQ7A 3PEWA 3IQIX 3ASTA 1MX3A 1ONOA 3C4VA 1H2HA 3FPCA 4NMWA 5GP1A 3SBOA 4P5DA 3UC9A 4AP9A 1Z0KA 4BC0A 3QWHA 3VVCA 5BR7A 3HS3A 1P7PA 5L46A 2IT1A 1CUAA 2FX3A 1NUHA 1UFOA 3A6JA 1XO1A 3CLVA 4IGKA 2ZUFA 2WWWA 3W1EA 3LRXA 1PZEA 2IDJA 4RPBA 2R85A 3W9YA 1RNLA 4WL0A 3L6RA 3QXGA 5SZIA 3UTCA 4EPTA 3V46A 4C0WA 1B3BA 2C04A 2BGMA 1FP7A 2J0UA 2RGNC 1G6Q1 4PLZA 2G1UA 2HRCA 2QKYA 1VHJA 5B6JA 3U44B 4XLCA 1SUAA 2JFZA 4UCFA 2GYWA 5DXJA 2GTIA 1ACLA 4EA8A 1IY2A 1IIBA 1T2AA 3N05A 4DDHA 1CZHA 5TQVA 3FOEC 3VKWA 4E1VA 3F7MA 2VG8A 2H4HA 3H1TA 2GBLC 1EBBA 2VF8A 1N8TA 4WCDA 3LKDA 4GE3A 2IHNA 1YTLA 1G17A 2UUBB 1Y6ZA 2R97A 3ZJTA 3UJDA 1D1TA 4CF3A 4CV2A 4X06A 1BXRA 1BEUB 1EXNA 1LQTA 1UBFA 4HR7A 4K6KA 4I3HA 3TD9A 4PC2A 1RI5A 2PBLA 3R3JA 1KKUA 3B5JA 4ZAZA 2O8FA 3H84A 4U0KA 1W0JA 3MRSA 4UHEA 3QE2A 3OWHA 3IMKA 4OD0A 4LXTA 2D6FA 3PZBA 4EKYA 2H31A 1CRPA 4AIIA 2AUTA 3FNIA 4M9CA 4RGVA 4WWHA 5TQ0B 3F90A 2RGCA 2HPVA 1T9GS 3AIMA 4JEHA 1CY6A 4L8FA 1B73A 3EGWA 5EWMA 3RYHB 4YA6A 2PCJA 3E9ZA 1XMPA 2QX7A 2GQ0A 1VL6A 1GTJ1 1JDTA 2AK3A 3W5CA 1RRVA 3BDVA 3FROA 3X1MA 1T3HA 3ZEAA 3THXA 4EGCB 1N5IA 2XW6A 2B5OA 2ZYIA 5FOXA 3NAZA 3TLCA 3LT1A 4HQNA 3VX4A 4A27A 3HJAA 4EJSB 2RGUA 4KLAA 4XPIA 4BO1A 1RU3A 2XX3A 1U8EA 3OQBA 5TIIA 5E7QA 4UM9D 3T6KA 1YZKA 4WDRA 3WV5A 4HE6A 3IRVA 2J3MA 1I2DA 3PYMA 4UAJA 1M6EX 1QGED 3NOQA 3S27A 4E4RA 1NASA 5IWAB 3RVOA 4C7OB 3EEFA 1JPUA 4OHPA 3M4JA 4JOSA 5CPFA 3L7YA 3ZTTA 4GW3A 3MHPA 3AQIA 2OQRA 1T8SA 3K2EA 3NRCA 2ZULA 4I4NA 4RF3A 4Q4HB 1PFKA 1RKQA 1FRNA 2ECPA 1HUQA 4WNAB 3VSCA 1N0WA 2GFHA 2Y77A 1EI9A 2ZSUA 5HM6A 2PXHA 3KVNA 4PC7A 1BDBA 4R68A 4DDUA 3AF1A 3KB2A 1R6XA 2WK1A 5CVEA 3O2QB 3U4IA 7ABPA 1JQKA 1NLYA 5CDFA 4KVZA 2CXQA 4PO3X 3JCZA 3AJDA 3LZCA 3M3HA 4ROTA 3H2BA 4YAEA 4BNLA 4DLNA 1XMVA 4G36A 1MB3A 1UXGA 2X58A 3BA6A 