1F66D

2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
b'KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PALINDROMIC 146 BASE PAIR DNA FRAGMENT
publication title Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f66D00
5JRGC 2AROA 3REJD 2YFWA 3VH5T 1U35D 3REID 5B31D 3UTAC 1F66C 4Z66D 1H3OA 3AV1A 3B6GB 3LJAB 3MGPC 4G92C 4YM6B 3AFAA 3AZMB 1P3GB 3AV2D 4X23B 1WWSA 2NQBD 4YS3C 3W97A 4X23D 3KWQC 5B2JA 5B24C 2NZDB 3MGSB 5JA4B 1P3IB 1BH8A 4WU9D 1ID3A 5BO0B 2NZDD 1P3ID 5GT0D 4KGCA 5DNMC 3X1UB 3RELD 3AZGA 4E44A 2LY8A 5AY8A 5B32B 3X1UD 5F99A 3C1BD 4J8VD 5B33B 1P3MB 1TZYC 4WU8A 5E5AD 1KX4D 1JFIB 5GSUA 5AVCA 3B6FB 1B67A 5AV5B 1ZLAB 2YFVB 3X1VC 5CPIA 3W96A 5B40C 1M1AB 3REHC 3AZLA 3A6ND 3X1TC 5B32G 3WTPB 3AZFC 3V9RB 2CV5A 3AN2B 1BH9B 4H9PB 2FJ7D 3AZNC 3AN2D 5AVBA 4KUDB 3WAAD 5B0YA 1TAFA 4KUDD 4KHAB 4UUZB 5B0ZB 5B0ZD 3B0DB 3NQUA 3MGRC 3TU4B 3O62A 5CPJA 3MNND 1KX3B 3W99D 1HQ3C 2HIOD 4XUJA 4H9SC 5GXQC 3LZ0B 3MVDB 5AV8B 3B0BA 5B1MB 1P3OB 5JRGB 1M18B 3MGQA 2IO5B 3B6GC 3LJAC 4CSRA 3AZHB 4Z5TA 3UTAB 1F66B 2F8ND 1P3GC 5B2IA 3UTAD 1F66D 4NFTA 3AFAC 1AOID 5BNVB 3MGPD 3MGSC 1P3BB 3W98C 5B2JC 3WKJB 4XZQA 3KWQB 4J8WA 5CHLB 3KUYA 5B24B 4YS3D 3VH5A 1P3PA 2JSSA 2F8NG 5B24D 1S32A 4KGCC 3LZ1A 3X1SA 5AY8C 3C1CD 5DNMD 3B0CT 5G49A 1M19A 3B0CW 4WU8C 1P3KA 1TZYB 5AV5C 1ZLAC 1M1AC 1TZYD 1P3LD 2BYMA 3WTPC 5CPIC 3R45A 3KXBA 3X1VB 3AZLC 3REHB 5AV6A 4Z2MH 3X1VD 3X1TB 5B40D 3AZEA 3AZJA 5CP6C 3AZFB 5CPKA 5AVBC 3AZFD 4J8XD 3AZNB 3AYWB 4ZUXB 3TU4C 2L5AA 5BNXB 1N1JA 4HGAC 3O62C 5GT3D 2F8NK 3MVDC 3MGRD 4H9OA 5AV8C 5B1MC 4XUJC 1ULYA 5AV9C 1P3OC 1P34A 3WA9B 1HQ3B 1M18C 5GXQB 2IO5C 1HQ3D 3AZHC 4LD9A 2AROB 3MGQC 2YFWB 4QLCA 4Z5TC 3VH6T 4H9RA 5BS7A 5DNNA 3VH6W 1H3OB 5B2IC 3LJAD 3B6GD 1P3AA 4H9QA 4H9NB 4YM6D 