1F66A

2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PALINDROMIC 146 BASE PAIR DNA FRAGMENT
publication title Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f66A00
5GT0D 3W99B 4XUJB 2NZDB 3REKC 3AZGA 4H9NA 3X1TB 1ID3C 3AZED 5F99C 4H9QA 5B24B 4ZBJC 1JFIA 5CPJD 1P3BC 3AFAB 3WTPE 3KXBA 1P3LB 3AZJD 5B40C 5B1LB 5DNMD 5DNNA 3MGQC 4J8VC 1P3IB 1EQZB 5CP6B 3REJB 5C3IB 5AV6D 4WZSB 3C1CD 3X1TC 4ZUXC 4H9SC 5B24C 1P3AD 2PYOD 3AFAC 4X23A 3AZHC 3B6FD 5B32B 4YM6A 5B1LC 4CAYA 1M19A 1A7WA 3LELB 3VH5T 5B2JC 3AV2D 3WAAB 1EQZC 5C3IC 3UTAC 1F66B 4J8WC 1U35B 5B2IC 1P34B 2AROA 2RVQD 3X1UD 3MGPA 5B33D 3MVDC 2L5AA 5AVCB 3AZMA 5B32C 1TAFA 5JRGA 4AWLB 3TU4A 3AZKA 2CV5D 3REIA 4WNNB 1M18A 5GXQC 2LY8A 1F66C 1ULYA 5AVBD 1BH9A 3UT9A 3AZEB 4QLCB 3LZ1A 3AZLD 2HUEC 5CPJB 4WU9C 1AOID 3MGSC 3MGRB 5GSUA 4R8PD 5GT0A 5AVCC 5BS7A 3WA9D 5B1MD 4LD9D 3W97A 3W96D 2FJ7C 4KHAB 3V9RA 3X1VC 1P3MD 5B31B 4KUDD 4NE6A 3B0DB 4J8UC 3WKJD 4Z66B 3MGRC 3LJAC 4Z5TA 3RELB 3B6FB 4XZQC 5BNXA 5AV6A 4E45A 3AV2B 3C1CA 5CPKB 3LZ0B 1ZLAB 2HIOD 2YFVA 3AZGD 4G91C 3KWQD 4J8XD 2FJ7A 3AZFD 3W98C 5AV9A 2CV5B 5B0YA 3X1SC 3NQJB 3KXBD 2NQBC 3MNNC 1P3GA 3LZ0C 1M1AB 4G92B 1B67A 3X1UA 5B33A 1KX3C 3REKD 3C1BA 4H9OA 4KGCB 5BNVB 1ID3D 1KX5B 5GT3A 4X23D 4UUZB 1S32C 4LD9B 4YM6D 5F99D 5CPIC 3AZNA 1M19D 3W96B 3A6NA 1P3OC 1P3FC 5AVBA 1P3BD 1P3PA 1M1AC 1P3MB 4G92C 5E5AB 5AV8A 3WTPC 3MNNA 1KX4A 1HQ3C 1AOIA 3AN2B 5BT1C 4R8PA 3WKJB 3AV1A 2AROD 3WA9A 4KGCC 3MGPD 5B1MA 1KX5C 3REHA 3KUYB 2IO5C 3AZMD 4ZUXD 5AV5C 1M18D 3AZIA 1S32A 3AZHD 4Z2MH 4WV4B 3AZGB 3B6GA 4H9NB 3KSYA 3UT9D 2BYMA 2YFWA 3AN2C 5B2JD 1BFMA 1H3OB 3VH6A 3UTBA 4EO5B 1HQ3A 5GSUD 5AY8A 3KUYC 5B2ID 5DNNB 4YS3B 2HIOA 5B0ZA 3W97D 3MVDD 4J8XA 3KWQA 4WU8B 5AV5A 5CHLB 3AZFA 5GXQD 3AYWA 3NQUA 4X23B 3B0CW 4Z5TD 3W99C 3O62A 1TZYB 4CAYB 4XUJC 1M19B 4NE5A 1P3KA 2NZDC 4YS3C 4JJNA 4WU9D 3MGSD 4WU8C 3REKA 1B6WA 2AROB 2FJ7D 1ID3A 1P3LC 4H9PA 5F99A 5JRGB 1TAFB 5AV9D 5B0YD 3TU4B 3AZKB 1TZYC 1P3BA 3REIB 4J8UD 1P3IC 5CP6C 3REJC 5B40A 1P3GD 3LJAD 5FUGA 3MGQA 4J8VA 3UT9B 1Q9CA 3LZ1B 3X1TA 5G49A 5GSUB 5GT0B 5B32G 4ZUXA 4H9SA 5B24A 3R45A 3C1BD 5GT3D 3LELC 3AFAA 3WAAC 3AZHA 3W97B 3AZND 5B1LA 3A6ND 3W98D 1U35C 1P3PD 5B2JA 1P34C 5AV8D 1EQZA 3MNND 1KX4D 3UTAA 4HGAB 4J8WA 4DRBA 3AZJB 5B2IA 3AV1D 4AWLC 5DNMB 3MVDA 3REHD 5AV6B 5B32A 3C1CB 3AZEC 5GXQA 3AZID 4QLCC 1S32D 1N1JA 4DRAA 1P3AB 2PYOB 3B6GD 5CPJC 1F66A 3AZJC 3UTBD 5DNMC 5AV9B 3WTPD 4WU9A 1HQ3D 3MGSA 5AY8D 5AVCA 1P3GB 5B0ZD 2F8NG 4H9RB 5KDMA 5B31C 1P3AC 3X1UB 3B0DC 5B31G 5B33B 5AV5D 2PYOC 3X1VA 4Z66C 3RELC 3B6FC 3VH6T 3AYWD 4H9OB 4J8UA 5GT3B 3MGRA 3AV2C 3LJAA 3O62D 3AZNB 3VH6W 4XZQA 5CPKC 3A6NB 1P3KD 4JJND 1ZLAC 5AVBB 3VH5A 3AZLB 5BO0A 2RVQC 1AOIB 2F8NA 4R8PB 2CV5C 4CSRA 3WA9B 5B1MB 4Z66A 3W98A 3X1SA 2NQBA 5B40D 3AZLC 4KUDB 3W99D 3MGQD 3LZ0A 2NZDD 4J8VD 2BYMB 2YFWB 3X1TD 1KX3A 5AY8B 4LD9C 3W96C 5B24D 2BYKA 2HIOB 3AFAD 1P3MC 1P3LD 5E5AC 4J8XB 5B1LD 3KWQB 5CPIA 1P3OA 4KUDC 1P3FA 3AZFB 1M1AA 4H9QB 3WKJC 1JFIB 1EQZD 3UTAD 3WTPA 3AYWB 3NQUB 4J8WD 3KXBB 3O62B 5JA4A 4KGCA 1P3KB 1KX5A 1BH8A 5B32D 3AZGC 3REKB 3B0CT 3LELD 3B0BA 4NE3A 1F66D 4EO5C 1ID3B 1U35D 3KXBC 3AN2A 4H9PB 4YM6B 5F99B 1P34D 4ZBJB 5DNNC 1P3BB 3KUYA 5AVCD 5FUGB 3MGQB 4J8VB 3MGPB 3X1VD 5G49B 4X23C 3AZMB 4QLCD 4YM6C 4ZUXB 1H3OA 3R45B 1M18B 1M19C 3MGRD 1WWIA 3AZHB 3W99A 4XZQD 4XUJA 2NZDA 4YS3A 1BH9B 4Z2MG 5B2JB 2AROC 3UTAB 4WU8A 4J8WB 3MGPC 2F8ND 5B2IB 3AZMC 5JRGC 3TU4C 3AZKC 5B31D 3REIC 1M18C 1P3LA 3MVDB 4Z66D 3RELD 3V9RB 1TZYA 3X1SD 2NQBD 1P3IA 5GXQB 5CP6A 3REJA 1WWSA 1N1JB 3LZ1C 3UT9C 2F8NH 5CPKD 3LZ0D 1ZLAD 5GSUC 1HTAA 4Z5TB 3VH5W 5GT0C 2HUEB 5BS7C 4WU9B 1KX3D 5BNXB 3MGSB 3W97C 2CWEA 3LELA 2YFVB 5KDMB 3WAAA 5CPID 2FJ7B 4HGAC 1P3OD 1U35A 1P3FD 1M1AD 3X1VB 1P34A 4Z5TC 5B0YB 4J8UB 5BT1D 2JSSA 5AV6C 3LJAB 3C1CC 1R4VA 4XZQB 4WNNA 4KGCD 1KX5D 5BO0B 2F8NB 3AZEA 4QLCA 3C1BB 5E5AD 5AV9C 4G91B 4CSRB 5B0YC 5CPJA 3AN2D 3AZJA 1P3GC 5DNMA 3W98B 1P3PB 3X1SB 2NQBB 3KUYD 5AV8B 3MNNB 1KX4B 4KHAA 3X1UC 5B33C 3AV1B 3C1BC 5B31A 1P3AA 2PYOA 3REHB 5GT3C 1KX3B 3RELA 3B6FA 4M6BA 3AZNC 2BYKB 3A6NC 4E44A 5AVBC 1P3PC 3AZIB 1S32B 3AV2A 5AV8C 3B6GB 4XUJD 5CPIB 1KX4C 5DNND 5CPKA 1P3OB 4YS3D 1P3FB 1AOIC 1ZLAA 4R8PC 4H9RA 3AV1C 3UTBB 3WTPB 4WU8D 3WA9C 1HQ3B 5B1MC 3REHC 2CV5A 5JA4B 5B0ZB 3NQJA 4NFTA 3AZIC 2IO5B 1BH8B 3B6GC 1TZYD 5AV5B 1P3ID 5CP6D 3REJD 3AZLA 3UTBC 5AY8C 5BNVA 4JJNB 2HIOC 1F1EA 5B0ZC 4UUZA 4LD9A 4J8XC 3W96A 3KWQC 5JRGD 3TU4D 3AZKD 1KU5A 3REID 3AZFC 3WAAD 1P3MA 2F8NK 5E5AA 3AYWC 4KUDA 3WKJA 3O62C 3LZ1D 1P3KC 4JJNC 5B40B