3FYTA 5EMJA 2ZXEA 1YGPA 2OZLA 5LZ7A 3R5XA 4J8PA 1NL3A 1KSGA 4QT0A 3I6QA 5DN9A 1ZPDA 3S28A 5FL3A 2XOKD 4BAGA 2QY6A 3TB6A 2OG2A 3D1VA 3K9QO 1E6WA 1XRMA 1O9BA 2Q3JA 2G1PA 3T7AA 1E3EA 1TO1E 1OHHD 3PUIA 4PSUA 4UNIA 3X1XA 5M5BA 3P9YA 1VIAA 1QIHA 2VAPA 1K75A 1MJGM 1XTPA 5LP1A 2JBAB 3R3SA 4CWAA 1YZHA 1WXGA 3BWEA 2A86A 2OBXA 4XOTA 1LDYA 3B1XA 1V41E 3CT4A 3T53B 4HP8A 2QX6A 1KMQA 3SIXA 1KZ7B 1UBMS 2X19A 1L5NA 3K4QA 2J45A 2J9XB 1SEVA 3SHQA 1VPEA 2GWRA 4PZAA 3R7NA 3JARA 3AEUB 3Q7EA 1GWNA 2ZREA 4WRRA 1OOEA 1SOUA 2DJIA 4G41A 4DMGA 2GPYA 3E9NA 2OXCA 5GONB 4C4AA 1YULA 4M9SA 2CZQA 3L04A 1IZYA 1OWMA 2JIRA 2LGJA 2JGDA 3PRJA 3JYPA 2ZP1A 1WSBA 4TS1A 3TZLA 1N2BA 4RJIA 1NYLA 1EVQA 1OH6A 3KJHA 4HI0E 1RQNA 3DVAA 4O2RA 4KWEA 3SD7A 1XAGA 4BNFA 2HJ9A 2LZ0A 4QDJA 1P5FA 2GBIA 3PFBA 4HWGA 3ZU5A 2IYTA 2X6QA 2XWSA 4KPUA 5IM4A 1Y1KE 9LDTA 3WTBA 4GHWA 5HW0A 2ONKA 3TSOA 1SA0B 3EQ8A 2PQ6A 4XQ0A 4M0FA 1YIDA 4POOA 1BH6A 1EZ1A 3HEMA 3LX6A 4R8RA 3WGLA 4CU2A 1BHSA 2HSGA 3KZNA 4JP1A 3JQCA 4CUJA 2RGNA 1CY2A 3G2LA 2D5CA 4EZEA 1RI4A 2ZCUA 5TJ9A 3FR8A 2YINC 4JVSB 4GSYA 3ASUA 2L0XA 3VOBA 4MV7A 5LNK6 1DG1G 4IUYA 3PNLA 4O8CA 3UB4A 2V1XA 4CEIA 3PQ4A 1PGJA 3HRHA 3I9MA 4PICA 3C3XA 2PQ0A 3LXUX 4JJZA 1PR0A 4HRXA 2GBLA 3VYWA 2IZ0A 3TLZA 3VI3B 1THZA 4XLZA 3GLGB 1Y82A 2WTBA 3AEKA 1M2OA 3CX6A 1A88A 3D7MA 2YJ4A 3EXEA 3VR0A 1EVYA 1FUUA 1MQSA 1SKUA 5B36A 1S9HA 2GA8A 4HDRA 4LQ4A 1GPMA 3OOJA 4B79A 2XZTA 3PRYA 5AFSA 3EBOA 1U5CA 3U3ZA 2PGXA 1BD4A 1CJKC 3ILSA 1XZLA 5FV7A 2IYWA 2XOKA 1KI3A 1ODSA 3CCLB 3EF3A 5EL0A 3NWBA 4C08A 4ZO6A 3UJ3X 3K9GA 4G09A 4QPNA 2AOUA 3WWZA 4D0RA 4XQ9A 3H5OA 3A9WA 3EJWA 3JWPA 1OHHA 3MJVA 3L7CA 5DX0A 4DWVA 5CXSA 3UFXA 2WLSA 3HVKA 3H04A 2R6FA 2XTJA 4TLCA 1DFIA 2WJYA 2A1TS 1LY1A 4FOTA 3MYRA 4Z4IA 4C30A 3SQNA 3DM9B 2DERA 4D44A 