1F66A

2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
b'KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PALINDROMIC 146 BASE PAIR DNA FRAGMENT
publication title Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f66A00
2AROD 3AZLA 3MGPA 2F8NK 3AFAD 5AV5A 3WA9A 1TZYA 1P3PD 4Z2MH 4XZQC 3RELB 5B0YC 3B6FD 4H9QA 3WKJC 4J8WD 3UTBD 3LJAA 5F99C 3MNNA 5BO0B 5BS7C 3TU4B 4AWLC 3W98B 4J8UC 5BO0A 5GSUC 5B2JB 5DNMB 3TU4A 1EQZD 3LELC 5B2JA 4H9PA 3X1UA 3REID 3AYWA 1KU5A 5DNMA 5AY8D 3AZFC 1S32B 1P3BC 5B40C 3C1BD 3X1TC 1U35D 1S32A 4CAYB 3KWQD 3UTAD 4CSRA 1WWSA 1AOIC 5B0ZA 4CAYA 5B24D 4Z66B 3W96C 4WU9C 4LD9D 4H9SC 5B33D 5CPKC 4JJND 5B31B 3AZID 2NQBB 1TAFB 5G49B 3UT9A 1ID3A 5AV6C 1TAFA 2HIOA 5G49A 4EO5B 3AZGD 3AZHC 3W97B 3R45A 3AZLD 3MGPD 5AV5D 3WA9D 1TZYD 3LZ0B 5CP6C 4YM6B 4G91B 3X1VB 3LZ0A 3LJAD 3O62A 3REHC 3X1SB 3MNND 3A6NC 1P3AB 3AZKA 4WV4B 4R8PC 3X1VA 3KUYC 5B2IC 1P3KC 3VH5A 2FJ7B 3TU4D 1KX3A 1KX5C 2RVQC 4XZQB 3AZMC 5B2JD 5B0YB 3X1UD 1ZLAC 3AYWD 5DNMD 2CV5C 3WAAB 1F1EA 4XZQA 5B0YA 3RELC 1S32D 3AV2C 3WKJA 4AWLB 4J8UB 5F99A 4XUJC 5B0ZD 5GSUB 5BS7A 4ZUXB 5JA4B 4J8UA 1M1AA 2BYKB 3W98C 5GSUA 4X23B 3AZFB 5B40B 3LELA 4KUDB 4QLCC 3UT9D 3AZFA 4UUZB 5BT1D 5AVBB 1P3BA 5B40A 1ID3D 2HIOD 3X1TA 1AOIB 5B32B 1R4VA 3W96B 3WTPB 1AOIA 5C3IC 1P3LC 3W96A 4Z66C 4WU9A 4H9RB 3AZEB 4Z5TC 4H9SA 3WTPE 5CPKA 3LZ0D 4NE3A 1P34B 5B31C 3O62D 5GXQC 3V9RB 2NQBC 3MGQB 3AZKD 3X1VD 1P3IC 5AV6A 2PYOC 4H9OB 3AZHA 4EO5C 1KX3D 2F8NB 3W97C 3NQJB 4H9OA 4DRAA 1H3OA 2F8NA 4XZQD 3NQJA 2F8NH 5CP6A 5B0YD 4YM6C 3A6NB 1BH9B 5DNNB 3REJC 3WKJD 4G91C 4R8PB 3REHA 5F99D 1BH9A 4WNNB 4H9NB 3KUYB 3X1SC 1P3AC 1P3KB 4R8PA 1KX5B 1M1AD 4J8UD 1KX4C 3AZMB 5GSUD 3KUYA 5B2IA 3AN2C 1P3KA 1ZLAB 2CV5B 1KX5A 2FJ7C 3AZMA 3LELD 3AZFD 3MGRC 3AV2B 2CV5A 4WU8C 1P3BD 5B40D 3WAAC 3X1TD 4XUJB 3RELA 3AV2A 4XUJA 5CPIB 1M18B 1AOID 3C1CB 3AZJB 3W96D 4WU9D 4ZUXC 5AV8B 3W98A 5CPKD 4QLCB 4X23C 5KDMB 2YFWB 4QLCA 4KUDC 5KDMA 2NZDB 5AV6D 4Z2MG 5AVBC 5C3IB 3AZHD 1P3LB 5B32C 1P3FB 2CWEA 4Z5TB 3WTPC 1P3LA 2F8ND 4Z66A 5CP6D 1P3GC 5CHLB 5GXQB 4Z5TA 3AZEC 5GT3C 3KSYA 5B31A 1P3IB 3REHD 5GXQA 1P34C 2PYOB 2NQBA 3MGQC 2BYMB 4R8PD 1P3IA 1N1JB 2PYOA 1F66B 3KUYD 5B2ID 1P3KD 3AV1C 2RVQD 1KX5D 3W97A 3AZMD 2YFVB 5GT0B 3REJB 2CV5D 2YFVA 3RELD 4YM6A 3AV2D 1P3MC 1HTAA 3REJA 5DNNC 1KX4B 4XUJD 1P3OC 3VH6T 3X1SA 3AN2B 5CPJB 1P3AA 3LZ1B 1KX4A 5B31G 3W98D 3AN2A 4J8VC 3MGRB 5BNXB 2FJ7A 4WU8B 3MGSB 4QLCD 3MGRA 4WU8A 4JJNC 3WAAA 3KXBC 1Q9CA 4M6BA 1HQ3C 1M18C 5CPIC 3AZNB 1P3LD 5B1MB 3C1CC 3AZJC 4Z66D 4ZUXA 4Z5TD 5JA4A 5AV8C 2BYKA 5JRGC 4X23A 3VH6W 3W99B 5B31D 5GXQD 2NQBD 1B67A 4KUDA 4HGAC 3B6GC 3REKC 1P3ID 4UUZA 2PYOD 5AVBA 2NZDC 4KGCC 5E5AC 1WWIA 5B32A 3W97D 1P3FC 1P3GB 2LY8A 3WTPA 2AROB 5GT3B 1BH8B 1P3PB 4H9RA 1P3GA 3AZEA 4YM6D 5B1LC 5GT3A 3REJD 4J8WB 1BH8A 3UTBB 1P34A 4J8XC 3X1SD 3V9RA 1P3AD 3MGQA 3AV1B 1KX4D 2IO5C 3AN2D 1F66C 5B0ZC 3AV1A 2FJ7D 1EQZB 3MGRD 3REIB 1P3MB 4WU8D 5GT0C 5AY8B 3MVDC 3WAAD 1P3OB 1P3MA 3A6NA 3NQUB 3UT9C 5DNNA 5AV9C 1U35B 3UTAB 1P3OA 4WNNA 4H9NA 3B0BA 5BNVB 5B24B 4J8VB 3LZ1C 5CPJC 4ZUXD 4LD9B 3B0DC 4J8VA 4X23D 1ZLAA 4JJNB 4KUDD 3MGSC 4JJNA 3KXBB 5AVBD 2F8NG 1HQ3B 4YS3C 3AZKC 5B32D 3AZGB 3KXBA 1M19C 4NE6A 1HQ3A 3WTPD 1M18A 5CPIA 5JRGB 5AVCC 3C1CA 3AZLB 3AZJA 4NE5A 3AZNC 5B1MC 5AV5B 1TZYB 1P3GD 3AZED 5AV8A 5JRGA 5GT3D 1BFMA 4HGAB 3B6GB 4H9QB 3REKB 3W99C 2YFWA 4KHAB 1P34D 3LJAB 3MGQD 3MNNB 3REKA 5E5AB 3B6GA 4KGCB 2L5AA 4KHAA 2NZDA 4KGCA 5E5AA 2HUEC 3AV1D 3VH6A 1P3FA 1M1AC 4H9PB 5B1LB 3X1UB 2AROC 3AYWB 1A7WA 3AFAC 4J8XB 1P3PC 1P3MD 5B1LA 3A6ND 5DNND 3B6FC 2IO5B 4J8WC 4J8XA 3UTBC 1P3OD 4CSRB 5B0ZB 2BYMA 1N1JA 4E44A 1F66A 4J8VD 1ZLAD 3MVDB 1EQZC 3REIC 5GT0A 5AV9B 3UT9B 3MVDA 4G92C 5AY8C 1ID3B 2HIOB 3C1BC 5AV9A 3KXBD 1U35C 3B0CT 1HQ3D 3KWQC 3UTAC 1M18D 5CPID 3R45B 3C1CD 3B0DB 3AZJD 5CPJA 3LZ1A 5B24C 5AV8D 5JRGD 4LD9C 5BNXA 5B33C 3O62B 3MGSA 3AZIC 3B6GD 4ZBJB 3REKD 4YS3B 3AZKB 1M19B 2NZDD 1ULYA 4KGCD 5E5AD 4YS3A 5AVCB 3AZGC 1M19A 1KX3B 1P3FD 5AVCA 3AZNA 3AZLC 5B1MA 3MGPC 5AV5C 3WA9C 1TZYC 3B0CW 5B1LD 3WKJB 3W99A 4J8XD 5FUGB 5F99B 3LJAC 2HUEB 3MNNC 5FUGA 1M1AB 1F66D 4WZSB 3AFAB 3TU4C 3LELB 4DRBA 2AROA 5B2JC 5GT0D 3X1UC 3MVDD 3AYWC 3B6FB 3AFAA 5DNMC 1P3BB 1P3PA 4NFTA 3X1TB 5AV9D 3B6FA 1S32C 2JSSA 4J8WA 3UTBA 3VH5T 5CPJD 3LZ1D 4WU9B 5CPKB 4G92B 5B32G 3MGSD 1EQZA 3C1BB 3REIA 5AY8A 3KWQB 5AV6B 5BT1C 4YS3D 1ID3C 3C1BA 2HIOC 3AZHB 3NQUA 1U35A 1M19D 3KWQA 3UTAA 5AVCD 3AZND 1H3OB 5B1MD 5BNVA 5B24A 1JFIB 5B33B 5CP6B 3AZIB 4LD9A 1JFIA 3W99D 3VH5W 5B33A 3LZ0C 3REHB 3AZIA 4E45A 3O62C 4ZBJC 3X1VC 1B6WA 5B2IB 3AZGA 3MGPB 3WA9B 1KX3C
