1F66C

2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords PALINDROMIC 146 BASE PAIR DNA FRAGMENT
total genus 32
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f66C00
3MGSD 5BT1D 3WAAA 5B24D 4R8PD 3LJAA 3WTPD 3O62D 3AZLD 4QLCC 3AZHA 3REKC 5AV8D 5GXQB 4YM6D 4Z2MH 3KUYC 1R4VA 5B1MD 2YFWA 5DNMC 2YFVA 4Z5TD 4QLCB 3AN2A 1A7WA 5B32G 1TZYC 4JJND 5B31C 2AROB 4Z66D 5F99C 3MNNC 3LZ0B 3B6FB 3X1UD 1U35A 3VH5W 3W98C 3WAAD 3REHC 1P3KA 4XUJD 3X1SD 4M6BA 4J8XC 3REJC 5CPIA 1P3FD 4CAYA 3B6FC 4LD9A 3VH6A 1M19A 1P3MC 3C1BD 5B0ZA 4J8UA 2F8NA 4QLCA 3LZ1C 1TAFA 5JRGA 2RVQC 3AZFA 5JRGB 3MVDD 1P3MB 4G91B 3W96D 4KGCA 1ID3B 5AV5C 3AV1B 5B24C 2HIOD 3LZ1B 4YS3B 4Z66B 4WNNB 1M18B 3WKJC 5GSUB 1KX3B 4H9SA 4G91C 3AZGD 1P3KB 1ID3D 5B24B 4YS3C 3MGPA 4J8VC 1EQZA 5GT0D 2PYOB 1M18C 3WKJB 4LD9D 3KWQD 5B2JA 3WA9D 3A6ND 1P3KC 3LJAC 5B0YC 1F66D 3AFAC 3UT9C 1P3AC 5B31D 3REKB 2BYKB 5BO0B 4HGAC 5B32A 3R45B 2PYOC 1P3AA 3AZGA 5DNNB 4CSRA 3X1UC 3KWQB 1BH9A 5BNXB 1HQ3C 3AN2B 5CPKC 5B33D 3AZMB 3AZLB 3MGQC 4Z66A 4WZSB 4H9PB 4DRAA 5FUGA 1S32D 3LELD 5B1LC 4WU9D 3C1CA 5GXQD 5AY8C 3X1SC 1AOIB 3B6FD 1HQ3B 3AZFD 4Z5TA 5B1MB 3AN2D 3W99D 5B33B 4WV4B 3C1BC 3MGSC 4WU8A 3W98A 5B0ZB 4ZUXB 4H9SC 4J8XB 3RELD 3REJB 1M19B 1H3OA 5B2IA 3MGSB 5AV5D 5G49A 3B0DC 3W99A 4ZUXD 3AFAA 3UT9A 3MVDB 3X1VA 3REIA 1BH8A 4WNNA 5DNMD 5AV6C 4Z5TC 3AZGC 3LZ1A 1P3GC 3AZKD 5B40C 5AV8B 3UTBA 4H9PA 5AV5B 3B0DB 4Z66C 4X23C 5CPJB 3LELB 3WTPA 3O62A 4Z5TB 5GSUC 4H9RA 5AY8A 4EO5C 3KXBB 3TU4D 5B32C 1P3ID 2PYOD 2BYKA 4LD9B 1BFMA 5E5AD 2CV5D 3AV1D 5AVBD 4XUJC 3REIC 5CPKD 5C3IC 3REJD 1WWSA 5F99A 4NE3A 1P3AB 5B32B 1KX3D 1N1JA 5B2IC 2IO5B 3AV2C 4XZQC 1P3LB 3AZFC 3LZ0A 5GT3C 4AWLB 3A6NA 5CPKB 5B2JD 1S32B 3MGPC 5B31G 4YS3A 2IO5C 3AV2B 3REKD 3VH5A 3MGQA 2NQBC 2HIOC 4H9RB 5AY8B 3RELC 1U35C 1KX3A 2NZDB 5B1MC 3AZJB 3WTPB 3O62B 3AZNB 1ZLAC 3AZJA 2FJ7C 2F8NB 5B0ZD 1P3FB 4J8UB 5B31A 4ZUXC 2FJ7A 5E5AB 2CV5B 1M19C 2NZDD 1M1AB 3MNNA 3MVDA 3AZKC 1P3GD 3A6NC 1P3PA 5B40D 1BH9B 5BNXA 1F66C 3W97D 4KUDD 3AZKB 3A6NB 5CPKA 1P3GB 1JFIB 4J8XD 3X1VC 1KX5C 4XZQA 5CP6D 1EQZB 3KSYA 4NFTA 3LELC 5AVBC 4ZBJC 4WU9C 5AY8D 5GXQC 3B6GC 2F8NG 5AVBA 3RELA 5E5AA 2CV5A 3UTBD 5AVBB 4ZBJB 5B31B 4WU9B 4CSRB 4G92C 4R8PA 4J8WC 1BH8B 3R45A 5AV9D 3KXBD 2NQBD 5AV8A 3UTBB 4XZQB 1U35D 1JFIA 3NQJB 4AWLC 5AV6D 1M18D 3WA9C 5CPIB 5B24A 3LJAD 3MGPB 4ZUXA 3AFAD 1B6WA 4JJNA 3UT9D 1P34D 4WU8B 1P3AD 4JJNB 3TU4A 3X1TB 1P34A 3MGRD 5CHLB 1F66A 3WA9B 5CPIC 4J8XA 2FJ7B 3W97C 3VH6T 1P3MA 3X1TC 5E5AC 2CV5C 2BYMA 3AZLA 3AV1C 5DNMA 3V9RB 5DNNA 3C1CB 3UTAB 3AZMD 1AOIA 3W99C 3LELA 2HIOA 5AVCC 1S32A 3W96C 3B6GD 3KUYB 5B2JC 3UTAC 3LJAB 3MGPD 2HUEB 2LY8A 3X1TA 1P34B 2AROC 4YS3D 3MGRB 5B2JB 3MNNB 3LZ0C 3KWQC 3B6GA 2AROA 3AZID 1P3KD 4DRBA 4H9NB 1P3OC 3W96A 1ID3A 3V9RA 4J8WB 1KX5A 5DNMB 3REHB 3X1UA 5CPJA 2F8ND 3AV1A 3TU4C 5B33C 5FUGB 1P3IC 1M1AD 1F1EA 5CPID 4H9OA 5DNND 4E44A 4Z2MG 3TU4B 5JA4A 5CP6C 3X1TD 4YM6A 1P3IB 5KDMB 4E45A 1Q9CA 3REJA 5GT3D 5AV6A 5AV6B 5CP6B 1N1JB 5B40B 5AV9A 1P3LD 1KX4A 1HQ3A 1P3BD 3UTAD 4KUDB 5GSUA 1M18A 4H9OB 3KXBC 5BNVA 4YM6C 3AZHB 4HGAB 1P3FA 3KXBA 4UUZA 3AZND 2F8NH 1P3PC 5C3IB 3AZNA 5GXQA 1P3OD 3C1CD 1P34C 3AZHC 3NQUA 4H9NA 4KGCC 3MGRC 5B2IB 5B1LB 5B0YA 3X1SB 1AOIC 5GT3B 3REID 3AFAB 3UT9B 3X1VD 3W98D 1KX5D 4KUDA 1KX4B 3C1BB 5B2ID 5DNNC 4XZQD 1U35B 5B1MA 3B6FA 1WWIA 3NQJA 3AZMC 3KUYA 3W98B 1KX4C 5AVCD 5GT0A 1EQZD 3W97A 5B33A 2RVQD 3MVDC 3AZGB 4WU9A 5AV9C 2FJ7D 5BO0A 5AV8C 5B0ZC 3AZIA 3KUYD 4X23B 5CPJC 3KWQA 5JRGC 3AZJD 3LZ0D 5AV9B 3X1VB 1KX5B 1ID3C 4J8VD 2L5AA 4J8UD 3WAAB 3C1BA 4LD9C 4KUDC 3MNND 1P3GA 5B0YD 3WKJA 4XUJB 3AYWD 4XUJA 4H9QA 4YM6B 1P3IA 3WAAC 3MGRA 3VH5T 4KGCD 4J8VB 3NQUB 5JA4B 2YFVB 1AOID 4KHAB 2YFWB 1P3PB 3AZFB 4G92B 1ULYA 1TAFB 5B0YB 4R8PB 3MGQD 4NE5A 2JSSA 5AVCA 2CWEA 1S32C 4KGCB 5B1LD 3UTBC 5BT1C 2HIOB 3LZ1D 3REIB 3X1UB 3AZMA 3AN2C 4R8PC 4J8WA 3UTAA 3WTPC 3O62C 1KX4D 1ZLAB 4J8WD 3AZLC 3MGQB 4QLCD 3WTPE 3B0CT 3AV2A 4H9QB 5BNVB 1P3LC 4CAYB 5GT0B 1P3BC 4NE6A 2PYOA 1P3BA 1F66B 3AZIC 2NQBA 1TZYD 5KDMA 1P3OA 2NQBB 1TZYA 5GT0C 3AZEB 1P3BB 5CP6A 3AZJC 3AZNC 5GT3A 3AZIB 1M1AA 5B1LA 3C1CC 4J8UC 3AZHD 3AZEC 4WU8D 5AVCB 1M1AC 5GSUD 1HQ3D 2F8NK 3REHA 1KU5A 5B32D 3B0CW 2NZDA 5AV5A 4UUZB 2HUEC 5BS7A 3WA9A 4EO5B 4J8VA 3AV2D 1EQZC 3MGSA 1TZYB 3AZEA 1P3OB 1H3OB 5B40A 3VH6W 3B6GB 2AROD 5F99B 3AYWA 3WKJD 4X23A 5BS7C 1HTAA 4JJNC 5CPJD 1ZLAD 3B0BA 5JRGD 1ZLAA 5F99D 1P3PD 3W97B 3RELB 1M19D 4X23D 2NZDC 3AYWC 3REHD 1B67A 1P3FC 2BYMB 3AZED 4WU8C 3W99B 4KHAA 5G49B 3REKA 1P3MD 3W96B 3AYWB 3AZKA 3X1SA 1KX3C 1P3LA