3K70B 4ENRA 1C9NA 4X1YA 2HJWA 1QHGA 2JGIA 5A3QA 2H2GA 3PXXA 4KQHA 3UV3A 1WV1A 5ESDA 5HQJA 4OAPA 1EQ2A 2D5LA 1JBKA 3BFKA 2IPLA 1DUSA 2EBUA 4PRZA 4TKZA 4NV3A 1O95C 3GR6A 4UNPA 3W2TA 4F9TA 1I80A 4M88A 1V8PA 2CK3D 2Q1SA 4FJ1A 5B58C 3NV7A 1Y3IA 3QVVA 5ISMA 2WMNB 4D46A 3PJGA 3AF3A 5EJ9A 3AUXA 3TIGA 3ED5A 4IOKA 1XYGA 4MVCA 4B40A 5JAPA 3IALA 1MT3A 3D6MA 4CF7A 5JNUA 5FA6A 1C9EA 4CTKA 3O0DA 4BNZA 2GF2A 2F90A 2PM8A 4PG6A 3T3MB 3R44A 4ZC8A 1XFAA 3QI2A 2AOTA 8GPBA 4K1XA 2WOOA 3KEMA 4FHEA 4HUTA 3EVFA 2GCOA 5K2OA 2QI9C 3DLBA 1TCUA 3BUSA 4A2QA 1X1BA 2I2XB 3AWIA 3QYFA 4PEVA 4HNVA 4Y9RA 4EG1A 3IA7A 1CDDA 3QVUA 4HQ0A 4ZOAA 3ES9A 1EK5A 2PKEA 4V0ME 4EF6A 1X7HA 1UWLA 1J20A 1CY4A 2QQGA 4GRAA 4MX8A 2QG6A 1WB9A 2VXBA 4TTSA 4CEHA 4OHVA 1GGJA 1DLIA 1P5JA 3GMDA 4AKSA 2V5AA 1E2IA 2B4KA 3QOWA 2FMFA 1MOSA 2CYBA 3VC1A 1KH1A 4CGZA 4X0EA 1LBHA 3IMGA 5E8JA 3JASB 5LA6B 1N1GA 4Z5XA 2OHOA 2QHXA 3KT0A 4MJ3A 5JI3E 2FWIA 3AMVA 3D6TB 1KQNA 3KYCA 4JLDA 1Z83A 5DYGA 5L3VA 1N9KA 5E2IA 2XQGA 3VXKA 4YRRA 4JBGA 4IJQA 3Q3JB 4YP7A 3F47A 3T1NA 4FYMA 1GT91 2ZTVA 2Y92A 1EKXA 5K0FA 4BLQA 4CT0A 4ZN6A 1T5DX 4KRGA 1MJNA 4Q4DA 4N8DA 4RHEA 3TAHA 1CQJB 4AURA 1U1GA 1IL0A 4S3MA 3L43A 4MDYA 5ADHA 5CIYA 3EVEA 3PCRB 2VJBA 3L82B 1B23P 5IRCD 4V1CB 1X7YA 2NVOA 4KJZA 1CTQA 4P25A 1O95D 3PLRA 1JSXA 5KNBH 1SHJA 1ZIYA 1FW8A 3FPGA 4W63A 2YRWA 3WK9A 3OI7A 2O8CA 1FUEA 1QX3A 2AN9A 2OZVA 2E5WA 3S40A 1YQWA 4I1YA 4ZYYA 1TZBA 4NH0A 5G4LA 2G88A 1DU4A 1JU3A 2WYRA 3C5CA 3DD1A 4AWBA 3ZD8A 2I6FA 1QPGA 2GPNA 2UYOA 3IR6A 4PY2A 4EHAA 4IS3A 1F8YA 3DFUA 1E6LA 1HFWA 2ABWA 2DBQA 3RYTC 1LI5A 1QYVA 3RS3A 2CK3A 5FV4A 5IVHA 1AURA 4J0CA 4I4CA 1CVIA 1MC8A 2GMWA 5ITZA 3ZVKA 3IIIA 4ETNA 2O20A 1P91A 1MOQA 1TUEA 1QG6A 4PHHA 1JH8A 3VU0A 3VTFA 1H8HD 4HH4A 5H9VA 1OYVA 2O4CA 5C5IA 1AGRA 