chains in the Genus database with same CATH superfamily
2AROD 3AZLA 3MGPA 2F8NK 3AFAD 5AV5A 3WA9A 1TZYA 1P3PD 4Z2MH 4XZQC 3RELB 5B0YC 3B6FD 4H9QA 3WKJC 4J8WD 3UTBD 3LJAA 5F99C 3MNNA 5BO0B 5BS7C 3TU4B 4AWLC 3W98B 4J8UC 3H0RC 5BO0A 5GSUC 5B2JB 5DNMB 3TU4A 1EQZD 3LELC 5B2JA 4H9PA 3X1UA 3REID 3AYWA 1KU5A 2Y2NA 5AY8D 5DNMA 3AZFC 1S32B 1P3BC 5B40C 3C1BD 3X1TC 1U35D 1S32A 4CAYB 3KWQD 3UTAD 4CSRA 1WWSA 1AOIC 5B0ZA 4CAYA 5B24D 4Z66B 3W96C 4WU9C 4LD9D 4H9SC 5B33D 5CPKC 4JJND 5B31B 3AZID 2NQBB 1TAFB 5G49B 3UT9A 1ID3A 5AV6C 1TAFA 2HIOA 5G49A 4EO5B 3AZGD 3AZHC 2Y2LA 3W97B 3R45A 3AZLD 3MGPD 5AV5D 3WA9D 1TZYD 3LZ0B 5CP6C 4YM6B 4G91B 3X1VB 3LZ0A 3LJAD 3O62A 3REHC 3X1SB 3MNND 3A6NC 1P3AB 3AZKA 4WV4B 4R8PC 3X1VA 3KUYC 5B2IC 1P3KC 2DQNC 3VH5A 2FJ7B 3TU4D 1KX3A 1KX5C 2RVQC 4XZQB 3AZMC 5B2JD 5B0YB 3X1UD 1ZLAC 3AYWD 5DNMD 2CV5C 3WAAB 1F1EA 4XZQA 5B0YA 3RELC 1S32D 3AV2C 3WKJA 4AWLB 4J8UB 5F99A 4XUJC 5B0ZD 5GSUB 5BS7A 4ZUXB 5JA4B 4J8UA 1M1AA 2BYKB 3W98C 5GSUA 4X23B 3AZFB 5B40B 3LELA 4KUDB 4QLCC 3UT9D 3AZFA 4UUZB 5BT1D 5AVBB 1P3BA 5B40A 1ID3D 2HIOD 3X1TA 1AOIB 5B32B 1R4VA 3W96B 3WTPB 1AOIA 5C3IC 1P3LC 3W96A 4Z66C 4WU9A 4H9RB 3AZEB 4Z5TC 4H9SA 3WTPE 5CPKA 3LZ0D 4NE3A 1P34B 5B31C 3O62D 1Z2CB 5GXQC 3V9RB 2NQBC 3MGQB 3AZKD 3X1VD 1P3IC 5AV6A 2PYOC 4H9OB 3AZHA 4EO5C 1KX3D 2F8NB 3W97C 3NQJB 4H9OA 3IP4C 4DRAA 1H3OA 2F8NA 4XZQD 3NQJA 2F8NH 5CP6A 5B0YD 2JCHA 3H0LC 4YM6C 3A6NB 1BH9B 5DNNB 3REJC 3WKJD 4G91C 4R8PB 3REHA 5F99D 1BH9A 4WNNB 4H9NB 3KUYB 3X1SC 2J8PA 1P3AC 4R8PA 1P3KB 1KX5B 1M1AD 4J8UD 1PZRA 1KX4C 3AZMB 5GSUD 3KUYA 3EPLA 5B2IA 3AN2C 1P3KA 1ZLAB 2FFFB 2CV5B 1KX5A 2FJ7C 3AZMA 3LELD 3AZFD 3MGRC 3AV2B 2CV5A 4WU8C 2Y2PA 1P3BD 5B40D 3WAAC 3X1TD 4XUJB 3RELA 3AV2A 4XUJA 5CPIB 1M18B 1AOID 3C1CB 3AZJB 3W96D 4WU9D 4ZUXC 5AV8B 3W98A 2ZY5A 2Y2KA 4QLCB 5CPKD 4X23C 5KDMB 2YFWB 2G5HC 4QLCA 4KUDC 5KDMA 2NZDB 5AV6D 4Z2MG 5AVBC 5C3IB 3AZHD 1P3LB 5B32C 1P3FB 2CWEA 4Z5TB 3WTPC 1P3LA 2F8ND 4Z66A 5CP6D 1P3GC 5CHLB 5GXQB 3H0MC 4Z5TA 3AZEC 5GT3C 3KSYA 5B31A 1P3IB 3REHD 1T3UA 5GXQA 1P34C 2PYOB 2NQBA 2W8SA 3MGQC 2BYMB 4R8PD 1P3IA 1N1JB 2PYOA 1F66B 3KUYD 5B2ID 1P3KD 2Y2JA 3AV1C 2RVQD 1KX5D 3W97A 3AZMD 2YFVB 5GT0B 4UPKA 3REJB 2CV5D 2YFVA 3RELD 4YM6A 3AV2D 1P3MC 1HTAA 3REJA 5DNNC 1KX4B 4XUJD 1P3OC 3VH6T 3X1SA 3AN2B 5CPJB 1P3AA 3LZ1B 1KX4A 5B31G 3W98D 3AN2A 4J8VC 3MGRB 5BNXB 2FJ7A 4WU8B 3MGSB 4QLCD 3MGRA 4WU8A 4JJNC 3WAAA 2Y2QA 3KXBC 1Q9CA 2XD5A 4M6BA 2ZY3A 1HQ3C 3EPJA 1M18C 5CPIC 3AZNB 1P3LD 5B1MB 3C1CC 3AZJC 4Z66D 4ZUXA 4Z5TD 5JA4A 5AV8C 2BYKA 5JRGC 4X23A 3VH6W 3W99B 5B31D 5GXQD 2F2AC 2NQBD 1B67A 4KUDA 4HGAC 3B6GC 3REKC 1P3ID 4UUZA 2PYOD 5AVBA 2NZDC 4KGCC 5E5AC 1WWIA 5B32A 2G5IC 2ZM5A 3W97D 1P3FC 1P3GB 2LY8A 3P5JB 3WTPA 2AROB 5GT3B 3A1KA 1BH8B 1P3PB 4H9RA 1P3GA 3AZEA 4YM6D 5B1LC 5GT3A 3REJD 3EPHA 4J8WB 1BH8A 3UTBB 1P34A 4J8XC 3X1SD 3V9RA 1P3AD 3MGQA 2Y2HA 3AV1B 1KX4D 1W2EA 2IO5C 2Y2MA 3AN2D 1F66C 5B0ZC 3AV1A 2FJ7D 1EQZB 3MGRD 3REIB 1P3MB 4WU8D 5GT0C 5AY8B 3MVDC 3WAAD 2VQRA 1P3OB 1P3MA 3A6NA 3NQUB 3EPKA 5DNNA 5AV9C 3UT9C 1U35B 3UTAB 1P3OA 4WNNA 4H9NA 3B0BA 5BNVB 5B24B 4J8VB 3LZ1C 5CPJC 4ZUXD 4LD9B 3B0DC 4J8VA 4X23D 1ZLAA 4JJNB 4KUDD 3MGSC 3FDDA 4JJNA 3KXBB 5AVBD 2F8NG 1HQ3B 4YS3C 3AZKC 5B32D 3AZGB 3KXBA 1M19C 4NE6A 2Y2GA 1HQ3A 3WTPD 1M18A 5CPIA 5JRGB 5AVCC 3C1CA 3AZLB 3AZJA 4NE5A 3AZNC 5B1MC 2ZY4A 1TZYB 5AV5B 4DQYB 1P3GD 3AZED 5AV8A 5JRGA 5GT3D 1BFMA 4HGAB 3B6GB 4H9QB 3REKB 3W99C 2YFWA 4KHAB 1P34D 3LJAB 3MGQD 3MNNB 3REKA 5E5AB 3B6GA 4KGCB 3A1IA 2L5AA 4KHAA 2NZDA 4KGCA 5E5AA 2HUEC 3AV1D 3VH6A 1P3FA 1M1AC 4H9PB 5B1LB 3X1UB 2AROC 3AYWB 1A7WA 3AFAC 4J8XB 1P3PC 1P3MD 5B1LA 3A6ND 5DNND 3B6FC 2IO5B 4J8WC 4J8XA 3UTBC 1P3OD 4CSRB 3AL0C 5B0ZB 2BYMA 1N1JA 4E44A 1F66A 4J8VD 1ZLAD 3MVDB 1EQZC 3REIC 5GT0A 5AV9B 3UT9B 3MVDA 4G92C 5AY8C 1ID3B 2HIOB 3C1BC 5AV9A 3KXBD 1U35C 3B0CT 1HQ3D 3KWQC 3UTAC 1M18D 5CPID 3R45B 3C1CD 3B0DB 3AZJD 5CPJA 3LZ1A 5B24C 5AV8D 5JRGD 2UWXA 4LD9C 5BNXA 5B33C 3O62B 3MGSA 3AZIC 3B6GD 4ZBJB 3REKD 4YS3B 3AZKB 1M19B 2NZDD 1ULYA 2ZY2A 4KGCD 5E5AD 4YS3A 5AVCB 3AZGC 1M19A 1KX3B 1P3FD 5AVCA 2XD1A 3AZNA 3AZLC 5B1MA 3MGPC 5AV5C 3WA9C 1TZYC 3B0CW 5B1LD 2DF4C 3WKJB 3W99A 4J8XD 5FUGB 5F99B 3LJAC 2HUEB 3MNNC 5FUGA 1M1AB 1F66D 4WZSB 3AFAB 3TU4C 3LELB 4DRBA 2AROA 5B2JC 5GT0D 3X1UC 2Y2OA 3MVDD 3AYWC 3AFAA 3B6FB 5DNMC 1P3BB 1P3PA 4NFTA 3X1TB 5AV9D 3B6FA 1S32C 2JSSA 4J8WA 3UTBA 3VH5T 5CPJD 3LZ1D 2RIQA 4WU9B 3F6TA 5CPKB 4G92B 5B32G 3MGSD 1EQZA 3C1BB 3REIA 5AY8A 3KWQB 5AV6B 5BT1C 4YS3D 1ID3C 3C1BA 2HIOC 3AZHB 3NQUA 1U35A 1M19D 3KWQA 3UTAA 5AVCD 2Y2IA 3AZND 1H3OB 5B1MD 5BNVA 5B24A 1JFIB 5B33B 5CP6B 3AZIB 4LD9A 1JFIA 3W99D 2JE5A 3VH5W 5B33A 3LZ0C 3REHB 2BG1A 4E45A 3AZIA 3O62C 4ZBJC 3X1VC 3KFUG 4WJ3C 3EG5B 1B6WA 5B2IB 3AZGA 3MGPB 3WA9B 1KX3C