chains in the Genus database with same CATH superfamily
3MGSD 5BT1D 3WAAA 5B24D 4R8PD 3LJAA 3WTPD 3O62D 3AZLD 4QLCC 3AZHA 3REKC 5AV8D 5GXQB 4YM6D 4Z2MH 3KUYC 1R4VA 5B1MD 2YFWA 2Y2OA 2YFVA 4Z5TD 5DNMC 4QLCB 3AN2A 3AL0C 1A7WA 5B32G 1TZYC 4JJND 5B31C 2AROB 4UPKA 4Z66D 5F99C 3MNNC 3LZ0B 3B6FB 3X1UD 1U35A 3H0RC 3EPHA 3VH5W 3W98C 3WAAD 3REHC 1P3KA 4XUJD 3X1SD 4M6BA 4J8XC 3REJC 5CPIA 1P3FD 4CAYA 3B6FC 4LD9A 1W2EA 3VH6A 1M19A 2ZY2A 1P3MC 3C1BD 5B0ZA 2Y2PA 4J8UA 2F8NA 4QLCA 3LZ1C 1TAFA 5JRGA 2RVQC 3AZFA 5JRGB 3MVDD 1P3MB 4G91B 3W96D 4KGCA 1ID3B 2G5IC 5AV5C 3AV1B 5B24C 2HIOD 3LZ1B 4YS3B 4Z66B 4WNNB 1M18B 3WKJC 5GSUB 1KX3B 4H9SA 4G91C 3AZGD 1P3KB 1ID3D 5B24B 4YS3C 3MGPA 4J8VC 1EQZA 5GT0D 3F6TA 2PYOB 1M18C 3WKJB 4LD9D 3KWQD 5B2JA 3WA9D 3A6ND 1P3KC 3LJAC 5B0YC 1F66D 3AFAC 3UT9C 1P3AC 5B31D 3REKB 2BYKB 5BO0B 4HGAC 5B32A 3R45B 2PYOC 1P3AA 3AZGA 2Y2GA 5DNNB 4CSRA 3X1UC 3KWQB 1BH9A 5BNXB 1HQ3C 3AN2B 5CPKC 5B33D 3AZMB 3AZLB 3MGQC 4Z66A 4WZSB 4H9PB 2JCHA 5FUGA 4DRAA 1S32D 3LELD 5B1LC 4WU9D 3C1CA 5GXQD 5AY8C 3X1SC 1AOIB 3B6FD 1HQ3B 3AZFD 4Z5TA 5B1MB 3AN2D 3W99D 5B33B 4WV4B 3C1BC 3MGSC 4WU8A 3W98A 5B0ZB 4ZUXB 4H9SC 4J8XB 3RELD 3REJB 1M19B 1H3OA 5B2IA 4DQYB 3MGSB 5AV5D 5G49A 3B0DC 3W99A 4ZUXD 3AFAA 3UT9A 3MVDB 3X1VA 3REIA 1BH8A 4WNNA 5DNMD 5AV6C 4Z5TC 3AZGC 3LZ1A 1P3GC 3AZKD 5B40C 5AV8B 3UTBA 4H9PA 5AV5B 3B0DB 4Z66C 4X23C 5CPJB 3LELB 3WTPA 3O62A 4Z5TB 5GSUC 4H9RA 5AY8A 4EO5C 3KXBB 3TU4D 5B32C 1P3ID 2PYOD 2BYKA 4LD9B 1BFMA 5E5AD 2CV5D 3AV1D 5AVBD 4XUJC 3REIC 5CPKD 5C3IC 3REJD 1WWSA 5F99A 4NE3A 1P3AB 1T3UA 1Z2CB 5B32B 1KX3D 1N1JA 5B2IC 2IO5B 3AV2C 4XZQC 1P3LB 3AZFC 3LZ0A 5GT3C 4AWLB 3A6NA 5CPKB 5B2JD 1S32B 3MGPC 5B31G 4YS3A 2IO5C 3AV2B 3REKD 3VH5A 3MGQA 2NQBC 2HIOC 4H9RB 5AY8B 3RELC 1U35C 1KX3A 2NZDB 5B1MC 3AZJB 2DF4C 3WTPB 3O62B 3AZNB 1ZLAC 3AZJA 2FJ7C 2F8NB 2VQRA 5B0ZD 2Y2JA 1P3FB 4J8UB 5B31A 4ZUXC 2FJ7A 5E5AB 2CV5B 1M19C 2NZDD 1M1AB 3MNNA 3MVDA 3AZKC 1P3GD 3A6NC 1P3PA 5B40D 1BH9B 5BNXA 1F66C 2ZY5A 3W97D 4KUDD 3AZKB 3A6NB 5CPKA 1P3GB 1JFIB 4J8XD 3X1VC 1KX5C 4XZQA 5CP6D 2J8PA 1EQZB 3KSYA 4NFTA 3LELC 5AVBC 4ZBJC 4WU9C 5AY8D 5GXQC 3B6GC 2F8NG 5AVBA 3RELA 5E5AA 2CV5A 3UTBD 5AVBB 2XD5A 4ZBJB 5B31B 4WU9B 4CSRB 4G92C 4R8PA 4J8WC 1BH8B 3R45A 5AV9D 3KXBD 2NQBD 2ZY4A 5AV8A 3UTBB 4XZQB 1U35D 1JFIA 3NQJB 4AWLC 5AV6D 2F2AC 1M18D 3WA9C 5CPIB 5B24A 3LJAD 3MGPB 4ZUXA 3AFAD 1B6WA 4JJNA 3UT9D 1P34D 4WU8B 1P3AD 4JJNB 3TU4A 3X1TB 1P34A 3MGRD 5CHLB 2BG1A 1F66A 3WA9B 5CPIC 4J8XA 2FJ7B 2FFFB 3W97C 3VH6T 1P3MA 3X1TC 5E5AC 2CV5C 2BYMA 3AZLA 3AV1C 5DNMA 3V9RB 5DNNA 3C1CB 3UTAB 3AZMD 1AOIA 3W99C 3LELA 2HIOA 5AVCC 1S32A 3W96C 3B6GD 3KUYB 3H0MC 5B2JC 3UTAC 2Y2KA 3LJAB 3MGPD 2HUEB 2LY8A 3X1TA 1P34B 2AROC 4YS3D 3MGRB 5B2JB 3MNNB 3LZ0C 3KWQC 3B6GA 2AROA 3AZID 1P3KD 4DRBA 4H9NB 1P3OC 3W96A 1ID3A 3V9RA 4J8WB 1KX5A 5DNMB 3REHB 3X1UA 5CPJA 2F8ND 3AV1A 3TU4C 5B33C 5FUGB 1P3IC 1M1AD 1F1EA 5CPID 4H9OA 5DNND 4E44A 4Z2MG 3TU4B 5JA4A 5CP6C 3X1TD 4YM6A 1P3IB 3FDDA 5KDMB 4E45A 1Q9CA 3REJA 5GT3D 5AV6A 5AV6B 5CP6B 1N1JB 5B40B 5AV9A 1P3LD 1KX4A 1HQ3A 1P3BD 3UTAD 4KUDB 5GSUA 1M18A 4H9OB 3KXBC 5BNVA 2G5HC 4YM6C 3AZHB 4WJ3C 4HGAB 1P3FA 3KXBA 4UUZA 3AZND 2F8NH 1P3PC 5C3IB 3AZNA 5GXQA 2Y2NA 1P3OD 3C1CD 1P34C 3AZHC 2JE5A 3NQUA 4H9NA 4KGCC 3MGRC 5B2IB 5B1LB 5B0YA 3X1SB 1AOIC 5GT3B 3REID 3AFAB 3UT9B 3X1VD 3W98D 1KX5D 4KUDA 1KX4B 3C1BB 5B2ID 2Y2MA 5DNNC 2Y2QA 4XZQD 1U35B 5B1MA 3B6FA 1WWIA 3NQJA 3AZMC 3KFUG 3KUYA 3W98B 1KX4C 5AVCD 5GT0A 1EQZD 3W97A 5B33A 2W8SA 2RVQD 3MVDC 3P5JB 2RIQA 3AZGB 2XD1A 4WU9A 5AV9C 2FJ7D 5BO0A 5AV8C 5B0ZC 3AZIA 3KUYD 4X23B 5CPJC 3KWQA 5JRGC 3AZJD 3LZ0D 2ZM5A 5AV9B 3X1VB 1KX5B 1PZRA 1ID3C 3EG5B 4J8VD 2L5AA 4J8UD 3WAAB 3IP4C 3C1BA 4LD9C 4KUDC 3MNND 1P3GA 5B0YD 3WKJA 4XUJB 3AYWD 2ZY3A 4XUJA 4H9QA 4YM6B 1P3IA 3WAAC 3MGRA 3VH5T 4KGCD 4J8VB 3NQUB 5JA4B 2YFVB 1AOID 4KHAB 2YFWB 1P3PB 3AZFB 4G92B 1ULYA 1TAFB 5B0YB 4R8PB 3MGQD 4NE5A 2JSSA 5AVCA 2CWEA 1S32C 4KGCB 5B1LD 3UTBC 5BT1C 2HIOB 3LZ1D 3REIB 3X1UB 3AZMA 3AN2C 4R8PC 4J8WA 3UTAA 3WTPC 3O62C 1KX4D 1ZLAB 4J8WD 3AZLC 3MGQB 4QLCD 3WTPE 3EPKA 3B0CT 3AV2A 4H9QB 5BNVB 1P3LC 4CAYB 5GT0B 1P3BC 4NE6A 2PYOA 1P3BA 1F66B 3AZIC 2NQBA 1TZYD 5KDMA 1P3OA 2NQBB 1TZYA 5GT0C 3AZEB 1P3BB 5CP6A 3AZJC 3AZNC 3EPLA 5GT3A 3AZIB 1M1AA 5B1LA 3C1CC 4J8UC 3AZHD 3AZEC 4WU8D 5AVCB 1M1AC 5GSUD 1HQ3D 2F8NK 3REHA 1KU5A 5B32D 3B0CW 2NZDA 5AV5A 4UUZB 2HUEC 5BS7A 3WA9A 4EO5B 3H0LC 4J8VA 3AV2D 1EQZC 3MGSA 1TZYB 3A1IA 3AZEA 1P3OB 1H3OB 5B40A 3VH6W 3B6GB 3A1KA 2AROD 3EPJA 5F99B 3AYWA 3WKJD 4X23A 5BS7C 1HTAA 4JJNC 5CPJD 1ZLAD 3B0BA 5JRGD 1ZLAA 5F99D 1P3PD 3W97B 3RELB 1M19D 4X23D 2Y2IA 2NZDC 3AYWC 3REHD 1B67A 2UWXA 1P3FC 2BYMB 3AZED 4WU8C 3W99B 4KHAA 5G49B 2Y2HA 3REKA 1P3MD 3W96B 3AYWB 3AZKA 2DQNC 3X1SA 2Y2LA 1KX3C 1P3LA