3MWGA 5CB4F 1L7BA 3UCEA 2ZRKA 4YT5A 2H5EA 4DLZA 2YFHA 1Q84A 3C3KA 1AZLA 4L75A 1P7ZA 2Q3FA 5HIKA 2QYTA 3BKWA 4NOKA 2QMZA 4PZYA 4W99A 1JSCA 3FSEA 1L5GB 4BVHA 3SY8A 1AJEA 4ZCMA 2PJZA 4MWSA 3C3EA 1PQWA 2F1OA 3W4IA 4LK2A 1P2SA 3USZA 5BPFA 2FHPA 5FFMA 2H29A 1KQPA 1SVSA 4ZHQB 3AI7A 1LA2A 4X64B 1DJMA 1A2OA 4G24A 1KFBB 1RM3A 2R1ZA 4PGAA 5C52B 2GPTA 3H5TA 4A5OA 1E7RA 3QX8A 2OEPA 4TKLA 2W8BB 1I4LD 3ETGA 2IU6A 4B48A 4BMPB 4H35A 1FMFA 3SR4A 2HSJA 3OZVA 1E59A 1YACA 1TFRA 1WA5A 4HZUA 1N0UA 1V39A 3RUFA 1A9TA 1UZMA 1XE3A 3FVTA 1XXLA 4P6VF 1YJCA 4YP1A 2ILTA 1GAJA 3LQQA 1DXOA 1S2IA 3QUSA 2Y2VA 3PFFA 4LOIA 4E1AA 2VQFB 1C0IA 1YOBA 2YOHA 1YBAA 1J2TA 1I2ZA 1KBZA 2P9HA 2WLTA 2YW2A 3B70A 3OZFA 3QKSA 3SQDA 5CB0A 5LZ2A 3S1SA 2X0EA 1QGOA 1JFVA 2BFDB 3C48A 2Q6KA 5IUNC 2WFZA 4HMQA 5C4IA 1DLJA 1JQBA 3EIXA 3R41A 4KW7A 2IDKA 2IY7A 4JOQA 4J0GA 4C29A 3DLAA 3K0CC 3TRDA 2JJMA 2QRMA 4AD8A 1V96A 4DXHA 3VR6D 4II7A 3KSMA 2KVOA 2VQ6A 2YVLA 3BRWA 3KU4A 4JL8A 1NGSA 3S2YA 1QE3A 4AMUA 1TZJA 4LS3A 4EX7A 4LBVA 2SBTA 3CONA 4GC9A 5IVPA 4NPHA 4KFUA 2ZZEA 1Y6FA 3O4IA 4D0LB 1OGJA 2INGX 2QRHA 2HYDA 3I39X 1GG2A 4Z4TA 1OXUA 1ZWKA 2EBWA 4NCKA 3EC1A 5IN4A 4MVJE 1G5FA 1QO9A 5IKPA 1NN0A 4D42A 1EAYA 4ZRNA 3KVOA 2BEVA 4FE3A 3WNZA 3Q9NA 1LNZA 1YB4A 3VR5D 3EVGA 4YMUA 1IPEA 4MVWA 4RXMA 4ZVMA 2HI0A 2QMYA 5CTJA 4L4ZA 1TQDA 4R1LA 4TUYB 4JI7B 4G8JA 4JB0A 4H4DA 2IOFK 2ISCA 3BIFA 5DT2A 3TW8B 1H8HA 2X8AA 2RHLA 1BYUA 3STXA 4HWPA 3C7CB 5JSYA 4L5YA 4Q1CA 4MTCA 4TZKA 1Y4AE 4HBZA 1T26A 4HEHA 4YMSA 2REOA 5CRIA 3X2SA 1ORIA 3BEOA 4BB5A 5JDIC 3QKWA 3DMPA 1U0TA 1WCIB 4IG4A 1P2DA 2HF9A 1TKRA 4QAJA 4JEUA 4MP6A 5EJ8A 4ZT3A 1AQUA 5AW2A 5BMOA 4EEKA 3FZQA 1ZN9A 5KNDH 3CUYA 2WJIA 1A5BB 4MS1A 3GLFB 1NW7A 4IJ5A 3LE8A 2B9VA 3QYPA 3PC3A 3S0JA 5BNWA 3ORYA 1G3QA 3QVLA 1XAIA 1X1QA 