chains in the Genus database with same CATH topology
2AROD 3AZLA 3MGPA 2F8NK 3AFAD 5AV5A 3WA9A 1TZYA 1P3PD 4Z2MH 4XZQC 3RELB 5B0YC 3B6FD 4H9QA 3WKJC 4J8WD 3UTBD 3LJAA 5F99C 3MNNA 5BO0B 5BS7C 3TU4B 4AWLC 3W98B 4J8UC 3H0RC 5BO0A 5GSUC 5B2JB 5DNMB 3TU4A 1EQZD 3LELC 5B2JA 4H9PA 3X1UA 3REID 3AYWA 1KU5A 2Y2NA 5AY8D 5DNMA 3AZFC 1S32B 1P3BC 5B40C 3C1BD 3X1TC 1U35D 1S32A 4CAYB 3KWQD 3UTAD 4CSRA 1WWSA 1AOIC 5B0ZA 4CAYA 5B24D 4Z66B 3W96C 4WU9C 4LD9D 4H9SC 5B33D 5CPKC 4JJND 5B31B 3AZID 2NQBB 1TAFB 5G49B 3UT9A 1ID3A 5AV6C 1TAFA 2HIOA 5G49A 4EO5B 3AZGD 3AZHC 2Y2LA 3W97B 3R45A 3AZLD 3MGPD 5AV5D 3WA9D 1TZYD 3LZ0B 5CP6C 4YM6B 4G91B 3X1VB 3LZ0A 3LJAD 3O62A 3REHC 3X1SB 3MNND 3A6NC 1P3AB 3AZKA 4WV4B 4R8PC 3X1VA 3KUYC 5B2IC 1P3KC 2DQNC 3VH5A 2FJ7B 3TU4D 1KX3A 1KX5C 2RVQC 4XZQB 3AZMC 5B2JD 5B0YB 3X1UD 1ZLAC 3AYWD 5DNMD 2CV5C 3WAAB 1F1EA 4XZQA 5B0YA 3RELC 1S32D 3AV2C 3WKJA 4AWLB 4J8UB 5F99A 4XUJC 5B0ZD 5GSUB 5BS7A 4ZUXB 5JA4B 4J8UA 1M1AA 2BYKB 3W98C 5GSUA 4X23B 3AZFB 5B40B 3LELA 4KUDB 4QLCC 3UT9D 3AZFA 4UUZB 5BT1D 5AVBB 1P3BA 5B40A 1ID3D 2HIOD 3X1TA 1AOIB 5B32B 1R4VA 3W96B 3WTPB 1AOIA 5C3IC 1P3LC 3W96A 4Z66C 4WU9A 4H9RB 3AZEB 4Z5TC 4H9SA 3WTPE 5CPKA 3LZ0D 4NE3A 1P34B 5B31C 3O62D 1Z2CB 5GXQC 3V9RB 2NQBC 3MGQB 3AZKD 3X1VD 1P3IC 5AV6A 2PYOC 4H9OB 3AZHA 4EO5C 1KX3D 2F8NB 3W97C 3NQJB 4H9OA 3IP4C 4DRAA 1H3OA 2F8NA 4XZQD 3NQJA 2F8NH 5CP6A 5B0YD 2JCHA 3H0LC 4YM6C 3A6NB 1BH9B 5DNNB 3REJC 3WKJD 4G91C 4R8PB 3REHA 5F99D 1BH9A 4WNNB 4H9NB 3KUYB 3X1SC 2J8PA 1P3AC 4R8PA 1P3KB 1KX5B 1M1AD 4J8UD 1PZRA 1KX4C 3AZMB 5GSUD 3KUYA 3EPLA 5B2IA 3AN2C 1P3KA 1ZLAB 2FFFB 2CV5B 1KX5A 2FJ7C 3AZMA 3LELD 3AZFD 3MGRC 3AV2B 2CV5A 4WU8C 2Y2PA 1P3BD 5B40D 3WAAC 3X1TD 4XUJB 3RELA 3AV2A 4XUJA 5CPIB 1M18B 1AOID 3C1CB 3AZJB 3W96D 4WU9D 4ZUXC 5AV8B 3W98A 2ZY5A 2Y2KA 4QLCB 5CPKD 4X23C 5KDMB 2YFWB 2G5HC 4QLCA 4KUDC 5KDMA 2NZDB 5AV6D 4Z2MG 5AVBC 5C3IB 3AZHD 1P3LB 5B32C 1P3FB 2CWEA 4Z5TB 3WTPC 1P3LA 2F8ND 4Z66A 5CP6D 1P3GC 5CHLB 5GXQB 3H0MC 4Z5TA 3AZEC 5GT3C 3KSYA 5B31A 1P3IB 3REHD 1T3UA 5GXQA 1P34C 2PYOB 2NQBA 2W8SA 3MGQC 2BYMB 4R8PD 1P3IA 1N1JB 2PYOA 1F66B 3KUYD 5B2ID 1P3KD 2Y2JA 3AV1C 2RVQD 1KX5D 3W97A 3AZMD 2YFVB 5GT0B 4UPKA 3REJB 2CV5D 2YFVA 3RELD 4YM6A 3AV2D 1P3MC 1HTAA 3REJA 5DNNC 1KX4B 4XUJD 1P3OC 3VH6T 3X1SA 3AN2B 5CPJB 1P3AA 3LZ1B 1KX4A 5B31G 3W98D 3AN2A 4J8VC 3MGRB 5BNXB 2FJ7A 4WU8B 3MGSB 4QLCD 3MGRA 4WU8A 4JJNC 3WAAA 2Y2QA 3KXBC 1Q9CA 2XD5A 4M6BA 2ZY3A 1HQ3C 3EPJA 1M18C 5CPIC 3AZNB 1P3LD 5B1MB 3C1CC 3AZJC 4Z66D 4ZUXA 4Z5TD 5JA4A 5AV8C 2BYKA 5JRGC 4X23A 3VH6W 3W99B 5B31D 5GXQD 2F2AC 2NQBD 1B67A 4KUDA 4HGAC 3B6GC 3REKC 1P3ID 4UUZA 2PYOD 5AVBA 2NZDC 4KGCC 5E5AC 1WWIA 5B32A 2G5IC 2ZM5A 3W97D 1P3FC 1P3GB 2LY8A 3P5JB 3WTPA 2AROB 5GT3B 3A1KA 1BH8B 1P3PB 4H9RA 1P3GA 3AZEA 4YM6D 5B1LC 5GT3A 3REJD 3EPHA 4J8WB 1BH8A 3UTBB 1P34A 4J8XC 3X1SD 3V9RA 1P3AD 3MGQA 2Y2HA 3AV1B 1KX4D 1W2EA 2IO5C 2Y2MA 3AN2D 1F66C 5B0ZC 3AV1A 2FJ7D 1EQZB 3MGRD 3REIB 1P3MB 4WU8D 5GT0C 5AY8B 3MVDC 3WAAD 2VQRA 1P3OB 1P3MA 3A6NA 3NQUB 3EPKA 5DNNA 5AV9C 3UT9C 1U35B 3UTAB 1P3OA 4WNNA 4H9NA 3B0BA 5BNVB 5B24B 4J8VB 3LZ1C 5CPJC 4ZUXD 4LD9B 3B0DC 4J8VA 4X23D 1ZLAA 4JJNB 4KUDD 3MGSC 3FDDA 4JJNA 3KXBB 5AVBD 2F8NG 1HQ3B 4YS3C 3AZKC 5B32D 3AZGB 3KXBA 1M19C 4NE6A 2Y2GA 1HQ3A 3WTPD 1M18A 5CPIA 5JRGB 5AVCC 3C1CA 3AZLB 3AZJA 4NE5A 3AZNC 5B1MC 2ZY4A 1TZYB 5AV5B 4DQYB 1P3GD 3AZED 5AV8A 5JRGA 5GT3D 1BFMA 4HGAB 3B6GB 4H9QB 3REKB 3W99C 2YFWA 4KHAB 1P34D 3LJAB 3MGQD 3MNNB 3REKA 5E5AB 3B6GA 4KGCB 3A1IA 2L5AA 4KHAA 2NZDA 4KGCA 5E5AA 2HUEC 3AV1D 3VH6A 1P3FA 1M1AC 4H9PB 5B1LB 3X1UB 2AROC 3AYWB 1A7WA 3AFAC 4J8XB 1P3PC 1P3MD 5B1LA 3A6ND 5DNND 3B6FC 2IO5B 4J8WC 4J8XA 3UTBC 1P3OD 4CSRB 3AL0C 5B0ZB 2BYMA 1N1JA 4E44A 1F66A 4J8VD 1ZLAD 3MVDB 1EQZC 3REIC 