chains in the Genus database with same CATH topology
3MGSD 5BT1D 3WAAA 5B24D 4R8PD 3LJAA 3WTPD 3O62D 3AZLD 4QLCC 3AZHA 3REKC 5AV8D 5GXQB 4YM6D 4Z2MH 3KUYC 1R4VA 5B1MD 2YFWA 2Y2OA 2YFVA 4Z5TD 5DNMC 4QLCB 3AN2A 3AL0C 1A7WA 5B32G 1TZYC 4JJND 5B31C 2AROB 4UPKA 4Z66D 5F99C 3MNNC 3LZ0B 3B6FB 3X1UD 1U35A 3H0RC 3EPHA 3VH5W 3W98C 3WAAD 3REHC 1P3KA 4XUJD 3X1SD 4M6BA 4J8XC 3REJC 5CPIA 1P3FD 4CAYA 3B6FC 4LD9A 1W2EA 3VH6A 1M19A 2ZY2A 1P3MC 3C1BD 5B0ZA 2Y2PA 4J8UA 2F8NA 4QLCA 3LZ1C 1TAFA 5JRGA 2RVQC 3AZFA 5JRGB 3MVDD 1P3MB 4G91B 3W96D 4KGCA 1ID3B 2G5IC 5AV5C 3AV1B 5B24C 2HIOD 3LZ1B 4YS3B 4Z66B 4WNNB 1M18B 3WKJC 5GSUB 1KX3B 4H9SA 4G91C 3AZGD 1P3KB 1ID3D 5B24B 4YS3C 3MGPA 4J8VC 1EQZA 5GT0D 3F6TA 2PYOB 1M18C 3WKJB 4LD9D 3KWQD 5B2JA 3WA9D 3A6ND 1P3KC 3LJAC 5B0YC 1F66D 3AFAC 3UT9C 1P3AC 5B31D 3REKB 2BYKB 5BO0B 4HGAC 5B32A 3R45B 2PYOC 1P3AA 3AZGA 2Y2GA 5DNNB 4CSRA 3X1UC 3KWQB 1BH9A 5BNXB 1HQ3C 3AN2B 5CPKC 5B33D 3AZMB 3AZLB 3MGQC 4Z66A 4WZSB 4H9PB 2JCHA 5FUGA 4DRAA 1S32D 3LELD 5B1LC 4WU9D 3C1CA 5GXQD 5AY8C 3X1SC 1AOIB 3B6FD 1HQ3B 3AZFD 4Z5TA 5B1MB 3AN2D 3W99D 5B33B 4WV4B 3C1BC 3MGSC 4WU8A 3W98A 5B0ZB 4ZUXB 4H9SC 4J8XB 3RELD 3REJB 1M19B 1H3OA 5B2IA 4DQYB 3MGSB 5AV5D 5G49A 3B0DC 3W99A 4ZUXD 3AFAA 3UT9A 3MVDB 3X1VA 3REIA 1BH8A 4WNNA 5DNMD 5AV6C 4Z5TC 3AZGC 3LZ1A 1P3GC 3AZKD 5B40C 5AV8B 3UTBA 4H9PA 5AV5B 3B0DB 4Z66C 4X23C 5CPJB 3LELB 3WTPA 3O62A 4Z5TB 5GSUC 4H9RA 5AY8A 4EO5C 3KXBB 3TU4D 5B32C 1P3ID 2PYOD 2BYKA 4LD9B 1BFMA 5E5AD 2CV5D 3AV1D 5AVBD 4XUJC 3REIC 5CPKD 5C3IC 3REJD 1WWSA 5F99A 4NE3A 1P3AB 1T3UA 1Z2CB 5B32B 1KX3D 1N1JA 5B2IC 2IO5B 3AV2C 4XZQC 1P3LB 3AZFC 3LZ0A 5GT3C 4AWLB 3A6NA 5CPKB 5B2JD 1S32B 3MGPC 5B31G 4YS3A 2IO5C 3AV2B 3REKD 3VH5A 3MGQA 2NQBC 2HIOC 4H9RB 5AY8B 3RELC 1U35C 1KX3A 2NZDB 5B1MC 3AZJB 2DF4C 3WTPB 3O62B 3AZNB 1ZLAC 3AZJA 2FJ7C 2F8NB 2VQRA 5B0ZD 2Y2JA 1P3FB 4J8UB 5B31A 4ZUXC 2FJ7A 5E5AB 2CV5B 1M19C 2NZDD 1M1AB 3MNNA 3MVDA 3AZKC 1P3GD 3A6NC 1P3PA 5B40D 1BH9B 5BNXA 1F66C 2ZY5A 3W97D 4KUDD 3AZKB 3A6NB 5CPKA 1P3GB 1JFIB 4J8XD 3X1VC 1KX5C 4XZQA 5CP6D 2J8PA 1EQZB 3KSYA 4NFTA 3LELC 5AVBC 4ZBJC 4WU9C 5AY8D 5GXQC 3B6GC 2F8NG 5AVBA 3RELA 5E5AA 2CV5A 3UTBD 5AVBB 2XD5A 4ZBJB 5B31B 4WU9B 4CSRB 4G92C 4R8PA 4J8WC 1BH8B 3R45A 5AV9D 3KXBD 2NQBD 2ZY4A 5AV8A 3UTBB 4XZQB 1U35D 1JFIA 3NQJB 4AWLC 5AV6D 2F2AC 1M18D 3WA9C 5CPIB 5B24A 3LJAD 3MGPB 4ZUXA 3AFAD 1B6WA 4JJNA 3UT9D 1P34D 4WU8B 1P3AD 4JJNB 3TU4A 3X1TB 1P34A 3MGRD 5CHLB 2BG1A 1F66A 3WA9B 5CPIC 4J8XA 2FJ7B 2FFFB 3W97C 3VH6T 1P3MA 3X1TC 5E5AC 2CV5C 2BYMA 3AZLA 3AV1C 5DNMA 3V9RB 5DNNA 3C1CB 3UTAB 3AZMD 1AOIA 3W99C 3LELA 2HIOA 5AVCC 1S32A 3W96C 3B6GD 3KUYB 3H0MC 5B2JC 3UTAC 2Y2KA 3LJAB 3MGPD 2HUEB 2LY8A 3X1TA 1P34B 2AROC 4YS3D 3MGRB 5B2JB 3MNNB 3LZ0C 3KWQC 3B6GA 2AROA 3AZID 1P3KD 4DRBA 4H9NB 1P3OC 3W96A 1ID3A 3V9RA 4J8WB 1KX5A 5DNMB 3REHB 3X1UA 5CPJA 2F8ND 3AV1A 3TU4C 5B33C 5FUGB 1P3IC 1M1AD 1F1EA 5CPID 4H9OA 5DNND 4E44A 4Z2MG 3TU4B 5JA4A 5CP6C 3X1TD 4YM6A 1P3IB 3FDDA 5KDMB 4E45A 1Q9CA 3REJA 5GT3D 5AV6A 5AV6B 5CP6B 1N1JB 5B40B 5AV9A 1P3LD 1KX4A 1HQ3A 1P3BD 3UTAD 4KUDB 5GSUA 1M18A 4H9OB 3KXBC 5BNVA 2G5HC 4YM6C 3AZHB 4WJ3C 4HGAB 1P3FA 3KXBA 4UUZA 3AZND 2F8NH 1P3PC 5C3IB 3AZNA 5GXQA 2Y2NA 1P3OD 3C1CD 1P34C 3AZHC 2JE5A 3NQUA 4H9NA 4KGCC 3MGRC 5B2IB 5B1LB 5B0YA 3X1SB 1AOIC 5GT3B 3REID 3AFAB 3UT9B 3X1VD 3W98D 1KX5D 4KUDA 1KX4B 3C1BB 5B2ID 2Y2MA 5DNNC 2Y2QA 4XZQD 1U35B 5B1MA 3B6FA 1WWIA 3NQJA 3AZMC 3KFUG 3KUYA 3W98B 1KX4C 5AVCD 5GT0A 1EQZD 3W97A 5B33A 2W8SA 2RVQD 3MVDC 3P5JB 2RIQA 3AZGB 2XD1A 4WU9A 5AV9C 2FJ7D 5BO0A 5AV8C 5B0ZC 3AZIA 3KUYD 4X23B 5CPJC 3KWQA 5JRGC 3AZJD 3LZ0D 2ZM5A 5AV9B 3X1VB 1KX5B 1PZRA 1ID3C 3EG5B 4J8VD 2L5AA 4J8UD 3WAAB 3IP4C 3C1BA 4LD9C 4KUDC 3MNND 1P3GA 5B0YD 3WKJA 4XUJB 3AYWD 2ZY3A 4XUJA 4H9QA 4YM6B 1P3IA 3WAAC 3MGRA 