chains in the Genus database with same CATH superfamily
5GT0D 3W99B 4XUJB 2NZDB 3REKC 3AZGA 4H9NA 3X1TB 1ID3C 3AZED 5F99C 4H9QA 5B24B 4ZBJC 1JFIA 5CPJD 1P3BC 3AFAB 3WTPE 3KXBA 1P3LB 3AZJD 5B40C 5B1LB 5DNMD 5DNNA 3MGQC 4J8VC 1P3IB 1EQZB 5CP6B 3REJB 5C3IB 5AV6D 4WZSB 3C1CD 3X1TC 4ZUXC 4H9SC 5B24C 1P3AD 2PYOD 3AFAC 4X23A 2F2AC 3AZHC 3B6FD 5B32B 4YM6A 5B1LC 4CAYA 1M19A 1A7WA 3EPLA 3LELB 3VH5T 5B2JC 3AV2D 3WAAB 1EQZC 5C3IC 3UTAC 1F66B 4J8WC 1U35B 5B2IC 1P34B 2AROA 2RVQD 3X1UD 2JCHA 3MGPA 5B33D 3MVDC 2L5AA 5AVCB 3AZMA 5B32C 1TAFA 5JRGA 4AWLB 3TU4A 3AZKA 2CV5D 3REIA 4WNNB 1M18A 5GXQC 2LY8A 1F66C 1ULYA 5AVBD 1BH9A 3UT9A 3AZEB 4QLCB 3LZ1A 3AZLD 2HUEC 2Y2GA 5CPJB 4WU9C 1AOID 3MGSC 3MGRB 5GSUA 4R8PD 5GT0A 5AVCC 5BS7A 3WA9D 5B1MD 4LD9D 3W97A 3W96D 2FJ7C 4KHAB 3IP4C 3V9RA 3X1VC 1P3MD 5B31B 4KUDD 4NE6A 3B0DB 4J8UC 3WKJD 4Z66B 3MGRC 3LJAC 4Z5TA 3RELB 3B6FB 4XZQC 2ZY3A 5BNXA 5AV6A 4E45A 3AV2B 3C1CA 5CPKB 3LZ0B 1ZLAB 2HIOD 2YFVA 3AZGD 4G91C 3KWQD 4J8XD 2FJ7A 1Z2CB 2Y2OA 3AZFD 3W98C 5AV9A 2CV5B 5B0YA 3X1SC 3NQJB 3KXBD 2NQBC 3MNNC 1P3GA 2Y2LA 3LZ0C 1M1AB 4G92B 1B67A 3X1UA 5B33A 1KX3C 3REKD 3C1BA 4H9OA 4KGCB 5BNVB 1ID3D 1KX5B 5GT3A 4X23D 4UUZB 1S32C 4LD9B 4YM6D 5F99D 5CPIC 3AZNA 1M19D 3W96B 3A6NA 1P3OC 1P3FC 5AVBA 1P3BD 1P3PA 1M1AC 1P3MB 4G92C 5E5AB 5AV8A 3WTPC 3MNNA 1KX4A 1HQ3C 3A1IA 1AOIA 3AN2B 5BT1C 4R8PA 3WKJB 3AV1A 2AROD 2Y2HA 3WA9A 4KGCC 3MGPD 5B1MA 1KX5C 3REHA 3KUYB 2IO5C 3AZMD 4ZUXD 5AV5C 1M18D 3EPJA 3AZIA 1S32A 3AZHD 4Z2MH 4WV4B 3AZGB 3B6GA 4H9NB 3KSYA 3F6TA 3UT9D 2BYMA 2YFWA 3AN2C 5B2JD 1BFMA 1H3OB 3VH6A 3UTBA 4EO5B 1HQ3A 5GSUD 5AY8A 3KUYC 5B2ID 5DNNB 4YS3B 2HIOA 5B0ZA 3W97D 3MVDD 4J8XA 3KWQA 4WU8B 5AV5A 5CHLB 3AZFA 5GXQD 3AYWA 3NQUA 4X23B 2Y2MA 3B0CW 3H0LC 4Z5TD 3W99C 3O62A 1TZYB 4CAYB 4XUJC 1M19B 4NE5A 1P3KA 3EPHA 2NZDC 4YS3C 4JJNA 4WU9D 3MGSD 2G5IC 4WU8C 3REKA 1B6WA 2AROB 2FJ7D 1ID3A 1P3LC 4H9PA 5F99A 5JRGB 1TAFB 5AV9D 5B0YD 4DQYB 3TU4B 1TZYC 3AZKB 3REIB 1P3BA 4J8UD 1P3IC 5CP6C 3REJC 3EG5B 5B40A 1P3GD 3LJAD 5FUGA 3MGQA 4J8VA 3UT9B 1Q9CA 2Y2JA 3LZ1B 3X1TA 5G49A 5GSUB 5GT0B 5B32G 4ZUXA 4H9SA 5B24A 3R45A 2G5HC 3C1BD 5GT3D 3LELC 3AFAA 3WAAC 3AZHA 3W97B 3AZND 2XD1A 5B1LA 3A6ND 3W98D 1U35C 1P3PD 3A1KA 5B2JA 1P34C 5AV8D 1EQZA 3MNND 2RIQA 3UTAA 1KX4D 4HGAB 4J8WA 4DRBA 3AZJB 5B2IA 3AV1D 4AWLC 5DNMB 3MVDA 3REHD 5AV6B 5B32A 3C1CB 2Y2PA 3AZEC 5GXQA 3AZID 4QLCC 1S32D 1N1JA 4DRAA 1P3AB 2PYOB 3B6GD 5CPJC 1F66A 3AZJC 3UTBD 5DNMC 5AV9B 3WTPD 4WU9A 1HQ3D 3MGSA 5AY8D 5AVCA 1P3GB 5B0ZD 2F8NG 4H9RB 5KDMA 5B31C 1P3AC 3X1UB 3B0DC 5B31G 5B33B 5AV5D 2PYOC 3X1VA 4Z66C 3RELC 3B6FC 1T3UA 3VH6T 3AYWD 4H9OB 4J8UA 5GT3B 3MGRA 3AV2C 3LJAA 3O62D 3AZNB 3VH6W 4XZQA 5CPKC 3A6NB 1P3KD 4JJND 1ZLAC 5AVBB 3VH5A 3AZLB 5BO0A 2RVQC 1AOIB 2F8NA 4R8PB 2CV5C 4CSRA 3WA9B 5B1MB 4Z66A 3W98A 3X1SA 2Y2QA 2NQBA 5B40D 3AZLC 4KUDB 3W99D 3MGQD 3LZ0A 2NZDD 4J8VD 2BYMB 2YFWB 2DQNC 3X1TD 1KX3A 2J8PA 5AY8B 4LD9C 3W96C 5B24D 2BYKA 2ZM5A 2HIOB 3AFAD 1P3MC 1P3LD 5E5AC 4J8XB 5B1LD 3KWQB 5CPIA 1P3OA 4KUDC 1P3FA 3AZFB 1M1AA 4H9QB 3WKJC 1JFIB 1EQZD 4WJ3C 3UTAD 3WTPA 3AYWB 3NQUB 4J8WD 3KXBB 3FDDA 3O62B 5JA4A 4KGCA 1P3KB 1KX5A 2UWXA 1BH8A 5B32D 3AZGC 3REKB 3B0CT 3LELD 3B0BA 4NE3A 1F66D 4EO5C 1ID3B 1U35D 3KXBC 3AN2A 4H9PB 4YM6B 5F99B 2XD5A 1P34D 4ZBJB 5DNNC 1P3BB 3KUYA 5AVCD 5FUGB 3MGQB 4J8VB 3MGPB 3X1VD 5G49B 4X23C 3AZMB 2Y2KA 3H0MC 4QLCD 4YM6C 4ZUXB 1H3OA 3R45B 3EPKA 1M18B 1M19C 3MGRD 1WWIA 2Y2NA 3AZHB 3W99A 4XZQD 4XUJA 2NZDA 4YS3A 1BH9B 4Z2MG 5B2JB 2AROC 3UTAB 4WU8A 4J8WB 3MGPC 2F8ND 5B2IB 3AZMC 5JRGC 3TU4C 3AZKC 5B31D 3REIC 1M18C 1P3LA 3MVDB 4Z66D 3RELD 3V9RB 1TZYA 3X1SD 2NQBD 1P3IA 5GXQB 5CP6A 3REJA 1WWSA 1N1JB 3LZ1C 3UT9C 2F8NH 5CPKD 3LZ0D 1ZLAD 5GSUC 1HTAA 4Z5TB 3VH5W 5GT0C 2HUEB 5BS7C 4WU9B 1KX3D 5BNXB 3MGSB 3W97C 2BG1A 2CWEA 3LELA 2YFVB 5KDMB 3WAAA 5CPID 2FJ7B 1W2EA 4HGAC 1P3OD 1U35A 1P3FD 1PZRA 1M1AD 3X1VB 1P34A 4Z5TC 3H0RC 5B0YB 4J8UB 5BT1D 2JSSA 5AV6C 3LJAB 3C1CC 1R4VA 4XZQB 4WNNA 4KGCD 1KX5D 5BO0B 2F8NB 3AZEA 4QLCA 3C1BB 5E5AD 5AV9C 4G91B 4CSRB 5B0YC 5CPJA 3AN2D 3AZJA 1P3GC 5DNMA 3W98B 1P3PB 3X1SB 2NQBB 2ZY4A 3KUYD 5AV8B 3MNNB 2ZY2A 1KX4B 4KHAA 2DF4C 3X1UC 5B33C 3AV1B 2VQRA 2W8SA 3C1BC 5B31A 1P3AA 2PYOA 3REHB 5GT3C 1KX3B 3RELA 3B6FA 4M6BA 3AZNC 2BYKB 2Y2IA 3A6NC 4E44A 5AVBC 1P3PC 3AZIB 1S32B 3AV2A 5AV8C 3B6GB 4XUJD 5CPIB 1KX4C 5DNND 5CPKA 1P3OB 4YS3D 1P3FB 1AOIC 1ZLAA 4R8PC 4H9RA 3AV1C 3KFUG 3UTBB 3P5JB 3AL0C 3WTPB 4WU8D 3WA9C 1HQ3B 5B1MC 2ZY5A 3REHC 2CV5A 4UPKA 5JA4B 5B0ZB 3NQJA 4NFTA 3AZIC 2IO5B 1BH8B 3B6GC 1TZYD 5AV5B 1P3ID 5CP6D 3REJD 3AZLA 3UTBC 2JE5A 5AY8C 5BNVA 4JJNB 2HIOC 1F1EA 5B0ZC 4UUZA 4LD9A 4J8XC 3W96A 3KWQC 5JRGD 3TU4D 3AZKD 1KU5A 3REID 3AZFC 3WAAD 1P3MA 2F8NK 5E5AA 3AYWC 4KUDA 3WKJA 3O62C 2FFFB 3LZ1D 1P3KC 4JJNC 5B40B