5GT0A 5AV9B 3UT9B 3MVDA 4G92C 5AY8C 1ID3B 2HIOB 3C1BC 5AV9A 3KXBD 1U35C 3B0CT 1HQ3D 3KWQC 3UTAC 1M18D 5CPID 3R45B 3C1CD 3B0DB 3AZJD 5CPJA 3LZ1A 5B24C 5AV8D 5JRGD 2UWXA 4LD9C 5BNXA 5B33C 3O62B 3MGSA 3AZIC 3B6GD 4ZBJB 3REKD 4YS3B 3AZKB 1M19B 2NZDD 1ULYA 2ZY2A 4KGCD 5E5AD 4YS3A 5AVCB 3AZGC 1M19A 1KX3B 1P3FD 5AVCA 2XD1A 3AZNA 3AZLC 5B1MA 3MGPC 5AV5C 3WA9C 1TZYC 3B0CW 5B1LD 2DF4C 3WKJB 3W99A 4J8XD 5FUGB 5F99B 3LJAC 2HUEB 3MNNC 5FUGA 1M1AB 1F66D 4WZSB 3AFAB 3TU4C 3LELB 4DRBA 2AROA 5B2JC 5GT0D 3X1UC 2Y2OA 3MVDD 3AYWC 3AFAA 3B6FB 5DNMC 1P3BB 1P3PA 4NFTA 3X1TB 5AV9D 3B6FA 1S32C 2JSSA 4J8WA 3UTBA 3VH5T 5CPJD 3LZ1D 2RIQA 4WU9B 3F6TA 5CPKB 4G92B 5B32G 3MGSD 1EQZA 3C1BB 3REIA 5AY8A 3KWQB 5AV6B 5BT1C 4YS3D 1ID3C 3C1BA 2HIOC 3AZHB 3NQUA 1U35A 1M19D 3KWQA 3UTAA 5AVCD 2Y2IA 3AZND 1H3OB 5B1MD 5BNVA 5B24A 1JFIB 5B33B 5CP6B 3AZIB 4LD9A 1JFIA 3W99D 2JE5A 3VH5W 5B33A 3LZ0C 3REHB 2BG1A 4E45A 3AZIA 3O62C 4ZBJC 3X1VC 3KFUG 4WJ3C 3EG5B 1B6WA 5B2IB 3AZGA 3MGPB 3WA9B 1KX3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO D;  3AZL A;  3MGP A;  2F8N K;  3AFA D;  5AV5 A;  3WA9 A;  1TZY A;  1P3P D;  4Z2M H;  4XZQ C;  3REL B;  5B0Y C;  3B6F D;  4H9Q A;  3WKJ C;  4J8W D;  3UTB D;  3LJA A;  5F99 C;  3MNN A;  5BO0 B;  5BS7 C;  3TU4 B;  4AWL C;  3W98 B;  4J8U C;  5BO0 A;  5GSU C;  5B2J B;  5DNM B;  3TU4 A;  1EQZ D;  3LEL C;  5B2J A;  4H9P A;  3X1U A;  3REI D;  3AYW A;  1KU5 A;  5DNM A;  5AY8 D;  3AZF C;  1S32 B;  1P3B C;  5B40 C;  3C1B D;  3X1T C;  1U35 D;  1S32 A;  4CAY B;  3KWQ D;  3UTA D;  4CSR A;  1WWS A;  1AOI C;  5B0Z A;  4CAY A;  5B24 D;  4Z66 B;  3W96 C;  4WU9 C;  4LD9 D;  4H9S C;  5B33 D;  5CPK C;  4JJN D;  5B31 B;  3AZI D;  2NQB B;  1TAF B;  5G49 B;  3UT9 A;  1ID3 A;  5AV6 C;  1TAF A;  2HIO A;  5G49 A;  4EO5 B;  3AZG D;  3AZH C;  3W97 B;  3R45 A;  3AZL D;  3MGP D;  5AV5 D;  3WA9 D;  1TZY D;  3LZ0 B;  5CP6 C;  4YM6 B;  4G91 B;  3X1V B;  3LZ0 A;  3LJA D;  3O62 A;  3REH C;  3X1S B;  3MNN D;  3A6N C;  1P3A B;  3AZK A;  4WV4 B;  4R8P C;  3X1V A;  3KUY C;  5B2I C;  1P3K C;  3VH5 A;  2FJ7 B;  3TU4 D;  1KX3 A;  1KX5 C;  2RVQ C;  4XZQ B;  3AZM C;  5B2J D;  5B0Y B;  3X1U D;  1ZLA C;  3AYW D;  5DNM D;  2CV5 C;  3WAA B;  1F1E A;  4XZQ A;  5B0Y A;  3REL C;  1S32 D;  3AV2 C;  3WKJ A;  4AWL B;  4J8U B;  5F99 A;  4XUJ C;  5B0Z D;  5GSU B;  5BS7 A;  4ZUX B;  5JA4 B;  4J8U A;  1M1A A;  2BYK B;  3W98 C;  5GSU A;  4X23 B;  3AZF B;  5B40 B;  3LEL A;  4KUD B;  4QLC C;  3UT9 D;  3AZF A;  4UUZ B;  5BT1 D;  5AVB B;  1P3B A;  5B40 A;  1ID3 D;  2HIO D;  3X1T A;  1AOI B;  5B32 B;  1R4V A;  3W96 B;  3WTP B;  1AOI A;  5C3I C;  1P3L C;  3W96 A;  4Z66 C;  4WU9 A;  4H9R B;  3AZE B;  4Z5T C;  4H9S A;  3WTP E;  5CPK A;  3LZ0 D;  4NE3 A;  1P34 B;  5B31 C;  3O62 D;  5GXQ C;  3V9R B;  2NQB C;  3MGQ B;  3AZK D;  3X1V D;  1P3I C;  5AV6 A;  2PYO C;  4H9O B;  3AZH A;  4EO5 C;  1KX3 D;  2F8N B;  3W97 C;  3NQJ B;  4H9O A;  4DRA A;  1H3O A;  2F8N A;  4XZQ D;  3NQJ A;  2F8N H;  5CP6 A;  5B0Y D;  4YM6 C;  3A6N B;  1BH9 B;  5DNN B;  3REJ C;  3WKJ D;  4G91 C;  4R8P B;  3REH A;  5F99 D;  1BH9 A;  4WNN B;  4H9N B;  3KUY B;  3X1S C;  1P3A C;  1P3K B;  4R8P A;  1KX5 B;  1M1A D;  4J8U D;  1KX4 C;  3AZM B;  5GSU D;  3KUY A;  5B2I A;  3AN2 C;  1P3K A;  1ZLA B;  2CV5 B;  1KX5 A;  2FJ7 C;  3AZM A;  3LEL D;  3AZF D;  3MGR C;  3AV2 B;  2CV5 A;  4WU8 C;  1P3B D;  5B40 D;  3WAA C;  3X1T D;  4XUJ B;  3REL A;  3AV2 A;  4XUJ A;  5CPI B;  1M18 B;  1AOI D;  3C1C B;  3AZJ B;  3W96 D;  4WU9 D;  4ZUX C;  5AV8 B;  3W98 A;  5CPK D;  4QLC B;  4X23 C;  5KDM B;  2YFW B;  4QLC A;  4KUD C;  5KDM A;  2NZD B;  5AV6 D;  4Z2M G;  5AVB C;  5C3I B;  3AZH D;  1P3L B;  5B32 C;  1P3F B;  2CWE A;  4Z5T B;  3WTP C;  1P3L A;  2F8N D;  4Z66 A;  5CP6 D;  1P3G C;  5CHL B;  5GXQ B;  4Z5T A;  3AZE C;  5GT3 C;  3KSY A;  5B31 A;  1P3I B;  3REH D;  5GXQ A;  1P34 C;  2PYO B;  2NQB A;  3MGQ C;  2BYM B;  4R8P D;  1P3I A;  1N1J B;  2PYO A;  1F66 B;  3KUY D;  5B2I D;  1P3K D;  3AV1 C;  2RVQ D;  1KX5 D;  3W97 A;  3AZM D;  2YFV B;  5GT0 B;  3REJ B;  2CV5 D;  2YFV A;  3REL D;  4YM6 A;  3AV2 D;  1P3M C;  1HTA A;  3REJ A;  5DNN C;  1KX4 B;  4XUJ D;  1P3O C;  3VH6 T;  3X1S A;  3AN2 B;  5CPJ B;  1P3A A;  3LZ1 B;  1KX4 A;  5B31 G;  3W98 D;  3AN2 A;  4J8V C;  3MGR B;  5BNX B;  2FJ7 A;  4WU8 B;  3MGS B;  4QLC D;  3MGR A;  4WU8 A;  4JJN C;  