3VH5T 4KGCD 4J8VB 3NQUB 5JA4B 2YFVB 1AOID 4KHAB 2YFWB 1P3PB 3AZFB 4G92B 1ULYA 1TAFB 5B0YB 4R8PB 3MGQD 4NE5A 2JSSA 5AVCA 2CWEA 1S32C 4KGCB 5B1LD 3UTBC 5BT1C 2HIOB 3LZ1D 3REIB 3X1UB 3AZMA 3AN2C 4R8PC 4J8WA 3UTAA 3WTPC 3O62C 1KX4D 1ZLAB 4J8WD 3AZLC 3MGQB 4QLCD 3WTPE 3EPKA 3B0CT 3AV2A 4H9QB 5BNVB 1P3LC 4CAYB 5GT0B 1P3BC 4NE6A 2PYOA 1P3BA 1F66B 3AZIC 2NQBA 1TZYD 5KDMA 1P3OA 2NQBB 1TZYA 5GT0C 3AZEB 1P3BB 5CP6A 3AZJC 3AZNC 3EPLA 5GT3A 3AZIB 1M1AA 5B1LA 3C1CC 4J8UC 3AZHD 3AZEC 4WU8D 5AVCB 1M1AC 5GSUD 1HQ3D 2F8NK 3REHA 1KU5A 5B32D 3B0CW 2NZDA 5AV5A 4UUZB 2HUEC 5BS7A 3WA9A 4EO5B 3H0LC 4J8VA 3AV2D 1EQZC 3MGSA 1TZYB 3A1IA 3AZEA 1P3OB 1H3OB 5B40A 3VH6W 3B6GB 3A1KA 2AROD 3EPJA 5F99B 3AYWA 3WKJD 4X23A 5BS7C 1HTAA 4JJNC 5CPJD 1ZLAD 3B0BA 5JRGD 1ZLAA 5F99D 1P3PD 3W97B 3RELB 1M19D 4X23D 2Y2IA 2NZDC 3AYWC 3REHD 1B67A 2UWXA 1P3FC 2BYMB 3AZED 4WU8C 3W99B 4KHAA 5G49B 2Y2HA 3REKA 1P3MD 3W96B 3AYWB 3AZKA 2DQNC 3X1SA 2Y2LA 1KX3C 1P3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGS D;  5BT1 D;  3WAA A;  5B24 D;  4R8P D;  3LJA A;  3WTP D;  3O62 D;  3AZL D;  4QLC C;  3AZH A;  3REK C;  5AV8 D;  5GXQ B;  4YM6 D;  4Z2M H;  3KUY C;  1R4V A;  5B1M D;  2YFW A;  5DNM C;  2YFV A;  4Z5T D;  4QLC B;  3AN2 A;  1A7W A;  5B32 G;  1TZY C;  4JJN D;  5B31 C;  2ARO B;  4Z66 D;  5F99 C;  3MNN C;  3LZ0 B;  3B6F B;  3X1U D;  1U35 A;  3VH5 W;  3W98 C;  3WAA D;  3REH C;  1P3K A;  4XUJ D;  3X1S D;  4M6B A;  4J8X C;  3REJ C;  5CPI A;  1P3F D;  4CAY A;  3B6F C;  4LD9 A;  3VH6 A;  1M19 A;  1P3M C;  3C1B D;  5B0Z A;  4J8U A;  2F8N A;  4QLC A;  3LZ1 C;  1TAF A;  5JRG A;  2RVQ C;  3AZF A;  5JRG B;  3MVD D;  1P3M B;  4G91 B;  3W96 D;  4KGC A;  1ID3 B;  5AV5 C;  3AV1 B;  5B24 C;  2HIO D;  3LZ1 B;  4YS3 B;  4Z66 B;  4WNN B;  1M18 B;  3WKJ C;  5GSU B;  1KX3 B;  4H9S A;  4G91 C;  3AZG D;  1P3K B;  1ID3 D;  5B24 B;  4YS3 C;  3MGP A;  4J8V C;  1EQZ A;  5GT0 D;  2PYO B;  1M18 C;  3WKJ B;  4LD9 D;  3KWQ D;  5B2J A;  3WA9 D;  3A6N D;  1P3K C;  3LJA C;  5B0Y C;  1F66 D;  3AFA C;  3UT9 C;  1P3A C;  5B31 D;  3REK B;  2BYK B;  5BO0 B;  4HGA C;  5B32 A;  3R45 B;  2PYO C;  1P3A A;  3AZG A;  5DNN B;  4CSR A;  3X1U C;  3KWQ B;  1BH9 A;  5BNX B;  1HQ3 C;  3AN2 B;  5CPK C;  5B33 D;  3AZM B;  3AZL B;  3MGQ C;  4Z66 A;  4WZS B;  4H9P B;  4DRA A;  5FUG A;  1S32 D;  3LEL D;  5B1L C;  4WU9 D;  3C1C A;  5GXQ D;  5AY8 C;  3X1S C;  1AOI B;  3B6F D;  1HQ3 B;  3AZF D;  4Z5T A;  5B1M B;  3AN2 D;  3W99 D;  5B33 B;  4WV4 B;  3C1B C;  3MGS C;  4WU8 A;  3W98 A;  5B0Z B;  4ZUX B;  4H9S C;  4J8X B;  3REL D;  3REJ B;  1M19 B;  1H3O A;  5B2I A;  3MGS B;  5AV5 D;  5G49 A;  3B0D C;  3W99 A;  4ZUX D;  3AFA A;  3UT9 A;  3MVD B;  3X1V A;  3REI A;  1BH8 A;  4WNN A;  5DNM D;  5AV6 C;  4Z5T C;  3AZG C;  3LZ1 A;  1P3G C;  3AZK D;  5B40 C;  5AV8 B;  3UTB A;  4H9P A;  5AV5 B;  3B0D B;  4Z66 C;  4X23 C;  5CPJ B;  3LEL B;  3WTP A;  3O62 A;  4Z5T B;  5GSU C;  4H9R A;  5AY8 A;  4EO5 C;  3KXB B;  3TU4 D;  5B32 C;  1P3I D;  2PYO D;  2BYK A;  4LD9 B;  1BFM A;  5E5A D;  2CV5 D;  3AV1 D;  5AVB D;  4XUJ C;  3REI C;  5CPK D;  5C3I C;  3REJ D;  1WWS A;  5F99 A;  4NE3 A;  1P3A B;  5B32 B;  1KX3 D;  1N1J A;  5B2I C;  2IO5 B;  3AV2 C;  4XZQ C;  1P3L B;  3AZF C;  3LZ0 A;  5GT3 C;  4AWL B;  3A6N A;  5CPK B;  5B2J D;  1S32 B;  3MGP C;  5B31 G;  4YS3 A;  2IO5 C;  3AV2 B;  3REK D;  3VH5 A;  3MGQ A;  2NQB C;  2HIO C;  4H9R B;  5AY8 B;  3REL C;  1U35 C;  1KX3 A;  2NZD B;  5B1M C;  3AZJ B;  3WTP B;  3O62 B;  3AZN B;  1ZLA C;  3AZJ A;  2FJ7 C;  2F8N B;  5B0Z D;  1P3F B;  4J8U B;  5B31 A;  4ZUX C;  2FJ7 A;  5E5A B;  2CV5 B;  1M19 C;  2NZD D;  1M1A B;  3MNN A;  3MVD A;  3AZK C;  1P3G D;  3A6N C;  1P3P A;  5B40 D;  1BH9 B;  5BNX A;  1F66 C;  3W97 D;  4KUD D;  3AZK B;  3A6N B;  5CPK A;  1P3G B;  1JFI B;  4J8X D;  3X1V C;  1KX5 C;  4XZQ A;  5CP6 D;  1EQZ B;  3KSY A;  4NFT A;  3LEL C;  5AVB C;  4ZBJ C;  4WU9 C;  5AY8 D;  5GXQ C;  3B6G C;  2F8N G;  5AVB A;  3REL A;  5E5A A;  2CV5 A;  3UTB D;  5AVB B;  4ZBJ B;  5B31 B;  4WU9 B;  4CSR B;  4G92 C;  4R8P A;  4J8W C;  1BH8 B;  3R45 A;  5AV9 D;  3KXB D;  2NQB D;  5AV8 A;  3UTB B;  4XZQ B;  1U35 D;  1JFI A;  3NQJ B;  4AWL C;  5AV6 D;  1M18 D;  3WA9 C;  5CPI B;  5B24 A;  3LJA D;  3MGP B;  4ZUX A;  3AFA D;  1B6W A;  4JJN A;  3UT9 D;  1P34 D;  4WU8 B;  1P3A D;  4JJN B;  3TU4 A;  3X1T B;  