chains in the Genus database with same CATH topology
5GT0D 3W99B 4XUJB 2NZDB 3REKC 3AZGA 4H9NA 3X1TB 1ID3C 3AZED 5F99C 4H9QA 5B24B 4ZBJC 1JFIA 5CPJD 1P3BC 3AFAB 3WTPE 3KXBA 1P3LB 3AZJD 5B40C 5B1LB 5DNMD 5DNNA 3MGQC 4J8VC 1P3IB 1EQZB 5CP6B 3REJB 5C3IB 5AV6D 4WZSB 3C1CD 3X1TC 4ZUXC 4H9SC 5B24C 1P3AD 2PYOD 3AFAC 4X23A 2F2AC 3AZHC 3B6FD 5B32B 4YM6A 5B1LC 4CAYA 1M19A 1A7WA 3EPLA 3LELB 3VH5T 5B2JC 3AV2D 3WAAB 1EQZC 5C3IC 3UTAC 1F66B 4J8WC 1U35B 5B2IC 1P34B 2AROA 2RVQD 3X1UD 2JCHA 3MGPA 5B33D 3MVDC 2L5AA 5AVCB 3AZMA 5B32C 1TAFA 5JRGA 4AWLB 3TU4A 3AZKA 2CV5D 3REIA 4WNNB 1M18A 5GXQC 2LY8A 1F66C 1ULYA 5AVBD 1BH9A 3UT9A 3AZEB 4QLCB 3LZ1A 3AZLD 2HUEC 2Y2GA 5CPJB 4WU9C 1AOID 3MGSC 3MGRB 5GSUA 4R8PD 5GT0A 5AVCC 5BS7A 3WA9D 5B1MD 4LD9D 3W97A 3W96D 2FJ7C 4KHAB 3IP4C 3V9RA 3X1VC 1P3MD 5B31B 4KUDD 4NE6A 3B0DB 4J8UC 3WKJD 4Z66B 3MGRC 3LJAC 4Z5TA 3RELB 3B6FB 4XZQC 2ZY3A 5BNXA 5AV6A 4E45A 3AV2B 3C1CA 5CPKB 3LZ0B 1ZLAB 2HIOD 2YFVA 3AZGD 4G91C 3KWQD 4J8XD 2FJ7A 1Z2CB 2Y2OA 3AZFD 3W98C 5AV9A 2CV5B 5B0YA 3X1SC 3NQJB 3KXBD 2NQBC 3MNNC 1P3GA 2Y2LA 3LZ0C 1M1AB 4G92B 1B67A 3X1UA 5B33A 1KX3C 3REKD 3C1BA 4H9OA 4KGCB 5BNVB 1ID3D 1KX5B 5GT3A 4X23D 4UUZB 1S32C 4LD9B 4YM6D 5F99D 5CPIC 3AZNA 1M19D 3W96B 3A6NA 1P3OC 1P3FC 5AVBA 1P3BD 1P3PA 1M1AC 1P3MB 4G92C 5E5AB 5AV8A 3WTPC 3MNNA 1KX4A 1HQ3C 3A1IA 1AOIA 3AN2B 5BT1C 4R8PA 3WKJB 3AV1A 2AROD 2Y2HA 3WA9A 4KGCC 3MGPD 5B1MA 1KX5C 3REHA 3KUYB 2IO5C 3AZMD 4ZUXD 5AV5C 1M18D 3EPJA 3AZIA 1S32A 3AZHD 4Z2MH 4WV4B 3AZGB 3B6GA 4H9NB 3KSYA 3F6TA 3UT9D 2BYMA 2YFWA 3AN2C 5B2JD 1BFMA 1H3OB 3VH6A 3UTBA 4EO5B 1HQ3A 5GSUD 5AY8A 3KUYC 5B2ID 5DNNB 4YS3B 2HIOA 5B0ZA 3W97D 3MVDD 4J8XA 3KWQA 4WU8B 5AV5A 5CHLB 3AZFA 5GXQD 3AYWA 3NQUA 4X23B 2Y2MA 3B0CW 3H0LC 4Z5TD 3W99C 3O62A 1TZYB 4CAYB 4XUJC 1M19B 4NE5A 1P3KA 3EPHA 2NZDC 4YS3C 4JJNA 4WU9D 3MGSD 2G5IC 4WU8C 3REKA 1B6WA 2AROB 2FJ7D 1ID3A 1P3LC 4H9PA 5F99A 5JRGB 1TAFB 5AV9D 5B0YD 4DQYB 3TU4B 1TZYC 3AZKB 3REIB 1P3BA 4J8UD 1P3IC 5CP6C 3REJC 3EG5B 5B40A 1P3GD 3LJAD 5FUGA 3MGQA 4J8VA 3UT9B 1Q9CA 2Y2JA 3LZ1B 3X1TA 5G49A 5GSUB 5GT0B 5B32G 4ZUXA 4H9SA 5B24A 3R45A 2G5HC 3C1BD 5GT3D 3LELC 3AFAA 3WAAC 3AZHA 3W97B 3AZND 2XD1A 5B1LA 3A6ND 3W98D 1U35C 1P3PD 3A1KA 5B2JA 1P34C 5AV8D 1EQZA 3MNND 2RIQA 3UTAA 1KX4D 4HGAB 4J8WA 4DRBA 3AZJB 5B2IA 3AV1D 4AWLC 5DNMB 3MVDA 3REHD 5AV6B 5B32A 3C1CB 2Y2PA 3AZEC 5GXQA 3AZID 4QLCC 1S32D 1N1JA 4DRAA 1P3AB 2PYOB 3B6GD 5CPJC 1F66A 3AZJC 3UTBD 5DNMC 5AV9B 3WTPD 4WU9A 1HQ3D 3MGSA 5AY8D 5AVCA 1P3GB 5B0ZD 2F8NG 4H9RB 5KDMA 5B31C 1P3AC 3X1UB 3B0DC 5B31G 5B33B 5AV5D 2PYOC 3X1VA 4Z66C 3RELC 3B6FC 1T3UA 3VH6T 3AYWD 4H9OB 4J8UA 5GT3B 3MGRA 3AV2C 3LJAA 3O62D 3AZNB 3VH6W 4XZQA 5CPKC 3A6NB 1P3KD 4JJND 1ZLAC 5AVBB 3VH5A 3AZLB 5BO0A 2RVQC 1AOIB 2F8NA 4R8PB 2CV5C 4CSRA 3WA9B 5B1MB 4Z66A 3W98A 3X1SA 2Y2QA 2NQBA 5B40D 3AZLC 4KUDB 3W99D 3MGQD 3LZ0A 2NZDD 4J8VD 2BYMB 2YFWB 2DQNC 3X1TD 1KX3A 2J8PA 5AY8B 4LD9C 3W96C 5B24D 2BYKA 2ZM5A 2HIOB 3AFAD 1P3MC 1P3LD 5E5AC 4J8XB 5B1LD 3KWQB 5CPIA 1P3OA 4KUDC 1P3FA 3AZFB 1M1AA 4H9QB 3WKJC 1JFIB 1EQZD 4WJ3C 3UTAD 3WTPA 3AYWB 3NQUB 4J8WD 3KXBB 3FDDA 3O62B 5JA4A 4KGCA 1P3KB 1KX5A 2UWXA 1BH8A 5B32D 3AZGC 3REKB 3B0CT 3LELD 3B0BA 4NE3A 1F66D 4EO5C 1ID3B 1U35D 3KXBC 3AN2A 4H9PB 4YM6B 5F99B 2XD5A 1P34D 4ZBJB 5DNNC 1P3BB 3KUYA 5AVCD 5FUGB 3MGQB 4J8VB 3MGPB 3X1VD 5G49B 4X23C 3AZMB 2Y2KA 3H0MC 4QLCD 4YM6C 4ZUXB 1H3OA 3R45B 3EPKA 1M18B 1M19C 3MGRD 1WWIA 2Y2NA 3AZHB 3W99A 4XZQD 4XUJA 2NZDA 4YS3A 1BH9B 4Z2MG 5B2JB 2AROC 3UTAB 4WU8A 4J8WB 3MGPC 2F8ND 5B2IB 3AZMC 5JRGC 3TU4C 3AZKC 5B31D 3REIC 1M18C 1P3LA 3MVDB 4Z66D 3RELD 3V9RB 1TZYA 3X1SD 2NQBD 1P3IA 5GXQB 5CP6A 3REJA 1WWSA 1N1JB 3LZ1C 3UT9C 2F8NH 5CPKD 3LZ0D 1ZLAD 5GSUC 1HTAA 4Z5TB 3VH5W 5GT0C 2HUEB 5BS7C 4WU9B 1KX3D 5BNXB 3MGSB 3W97C 2BG1A 2CWEA 3LELA 