3WAA A;  3KXB C;  1Q9C A;  4M6B A;  1HQ3 C;  1M18 C;  5CPI C;  3AZN B;  1P3L D;  5B1M B;  3C1C C;  3AZJ C;  4Z66 D;  4ZUX A;  4Z5T D;  5JA4 A;  5AV8 C;  2BYK A;  5JRG C;  4X23 A;  3VH6 W;  3W99 B;  5B31 D;  5GXQ D;  2NQB D;  1B67 A;  4KUD A;  4HGA C;  3B6G C;  3REK C;  1P3I D;  4UUZ A;  2PYO D;  5AVB A;  2NZD C;  4KGC C;  5E5A C;  1WWI A;  5B32 A;  3W97 D;  1P3F C;  1P3G B;  2LY8 A;  3WTP A;  2ARO B;  5GT3 B;  1BH8 B;  1P3P B;  4H9R A;  1P3G A;  3AZE A;  4YM6 D;  5B1L C;  5GT3 A;  3REJ D;  4J8W B;  1BH8 A;  3UTB B;  1P34 A;  4J8X C;  3X1S D;  3V9R A;  1P3A D;  3MGQ A;  3AV1 B;  1KX4 D;  2IO5 C;  3AN2 D;  1F66 C;  5B0Z C;  3AV1 A;  2FJ7 D;  1EQZ B;  3MGR D;  3REI B;  1P3M B;  4WU8 D;  5GT0 C;  5AY8 B;  3MVD C;  3WAA D;  1P3O B;  1P3M A;  3A6N A;  3NQU B;  3UT9 C;  5DNN A;  5AV9 C;  1U35 B;  3UTA B;  1P3O A;  4WNN A;  4H9N A;  3B0B A;  5BNV B;  5B24 B;  4J8V B;  3LZ1 C;  5CPJ C;  4ZUX D;  4LD9 B;  3B0D C;  4J8V A;  4X23 D;  1ZLA A;  4JJN B;  4KUD D;  3MGS C;  4JJN A;  3KXB B;  5AVB D;  2F8N G;  1HQ3 B;  4YS3 C;  3AZK C;  5B32 D;  3AZG B;  3KXB A;  1M19 C;  4NE6 A;  1HQ3 A;  3WTP D;  1M18 A;  5CPI A;  5JRG B;  5AVC C;  3C1C A;  3AZL B;  3AZJ A;  4NE5 A;  3AZN C;  5B1M C;  5AV5 B;  1TZY B;  1P3G D;  3AZE D;  5AV8 A;  5JRG A;  5GT3 D;  1BFM A;  4HGA B;  3B6G B;  4H9Q B;  3REK B;  3W99 C;  2YFW A;  4KHA B;  1P34 D;  3LJA B;  3MGQ D;  3MNN B;  3REK A;  5E5A B;  3B6G A;  4KGC B;  2L5A A;  4KHA A;  2NZD A;  4KGC A;  5E5A A;  2HUE C;  3AV1 D;  3VH6 A;  1P3F A;  1M1A C;  4H9P B;  5B1L B;  3X1U B;  2ARO C;  3AYW B;  1A7W A;  3AFA C;  4J8X B;  1P3P C;  1P3M D;  5B1L A;  3A6N D;  5DNN D;  3B6F C;  2IO5 B;  4J8W C;  4J8X A;  3UTB C;  1P3O D;  4CSR B;  5B0Z B;  2BYM A;  1N1J A;  4E44 A;  1F66 A;  4J8V D;  1ZLA D;  3MVD B;  1EQZ C;  3REI C;  5GT0 A;  5AV9 B;  3UT9 B;  3MVD A;  4G92 C;  5AY8 C;  1ID3 B;  2HIO B;  3C1B C;  5AV9 A;  3KXB D;  1U35 C;  3B0C T;  1HQ3 D;  3KWQ C;  3UTA C;  1M18 D;  5CPI D;  3R45 B;  3C1C D;  3B0D B;  3AZJ D;  5CPJ A;  3LZ1 A;  5B24 C;  5AV8 D;  5JRG D;  4LD9 C;  5BNX A;  5B33 C;  3O62 B;  3MGS A;  3AZI C;  3B6G D;  4ZBJ B;  3REK D;  4YS3 B;  3AZK B;  1M19 B;  2NZD D;  1ULY A;  4KGC D;  5E5A D;  4YS3 A;  5AVC B;  3AZG C;  1M19 A;  1KX3 B;  1P3F D;  5AVC A;  3AZN A;  3AZL C;  5B1M A;  3MGP C;  5AV5 C;  3WA9 C;  1TZY C;  3B0C W;  5B1L D;  3WKJ B;  3W99 A;  4J8X D;  5FUG B;  5F99 B;  3LJA C;  2HUE B;  3MNN C;  5FUG A;  1M1A B;  1F66 D;  4WZS B;  3AFA B;  3TU4 C;  3LEL B;  4DRB A;  2ARO A;  5B2J C;  5GT0 D;  3X1U C;  3MVD D;  3AYW C;  3B6F B;  3AFA A;  5DNM C;  1P3B B;  1P3P A;  4NFT A;  3X1T B;  5AV9 D;  3B6F A;  1S32 C;  2JSS A;  4J8W A;  3UTB A;  3VH5 T;  5CPJ D;  3LZ1 D;  4WU9 B;  5CPK B;  4G92 B;  5B32 G;  3MGS D;  1EQZ A;  3C1B B;  3REI A;  5AY8 A;  3KWQ B;  5AV6 B;  5BT1 C;  4YS3 D;  1ID3 C;  3C1B A;  2HIO C;  3AZH B;  3NQU A;  1U35 A;  1M19 D;  3KWQ A;  3UTA A;  5AVC D;  3AZN D;  1H3O B;  5B1M D;  5BNV A;  5B24 A;  1JFI B;  5B33 B;  5CP6 B;  3AZI B;  4LD9 A;  1JFI A;  3W99 D;  3VH5 W;  5B33 A;  3LZ0 C;  3REH B;  3AZI A;  4E45 A;  3O62 C;  4ZBJ C;  3X1V C;  1B6W A;  5B2I B;  3AZG A;  3MGP B;  3WA9 B;  1KX3 C; 
#chains in the Genus database with same CATH topology
 2ARO D;  3AZL A;  3MGP A;  2F8N K;  3AFA D;  5AV5 A;  3WA9 A;  1TZY A;  1P3P D;  4Z2M H;  4XZQ C;  3REL B;  5B0Y C;  3B6F D;  4H9Q A;  3WKJ C;  4J8W D;  3UTB D;  3LJA A;  5F99 C;  3MNN A;  5BO0 B;  5BS7 C;  3TU4 B;  4AWL C;  3W98 B;  4J8U C;  3H0R C;  5BO0 A;  5GSU C;  5B2J B;  5DNM B;  3TU4 A;  1EQZ D;  3LEL C;  5B2J A;  4H9P A;  3X1U A;  3REI D;  3AYW A;  1KU5 A;  2Y2N A;  5AY8 D;  5DNM A;  3AZF C;  1S32 B;  1P3B C;  5B40 C;  3C1B D;  3X1T C;  1U35 D;  1S32 A;  4CAY B;  3KWQ D;  3UTA D;  4CSR A;  1WWS A;  1AOI C;  5B0Z A;  4CAY A;  5B24 D;  4Z66 B;  3W96 C;  4WU9 C;  4LD9 D;  4H9S C;  5B33 D;  5CPK C;  4JJN D;  5B31 B;  3AZI D;  2NQB B;  1TAF B;  5G49 B;  3UT9 A;  1ID3 A;  5AV6 C;  1TAF A;  2HIO A;  5G49 A;  4EO5 B;  3AZG D;  3AZH C;  2Y2L A;  3W97 B;  3R45 A;  3AZL D;  3MGP D;  5AV5 D;  3WA9 D;  1TZY D;  3LZ0 B;  5CP6 C;  4YM6 B;  4G91 B;  3X1V B;  3LZ0 A;  3LJA D;  3O62 A;  3REH C;  3X1S B;  3MNN D;  3A6N C;  1P3A B;  3AZK A;  4WV4 B;  4R8P C;  3X1V A;  3KUY C;  5B2I C;  1P3K C;  2DQN C;  3VH5 A;  2FJ7 B;  3TU4 D;  1KX3 A;  1KX5 C;  