1P34 A;  3MGR D;  5CHL B;  1F66 A;  3WA9 B;  5CPI C;  4J8X A;  2FJ7 B;  3W97 C;  3VH6 T;  1P3M A;  3X1T C;  5E5A C;  2CV5 C;  2BYM A;  3AZL A;  3AV1 C;  5DNM A;  3V9R B;  5DNN A;  3C1C B;  3UTA B;  3AZM D;  1AOI A;  3W99 C;  3LEL A;  2HIO A;  5AVC C;  1S32 A;  3W96 C;  3B6G D;  3KUY B;  5B2J C;  3UTA C;  3LJA B;  3MGP D;  2HUE B;  2LY8 A;  3X1T A;  1P34 B;  2ARO C;  4YS3 D;  3MGR B;  5B2J B;  3MNN B;  3LZ0 C;  3KWQ C;  3B6G A;  2ARO A;  3AZI D;  1P3K D;  4DRB A;  4H9N B;  1P3O C;  3W96 A;  1ID3 A;  3V9R A;  4J8W B;  1KX5 A;  5DNM B;  3REH B;  3X1U A;  5CPJ A;  2F8N D;  3AV1 A;  3TU4 C;  5B33 C;  5FUG B;  1P3I C;  1M1A D;  1F1E A;  5CPI D;  4H9O A;  5DNN D;  4E44 A;  4Z2M G;  3TU4 B;  5JA4 A;  5CP6 C;  3X1T D;  4YM6 A;  1P3I B;  5KDM B;  4E45 A;  1Q9C A;  3REJ A;  5GT3 D;  5AV6 A;  5AV6 B;  5CP6 B;  1N1J B;  5B40 B;  5AV9 A;  1P3L D;  1KX4 A;  1HQ3 A;  1P3B D;  3UTA D;  4KUD B;  5GSU A;  1M18 A;  4H9O B;  3KXB C;  5BNV A;  4YM6 C;  3AZH B;  4HGA B;  1P3F A;  3KXB A;  4UUZ A;  3AZN D;  2F8N H;  1P3P C;  5C3I B;  3AZN A;  5GXQ A;  1P3O D;  3C1C D;  1P34 C;  3AZH C;  3NQU A;  4H9N A;  4KGC C;  3MGR C;  5B2I B;  5B1L B;  5B0Y A;  3X1S B;  1AOI C;  5GT3 B;  3REI D;  3AFA B;  3UT9 B;  3X1V D;  3W98 D;  1KX5 D;  4KUD A;  1KX4 B;  3C1B B;  5B2I D;  5DNN C;  4XZQ D;  1U35 B;  5B1M A;  3B6F A;  1WWI A;  3NQJ A;  3AZM C;  3KUY A;  3W98 B;  1KX4 C;  5AVC D;  5GT0 A;  1EQZ D;  3W97 A;  5B33 A;  2RVQ D;  3MVD C;  3AZG B;  4WU9 A;  5AV9 C;  2FJ7 D;  5BO0 A;  5AV8 C;  5B0Z C;  3AZI A;  3KUY D;  4X23 B;  5CPJ C;  3KWQ A;  5JRG C;  3AZJ D;  3LZ0 D;  5AV9 B;  3X1V B;  1KX5 B;  1ID3 C;  4J8V D;  2L5A A;  4J8U D;  3WAA B;  3C1B A;  4LD9 C;  4KUD C;  3MNN D;  1P3G A;  5B0Y D;  3WKJ A;  4XUJ B;  3AYW D;  4XUJ A;  4H9Q A;  4YM6 B;  1P3I A;  3WAA C;  3MGR A;  3VH5 T;  4KGC D;  4J8V B;  3NQU B;  5JA4 B;  2YFV B;  1AOI D;  4KHA B;  2YFW B;  1P3P B;  3AZF B;  4G92 B;  1ULY A;  1TAF B;  5B0Y B;  4R8P B;  3MGQ D;  4NE5 A;  2JSS A;  5AVC A;  2CWE A;  1S32 C;  4KGC B;  5B1L D;  3UTB C;  5BT1 C;  2HIO B;  3LZ1 D;  3REI B;  3X1U B;  3AZM A;  3AN2 C;  4R8P C;  4J8W A;  3UTA A;  3WTP C;  3O62 C;  1KX4 D;  1ZLA B;  4J8W D;  3AZL C;  3MGQ B;  4QLC D;  3WTP E;  3B0C T;  3AV2 A;  4H9Q B;  5BNV B;  1P3L C;  4CAY B;  5GT0 B;  1P3B C;  4NE6 A;  2PYO A;  1P3B A;  1F66 B;  3AZI C;  2NQB A;  1TZY D;  5KDM A;  1P3O A;  2NQB B;  1TZY A;  5GT0 C;  3AZE B;  1P3B B;  5CP6 A;  3AZJ C;  3AZN C;  5GT3 A;  3AZI B;  1M1A A;  5B1L A;  3C1C C;  4J8U C;  3AZH D;  3AZE C;  4WU8 D;  5AVC B;  1M1A C;  5GSU D;  1HQ3 D;  2F8N K;  3REH A;  1KU5 A;  5B32 D;  3B0C W;  2NZD A;  5AV5 A;  4UUZ B;  2HUE C;  5BS7 A;  3WA9 A;  4EO5 B;  4J8V A;  3AV2 D;  1EQZ C;  3MGS A;  1TZY B;  3AZE A;  1P3O B;  1H3O B;  5B40 A;  3VH6 W;  3B6G B;  2ARO D;  5F99 B;  3AYW A;  3WKJ D;  4X23 A;  5BS7 C;  1HTA A;  4JJN C;  5CPJ D;  1ZLA D;  3B0B A;  5JRG D;  1ZLA A;  5F99 D;  1P3P D;  3W97 B;  3REL B;  1M19 D;  4X23 D;  2NZD C;  3AYW C;  3REH D;  1B67 A;  1P3F C;  2BYM B;  3AZE D;  4WU8 C;  3W99 B;  4KHA A;  5G49 B;  3REK A;  1P3M D;  3W96 B;  3AYW B;  3AZK A;  3X1S A;  1KX3 C;  1P3L A; 
#chains in the Genus database with same CATH topology
 3MGS D;  5BT1 D;  3WAA A;  5B24 D;  4R8P D;  3LJA A;  3WTP D;  3O62 D;  3AZL D;  4QLC C;  3AZH A;  3REK C;  5AV8 D;  5GXQ B;  4YM6 D;  4Z2M H;  3KUY C;  1R4V A;  5B1M D;  2YFW A;  2Y2O A;  2YFV A;  4Z5T D;  5DNM C;  4QLC B;  3AN2 A;  3AL0 C;  1A7W A;  5B32 G;  1TZY C;  4JJN D;  5B31 C;  2ARO B;  4UPK A;  4Z66 D;  5F99 C;  3MNN C;  3LZ0 B;  3B6F B;  3X1U D;  1U35 A;  3H0R C;  3EPH A;  3VH5 W;  3W98 C;  3WAA D;  3REH C;  1P3K A;  4XUJ D;  3X1S D;  4M6B A;  4J8X C;  3REJ C;  5CPI A;  1P3F D;  4CAY A;  3B6F C;  4LD9 A;  1W2E A;  3VH6 A;  1M19 A;  2ZY2 A;  1P3M C;  3C1B D;  5B0Z A;  2Y2P A;  4J8U A;  2F8N A;  4QLC A;  3LZ1 C;  1TAF A;  5JRG A;  2RVQ C;  3AZF A;  5JRG B;  3MVD D;  1P3M B;  4G91 B;  3W96 D;  4KGC A;  1ID3 B;  2G5I C;  5AV5 C;  3AV1 B;  5B24 C;  2HIO D;  3LZ1 B;  4YS3 B;  4Z66 B;  4WNN B;  1M18 B;  3WKJ C;  5GSU B;  1KX3 B;  4H9S A;  4G91 C;  3AZG D;  1P3K B;  1ID3 D;  5B24 B;  4YS3 C;  3MGP A;  4J8V C;  1EQZ A;  5GT0 D;  3F6T A;  2PYO B;  1M18 C;  3WKJ B;  4LD9 D;  3KWQ D;  5B2J A;  3WA9 D;  3A6N D;  1P3K C;  3LJA C;  5B0Y C;  1F66 D;  3AFA C;  