2YFVB 5KDMB 3WAAA 5CPID 2FJ7B 1W2EA 4HGAC 1P3OD 1U35A 1P3FD 1PZRA 1M1AD 3X1VB 1P34A 4Z5TC 3H0RC 5B0YB 4J8UB 5BT1D 2JSSA 5AV6C 3LJAB 3C1CC 1R4VA 4XZQB 4WNNA 4KGCD 1KX5D 5BO0B 2F8NB 3AZEA 4QLCA 3C1BB 5E5AD 5AV9C 4G91B 4CSRB 5B0YC 5CPJA 3AN2D 3AZJA 1P3GC 5DNMA 3W98B 1P3PB 3X1SB 2NQBB 2ZY4A 3KUYD 5AV8B 3MNNB 2ZY2A 1KX4B 4KHAA 2DF4C 3X1UC 5B33C 3AV1B 2VQRA 2W8SA 3C1BC 5B31A 1P3AA 2PYOA 3REHB 5GT3C 1KX3B 3RELA 3B6FA 4M6BA 3AZNC 2BYKB 2Y2IA 3A6NC 4E44A 5AVBC 1P3PC 3AZIB 1S32B 3AV2A 5AV8C 3B6GB 4XUJD 5CPIB 1KX4C 5DNND 5CPKA 1P3OB 4YS3D 1P3FB 1AOIC 1ZLAA 4R8PC 4H9RA 3AV1C 3KFUG 3UTBB 3P5JB 3AL0C 3WTPB 4WU8D 3WA9C 1HQ3B 5B1MC 2ZY5A 3REHC 2CV5A 4UPKA 5JA4B 5B0ZB 3NQJA 4NFTA 3AZIC 2IO5B 1BH8B 3B6GC 1TZYD 5AV5B 1P3ID 5CP6D 3REJD 3AZLA 3UTBC 2JE5A 5AY8C 5BNVA 4JJNB 2HIOC 1F1EA 5B0ZC 4UUZA 4LD9A 4J8XC 3W96A 3KWQC 5JRGD 3TU4D 3AZKD 1KU5A 3REID 3AZFC 3WAAD 1P3MA 2F8NK 5E5AA 3AYWC 4KUDA 3WKJA 3O62C 2FFFB 3LZ1D 1P3KC 4JJNC 5B40B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 D;  3W99 B;  4XUJ B;  2NZD B;  3REK C;  3AZG A;  4H9N A;  3X1T B;  1ID3 C;  3AZE D;  5F99 C;  4H9Q A;  5B24 B;  4ZBJ C;  1JFI A;  5CPJ D;  1P3B C;  3AFA B;  3WTP E;  3KXB A;  1P3L B;  3AZJ D;  5B40 C;  5B1L B;  5DNM D;  5DNN A;  3MGQ C;  4J8V C;  1P3I B;  1EQZ B;  5CP6 B;  3REJ B;  5C3I B;  5AV6 D;  4WZS B;  3C1C D;  3X1T C;  4ZUX C;  4H9S C;  5B24 C;  1P3A D;  2PYO D;  3AFA C;  4X23 A;  3AZH C;  3B6F D;  5B32 B;  4YM6 A;  5B1L C;  4CAY A;  1M19 A;  1A7W A;  3LEL B;  3VH5 T;  5B2J C;  3AV2 D;  3WAA B;  1EQZ C;  5C3I C;  3UTA C;  1F66 B;  4J8W C;  1U35 B;  5B2I C;  1P34 B;  2ARO A;  2RVQ D;  3X1U D;  3MGP A;  5B33 D;  3MVD C;  2L5A A;  5AVC B;  3AZM A;  5B32 C;  1TAF A;  5JRG A;  4AWL B;  3TU4 A;  3AZK A;  2CV5 D;  3REI A;  4WNN B;  1M18 A;  5GXQ C;  2LY8 A;  1F66 C;  1ULY A;  5AVB D;  1BH9 A;  3UT9 A;  3AZE B;  4QLC B;  3LZ1 A;  3AZL D;  2HUE C;  5CPJ B;  4WU9 C;  1AOI D;  3MGS C;  3MGR B;  5GSU A;  4R8P D;  5GT0 A;  5AVC C;  5BS7 A;  3WA9 D;  5B1M D;  4LD9 D;  3W97 A;  3W96 D;  2FJ7 C;  4KHA B;  3V9R A;  3X1V C;  1P3M D;  5B31 B;  4KUD D;  4NE6 A;  3B0D B;  4J8U C;  3WKJ D;  4Z66 B;  3MGR C;  3LJA C;  4Z5T A;  3REL B;  3B6F B;  4XZQ C;  5BNX A;  5AV6 A;  4E45 A;  3AV2 B;  3C1C A;  5CPK B;  3LZ0 B;  1ZLA B;  2HIO D;  2YFV A;  3AZG D;  4G91 C;  3KWQ D;  4J8X D;  2FJ7 A;  3AZF D;  3W98 C;  5AV9 A;  2CV5 B;  5B0Y A;  3X1S C;  3NQJ B;  3KXB D;  2NQB C;  3MNN C;  1P3G A;  3LZ0 C;  1M1A B;  4G92 B;  1B67 A;  3X1U A;  5B33 A;  1KX3 C;  3REK D;  3C1B A;  4H9O A;  4KGC B;  5BNV B;  1ID3 D;  1KX5 B;  5GT3 A;  4X23 D;  4UUZ B;  1S32 C;  4LD9 B;  4YM6 D;  5F99 D;  5CPI C;  3AZN A;  1M19 D;  3W96 B;  3A6N A;  1P3O C;  1P3F C;  5AVB A;  1P3B D;  1P3P A;  1M1A C;  1P3M B;  4G92 C;  5E5A B;  5AV8 A;  3WTP C;  3MNN A;  1KX4 A;  1HQ3 C;  1AOI A;  3AN2 B;  5BT1 C;  4R8P A;  3WKJ B;  3AV1 A;  2ARO D;  3WA9 A;  4KGC C;  3MGP D;  5B1M A;  1KX5 C;  3REH A;  3KUY B;  2IO5 C;  3AZM D;  4ZUX D;  5AV5 C;  1M18 D;  3AZI A;  1S32 A;  3AZH D;  4Z2M H;  4WV4 B;  3AZG B;  3B6G A;  4H9N B;  3KSY A;  3UT9 D;  2BYM A;  2YFW A;  3AN2 C;  5B2J D;  1BFM A;  1H3O B;  3VH6 A;  3UTB A;  4EO5 B;  1HQ3 A;  5GSU D;  5AY8 A;  3KUY C;  5B2I D;  5DNN B;  4YS3 B;  2HIO A;  5B0Z A;  3W97 D;  3MVD D;  4J8X A;  3KWQ A;  4WU8 B;  5AV5 A;  5CHL B;  3AZF A;  5GXQ D;  3AYW A;  3NQU A;  4X23 B;  3B0C W;  4Z5T D;  3W99 C;  3O62 A;  1TZY B;  4CAY B;  4XUJ C;  1M19 B;  4NE5 A;  1P3K A;  2NZD C;  4YS3 C;  4JJN A;  4WU9 D;  3MGS D;  4WU8 C;  3REK A;  1B6W A;  2ARO B;  2FJ7 D;  1ID3 A;  1P3L C;  4H9P A;  5F99 A;  5JRG B;  1TAF B;  5AV9 D;  5B0Y D;  3TU4 B;  3AZK B;  1TZY C;  1P3B A;  3REI B;  4J8U D;  1P3I C;  5CP6 C;  3REJ C;  5B40 A;  1P3G D;  3LJA D;  5FUG A;  3MGQ A;  4J8V A;  3UT9 B;  1Q9C A;  3LZ1 B;  3X1T A;  5G49 A;  5GSU B;  5GT0 B;  5B32 G;  4ZUX A;  4H9S A;  5B24 A;  3R45 A;  3C1B D;  5GT3 D;  3LEL C;  3AFA A;  3WAA C;  3AZH A;  3W97 B;  3AZN D;  5B1L A;  3A6N D;  3W98 D;  1U35 C;  1P3P D;  5B2J A;  1P34 C;  5AV8 D;  1EQZ A;  3MNN D;  1KX4 D;  3UTA A;  4HGA B;  4J8W A;  4DRB A;  3AZJ B;  5B2I A;  3AV1 D;  4AWL C;  5DNM B;  3MVD A;  3REH D;  5AV6 B;  5B32 A;  3C1C B;  3AZE C;  5GXQ A;  3AZI D;  4QLC C;  1S32 D;  1N1J A;  4DRA A;  1P3A B;  2PYO B;  3B6G D;  5CPJ C;  1F66 A;  3AZJ C;  3UTB D;  