2RVQ C;  4XZQ B;  3AZM C;  5B2J D;  5B0Y B;  3X1U D;  1ZLA C;  3AYW D;  5DNM D;  2CV5 C;  3WAA B;  1F1E A;  4XZQ A;  5B0Y A;  3REL C;  1S32 D;  3AV2 C;  3WKJ A;  4AWL B;  4J8U B;  5F99 A;  4XUJ C;  5B0Z D;  5GSU B;  5BS7 A;  4ZUX B;  5JA4 B;  4J8U A;  1M1A A;  2BYK B;  3W98 C;  5GSU A;  4X23 B;  3AZF B;  5B40 B;  3LEL A;  4KUD B;  4QLC C;  3UT9 D;  3AZF A;  4UUZ B;  5BT1 D;  5AVB B;  1P3B A;  5B40 A;  1ID3 D;  2HIO D;  3X1T A;  1AOI B;  5B32 B;  1R4V A;  3W96 B;  3WTP B;  1AOI A;  5C3I C;  1P3L C;  3W96 A;  4Z66 C;  4WU9 A;  4H9R B;  3AZE B;  4Z5T C;  4H9S A;  3WTP E;  5CPK A;  3LZ0 D;  4NE3 A;  1P34 B;  5B31 C;  3O62 D;  1Z2C B;  5GXQ C;  3V9R B;  2NQB C;  3MGQ B;  3AZK D;  3X1V D;  1P3I C;  5AV6 A;  2PYO C;  4H9O B;  3AZH A;  4EO5 C;  1KX3 D;  2F8N B;  3W97 C;  3NQJ B;  4H9O A;  3IP4 C;  4DRA A;  1H3O A;  2F8N A;  4XZQ D;  3NQJ A;  2F8N H;  5CP6 A;  5B0Y D;  2JCH A;  3H0L C;  4YM6 C;  3A6N B;  1BH9 B;  5DNN B;  3REJ C;  3WKJ D;  4G91 C;  4R8P B;  3REH A;  5F99 D;  1BH9 A;  4WNN B;  4H9N B;  3KUY B;  3X1S C;  2J8P A;  1P3A C;  4R8P A;  1P3K B;  1KX5 B;  1M1A D;  4J8U D;  1PZR A;  1KX4 C;  3AZM B;  5GSU D;  3KUY A;  3EPL A;  5B2I A;  3AN2 C;  1P3K A;  1ZLA B;  2FFF B;  2CV5 B;  1KX5 A;  2FJ7 C;  3AZM A;  3LEL D;  3AZF D;  3MGR C;  3AV2 B;  2CV5 A;  4WU8 C;  2Y2P A;  1P3B D;  5B40 D;  3WAA C;  3X1T D;  4XUJ B;  3REL A;  3AV2 A;  4XUJ A;  5CPI B;  1M18 B;  1AOI D;  3C1C B;  3AZJ B;  3W96 D;  4WU9 D;  4ZUX C;  5AV8 B;  3W98 A;  2ZY5 A;  2Y2K A;  4QLC B;  5CPK D;  4X23 C;  5KDM B;  2YFW B;  2G5H C;  4QLC A;  4KUD C;  5KDM A;  2NZD B;  5AV6 D;  4Z2M G;  5AVB C;  5C3I B;  3AZH D;  1P3L B;  5B32 C;  1P3F B;  2CWE A;  4Z5T B;  3WTP C;  1P3L A;  2F8N D;  4Z66 A;  5CP6 D;  1P3G C;  5CHL B;  5GXQ B;  3H0M C;  4Z5T A;  3AZE C;  5GT3 C;  3KSY A;  5B31 A;  1P3I B;  3REH D;  1T3U A;  5GXQ A;  1P34 C;  2PYO B;  2NQB A;  2W8S A;  3MGQ C;  2BYM B;  4R8P D;  1P3I A;  1N1J B;  2PYO A;  1F66 B;  3KUY D;  5B2I D;  1P3K D;  2Y2J A;  3AV1 C;  2RVQ D;  1KX5 D;  3W97 A;  3AZM D;  2YFV B;  5GT0 B;  4UPK A;  3REJ B;  2CV5 D;  2YFV A;  3REL D;  4YM6 A;  3AV2 D;  1P3M C;  1HTA A;  3REJ A;  5DNN C;  1KX4 B;  4XUJ D;  1P3O C;  3VH6 T;  3X1S A;  3AN2 B;  5CPJ B;  1P3A A;  3LZ1 B;  1KX4 A;  5B31 G;  3W98 D;  3AN2 A;  4J8V C;  3MGR B;  5BNX B;  2FJ7 A;  4WU8 B;  3MGS B;  4QLC D;  3MGR A;  4WU8 A;  4JJN C;  3WAA A;  2Y2Q A;  3KXB C;  1Q9C A;  2XD5 A;  4M6B A;  2ZY3 A;  1HQ3 C;  3EPJ A;  1M18 C;  5CPI C;  3AZN B;  1P3L D;  5B1M B;  3C1C C;  3AZJ C;  4Z66 D;  4ZUX A;  4Z5T D;  5JA4 A;  5AV8 C;  2BYK A;  5JRG C;  4X23 A;  3VH6 W;  3W99 B;  5B31 D;  5GXQ D;  2F2A C;  2NQB D;  1B67 A;  4KUD A;  4HGA C;  3B6G C;  3REK C;  1P3I D;  4UUZ A;  2PYO D;  5AVB A;  2NZD C;  4KGC C;  5E5A C;  1WWI A;  5B32 A;  2G5I C;  2ZM5 A;  3W97 D;  1P3F C;  1P3G B;  2LY8 A;  3P5J B;  3WTP A;  2ARO B;  5GT3 B;  3A1K A;  1BH8 B;  1P3P B;  4H9R A;  1P3G A;  3AZE A;  4YM6 D;  5B1L C;  5GT3 A;  3REJ D;  3EPH A;  4J8W B;  1BH8 A;  3UTB B;  1P34 A;  4J8X C;  3X1S D;  3V9R A;  1P3A D;  3MGQ A;  2Y2H A;  3AV1 B;  1KX4 D;  1W2E A;  2IO5 C;  2Y2M A;  3AN2 D;  1F66 C;  5B0Z C;  3AV1 A;  2FJ7 D;  1EQZ B;  3MGR D;  3REI B;  1P3M B;  4WU8 D;  5GT0 C;  5AY8 B;  3MVD C;  3WAA D;  2VQR A;  1P3O B;  1P3M A;  3A6N A;  3NQU B;  3EPK A;  5DNN A;  5AV9 C;  3UT9 C;  1U35 B;  3UTA B;  1P3O A;  4WNN A;  4H9N A;  3B0B A;  5BNV B;  5B24 B;  4J8V B;  3LZ1 C;  5CPJ C;  4ZUX D;  4LD9 B;  3B0D C;  4J8V A;  4X23 D;  1ZLA A;  4JJN B;  4KUD D;  3MGS C;  3FDD A;  4JJN A;  3KXB B;  5AVB D;  2F8N G;  1HQ3 B;  4YS3 C;  3AZK C;  5B32 D;  3AZG B;  3KXB A;  1M19 C;  4NE6 A;  2Y2G A;  1HQ3 A;  3WTP D;  1M18 A;  5CPI A;  5JRG B;  5AVC C;  3C1C A;  3AZL B;  3AZJ A;  4NE5 A;  3AZN C;  5B1M C;  2ZY4 A;  1TZY B;  5AV5 B;  4DQY B;  1P3G D;  3AZE D;  5AV8 A;  5JRG A;  5GT3 D;  1BFM A;  4HGA B;  3B6G B;  4H9Q B;  3REK B;  3W99 C;  2YFW A;  4KHA B;  1P34 D;  3LJA B;  3MGQ D;  3MNN B;  3REK A;  5E5A B;  3B6G A;  4KGC B;  3A1I A;  2L5A A;  4KHA A;  2NZD A;  4KGC A;  5E5A A;  2HUE C;  3AV1 D;  3VH6 A;  1P3F A;  1M1A C;  4H9P B;  5B1L B;  3X1U B;  2ARO C;  3AYW B;  1A7W A;  3AFA C;  4J8X B;  1P3P C;  1P3M D;  5B1L A;  3A6N D;  5DNN D;  3B6F C;  2IO5 B;  4J8W C;  4J8X A;  3UTB C;  1P3O D;  4CSR B;  3AL0 C;  5B0Z B;  2BYM A;  