3UT9 C;  1P3A C;  5B31 D;  3REK B;  2BYK B;  5BO0 B;  4HGA C;  5B32 A;  3R45 B;  2PYO C;  1P3A A;  3AZG A;  2Y2G A;  5DNN B;  4CSR A;  3X1U C;  3KWQ B;  1BH9 A;  5BNX B;  1HQ3 C;  3AN2 B;  5CPK C;  5B33 D;  3AZM B;  3AZL B;  3MGQ C;  4Z66 A;  4WZS B;  4H9P B;  2JCH A;  5FUG A;  4DRA A;  1S32 D;  3LEL D;  5B1L C;  4WU9 D;  3C1C A;  5GXQ D;  5AY8 C;  3X1S C;  1AOI B;  3B6F D;  1HQ3 B;  3AZF D;  4Z5T A;  5B1M B;  3AN2 D;  3W99 D;  5B33 B;  4WV4 B;  3C1B C;  3MGS C;  4WU8 A;  3W98 A;  5B0Z B;  4ZUX B;  4H9S C;  4J8X B;  3REL D;  3REJ B;  1M19 B;  1H3O A;  5B2I A;  4DQY B;  3MGS B;  5AV5 D;  5G49 A;  3B0D C;  3W99 A;  4ZUX D;  3AFA A;  3UT9 A;  3MVD B;  3X1V A;  3REI A;  1BH8 A;  4WNN A;  5DNM D;  5AV6 C;  4Z5T C;  3AZG C;  3LZ1 A;  1P3G C;  3AZK D;  5B40 C;  5AV8 B;  3UTB A;  4H9P A;  5AV5 B;  3B0D B;  4Z66 C;  4X23 C;  5CPJ B;  3LEL B;  3WTP A;  3O62 A;  4Z5T B;  5GSU C;  4H9R A;  5AY8 A;  4EO5 C;  3KXB B;  3TU4 D;  5B32 C;  1P3I D;  2PYO D;  2BYK A;  4LD9 B;  1BFM A;  5E5A D;  2CV5 D;  3AV1 D;  5AVB D;  4XUJ C;  3REI C;  5CPK D;  5C3I C;  3REJ D;  1WWS A;  5F99 A;  4NE3 A;  1P3A B;  1T3U A;  1Z2C B;  5B32 B;  1KX3 D;  1N1J A;  5B2I C;  2IO5 B;  3AV2 C;  4XZQ C;  1P3L B;  3AZF C;  3LZ0 A;  5GT3 C;  4AWL B;  3A6N A;  5CPK B;  5B2J D;  1S32 B;  3MGP C;  5B31 G;  4YS3 A;  2IO5 C;  3AV2 B;  3REK D;  3VH5 A;  3MGQ A;  2NQB C;  2HIO C;  4H9R B;  5AY8 B;  3REL C;  1U35 C;  1KX3 A;  2NZD B;  5B1M C;  3AZJ B;  2DF4 C;  3WTP B;  3O62 B;  3AZN B;  1ZLA C;  3AZJ A;  2FJ7 C;  2F8N B;  2VQR A;  5B0Z D;  2Y2J A;  1P3F B;  4J8U B;  5B31 A;  4ZUX C;  2FJ7 A;  5E5A B;  2CV5 B;  1M19 C;  2NZD D;  1M1A B;  3MNN A;  3MVD A;  3AZK C;  1P3G D;  3A6N C;  1P3P A;  5B40 D;  1BH9 B;  5BNX A;  1F66 C;  2ZY5 A;  3W97 D;  4KUD D;  3AZK B;  3A6N B;  5CPK A;  1P3G B;  1JFI B;  4J8X D;  3X1V C;  1KX5 C;  4XZQ A;  5CP6 D;  2J8P A;  1EQZ B;  3KSY A;  4NFT A;  3LEL C;  5AVB C;  4ZBJ C;  4WU9 C;  5AY8 D;  5GXQ C;  3B6G C;  2F8N G;  5AVB A;  3REL A;  5E5A A;  2CV5 A;  3UTB D;  5AVB B;  2XD5 A;  4ZBJ B;  5B31 B;  4WU9 B;  4CSR B;  4G92 C;  4R8P A;  4J8W C;  1BH8 B;  3R45 A;  5AV9 D;  3KXB D;  2NQB D;  2ZY4 A;  5AV8 A;  3UTB B;  4XZQ B;  1U35 D;  1JFI A;  3NQJ B;  4AWL C;  5AV6 D;  2F2A C;  1M18 D;  3WA9 C;  5CPI B;  5B24 A;  3LJA D;  3MGP B;  4ZUX A;  3AFA D;  1B6W A;  4JJN A;  3UT9 D;  1P34 D;  4WU8 B;  1P3A D;  4JJN B;  3TU4 A;  3X1T B;  1P34 A;  3MGR D;  5CHL B;  2BG1 A;  1F66 A;  3WA9 B;  5CPI C;  4J8X A;  2FJ7 B;  2FFF B;  3W97 C;  3VH6 T;  1P3M A;  3X1T C;  5E5A C;  2CV5 C;  2BYM A;  3AZL A;  3AV1 C;  5DNM A;  3V9R B;  5DNN A;  3C1C B;  3UTA B;  3AZM D;  1AOI A;  3W99 C;  3LEL A;  2HIO A;  5AVC C;  1S32 A;  3W96 C;  3B6G D;  3KUY B;  3H0M C;  5B2J C;  3UTA C;  2Y2K A;  3LJA B;  3MGP D;  2HUE B;  2LY8 A;  3X1T A;  1P34 B;  2ARO C;  4YS3 D;  3MGR B;  5B2J B;  3MNN B;  3LZ0 C;  3KWQ C;  3B6G A;  2ARO A;  3AZI D;  1P3K D;  4DRB A;  4H9N B;  1P3O C;  3W96 A;  1ID3 A;  3V9R A;  4J8W B;  1KX5 A;  5DNM B;  3REH B;  3X1U A;  5CPJ A;  2F8N D;  3AV1 A;  3TU4 C;  5B33 C;  5FUG B;  1P3I C;  1M1A D;  1F1E A;  5CPI D;  4H9O A;  5DNN D;  4E44 A;  4Z2M G;  3TU4 B;  5JA4 A;  5CP6 C;  3X1T D;  4YM6 A;  1P3I B;  3FDD A;  5KDM B;  4E45 A;  1Q9C A;  3REJ A;  5GT3 D;  5AV6 A;  5AV6 B;  5CP6 B;  1N1J B;  5B40 B;  5AV9 A;  1P3L D;  1KX4 A;  1HQ3 A;  1P3B D;  3UTA D;  4KUD B;  5GSU A;  1M18 A;  4H9O B;  3KXB C;  5BNV A;  2G5H C;  4YM6 C;  3AZH B;  4WJ3 C;  4HGA B;  1P3F A;  3KXB A;  4UUZ A;  3AZN D;  2F8N H;  1P3P C;  5C3I B;  3AZN A;  5GXQ A;  2Y2N A;  1P3O D;  3C1C D;  1P34 C;  3AZH C;  2JE5 A;  3NQU A;  4H9N A;  4KGC C;  3MGR C;  5B2I B;  5B1L B;  5B0Y A;  3X1S B;  1AOI C;  5GT3 B;  3REI D;  3AFA B;  3UT9 B;  3X1V D;  3W98 D;  1KX5 D;  4KUD A;  1KX4 B;  3C1B B;  5B2I D;  2Y2M A;  5DNN C;  2Y2Q A;  4XZQ D;  1U35 B;  5B1M A;  3B6F A;  1WWI A;  3NQJ A;  3AZM C;  3KFU G;  3KUY A;  3W98 B;  1KX4 C;  5AVC D;  5GT0 A;  1EQZ D;  3W97 A;  5B33 A;  2W8S A;  2RVQ D;  3MVD C;  3P5J B;  2RIQ A;  3AZG B;  2XD1 A;  4WU9 A;  5AV9 C;  2FJ7 D;  5BO0 A;  5AV8 C;  5B0Z C;  3AZI A;  3KUY D;  4X23 B;  5CPJ C;  3KWQ A;  5JRG C;  3AZJ D;  3LZ0 D;  2ZM5 A;  5AV9 B;  3X1V B;  1KX5 B;  1PZR A;  1ID3 C;  3EG5 B;  4J8V D;  2L5A A;  4J8U D;  3WAA B;  3IP4 C;  3C1B A;  4LD9 C;  4KUD C;  