5DNM C;  5AV9 B;  3WTP D;  4WU9 A;  1HQ3 D;  3MGS A;  5AY8 D;  5AVC A;  1P3G B;  5B0Z D;  2F8N G;  4H9R B;  5KDM A;  5B31 C;  1P3A C;  3X1U B;  3B0D C;  5B31 G;  5B33 B;  5AV5 D;  2PYO C;  3X1V A;  4Z66 C;  3REL C;  3B6F C;  3VH6 T;  3AYW D;  4H9O B;  4J8U A;  5GT3 B;  3MGR A;  3AV2 C;  3LJA A;  3O62 D;  3AZN B;  3VH6 W;  4XZQ A;  5CPK C;  3A6N B;  1P3K D;  4JJN D;  1ZLA C;  5AVB B;  3VH5 A;  3AZL B;  5BO0 A;  2RVQ C;  1AOI B;  2F8N A;  4R8P B;  2CV5 C;  4CSR A;  3WA9 B;  5B1M B;  4Z66 A;  3W98 A;  3X1S A;  2NQB A;  5B40 D;  3AZL C;  4KUD B;  3W99 D;  3MGQ D;  3LZ0 A;  2NZD D;  4J8V D;  2BYM B;  2YFW B;  3X1T D;  1KX3 A;  5AY8 B;  4LD9 C;  3W96 C;  5B24 D;  2BYK A;  2HIO B;  3AFA D;  1P3M C;  1P3L D;  5E5A C;  4J8X B;  5B1L D;  3KWQ B;  5CPI A;  1P3O A;  4KUD C;  1P3F A;  3AZF B;  1M1A A;  4H9Q B;  3WKJ C;  1JFI B;  1EQZ D;  3UTA D;  3WTP A;  3AYW B;  3NQU B;  4J8W D;  3KXB B;  3O62 B;  5JA4 A;  4KGC A;  1P3K B;  1KX5 A;  1BH8 A;  5B32 D;  3AZG C;  3REK B;  3B0C T;  3LEL D;  3B0B A;  4NE3 A;  1F66 D;  4EO5 C;  1ID3 B;  1U35 D;  3KXB C;  3AN2 A;  4H9P B;  4YM6 B;  5F99 B;  1P34 D;  4ZBJ B;  5DNN C;  1P3B B;  3KUY A;  5AVC D;  5FUG B;  3MGQ B;  4J8V B;  3MGP B;  3X1V D;  5G49 B;  4X23 C;  3AZM B;  4QLC D;  4YM6 C;  4ZUX B;  1H3O A;  3R45 B;  1M18 B;  1M19 C;  3MGR D;  1WWI A;  3AZH B;  3W99 A;  4XZQ D;  4XUJ A;  2NZD A;  4YS3 A;  1BH9 B;  4Z2M G;  5B2J B;  2ARO C;  3UTA B;  4WU8 A;  4J8W B;  3MGP C;  2F8N D;  5B2I B;  3AZM C;  5JRG C;  3TU4 C;  3AZK C;  5B31 D;  3REI C;  1M18 C;  1P3L A;  3MVD B;  4Z66 D;  3REL D;  3V9R B;  1TZY A;  3X1S D;  2NQB D;  1P3I A;  5GXQ B;  5CP6 A;  3REJ A;  1WWS A;  1N1J B;  3LZ1 C;  3UT9 C;  2F8N H;  5CPK D;  3LZ0 D;  1ZLA D;  5GSU C;  1HTA A;  4Z5T B;  3VH5 W;  5GT0 C;  2HUE B;  5BS7 C;  4WU9 B;  1KX3 D;  5BNX B;  3MGS B;  3W97 C;  2CWE A;  3LEL A;  2YFV B;  5KDM B;  3WAA A;  5CPI D;  2FJ7 B;  4HGA C;  1P3O D;  1U35 A;  1P3F D;  1M1A D;  3X1V B;  1P34 A;  4Z5T C;  5B0Y B;  4J8U B;  5BT1 D;  2JSS A;  5AV6 C;  3LJA B;  3C1C C;  1R4V A;  4XZQ B;  4WNN A;  4KGC D;  1KX5 D;  5BO0 B;  2F8N B;  3AZE A;  4QLC A;  3C1B B;  5E5A D;  5AV9 C;  4G91 B;  4CSR B;  5B0Y C;  5CPJ A;  3AN2 D;  3AZJ A;  1P3G C;  5DNM A;  3W98 B;  1P3P B;  3X1S B;  2NQB B;  3KUY D;  5AV8 B;  3MNN B;  1KX4 B;  4KHA A;  3X1U C;  5B33 C;  3AV1 B;  3C1B C;  5B31 A;  1P3A A;  2PYO A;  3REH B;  5GT3 C;  1KX3 B;  3REL A;  3B6F A;  4M6B A;  3AZN C;  2BYK B;  3A6N C;  4E44 A;  5AVB C;  1P3P C;  3AZI B;  1S32 B;  3AV2 A;  5AV8 C;  3B6G B;  4XUJ D;  5CPI B;  1KX4 C;  5DNN D;  5CPK A;  1P3O B;  4YS3 D;  1P3F B;  1AOI C;  1ZLA A;  4R8P C;  4H9R A;  3AV1 C;  3UTB B;  3WTP B;  4WU8 D;  3WA9 C;  1HQ3 B;  5B1M C;  3REH C;  2CV5 A;  5JA4 B;  5B0Z B;  3NQJ A;  4NFT A;  3AZI C;  2IO5 B;  1BH8 B;  3B6G C;  1TZY D;  5AV5 B;  1P3I D;  5CP6 D;  3REJ D;  3AZL A;  3UTB C;  5AY8 C;  5BNV A;  4JJN B;  2HIO C;  1F1E A;  5B0Z C;  4UUZ A;  4LD9 A;  4J8X C;  3W96 A;  3KWQ C;  5JRG D;  3TU4 D;  3AZK D;  1KU5 A;  3REI D;  3AZF C;  3WAA D;  1P3M A;  2F8N K;  5E5A A;  3AYW C;  4KUD A;  3WKJ A;  3O62 C;  3LZ1 D;  1P3K C;  4JJN C;  5B40 B; 
#chains in the Genus database with same CATH topology
 5GT0 D;  3W99 B;  4XUJ B;  2NZD B;  3REK C;  3AZG A;  4H9N A;  3X1T B;  1ID3 C;  3AZE D;  5F99 C;  4H9Q A;  5B24 B;  4ZBJ C;  1JFI A;  5CPJ D;  1P3B C;  3AFA B;  3WTP E;  3KXB A;  1P3L B;  3AZJ D;  5B40 C;  5B1L B;  5DNM D;  5DNN A;  3MGQ C;  4J8V C;  1P3I B;  1EQZ B;  5CP6 B;  3REJ B;  5C3I B;  5AV6 D;  4WZS B;  3C1C D;  3X1T C;  4ZUX C;  4H9S C;  5B24 C;  1P3A D;  2PYO D;  3AFA C;  4X23 A;  2F2A C;  3AZH C;  3B6F D;  5B32 B;  4YM6 A;  5B1L C;  4CAY A;  1M19 A;  1A7W A;  3EPL A;  3LEL B;  3VH5 T;  5B2J C;  3AV2 D;  3WAA B;  1EQZ C;  5C3I C;  3UTA C;  1F66 B;  4J8W C;  1U35 B;  5B2I C;  1P34 B;  2ARO A;  2RVQ D;  3X1U D;  2JCH A;  3MGP A;  5B33 D;  3MVD C;  2L5A A;  5AVC B;  3AZM A;  5B32 C;  1TAF A;  5JRG A;  4AWL B;  3TU4 A;  3AZK A;  2CV5 D;  3REI A;  4WNN B;  1M18 A;  5GXQ C;  2LY8 A;  1F66 C;  1ULY A;  5AVB D;  1BH9 A;  3UT9 A;  3AZE B;  4QLC B;  3LZ1 A;  3AZL D;  2HUE C;  2Y2G A;  5CPJ B;  4WU9 C;  1AOI D;  3MGS C;  3MGR B;  5GSU A;  4R8P D;  5GT0 A;  5AVC C;  5BS7 A;  3WA9 D;  5B1M D;  4LD9 D;  3W97 A;  3W96 D;  2FJ7 C;  4KHA B;  3IP4 C;  3V9R A;  3X1V