1N1J A;  4E44 A;  1F66 A;  4J8V D;  1ZLA D;  3MVD B;  1EQZ C;  3REI C;  5GT0 A;  5AV9 B;  3UT9 B;  3MVD A;  4G92 C;  5AY8 C;  1ID3 B;  2HIO B;  3C1B C;  5AV9 A;  3KXB D;  1U35 C;  3B0C T;  1HQ3 D;  3KWQ C;  3UTA C;  1M18 D;  5CPI D;  3R45 B;  3C1C D;  3B0D B;  3AZJ D;  5CPJ A;  3LZ1 A;  5B24 C;  5AV8 D;  5JRG D;  2UWX A;  4LD9 C;  5BNX A;  5B33 C;  3O62 B;  3MGS A;  3AZI C;  3B6G D;  4ZBJ B;  3REK D;  4YS3 B;  3AZK B;  1M19 B;  2NZD D;  1ULY A;  2ZY2 A;  4KGC D;  5E5A D;  4YS3 A;  5AVC B;  3AZG C;  1M19 A;  1KX3 B;  1P3F D;  5AVC A;  2XD1 A;  3AZN A;  3AZL C;  5B1M A;  3MGP C;  5AV5 C;  3WA9 C;  1TZY C;  3B0C W;  5B1L D;  2DF4 C;  3WKJ B;  3W99 A;  4J8X D;  5FUG B;  5F99 B;  3LJA C;  2HUE B;  3MNN C;  5FUG A;  1M1A B;  1F66 D;  4WZS B;  3AFA B;  3TU4 C;  3LEL B;  4DRB A;  2ARO A;  5B2J C;  5GT0 D;  3X1U C;  2Y2O A;  3MVD D;  3AYW C;  3AFA A;  3B6F B;  5DNM C;  1P3B B;  1P3P A;  4NFT A;  3X1T B;  5AV9 D;  3B6F A;  1S32 C;  2JSS A;  4J8W A;  3UTB A;  3VH5 T;  5CPJ D;  3LZ1 D;  2RIQ A;  4WU9 B;  3F6T A;  5CPK B;  4G92 B;  5B32 G;  3MGS D;  1EQZ A;  3C1B B;  3REI A;  5AY8 A;  3KWQ B;  5AV6 B;  5BT1 C;  4YS3 D;  1ID3 C;  3C1B A;  2HIO C;  3AZH B;  3NQU A;  1U35 A;  1M19 D;  3KWQ A;  3UTA A;  5AVC D;  2Y2I A;  3AZN D;  1H3O B;  5B1M D;  5BNV A;  5B24 A;  1JFI B;  5B33 B;  5CP6 B;  3AZI B;  4LD9 A;  1JFI A;  3W99 D;  2JE5 A;  3VH5 W;  5B33 A;  3LZ0 C;  3REH B;  2BG1 A;  4E45 A;  3AZI A;  3O62 C;  4ZBJ C;  3X1V C;  3KFU G;  4WJ3 C;  3EG5 B;  1B6W A;  5B2I B;  3AZG A;  3MGP B;  3WA9 B;  1KX3 C; 
#chains in the Genus database with same CATH homology
 2ARO D;  3AZL A;  3MGP A;  2F8N K;  3AFA D;  5AV5 A;  3WA9 A;  1TZY A;  1P3P D;  4Z2M H;  4XZQ C;  3REL B;  5B0Y C;  3B6F D;  4H9Q A;  3WKJ C;  4J8W D;  3UTB D;  3LJA A;  5F99 C;  3MNN A;  5BO0 B;  5BS7 C;  3TU4 B;  4AWL C;  3W98 B;  4J8U C;  3H0R C;  5BO0 A;  5GSU C;  5B2J B;  5DNM B;  3TU4 A;  1EQZ D;  3LEL C;  5B2J A;  4H9P A;  3X1U A;  3REI D;  3AYW A;  1KU5 A;  2Y2N A;  5AY8 D;  5DNM A;  3AZF C;  1S32 B;  1P3B C;  5B40 C;  3C1B D;  3X1T C;  1U35 D;  1S32 A;  4CAY B;  3KWQ D;  3UTA D;  4CSR A;  1WWS A;  1AOI C;  5B0Z A;  4CAY A;  5B24 D;  4Z66 B;  3W96 C;  4WU9 C;  4LD9 D;  4H9S C;  5B33 D;  5CPK C;  4JJN D;  5B31 B;  3AZI D;  2NQB B;  1TAF B;  5G49 B;  3UT9 A;  1ID3 A;  5AV6 C;  1TAF A;  2HIO A;  5G49 A;  4EO5 B;  3AZG D;  3AZH C;  2Y2L A;  3W97 B;  3R45 A;  3AZL D;  3MGP D;  5AV5 D;  3WA9 D;  1TZY D;  3LZ0 B;  5CP6 C;  4YM6 B;  4G91 B;  3X1V B;  3LZ0 A;  3LJA D;  3O62 A;  3REH C;  3X1S B;  3MNN D;  3A6N C;  1P3A B;  3AZK A;  4WV4 B;  4R8P C;  3X1V A;  3KUY C;  5B2I C;  1P3K C;  2DQN C;  3VH5 A;  2FJ7 B;  3TU4 D;  1KX3 A;  1KX5 C;  2RVQ C;  4XZQ B;  3AZM C;  5B2J D;  5B0Y B;  3X1U D;  1ZLA C;  3AYW D;  5DNM D;  2CV5 C;  3WAA B;  1F1E A;  4XZQ A;  5B0Y A;  3REL C;  1S32 D;  3AV2 C;  3WKJ A;  4AWL B;  4J8U B;  5F99 A;  4XUJ C;  5B0Z D;  5GSU B;  5BS7 A;  4ZUX B;  5JA4 B;  4J8U A;  1M1A A;  2BYK B;  3W98 C;  5GSU A;  4X23 B;  3AZF B;  5B40 B;  3LEL A;  4KUD B;  4QLC C;  3UT9 D;  3AZF A;  4UUZ B;  5BT1 D;  5AVB B;  1P3B A;  5B40 A;  1ID3 D;  2HIO D;  3X1T A;  1AOI B;  5B32 B;  1R4V A;  3W96 B;  3WTP B;  1AOI A;  5C3I C;  1P3L C;  3W96 A;  4Z66 C;  4WU9 A;  4H9R B;  3AZE B;  4Z5T C;  4H9S A;  3WTP E;  5CPK A;  3LZ0 D;  4NE3 A;  1P34 B;  5B31 C;  3O62 D;  1Z2C B;  5GXQ C;  3V9R B;  2NQB C;  3MGQ B;  3AZK D;  3X1V D;  1P3I C;  5AV6 A;  2PYO C;  4H9O B;  3AZH A;  4EO5 C;  1KX3 D;  2F8N B;  3W97 C;  3NQJ B;  4H9O A;  3IP4 C;  4DRA A;  1H3O A;  2F8N A;  4XZQ D;  3NQJ A;  2F8N H;  5CP6 A;  5B0Y D;  2JCH A;  3H0L C;  4YM6 C;  3A6N B;  1BH9 B;  5DNN B;  3REJ C;  3WKJ D;  4G91 C;  4R8P B;  3REH A;  5F99 D;  1BH9 A;  4WNN B;  4H9N B;  3KUY B;  3X1S C;  2J8P A;  1P3A C;  4R8P A;  1P3K B;  1KX5 B;  1M1A D;  4J8U D;  1PZR A;  1KX4 C;  3AZM B;  5GSU D;  3KUY A;  3EPL A;  5B2I A;  3AN2 C;  1P3K A;  1ZLA B;  2FFF B;  2CV5 B;  1KX5 A;  2FJ7 C;  3AZM A;  3LEL D;  3AZF D;  3MGR C;  3AV2 B;  2CV5 A;  4WU8 C;  2Y2P A;  1P3B D;  5B40 D;  3WAA C;  3X1T D;  4XUJ B;  3REL A;  3AV2 A;  4XUJ A;  5CPI B;  1M18 B;  1AOI D;  3C1C B;  3AZJ B;  3W96 D;  4WU9 D;  4ZUX C;  5AV8 B;  3W98 A;  2ZY5 A;  2Y2K A;  4QLC B;  5CPK D;  4X23 C;  5KDM B;  2YFW B;  2G5H C;  4QLC A;  4KUD C;  5KDM A;  2NZD B;  5AV6 