1R0ZA 4REOA 4E13A 2FZKA 5EXPA 2I1VB 3KL2A 2ZRBA 1VKNA 2CDCA 4C78A 3LPMA 3IT0A 4QZVA 4B5KA 3AL3A 3CUKA 3QFRA 2NU9B 3WKEA 1DDOA 2WVAA 5C0OE 3H2SA 3MVEA 1P1HA 1UK8A 5DF1A 2AKYA 3G23A 4YX9A 2C57A 3P4UA 4DLLA 4JT2A 4LV5B 1ZFNA 2VDUE 2QMHA 1JVNA 1WCWA 4LZOA 2P8JA 1V6CA 5HCIA 2JEOA 3H0EA 1KC3A 1V1RA 2ZLBA 1U6JA 5CA0A 4RD4A 1DINA 4IW3B 2WD9A 4EKEA 5BSWA 5FDFA 5J2TA 3G7SA 2PGLA 2Z0MA 3CSSA 5A6VA 3AEYA 2FG7C 6AT1A 2Q1XA 3A6HA 4ILKA 4ENPA 4Q1DA 4M4SA 2EWMA 4N82A 4UOZA 2ZYRA 1E5TA 2V9ZA 3LDHA 5KOJB 1H4VB 2PH1A 3RKRA 1VHLA 1YC2A 3A31A 5DNUA 1Q77A 3VR6A 2ZBRA 3ZV7A 1PZHA 4NYJQ 5ALIA 3URMA 4NQZA 5A4FS 5KWSA 1PT9A 4US1R 5E6SA 2W2LD 4OYYA 2FMXA 4G1BA 5J2UB 2UXDB 1LLQA 3B3JA 2FY8A 4O4IA 4MEAA 4WHMA 4NNJA 1DIAA 5EE3A 3TO5A 2YZ7A 4B43A 2HGZA 1NLMA 1GXSB 3FX2A 2NUAA 4ZQGA 4ZEVA 1EWQA 3B7GA 2F3TA 3R9KA 3ZXSA 1MRNA 1QQ7A 3BH0A 2G5GX 4HLDA 5A4AA 5JZOA 1RC1A 3B9BA 1KEKA 4HGPA 1HNWB 3WA6A 1U0RA 3LA8A 1G2IA 3VR5A 1L5ZA 4QLAA 3MQ4A 4XYMA 3WFZA 1QV7A 2VDPB 5BR4A 3PRHA 3I76A 5EEGA 2OE2A 5FTNA 2BWJA 1F17A 1E2EA 1NSTA 3BHJA 3E9YA 2FDRA 3G8AA 2BKXA 4FCWA 1Z16A 4MVJP 4TS3A 2ZQ5A 3ZHSA 3AM3A 1ZGAA 2QLFA 3ABQB 1M1NA 3UJHA 5JJBA 4ZAFA 1ECLA 5AJVB 2C7BA 3Q6QA 1Z0UA 2XTMA 2LV8A 3UMYA 4ZAWA 1KU0A 1EVJA 3DLIA 3OLZA 4QOHA 4M89A 1SUIA 3N8HA 1GTVA 5IX8A 1AMUA 2CLEB 2HK6A 3N0XA 1FX1A 2JAWA 3BD6A 1BOFA 2WU8A 4Z4QA 4NENA 1POWA 1VMDA 1PHRA 3K5WA 1Z63A 1GNTA 2OP1A 2P4EA 3OZCA 1IEXA 2CNWD 3V1YA 3CTAA 1E32A 3P4YA 4UQPA 1PSDA 2KLBA 3NV9A 2JG3A 1ST2A 2HEIA 2IDMA 3HXLA 2O1WA 3JVVA 4IJWA 4CVNA 2FR8C 3K8YA 3DTVD 2O50A 2JZOA 3CQ9A 3QELB 2JLYA 3VR1A 5TRTA 3V2UA 2W4MA 3K0CA 4G9GA 1RT9A 4WBXC 2VTKA 3SDZA 4URZR 3F4KA 3W0LB 2ZTGA 4PW0A 3U3OA 1FFXB 3LIPA 2XNDD 3AHIA 4LUCA 3VMMA 2CUTA 2OCKA 3EMBA 3HGQA 3P2IA 3R2JA 5JH7B 2DHRA 4J0KA 1H2ZA 5NULA 