C;  1P3M D;  5B31 B;  4KUD D;  4NE6 A;  3B0D B;  4J8U C;  3WKJ D;  4Z66 B;  3MGR C;  3LJA C;  4Z5T A;  3REL B;  3B6F B;  4XZQ C;  2ZY3 A;  5BNX A;  5AV6 A;  4E45 A;  3AV2 B;  3C1C A;  5CPK B;  3LZ0 B;  1ZLA B;  2HIO D;  2YFV A;  3AZG D;  4G91 C;  3KWQ D;  4J8X D;  2FJ7 A;  1Z2C B;  2Y2O A;  3AZF D;  3W98 C;  5AV9 A;  2CV5 B;  5B0Y A;  3X1S C;  3NQJ B;  3KXB D;  2NQB C;  3MNN C;  1P3G A;  2Y2L A;  3LZ0 C;  1M1A B;  4G92 B;  1B67 A;  3X1U A;  5B33 A;  1KX3 C;  3REK D;  3C1B A;  4H9O A;  4KGC B;  5BNV B;  1ID3 D;  1KX5 B;  5GT3 A;  4X23 D;  4UUZ B;  1S32 C;  4LD9 B;  4YM6 D;  5F99 D;  5CPI C;  3AZN A;  1M19 D;  3W96 B;  3A6N A;  1P3O C;  1P3F C;  5AVB A;  1P3B D;  1P3P A;  1M1A C;  1P3M B;  4G92 C;  5E5A B;  5AV8 A;  3WTP C;  3MNN A;  1KX4 A;  1HQ3 C;  3A1I A;  1AOI A;  3AN2 B;  5BT1 C;  4R8P A;  3WKJ B;  3AV1 A;  2ARO D;  2Y2H A;  3WA9 A;  4KGC C;  3MGP D;  5B1M A;  1KX5 C;  3REH A;  3KUY B;  2IO5 C;  3AZM D;  4ZUX D;  5AV5 C;  1M18 D;  3EPJ A;  3AZI A;  1S32 A;  3AZH D;  4Z2M H;  4WV4 B;  3AZG B;  3B6G A;  4H9N B;  3KSY A;  3F6T A;  3UT9 D;  2BYM A;  2YFW A;  3AN2 C;  5B2J D;  1BFM A;  1H3O B;  3VH6 A;  3UTB A;  4EO5 B;  1HQ3 A;  5GSU D;  5AY8 A;  3KUY C;  5B2I D;  5DNN B;  4YS3 B;  2HIO A;  5B0Z A;  3W97 D;  3MVD D;  4J8X A;  3KWQ A;  4WU8 B;  5AV5 A;  5CHL B;  3AZF A;  5GXQ D;  3AYW A;  3NQU A;  4X23 B;  2Y2M A;  3B0C W;  3H0L C;  4Z5T D;  3W99 C;  3O62 A;  1TZY B;  4CAY B;  4XUJ C;  1M19 B;  4NE5 A;  1P3K A;  3EPH A;  2NZD C;  4YS3 C;  4JJN A;  4WU9 D;  3MGS D;  2G5I C;  4WU8 C;  3REK A;  1B6W A;  2ARO B;  2FJ7 D;  1ID3 A;  1P3L C;  4H9P A;  5F99 A;  5JRG B;  1TAF B;  5AV9 D;  5B0Y D;  4DQY B;  3TU4 B;  1TZY C;  3AZK B;  3REI B;  1P3B A;  4J8U D;  1P3I C;  5CP6 C;  3REJ C;  3EG5 B;  5B40 A;  1P3G D;  3LJA D;  5FUG A;  3MGQ A;  4J8V A;  3UT9 B;  1Q9C A;  2Y2J A;  3LZ1 B;  3X1T A;  5G49 A;  5GSU B;  5GT0 B;  5B32 G;  4ZUX A;  4H9S A;  5B24 A;  3R45 A;  2G5H C;  3C1B D;  5GT3 D;  3LEL C;  3AFA A;  3WAA C;  3AZH A;  3W97 B;  3AZN D;  2XD1 A;  5B1L A;  3A6N D;  3W98 D;  1U35 C;  1P3P D;  3A1K A;  5B2J A;  1P34 C;  5AV8 D;  1EQZ A;  3MNN D;  2RIQ A;  3UTA A;  1KX4 D;  4HGA B;  4J8W A;  4DRB A;  3AZJ B;  5B2I A;  3AV1 D;  4AWL C;  5DNM B;  3MVD A;  3REH D;  5AV6 B;  5B32 A;  3C1C B;  2Y2P A;  3AZE C;  5GXQ A;  3AZI D;  4QLC C;  1S32 D;  1N1J A;  4DRA A;  1P3A B;  2PYO B;  3B6G D;  5CPJ C;  1F66 A;  3AZJ C;  3UTB D;  5DNM C;  5AV9 B;  3WTP D;  4WU9 A;  1HQ3 D;  3MGS A;  5AY8 D;  5AVC A;  1P3G B;  5B0Z D;  2F8N G;  4H9R B;  5KDM A;  5B31 C;  1P3A C;  3X1U B;  3B0D C;  5B31 G;  5B33 B;  5AV5 D;  2PYO C;  3X1V A;  4Z66 C;  3REL C;  3B6F C;  1T3U A;  3VH6 T;  3AYW D;  4H9O B;  4J8U A;  5GT3 B;  3MGR A;  3AV2 C;  3LJA A;  3O62 D;  3AZN B;  3VH6 W;  4XZQ A;  5CPK C;  3A6N B;  1P3K D;  4JJN D;  1ZLA C;  5AVB B;  3VH5 A;  3AZL B;  5BO0 A;  2RVQ C;  1AOI B;  2F8N A;  4R8P B;  2CV5 C;  4CSR A;  3WA9 B;  5B1M B;  4Z66 A;  3W98 A;  3X1S A;  2Y2Q A;  2NQB A;  5B40 D;  3AZL C;  4KUD B;  3W99 D;  3MGQ D;  3LZ0 A;  2NZD D;  4J8V D;  2BYM B;  2YFW B;  2DQN C;  3X1T D;  1KX3 A;  2J8P A;  5AY8 B;  4LD9 C;  3W96 C;  5B24 D;  2BYK A;  2ZM5 A;  2HIO B;  3AFA D;  1P3M C;  1P3L D;  5E5A C;  4J8X B;  5B1L D;  3KWQ B;  5CPI A;  1P3O A;  4KUD C;  1P3F A;  3AZF B;  1M1A A;  4H9Q B;  3WKJ C;  1JFI B;  1EQZ D;  4WJ3 C;  3UTA D;  3WTP A;  3AYW B;  3NQU B;  4J8W D;  3KXB B;  3FDD A;  3O62 B;  5JA4 A;  4KGC A;  1P3K B;  1KX5 A;  2UWX A;  1BH8 A;  5B32 D;  3AZG C;  3REK B;  3B0C T;  3LEL D;  3B0B A;  4NE3 A;  1F66 D;  4EO5 C;  1ID3 B;  1U35 D;  3KXB C;  3AN2 A;  4H9P B;  4YM6 B;  5F99 B;  2XD5 A;  1P34 D;  4ZBJ B;  5DNN C;  1P3B B;  3KUY A;  5AVC D;  5FUG B;  3MGQ B;  4J8V B;  3MGP B;  3X1V D;  5G49 B;  4X23 C;  3AZM B;  2Y2K A;  3H0M C;  4QLC D;  4YM6 C;  4ZUX B;  1H3O A;  3R45 B;  3EPK A;  1M18 B;  1M19 C;  3MGR D;  1WWI A;  2Y2N A;  3AZH B;  3W99 A;  4XZQ D;  4XUJ A;  2NZD A;  4YS3 A;  1BH9 B;  4Z2M G;  5B2J B;  2ARO C;  3UTA B;  4WU8 A;  4J8W B;  3MGP C;  2F8N D;  5B2I B;  3AZM C;  5JRG C;  3TU4 C;  3AZK C;  5B31 D;  3REI C;  1M18 C;  1P3L A;  3MVD B;  4Z66 D;  3REL D;  3V9R B;  1TZY A;  3X1S D;  2NQB D;  1P3I A;  5GXQ B;  5CP6 A;  3REJ A;  1WWS A;  1N1J B;  3LZ1 C;  3UT9 C;  2F8N H;  5CPK D;  3LZ0 D;  1ZLA D;  5GSU C;  1HTA A;  4Z5T