3MNN D;  1P3G A;  5B0Y D;  3WKJ A;  4XUJ B;  3AYW D;  2ZY3 A;  4XUJ A;  4H9Q A;  4YM6 B;  1P3I A;  3WAA C;  3MGR A;  3VH5 T;  4KGC D;  4J8V B;  3NQU B;  5JA4 B;  2YFV B;  1AOI D;  4KHA B;  2YFW B;  1P3P B;  3AZF B;  4G92 B;  1ULY A;  1TAF B;  5B0Y B;  4R8P B;  3MGQ D;  4NE5 A;  2JSS A;  5AVC A;  2CWE A;  1S32 C;  4KGC B;  5B1L D;  3UTB C;  5BT1 C;  2HIO B;  3LZ1 D;  3REI B;  3X1U B;  3AZM A;  3AN2 C;  4R8P C;  4J8W A;  3UTA A;  3WTP C;  3O62 C;  1KX4 D;  1ZLA B;  4J8W D;  3AZL C;  3MGQ B;  4QLC D;  3WTP E;  3EPK A;  3B0C T;  3AV2 A;  4H9Q B;  5BNV B;  1P3L C;  4CAY B;  5GT0 B;  1P3B C;  4NE6 A;  2PYO A;  1P3B A;  1F66 B;  3AZI C;  2NQB A;  1TZY D;  5KDM A;  1P3O A;  2NQB B;  1TZY A;  5GT0 C;  3AZE B;  1P3B B;  5CP6 A;  3AZJ C;  3AZN C;  3EPL A;  5GT3 A;  3AZI B;  1M1A A;  5B1L A;  3C1C C;  4J8U C;  3AZH D;  3AZE C;  4WU8 D;  5AVC B;  1M1A C;  5GSU D;  1HQ3 D;  2F8N K;  3REH A;  1KU5 A;  5B32 D;  3B0C W;  2NZD A;  5AV5 A;  4UUZ B;  2HUE C;  5BS7 A;  3WA9 A;  4EO5 B;  3H0L C;  4J8V A;  3AV2 D;  1EQZ C;  3MGS A;  1TZY B;  3A1I A;  3AZE A;  1P3O B;  1H3O B;  5B40 A;  3VH6 W;  3B6G B;  3A1K A;  2ARO D;  3EPJ A;  5F99 B;  3AYW A;  3WKJ D;  4X23 A;  5BS7 C;  1HTA A;  4JJN C;  5CPJ D;  1ZLA D;  3B0B A;  5JRG D;  1ZLA A;  5F99 D;  1P3P D;  3W97 B;  3REL B;  1M19 D;  4X23 D;  2Y2I A;  2NZD C;  3AYW C;  3REH D;  1B67 A;  2UWX A;  1P3F C;  2BYM B;  3AZE D;  4WU8 C;  3W99 B;  4KHA A;  5G49 B;  2Y2H A;  3REK A;  1P3M D;  3W96 B;  3AYW B;  3AZK A;  2DQN C;  3X1S A;  2Y2L A;  1KX3 C;  1P3L A; 
#chains in the Genus database with same CATH homology
 3MGS D;  5BT1 D;  3WAA A;  5B24 D;  4R8P D;  3LJA A;  3WTP D;  3O62 D;  3AZL D;  4QLC C;  3AZH A;  3REK C;  5AV8 D;  5GXQ B;  4YM6 D;  4Z2M H;  3KUY C;  1R4V A;  5B1M D;  2YFW A;  2Y2O A;  2YFV A;  4Z5T D;  5DNM C;  4QLC B;  3AN2 A;  3AL0 C;  1A7W A;  5B32 G;  1TZY C;  4JJN D;  5B31 C;  2ARO B;  4UPK A;  4Z66 D;  5F99 C;  3MNN C;  3LZ0 B;  3B6F B;  3X1U D;  1U35 A;  3H0R C;  3EPH A;  3VH5 W;  3W98 C;  3WAA D;  3REH C;  1P3K A;  4XUJ D;  3X1S D;  4M6B A;  4J8X C;  3REJ C;  5CPI A;  1P3F D;  4CAY A;  3B6F C;  4LD9 A;  1W2E A;  3VH6 A;  1M19 A;  2ZY2 A;  1P3M C;  3C1B D;  5B0Z A;  2Y2P A;  4J8U A;  2F8N A;  4QLC A;  3LZ1 C;  1TAF A;  5JRG A;  2RVQ C;  3AZF A;  5JRG B;  3MVD D;  1P3M B;  4G91 B;  3W96 D;  4KGC A;  1ID3 B;  2G5I C;  5AV5 C;  3AV1 B;  5B24 C;  2HIO D;  3LZ1 B;  4YS3 B;  4Z66 B;  4WNN B;  1M18 B;  3WKJ C;  5GSU B;  1KX3 B;  4H9S A;  4G91 C;  3AZG D;  1P3K B;  1ID3 D;  5B24 B;  4YS3 C;  3MGP A;  4J8V C;  1EQZ A;  5GT0 D;  3F6T A;  2PYO B;  1M18 C;  3WKJ B;  4LD9 D;  3KWQ D;  5B2J A;  3WA9 D;  3A6N D;  1P3K C;  3LJA C;  5B0Y C;  1F66 D;  3AFA C;  3UT9 C;  1P3A C;  5B31 D;  3REK B;  2BYK B;  5BO0 B;  4HGA C;  5B32 A;  3R45 B;  2PYO C;  1P3A A;  3AZG A;  2Y2G A;  5DNN B;  4CSR A;  3X1U C;  3KWQ B;  1BH9 A;  5BNX B;  1HQ3 C;  3AN2 B;  5CPK C;  5B33 D;  3AZM B;  3AZL B;  3MGQ C;  4Z66 A;  4WZS B;  4H9P B;  2JCH A;  5FUG A;  4DRA A;  1S32 D;  3LEL D;  5B1L C;  4WU9 D;  3C1C A;  5GXQ D;  5AY8 C;  3X1S C;  1AOI B;  3B6F D;  1HQ3 B;  3AZF D;  4Z5T A;  5B1M B;  3AN2 D;  3W99 D;  5B33 B;  4WV4 B;  3C1B C;  3MGS C;  4WU8 A;  3W98 A;  5B0Z B;  4ZUX B;  4H9S C;  4J8X B;  3REL D;  3REJ B;  1M19 B;  1H3O A;  5B2I A;  4DQY B;  3MGS B;  5AV5 D;  5G49 A;  3B0D C;  3W99 A;  4ZUX D;  3AFA A;  3UT9 A;  3MVD B;  3X1V A;  3REI A;  1BH8 A;  4WNN A;  5DNM D;  5AV6 C;  4Z5T C;  3AZG C;  3LZ1 A;  1P3G C;  3AZK D;  5B40 C;  5AV8 B;  3UTB A;  4H9P A;  5AV5 B;  3B0D B;  4Z66 C;  4X23 C;  5CPJ B;  3LEL B;  3WTP A;  3O62 A;  4Z5T B;  5GSU C;  4H9R A;  5AY8 A;  4EO5 C;  3KXB B;  3TU4 D;  5B32 C;  1P3I D;  2PYO D;  2BYK A;  4LD9 B;  1BFM A;  5E5A D;  2CV5 D;  3AV1 D;  5AVB D;  4XUJ C;  3REI C;  5CPK D;  5C3I C;  3REJ D;  1WWS A;  5F99 A;  4NE3 A;  1P3A B;  1T3U A;  1Z2C B;  5B32 B;  1KX3 D;  1N1J A;  5B2I C;  2IO5 B;  3AV2 C;  4XZQ C;  1P3L B;  3AZF C;  3LZ0 A;  5GT3 C;  4AWL B;  3A6N A;  5CPK B;  5B2J D;  1S32 B;  3MGP C;  5B31 G;  4YS3 A;  2IO5 C;  3AV2 B;  3REK D;  3VH5 A;  3MGQ A;  2NQB C;  2HIO C;  4H9R B;  5AY8 B;  3REL C;  1U35 C;  1KX3 A;  2NZD B;  5B1M C;  3AZJ B;  2DF4 C;  3WTP B;  3O62 B;  3AZN B;  1ZLA C;  3AZJ A;  2FJ7 C;  2F8N B;  2VQR A;  5B0Z D;  2Y2J A;  1P3F B;  4J8U B;  5B31 A;  4ZUX