4Q3OA 4CM4B 5ELXA 3PGXA 2JA2A 1CWUA 1JKJB 1ZU4A 5E2AA 2P3MA 3FPKA 1KHHA 1NC3A 3UHAA 1JS1X 2BZ0A 4HAUA 4YAOA 4W5RA 2WG1A 4IH1A 3CCJB 3AFHA 2O48X 3KYDB 2YFYA 4HXEB 1VKZA 3UVEA 4X7CA 4CDNA 4OP3A 1AN0A 1OBFO 1Z26A 3VH3A 2ZIGA 3WKDA 2HCJB 3G0CA 2F3QA 2JAPA 1WIWA 1Y8AA 2Y1FA 4I6JA 1KO4A 3KT8A 4R2WA 1MV8A 2W2LA 5SYNA 3N8KA 5KYYB 1Q86D 4ZU1X 3V4ZA 4HHEA 5BNTA 3P2MA 3R0JA 4RKQA 3IEMA 2EDCA 2CKDA 4TKVA 1W5SA 4WFIA 4QBTA 5EHNA 4IVQA 4CLDA 5JYCA 2WHQA 3NAGA 3JAWA 4IIVA 4IRUB 4DDWA 4KIGA 3L01A 1NXSA 4BNIA 2J31A 1YB2A 3F8SA 4L8GA 3LBAA 3WBKA 1EX1A 3CSDA 3UHPA 5EMNA 2OKGA 2JGNA 3K72B 4TSFD 5JDIA 2IWHA 4ZK2A 1A8PA 5I3CA 4N40A 1I33A 4AY4A 4BPBA 1ZINA 3PKIA 4JI0B 2ZRHA 4RVFA 1N2JA 3ZWYA 3TGLA 3ISXA 1T1RA 2J7KA 4WZAA 3PV0A 1H9BA 4W5OA 2C61A 4URYR 4ZYLA 1NBWB 2FLKA 1VIYA 2WSIA 4OL9A 1HETA 1SVLA 3FTQA 1DS6A 3PWKA 4NMHA 4MHSA 3RROA 4QGSA 2D8MA 2NQ2C 2AIRA 4P9SA 1Y6GA 1FMCA 1W6UA 2ZYDA 2GEKA 3EDCA 3RIHA 3X2EA 1JR4A 1NVVR 2J33A 5FBVB 2EKPA 3BT7A 1XTJA 4KRXA 1O57A 3FPHA 3GUZA 2ZYAA 4H08A 1X15A 1V5WA 4MI3A 1ZHOA 3KHSA 4QV2A 1S96A 1SIOA 4M1QA 5JMOA 5REQA 2ZZQA 5LCXA 4D0GA 3D6NB 1MH9A 5A7HA 2EGGA 2HBYA 4DIUA 1Q44A 2CNWA 4COKA 1TCBA 2QTNA 3AJRA 3OIFA 1UMCB 2ERCA 4UEJA 4BNMA 1UKAA 3LK6A 3QNMA 4FFRA 5D3ZA 4BASA 2FETA 5B3JC 1KPIA 5AVQA 2VRNA 1TM5E 3PHLA 2NO1A 4I9UA 2ERXA 3SLDA 2ZL6A 2NSJA 3DTVA 1FJ2A 4GR4A 4OUDB 3SF8B 3V7FA 1X7ZA 2FJ0A 4ZCQA 1SBYA 2VUHB 4AVYA 4B6JA 3AR4A 2ID4A 2QMQA 3DE7X 1QH1A 4JSTA 2LIPA 3L0PA 2JARA 3WI7A 3R9XB 1VKJA 4BGEA 2IEAA 4W8OA 3M9XA 2XNDA 3CPEA 3FCXA 1TK2A 2FZEA 2K4MA 3KR0A 4TV9F 3DHNA 3L46A 4F6CA 4CM1A 3RTGA 2FZLA 5E1OA 4I4IA 3W6PA 3A3GA 4KQCA 1JG6A 3KV1A 3GZJA 1LCIA 1QNLA 4UE3S 3UAVA 4CZ2A 5AW0A 4PZLA 4LF8B 1QG4A 2ZIFA 3B78A 4XQFA 2YS7A 3LMKA 3MERA 4V0NA 1Q82D 2QLJA 3AW9A 5AJUA 2GCEA 