B;  3VH5 W;  5GT0 C;  2HUE B;  5BS7 C;  4WU9 B;  1KX3 D;  5BNX B;  3MGS B;  3W97 C;  2BG1 A;  2CWE A;  3LEL A;  2YFV B;  5KDM B;  3WAA A;  5CPI D;  2FJ7 B;  1W2E A;  4HGA C;  1P3O D;  1U35 A;  1P3F D;  1PZR A;  1M1A D;  3X1V B;  1P34 A;  4Z5T C;  3H0R C;  5B0Y B;  4J8U B;  5BT1 D;  2JSS A;  5AV6 C;  3LJA B;  3C1C C;  1R4V A;  4XZQ B;  4WNN A;  4KGC D;  1KX5 D;  5BO0 B;  2F8N B;  3AZE A;  4QLC A;  3C1B B;  5E5A D;  5AV9 C;  4G91 B;  4CSR B;  5B0Y C;  5CPJ A;  3AN2 D;  3AZJ A;  1P3G C;  5DNM A;  3W98 B;  1P3P B;  3X1S B;  2NQB B;  2ZY4 A;  3KUY D;  5AV8 B;  3MNN B;  2ZY2 A;  1KX4 B;  4KHA A;  2DF4 C;  3X1U C;  5B33 C;  3AV1 B;  2VQR A;  2W8S A;  3C1B C;  5B31 A;  1P3A A;  2PYO A;  3REH B;  5GT3 C;  1KX3 B;  3REL A;  3B6F A;  4M6B A;  3AZN C;  2BYK B;  2Y2I A;  3A6N C;  4E44 A;  5AVB C;  1P3P C;  3AZI B;  1S32 B;  3AV2 A;  5AV8 C;  3B6G B;  4XUJ D;  5CPI B;  1KX4 C;  5DNN D;  5CPK A;  1P3O B;  4YS3 D;  1P3F B;  1AOI C;  1ZLA A;  4R8P C;  4H9R A;  3AV1 C;  3KFU G;  3UTB B;  3P5J B;  3AL0 C;  3WTP B;  4WU8 D;  3WA9 C;  1HQ3 B;  5B1M C;  2ZY5 A;  3REH C;  2CV5 A;  4UPK A;  5JA4 B;  5B0Z B;  3NQJ A;  4NFT A;  3AZI C;  2IO5 B;  1BH8 B;  3B6G C;  1TZY D;  5AV5 B;  1P3I D;  5CP6 D;  3REJ D;  3AZL A;  3UTB C;  2JE5 A;  5AY8 C;  5BNV A;  4JJN B;  2HIO C;  1F1E A;  5B0Z C;  4UUZ A;  4LD9 A;  4J8X C;  3W96 A;  3KWQ C;  5JRG D;  3TU4 D;  3AZK D;  1KU5 A;  3REI D;  3AZF C;  3WAA D;  1P3M A;  2F8N K;  5E5A A;  3AYW C;  4KUD A;  3WKJ A;  3O62 C;  2FFF B;  3LZ1 D;  1P3K C;  4JJN C;  5B40 B; 
#chains in the Genus database with same CATH homology
 5GT0 D;  3W99 B;  4XUJ B;  2NZD B;  3REK C;  3AZG A;  4H9N A;  3X1T B;  1ID3 C;  3AZE D;  5F99 C;  4H9Q A;  5B24 B;  4ZBJ C;  1JFI A;  5CPJ D;  1P3B C;  3AFA B;  3WTP E;  3KXB A;  1P3L B;  3AZJ D;  5B40 C;  5B1L B;  5DNM D;  5DNN A;  3MGQ C;  4J8V C;  1P3I B;  1EQZ B;  5CP6 B;  3REJ B;  5C3I B;  5AV6 D;  4WZS B;  3C1C D;  3X1T C;  4ZUX C;  4H9S C;  5B24 C;  1P3A D;  2PYO D;  3AFA C;  4X23 A;  2F2A C;  3AZH C;  3B6F D;  5B32 B;  4YM6 A;  5B1L C;  4CAY A;  1M19 A;  1A7W A;  3EPL A;  3LEL B;  3VH5 T;  5B2J C;  3AV2 D;  3WAA B;  1EQZ C;  5C3I C;  3UTA C;  1F66 B;  4J8W C;  1U35 B;  5B2I C;  1P34 B;  2ARO A;  2RVQ D;  3X1U D;  2JCH A;  3MGP A;  5B33 D;  3MVD C;  2L5A A;  5AVC B;  3AZM A;  5B32 C;  1TAF A;  5JRG A;  4AWL B;  3TU4 A;  3AZK A;  2CV5 D;  3REI A;  4WNN B;  1M18 A;  5GXQ C;  2LY8 A;  1F66 C;  1ULY A;  5AVB D;  1BH9 A;  3UT9 A;  3AZE B;  4QLC B;  3LZ1 A;  3AZL D;  2HUE C;  2Y2G A;  5CPJ B;  4WU9 C;  1AOI D;  3MGS C;  3MGR B;  5GSU A;  4R8P D;  5GT0 A;  5AVC C;  5BS7 A;  3WA9 D;  5B1M D;  4LD9 D;  3W97 A;  3W96 D;  2FJ7 C;  4KHA B;  3IP4 C;  3V9R A;  3X1V C;  1P3M D;  5B31 B;  4KUD D;  4NE6 A;  3B0D B;  4J8U C;  3WKJ D;  4Z66 B;  3MGR C;  3LJA C;  4Z5T A;  3REL B;  3B6F B;  4XZQ C;  2ZY3 A;  5BNX A;  5AV6 A;  4E45 A;  3AV2 B;  3C1C A;  5CPK B;  3LZ0 B;  1ZLA B;  2HIO D;  2YFV A;  3AZG D;  4G91 C;  3KWQ D;  4J8X D;  2FJ7 A;  1Z2C B;  2Y2O A;  3AZF D;  3W98 C;  5AV9 A;  2CV5 B;  5B0Y A;  3X1S C;  3NQJ B;  3KXB D;  2NQB C;  3MNN C;  1P3G A;  2Y2L A;  3LZ0 C;  1M1A B;  4G92 B;  1B67 A;  3X1U A;  5B33 A;  1KX3 C;  3REK D;  3C1B A;  4H9O A;  4KGC B;  5BNV B;  1ID3 D;  1KX5 B;  5GT3 A;  4X23 D;  4UUZ B;  1S32 C;  4LD9 B;  4YM6 D;  5F99 D;  5CPI C;  3AZN A;  1M19 D;  3W96 B;  3A6N A;  1P3O C;  1P3F C;  5AVB A;  1P3B D;  1P3P A;  1M1A C;  1P3M B;  4G92 C;  5E5A B;  5AV8 A;  3WTP C;  3MNN A;  1KX4 A;  1HQ3 C;  3A1I A;  1AOI A;  3AN2 B;  5BT1 C;  4R8P A;  3WKJ B;  3AV1 A;  2ARO D;  2Y2H A;  3WA9 A;  4KGC C;  3MGP D;  5B1M A;  1KX5 C;  3REH A;  3KUY B;  2IO5 C;  3AZM D;  4ZUX D;  5AV5 C;  1M18 D;  3EPJ A;  3AZI A;  1S32 A;  3AZH D;  4Z2M H;  4WV4 B;  3AZG B;  3B6G A;  4H9N B;  3KSY A;  3F6T A;  3UT9 D;  2BYM A;  2YFW A;  3AN2 C;  5B2J D;  1BFM A;  1H3O B;  3VH6 A;  3UTB A;  4EO5 B;  1HQ3 A;  5GSU D;  5AY8 A;  3KUY C;  5B2I D;  5DNN B;  4YS3 B;  2HIO A;  5B0Z A;  3W97 D;  3MVD D;  4J8X A;  3KWQ A;  4WU8 B;  5AV5 A;  5CHL B;  3AZF A;  5GXQ D;  3AYW A;  3NQU A;  4X23 B;  2Y2M A;  3B0C W;  3H0L C;  4Z5T D;  3W99 C;  3O62 A;  1TZY B;  4CAY B;  4XUJ C;  1M19 B;  4NE5 A;  1P3K A;  3EPH A;  2NZD C;  4YS3 C;  4JJN A;  4WU9 D;  3MGS D;  2G5I C;  4WU8 C;  3REK A;  1B6W A;  2ARO B;  2FJ7 D;  1ID3 