C;  2FJ7 A;  5E5A B;  2CV5 B;  1M19 C;  2NZD D;  1M1A B;  3MNN A;  3MVD A;  3AZK C;  1P3G D;  3A6N C;  1P3P A;  5B40 D;  1BH9 B;  5BNX A;  1F66 C;  2ZY5 A;  3W97 D;  4KUD D;  3AZK B;  3A6N B;  5CPK A;  1P3G B;  1JFI B;  4J8X D;  3X1V C;  1KX5 C;  4XZQ A;  5CP6 D;  2J8P A;  1EQZ B;  3KSY A;  4NFT A;  3LEL C;  5AVB C;  4ZBJ C;  4WU9 C;  5AY8 D;  5GXQ C;  3B6G C;  2F8N G;  5AVB A;  3REL A;  5E5A A;  2CV5 A;  3UTB D;  5AVB B;  2XD5 A;  4ZBJ B;  5B31 B;  4WU9 B;  4CSR B;  4G92 C;  4R8P A;  4J8W C;  1BH8 B;  3R45 A;  5AV9 D;  3KXB D;  2NQB D;  2ZY4 A;  5AV8 A;  3UTB B;  4XZQ B;  1U35 D;  1JFI A;  3NQJ B;  4AWL C;  5AV6 D;  2F2A C;  1M18 D;  3WA9 C;  5CPI B;  5B24 A;  3LJA D;  3MGP B;  4ZUX A;  3AFA D;  1B6W A;  4JJN A;  3UT9 D;  1P34 D;  4WU8 B;  1P3A D;  4JJN B;  3TU4 A;  3X1T B;  1P34 A;  3MGR D;  5CHL B;  2BG1 A;  1F66 A;  3WA9 B;  5CPI C;  4J8X A;  2FJ7 B;  2FFF B;  3W97 C;  3VH6 T;  1P3M A;  3X1T C;  5E5A C;  2CV5 C;  2BYM A;  3AZL A;  3AV1 C;  5DNM A;  3V9R B;  5DNN A;  3C1C B;  3UTA B;  3AZM D;  1AOI A;  3W99 C;  3LEL A;  2HIO A;  5AVC C;  1S32 A;  3W96 C;  3B6G D;  3KUY B;  3H0M C;  5B2J C;  3UTA C;  2Y2K A;  3LJA B;  3MGP D;  2HUE B;  2LY8 A;  3X1T A;  1P34 B;  2ARO C;  4YS3 D;  3MGR B;  5B2J B;  3MNN B;  3LZ0 C;  3KWQ C;  3B6G A;  2ARO A;  3AZI D;  1P3K D;  4DRB A;  4H9N B;  1P3O C;  3W96 A;  1ID3 A;  3V9R A;  4J8W B;  1KX5 A;  5DNM B;  3REH B;  3X1U A;  5CPJ A;  2F8N D;  3AV1 A;  3TU4 C;  5B33 C;  5FUG B;  1P3I C;  1M1A D;  1F1E A;  5CPI D;  4H9O A;  5DNN D;  4E44 A;  4Z2M G;  3TU4 B;  5JA4 A;  5CP6 C;  3X1T D;  4YM6 A;  1P3I B;  3FDD A;  5KDM B;  4E45 A;  1Q9C A;  3REJ A;  5GT3 D;  5AV6 A;  5AV6 B;  5CP6 B;  1N1J B;  5B40 B;  5AV9 A;  1P3L D;  1KX4 A;  1HQ3 A;  1P3B D;  3UTA D;  4KUD B;  5GSU A;  1M18 A;  4H9O B;  3KXB C;  5BNV A;  2G5H C;  4YM6 C;  3AZH B;  4WJ3 C;  4HGA B;  1P3F A;  3KXB A;  4UUZ A;  3AZN D;  2F8N H;  1P3P C;  5C3I B;  3AZN A;  5GXQ A;  2Y2N A;  1P3O D;  3C1C D;  1P34 C;  3AZH C;  2JE5 A;  3NQU A;  4H9N A;  4KGC C;  3MGR C;  5B2I B;  5B1L B;  5B0Y A;  3X1S B;  1AOI C;  5GT3 B;  3REI D;  3AFA B;  3UT9 B;  3X1V D;  3W98 D;  1KX5 D;  4KUD A;  1KX4 B;  3C1B B;  5B2I D;  2Y2M A;  5DNN C;  2Y2Q A;  4XZQ D;  1U35 B;  5B1M A;  3B6F A;  1WWI A;  3NQJ A;  3AZM C;  3KFU G;  3KUY A;  3W98 B;  1KX4 C;  5AVC D;  5GT0 A;  1EQZ D;  3W97 A;  5B33 A;  2W8S A;  2RVQ D;  3MVD C;  3P5J B;  2RIQ A;  3AZG B;  2XD1 A;  4WU9 A;  5AV9 C;  2FJ7 D;  5BO0 A;  5AV8 C;  5B0Z C;  3AZI A;  3KUY D;  4X23 B;  5CPJ C;  3KWQ A;  5JRG C;  3AZJ D;  3LZ0 D;  2ZM5 A;  5AV9 B;  3X1V B;  1KX5 B;  1PZR A;  1ID3 C;  3EG5 B;  4J8V D;  2L5A A;  4J8U D;  3WAA B;  3IP4 C;  3C1B A;  4LD9 C;  4KUD C;  3MNN D;  1P3G A;  5B0Y D;  3WKJ A;  4XUJ B;  3AYW D;  2ZY3 A;  4XUJ A;  4H9Q A;  4YM6 B;  1P3I A;  3WAA C;  3MGR A;  3VH5 T;  4KGC D;  4J8V B;  3NQU B;  5JA4 B;  2YFV B;  1AOI D;  4KHA B;  2YFW B;  1P3P B;  3AZF B;  4G92 B;  1ULY A;  1TAF B;  5B0Y B;  4R8P B;  3MGQ D;  4NE5 A;  2JSS A;  5AVC A;  2CWE A;  1S32 C;  4KGC B;  5B1L D;  3UTB C;  5BT1 C;  2HIO B;  3LZ1 D;  3REI B;  3X1U B;  3AZM A;  3AN2 C;  4R8P C;  4J8W A;  3UTA A;  3WTP C;  3O62 C;  1KX4 D;  1ZLA B;  4J8W D;  3AZL C;  3MGQ B;  4QLC D;  3WTP E;  3EPK A;  3B0C T;  3AV2 A;  4H9Q B;  5BNV B;  1P3L C;  4CAY B;  5GT0 B;  1P3B C;  4NE6 A;  2PYO A;  1P3B A;  1F66 B;  3AZI C;  2NQB A;  1TZY D;  5KDM A;  1P3O A;  2NQB B;  1TZY A;  5GT0 C;  3AZE B;  1P3B B;  5CP6 A;  3AZJ C;  3AZN C;  3EPL A;  5GT3 A;  3AZI B;  1M1A A;  5B1L A;  3C1C C;  4J8U C;  3AZH D;  3AZE C;  4WU8 D;  5AVC B;  1M1A C;  5GSU D;  1HQ3 D;  2F8N K;  3REH A;  1KU5 A;  5B32 D;  3B0C W;  2NZD A;  5AV5 A;  4UUZ B;  2HUE C;  5BS7 A;  3WA9 A;  4EO5 B;  3H0L C;  4J8V A;  3AV2 D;  1EQZ C;  3MGS A;  1TZY B;  3A1I A;  3AZE A;  1P3O B;  1H3O B;  5B40 A;  3VH6 W;  3B6G B;  3A1K A;  2ARO D;  3EPJ A;  5F99 B;  3AYW A;  3WKJ D;  4X23 A;  5BS7 C;  1HTA A;  4JJN C;  5CPJ D;  1ZLA D;  3B0B A;  5JRG D;  1ZLA A;  5F99 D;  1P3P D;  3W97 B;  3REL B;  1M19 D;  4X23 D;  2Y2I A;  2NZD C;  3AYW C;  3REH D;  1B67 A;  2UWX A;  1P3F C;  2BYM B;  3AZE D;  4WU8 C;  3W99 B;  4KHA A;  5G49 B;  2Y2H A;  3REK A;  1P3M D;  3W96 B;  3AYW B;  3AZK A;  2DQN C;  3X1S A;  2Y2L A;  1KX3 C;  1P3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...