2ZJZA 4RQUA 3ECCA 3UFBA 5L40A 3C8DA 3GXOA 1XXHE 3PR1A 4HO1X 4KK4A 4ZXPA 3VHLB 5K3OA 4QSHA 3GDGA 4J0IA 2WSYB 4PLVA 4L9WA 3WXBA 1SU7A 2O5CA 3HBJA 4G0VA 1Q92A 1WULS 3G2IA 1VQKB 1VQ7B 1HLDA 3Q11A 5CW2A 2O3TA 4R1OA 4A2PA 3AP1A 2I71A 2PX2A 3CXRA 2VNKA 5EZ5A 2G9NA 3TGPA 3LSYA 2WU0A 5AI8A 1BFKA 1J1ZA 4G0WA 1AHHA 4KX3A 4AQYB 3V7NA 1HKUA 4GKBA 1FYDA 2VCEA 4JU9A 4TSFA 1F1JA 5LDDC 5EQDA 2VJYA 2RC6A 5KAPA 1DQPA 2ZJ6A 5JJCA 1CP3A 1J33A 1PR5A 1TYZA 3KSZO 3DOOA 1VC2A 2O1EA 3KP1A 4RZIA 4TRMA 1PKEA 3A6PC 1VIVA 3IEKA 3ZD6A 3P0EA 3DS8A 1SJ9A 5KZMB 4FNMA 3LF2A 2IJGX 1P2BA 2J3IA 3DL2A 3L7IA 3OPVA 4HYTA 2OPHA 2GARA 4EGFA 3DJFA 3KQPA 1EVLA 3BILA 3EVTA 4BJ1A 4HFRA 3EOAI 1BG6A 1G7RA 1E2KA 3R3XA 4WIAA 3V42A 2AL7A 5LN1A 2G4CA 2N46A 1G2OA 1GD1O 3H1BA 3LOQA 4P32A 3FLMA 5FAXA 1WOOA 1HYHA 4P7FA 4F4CA 2GJKA 2NZ2A 4FFSA 3UWMA 2V3CC 2FN3A 3PP8A 5H70A 3LC2O 3WL7A 5CYGA 3AX6A 2OAP1 2K7FA 1FLVA 5ENZA 1FS5A 5IUJC 3V8BA 3ZXUB 3BFXA 3DAHA 5CEEA 4RZ2A 4KKUA 5CIQA 4EMSA 2HNKA 1BHQ1 3JD4A 3R5KA 1UMBB 1K86A 3LLCA 1K3FA 1YQEA 2J5KA 1M8PA 1GKYA 3ZCSA 4BNXA 3KR2A 4KDCA 1NF9A 1IONA 3CKYA 2WKRA 2C5GA 4OXYA 1EZZA 4XLEA 1TZKA 3GP3A 4M21A 2M98A 3F2VA 2ZZMA 3QYJA 3OIYA 1NV9A 4EY5A 4YQEA 3RRFA 4ND6A 1O5OA 1T2VA 2QTBA 4X8HA 1YZUA 1JLLB 2VDRB 2HFKA 3R7WA 1R8YA 1NUPA 3A2KA 1I3KA 1LSJA 1J5EB 1HDZA 1FPMA 2H1OA 4OHKA 4UDYX 5M29A 1FNNA 2NT4A 4EW2A 4F11A 1LNSA 4H4EA 2J9RA 4V0KA 4LC1A 5DNAA 3TSZA 4RPJA 4N5NA 1FRVA 2VDWA 1AT1A 3OEED 4K05A 3GLVA 4MIOA 3EXG1 4X84A 1NVAA 2H57A 2C96A 3FNRA 4LDZA 4LYAA 1PR2A 2XWBF 2CCKA 3LC0A 4M9UA 4B7AA 2Y1WA 4YQZA 3WLMA 2H9AA 3PFNA 4UZUA 4B44A 2A3RA 2HHAA 4Y1RA 2OVBA 4DCPA 2QI9F 1HWYA 1KI1A 2J0EA 4AMBA 1TYEB 3TQTA 3EXHC 5THXA 3BYZA 3MJFA 4R98A 5DRYA 1ZN8A 1QWSA 1IPFA 1XRQA 1XZ8A 2G8LA 1GUDA 2X22A 4O3FA 3BJZA 3UH1A 2AYZA 