D;  4Z2M G;  5AVB C;  5C3I B;  3AZH D;  1P3L B;  5B32 C;  1P3F B;  2CWE A;  4Z5T B;  3WTP C;  1P3L A;  2F8N D;  4Z66 A;  5CP6 D;  1P3G C;  5CHL B;  5GXQ B;  3H0M C;  4Z5T A;  3AZE C;  5GT3 C;  3KSY A;  5B31 A;  1P3I B;  3REH D;  1T3U A;  5GXQ A;  1P34 C;  2PYO B;  2NQB A;  2W8S A;  3MGQ C;  2BYM B;  4R8P D;  1P3I A;  1N1J B;  2PYO A;  1F66 B;  3KUY D;  5B2I D;  1P3K D;  2Y2J A;  3AV1 C;  2RVQ D;  1KX5 D;  3W97 A;  3AZM D;  2YFV B;  5GT0 B;  4UPK A;  3REJ B;  2CV5 D;  2YFV A;  3REL D;  4YM6 A;  3AV2 D;  1P3M C;  1HTA A;  3REJ A;  5DNN C;  1KX4 B;  4XUJ D;  1P3O C;  3VH6 T;  3X1S A;  3AN2 B;  5CPJ B;  1P3A A;  3LZ1 B;  1KX4 A;  5B31 G;  3W98 D;  3AN2 A;  4J8V C;  3MGR B;  5BNX B;  2FJ7 A;  4WU8 B;  3MGS B;  4QLC D;  3MGR A;  4WU8 A;  4JJN C;  3WAA A;  2Y2Q A;  3KXB C;  1Q9C A;  2XD5 A;  4M6B A;  2ZY3 A;  1HQ3 C;  3EPJ A;  1M18 C;  5CPI C;  3AZN B;  1P3L D;  5B1M B;  3C1C C;  3AZJ C;  4Z66 D;  4ZUX A;  4Z5T D;  5JA4 A;  5AV8 C;  2BYK A;  5JRG C;  4X23 A;  3VH6 W;  3W99 B;  5B31 D;  5GXQ D;  2F2A C;  2NQB D;  1B67 A;  4KUD A;  4HGA C;  3B6G C;  3REK C;  1P3I D;  4UUZ A;  2PYO D;  5AVB A;  2NZD C;  4KGC C;  5E5A C;  1WWI A;  5B32 A;  2G5I C;  2ZM5 A;  3W97 D;  1P3F C;  1P3G B;  2LY8 A;  3P5J B;  3WTP A;  2ARO B;  5GT3 B;  3A1K A;  1BH8 B;  1P3P B;  4H9R A;  1P3G A;  3AZE A;  4YM6 D;  5B1L C;  5GT3 A;  3REJ D;  3EPH A;  4J8W B;  1BH8 A;  3UTB B;  1P34 A;  4J8X C;  3X1S D;  3V9R A;  1P3A D;  3MGQ A;  2Y2H A;  3AV1 B;  1KX4 D;  1W2E A;  2IO5 C;  2Y2M A;  3AN2 D;  1F66 C;  5B0Z C;  3AV1 A;  2FJ7 D;  1EQZ B;  3MGR D;  3REI B;  1P3M B;  4WU8 D;  5GT0 C;  5AY8 B;  3MVD C;  3WAA D;  2VQR A;  1P3O B;  1P3M A;  3A6N A;  3NQU B;  3EPK A;  5DNN A;  5AV9 C;  3UT9 C;  1U35 B;  3UTA B;  1P3O A;  4WNN A;  4H9N A;  3B0B A;  5BNV B;  5B24 B;  4J8V B;  3LZ1 C;  5CPJ C;  4ZUX D;  4LD9 B;  3B0D C;  4J8V A;  4X23 D;  1ZLA A;  4JJN B;  4KUD D;  3MGS C;  3FDD A;  4JJN A;  3KXB B;  5AVB D;  2F8N G;  1HQ3 B;  4YS3 C;  3AZK C;  5B32 D;  3AZG B;  3KXB A;  1M19 C;  4NE6 A;  2Y2G A;  1HQ3 A;  3WTP D;  1M18 A;  5CPI A;  5JRG B;  5AVC C;  3C1C A;  3AZL B;  3AZJ A;  4NE5 A;  3AZN C;  5B1M C;  2ZY4 A;  1TZY B;  5AV5 B;  4DQY B;  1P3G D;  3AZE D;  5AV8 A;  5JRG A;  5GT3 D;  1BFM A;  4HGA B;  3B6G B;  4H9Q B;  3REK B;  3W99 C;  2YFW A;  4KHA B;  1P34 D;  3LJA B;  3MGQ D;  3MNN B;  3REK A;  5E5A B;  3B6G A;  4KGC B;  3A1I A;  2L5A A;  4KHA A;  2NZD A;  4KGC A;  5E5A A;  2HUE C;  3AV1 D;  3VH6 A;  1P3F A;  1M1A C;  4H9P B;  5B1L B;  3X1U B;  2ARO C;  3AYW B;  1A7W A;  3AFA C;  4J8X B;  1P3P C;  1P3M D;  5B1L A;  3A6N D;  5DNN D;  3B6F C;  2IO5 B;  4J8W C;  4J8X A;  3UTB C;  1P3O D;  4CSR B;  3AL0 C;  5B0Z B;  2BYM A;  1N1J A;  4E44 A;  1F66 A;  4J8V D;  1ZLA D;  3MVD B;  1EQZ C;  3REI C;  5GT0 A;  5AV9 B;  3UT9 B;  3MVD A;  4G92 C;  5AY8 C;  1ID3 B;  2HIO B;  3C1B C;  5AV9 A;  3KXB D;  1U35 C;  3B0C T;  1HQ3 D;  3KWQ C;  3UTA C;  1M18 D;  5CPI D;  3R45 B;  3C1C D;  3B0D B;  3AZJ D;  5CPJ A;  3LZ1 A;  5B24 C;  5AV8 D;  5JRG D;  2UWX A;  4LD9 C;  5BNX A;  5B33 C;  3O62 B;  3MGS A;  3AZI C;  3B6G D;  4ZBJ B;  3REK D;  4YS3 B;  3AZK B;  1M19 B;  2NZD D;  1ULY A;  2ZY2 A;  4KGC D;  5E5A D;  4YS3 A;  5AVC B;  3AZG C;  1M19 A;  1KX3 B;  1P3F D;  5AVC A;  2XD1 A;  3AZN A;  3AZL C;  5B1M A;  3MGP C;  5AV5 C;  3WA9 C;  1TZY C;  3B0C W;  5B1L D;  2DF4 C;  3WKJ B;  3W99 A;  4J8X D;  5FUG B;  5F99 B;  3LJA C;  2HUE B;  3MNN C;  5FUG A;  1M1A B;  1F66 D;  4WZS B;  3AFA B;  3TU4 C;  3LEL B;  4DRB A;  2ARO A;  5B2J C;  5GT0 D;  3X1U C;  2Y2O A;  3MVD D;  3AYW C;  3AFA A;  3B6F B;  5DNM C;  1P3B B;  1P3P A;  4NFT A;  3X1T B;  5AV9 D;  3B6F A;  1S32 C;  2JSS A;  4J8W A;  3UTB A;  3VH5 T;  5CPJ D;  3LZ1 D;  2RIQ A;  4WU9 B;  3F6T A;  5CPK B;  4G92 B;  5B32 G;  3MGS D;  1EQZ A;  3C1B B;  3REI A;  5AY8 A;  3KWQ B;  5AV6 B;  5BT1 C;  4YS3 D;  1ID3 C;  3C1B A;  2HIO C;  3AZH B;  3NQU A;  1U35 A;  1M19 D;  3KWQ A;  3UTA A;  5AVC D;  2Y2I A;  3AZN D;  1H3O B;  5B1M D;  5BNV A;  5B24 A;  1JFI B;  5B33 B;  5CP6 B;  3AZI B;  4LD9 A;  1JFI A;  3W99 D;  2JE5 A;  3VH5 W;  5B33 A;  3LZ0 C;  3REH B;  2BG1 A;  4E45 A;  3AZI A;  3O62 C;  4ZBJ C;  3X1V C;  3KFU G;  4WJ3 C;  3EG5 B;  1B6W A;  5B2I B;  3AZG A;  3MGP B;  3WA9 B;  1KX3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...