A;  1P3L C;  4H9P A;  5F99 A;  5JRG B;  1TAF B;  5AV9 D;  5B0Y D;  4DQY B;  3TU4 B;  1TZY C;  3AZK B;  3REI B;  1P3B A;  4J8U D;  1P3I C;  5CP6 C;  3REJ C;  3EG5 B;  5B40 A;  1P3G D;  3LJA D;  5FUG A;  3MGQ A;  4J8V A;  3UT9 B;  1Q9C A;  2Y2J A;  3LZ1 B;  3X1T A;  5G49 A;  5GSU B;  5GT0 B;  5B32 G;  4ZUX A;  4H9S A;  5B24 A;  3R45 A;  2G5H C;  3C1B D;  5GT3 D;  3LEL C;  3AFA A;  3WAA C;  3AZH A;  3W97 B;  3AZN D;  2XD1 A;  5B1L A;  3A6N D;  3W98 D;  1U35 C;  1P3P D;  3A1K A;  5B2J A;  1P34 C;  5AV8 D;  1EQZ A;  3MNN D;  2RIQ A;  3UTA A;  1KX4 D;  4HGA B;  4J8W A;  4DRB A;  3AZJ B;  5B2I A;  3AV1 D;  4AWL C;  5DNM B;  3MVD A;  3REH D;  5AV6 B;  5B32 A;  3C1C B;  2Y2P A;  3AZE C;  5GXQ A;  3AZI D;  4QLC C;  1S32 D;  1N1J A;  4DRA A;  1P3A B;  2PYO B;  3B6G D;  5CPJ C;  1F66 A;  3AZJ C;  3UTB D;  5DNM C;  5AV9 B;  3WTP D;  4WU9 A;  1HQ3 D;  3MGS A;  5AY8 D;  5AVC A;  1P3G B;  5B0Z D;  2F8N G;  4H9R B;  5KDM A;  5B31 C;  1P3A C;  3X1U B;  3B0D C;  5B31 G;  5B33 B;  5AV5 D;  2PYO C;  3X1V A;  4Z66 C;  3REL C;  3B6F C;  1T3U A;  3VH6 T;  3AYW D;  4H9O B;  4J8U A;  5GT3 B;  3MGR A;  3AV2 C;  3LJA A;  3O62 D;  3AZN B;  3VH6 W;  4XZQ A;  5CPK C;  3A6N B;  1P3K D;  4JJN D;  1ZLA C;  5AVB B;  3VH5 A;  3AZL B;  5BO0 A;  2RVQ C;  1AOI B;  2F8N A;  4R8P B;  2CV5 C;  4CSR A;  3WA9 B;  5B1M B;  4Z66 A;  3W98 A;  3X1S A;  2Y2Q A;  2NQB A;  5B40 D;  3AZL C;  4KUD B;  3W99 D;  3MGQ D;  3LZ0 A;  2NZD D;  4J8V D;  2BYM B;  2YFW B;  2DQN C;  3X1T D;  1KX3 A;  2J8P A;  5AY8 B;  4LD9 C;  3W96 C;  5B24 D;  2BYK A;  2ZM5 A;  2HIO B;  3AFA D;  1P3M C;  1P3L D;  5E5A C;  4J8X B;  5B1L D;  3KWQ B;  5CPI A;  1P3O A;  4KUD C;  1P3F A;  3AZF B;  1M1A A;  4H9Q B;  3WKJ C;  1JFI B;  1EQZ D;  4WJ3 C;  3UTA D;  3WTP A;  3AYW B;  3NQU B;  4J8W D;  3KXB B;  3FDD A;  3O62 B;  5JA4 A;  4KGC A;  1P3K B;  1KX5 A;  2UWX A;  1BH8 A;  5B32 D;  3AZG C;  3REK B;  3B0C T;  3LEL D;  3B0B A;  4NE3 A;  1F66 D;  4EO5 C;  1ID3 B;  1U35 D;  3KXB C;  3AN2 A;  4H9P B;  4YM6 B;  5F99 B;  2XD5 A;  1P34 D;  4ZBJ B;  5DNN C;  1P3B B;  3KUY A;  5AVC D;  5FUG B;  3MGQ B;  4J8V B;  3MGP B;  3X1V D;  5G49 B;  4X23 C;  3AZM B;  2Y2K A;  3H0M C;  4QLC D;  4YM6 C;  4ZUX B;  1H3O A;  3R45 B;  3EPK A;  1M18 B;  1M19 C;  3MGR D;  1WWI A;  2Y2N A;  3AZH B;  3W99 A;  4XZQ D;  4XUJ A;  2NZD A;  4YS3 A;  1BH9 B;  4Z2M G;  5B2J B;  2ARO C;  3UTA B;  4WU8 A;  4J8W B;  3MGP C;  2F8N D;  5B2I B;  3AZM C;  5JRG C;  3TU4 C;  3AZK C;  5B31 D;  3REI C;  1M18 C;  1P3L A;  3MVD B;  4Z66 D;  3REL D;  3V9R B;  1TZY A;  3X1S D;  2NQB D;  1P3I A;  5GXQ B;  5CP6 A;  3REJ A;  1WWS A;  1N1J B;  3LZ1 C;  3UT9 C;  2F8N H;  5CPK D;  3LZ0 D;  1ZLA D;  5GSU C;  1HTA A;  4Z5T B;  3VH5 W;  5GT0 C;  2HUE B;  5BS7 C;  4WU9 B;  1KX3 D;  5BNX B;  3MGS B;  3W97 C;  2BG1 A;  2CWE A;  3LEL A;  2YFV B;  5KDM B;  3WAA A;  5CPI D;  2FJ7 B;  1W2E A;  4HGA C;  1P3O D;  1U35 A;  1P3F D;  1PZR A;  1M1A D;  3X1V B;  1P34 A;  4Z5T C;  3H0R C;  5B0Y B;  4J8U B;  5BT1 D;  2JSS A;  5AV6 C;  3LJA B;  3C1C C;  1R4V A;  4XZQ B;  4WNN A;  4KGC D;  1KX5 D;  5BO0 B;  2F8N B;  3AZE A;  4QLC A;  3C1B B;  5E5A D;  5AV9 C;  4G91 B;  4CSR B;  5B0Y C;  5CPJ A;  3AN2 D;  3AZJ A;  1P3G C;  5DNM A;  3W98 B;  1P3P B;  3X1S B;  2NQB B;  2ZY4 A;  3KUY D;  5AV8 B;  3MNN B;  2ZY2 A;  1KX4 B;  4KHA A;  2DF4 C;  3X1U C;  5B33 C;  3AV1 B;  2VQR A;  2W8S A;  3C1B C;  5B31 A;  1P3A A;  2PYO A;  3REH B;  5GT3 C;  1KX3 B;  3REL A;  3B6F A;  4M6B A;  3AZN C;  2BYK B;  2Y2I A;  3A6N C;  4E44 A;  5AVB C;  1P3P C;  3AZI B;  1S32 B;  3AV2 A;  5AV8 C;  3B6G B;  4XUJ D;  5CPI B;  1KX4 C;  5DNN D;  5CPK A;  1P3O B;  4YS3 D;  1P3F B;  1AOI C;  1ZLA A;  4R8P C;  4H9R A;  3AV1 C;  3KFU G;  3UTB B;  3P5J B;  3AL0 C;  3WTP B;  4WU8 D;  3WA9 C;  1HQ3 B;  5B1M C;  2ZY5 A;  3REH C;  2CV5 A;  4UPK A;  5JA4 B;  5B0Z B;  3NQJ A;  4NFT A;  3AZI C;  2IO5 B;  1BH8 B;  3B6G C;  1TZY D;  5AV5 B;  1P3I D;  5CP6 D;  3REJ D;  3AZL A;  3UTB C;  2JE5 A;  5AY8 C;  5BNV A;  4JJN B;  2HIO C;  1F1E A;  5B0Z C;  4UUZ A;  4LD9 A;  4J8X C;  3W96 A;  3KWQ C;  5JRG D;  3TU4 D;  3AZK D;  1KU5 A;  3REI D;  3AZF C;  3WAA D;  1P3M A;  2F8N K;  5E5A A;  3AYW C;  4KUD A;  3WKJ A;  3O62 C;  2FFF B;  3LZ1 D;  1P3K C;  4JJN C;  5B40 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...