1JHDA 4DKXA 5CVVA 2CVQA 1WAMA 4PSVA 3TQIA 4QRHA 4YJGA 4A36A 5FPHA 2BFWA 4PS1A 4QSMA 4TRRA 1UD2A 1D1QA 1M7BA 3D2LA 3MC1A 4IQFA 2WWTA 4C4PA 4MR7B 1JB9A 1MCZA 2QM8A 2J30A 2X7XA 3OTQA 4EVIA 4KYTA 2VJNA 2D1TA 3MTIA 3OLVA 1ESMA 2G28A 4A1FA 1BVHA 3UJAA 1EK6A 1G20E 3GJQA 3GDOA 4WINA 5E7MA 5B3JA 3K4PA 2H2DA 4IV5A 4KEAA 4A1OA 4B33A 3GVJA 4EPRA 3KQQA 3UTDA 1NUTA 1I01A 1Z3CA 3G9UA 4F4FA 4MR8B 2NXCA 2FUCA 4X7FA 3CRNA 1N5JA 1AUPA 1JBQA 1NRWA 3UIEA 3ANTA 4DFDA 3AUFA 3BULA 1XEWX 2Z95A 3EZ6A 1YVPA 2WAMA 3HKBA 3RGWS 3ZE8A 4KWTA 3GW8A 1R7RA 3CW9A 5CMLA 1RBQA 2Y1DA 4GBMA 4JBLA 1JR6A 1CP2A 4PGOA 1SKBA 1X7XA 2Y05A 2YHAA 2XA2A 3MA0A 4C05A 2R00C 4EK9A 5AW8A 5BW4A 2ONZA 1YJXA 4IQ0A 4HXYA 1OASA 2PZFA 3KTFA 4H6PA 1TX4B 5CA0F 3VO2A 1SIBE 5FLEX 1NOJA 3PXCX 3A1VA 4WBNF 5A5EA 1UC8A 1R4NA 4EYEA 2GJ4A 4ND3A 3ZI7A 1IRIA 4N3CA 3DPIA 2GXAA 3W5HA 1HVXA 3HBMA 2W98A 3DZHA 4HLCA 1DJNA 4I50F 4YMTA 3UYKA 5DCWA 2QLMA 1S2DA 3N8DA 1TU3A 3ZWXA 3WL3A 1G8SA 3QA3E 4QYTA 1Y3HA 2QL5A 5G0VA 4MRNA 4O4IF 2VXOA 3GJ6A 1SN7A 1QZZA 3NWOA 3JXEA 4KKXB 3HWWA 4GEGA 1E3XA 1GAWA 2EZUA 3BTVA 1HRKA 3S2EA 3OEEA 4B17A 1IHOA 4FVTA 4MPTA 3E8SA 4PXYA 4EUEA 4QVKA 3F3SA 1J5XA 4M1KA 3RBVA 4ALNA 4XEHA 4C7BA 3Q10A 4WZTA 5EKXA 2YMPA 4E5VA 3SJBA 2PD4A 3ZI0A 2ZYGA 4NCHA 3WLEA 1QGAA 1IJKA 4NEQA 1UBUS 3E5HA 3R20A 2PSFA 2A9RA 1RHMA 1L8LA 4BO6A 2IKSA 4QXQA 3URKA 2HPHA 3ROXA 4RSRA 4DREA 4JIGA 2H4XA 3P19A 3U56A 1DT5A 3CC4B 1DHTA 4NZ9A 4U2CA 4WEOA 2HADA 4XXHA 2Y27A 3GVLA 4ZGGA 2R8RA 1KVTA 2B7CA 1IXYA 1QTQA 2RKWA 1SU6A 1RHUA 3QH4A 4II3A 4F04A 2NQ8A 2PLWA 3W78A 3GRZA 2AMLA 4J7AA 3GA7A 4LX8A 2OO7A 3UCFA 1JI3A 1FFWA 2UYGA 4M0KA 3A2NA 4MLPA 3DMHA 5AKXA 5JWRA 3N2KB 3FG9A 2EU8A 1KQSB 3PGMA 4WBSA 1TTHA 3KJEA 3X1KA 1E6CA 1ONPA 3G71B 4MB6A 1KGSA 1PGOA 3PRKE 2GZ1A 5H59A 1J99A