3AV1B 3AZMD 1P3BC 1P3FA 1KX5A 3UTBA 1P3GD 3AFAB 3WKJC 3REJA 2BYKA 3AFAD 1U35A 3W98B 3REIA 5B31A 5B2JB 4Z66A 3MGSD 3W98D 3KUYC 5B2JD 1BH8B 4G91C 1S32C 4KGCB 3AV2A 4KGCD 5B32D 2NQBA 5AY8B 4NE3A 5B33D 1P3MD 1M19C 4WU9A 1P3KC 4E45A 2NZDA 4WU8B 5GT0A 5KDMA 4WU8D 3RELA 5GSUB 3B6FD 5AVCB 5AV5D 1ZLAD 1M1AD 3C1BA 4J8VA 5CPIB 3W96B 3AZIA 4WZSB 3AZLB 3WTPD 5E5AA 1KX4A 3AZLD 3AYWC 2CV5B 1JFIA 4EO5B 5CP6B 4ZUXC 5CPKC 4NE5A 5AVBB 5CP6D 5B0YB 1TAFB 5AVBD 3A6NA 5B1LA 3TU4D 2FJ7A 4HGAB 3NQUB 3V9RA 4AWLB 3O62B 5CPJB 3WA9C 3WAAA 3O62D 1KX3D 4JJNA 3MVDD 3LZ0D 4UUZA 5AV9B 4XUJB 5AV8D 2AROC 1WWIA 2RVQC 5B1MD 4XUJD 5BT1C 5AV9D 1P3OD 5JRGD 1M18D 3MGQB 3AV1C 3AZHD 3MNNA 4CSRB 3MGQD 4Z5TB 5DNNC 3W99A 2HIOA 2PYOA 5B2IB 3UTBC 3W97C 1P3BD 1ID3C 3WKJD 5B31C 3KWQD 3UT9A 4XZQB 2F8NA 4J8WB 3KUYB 3REKA 4ZBJC 3AZGC 3UTAA 1P3PB 1AOIA 4G91B 3VH6A 3KUYD 1S32B 5F99C 3MGPA 4J8UA 4YS3A 4WU9C 5G49B 5GSUC 1M19B 5B24A 5AVCC 1P3KB 3W96C 3NQJA 3C1CA 2F8NH 5DNMA 3C1BC 2BYMB 3AZIC 3KXBB 3REHD 2CV5C 4WNNA 4EO5C 3X1TD 5B0YC 3AZEB 1TZYA 1P3LA 3AZND 5CPKB 3AYWD 4ZUXD 4CAYA 1EQZA 3A6NC 4AWLC 5CPJC 5B40A 5B1LC 1N1JB 3LELA 1B6WA 4DRAA 3AZFA 3WAAC 4J8XA 4NE6A 4H9OB 4JJNC 5FUGA 3WA9D 5GXQD 1P34B 4R8PA 5GT3A 2AROD 3AZKA 4LD9B 2RVQD 5BT1D 3MGRA 4QLCB 3W99C 2PYOC 3AV1D 5DNNB 1P3AB 1KX5B 1P3FB 1HQ3A 4H9SA 3UTBB 3W97B 4XZQC 3REJB 2BYKB 5C3IB 4J8WC 3W97D 1P3PC 1U35B 3UT9C 3REIB 5B31B 1ID3B 4Z66B 3B6GA 3LJAA 3REKC 1ID3D 3VH5W 4YM6A 3LZ1C 3AZMA 4ZBJB 1AOIC 3AZGB 1P3GA 3X1SC 4H9NA 4X23A 3AZGD 3AV2B 5F99B 4J8UC 5AY8D 2NQBB 5F99D 3MGSA 5JA4A 1P3IA 3W98A 5BO0A 4WU9B 5B31G 2CWEA 3X1UA 5GT0B 5GSUD 5KDMB 3KXBC 3RELB 5AVCD 5B32A 3C1CC 5AV6C 5CPID 3W96D 5B33A 3C1BB 3AZEC 1P3MA 4J8VB 3AZJC 3AZIB 2HUEC 5E5AB 1KX4B 3AZID 2CV5D 1Q9CA 1P3LC 5B0YD 3B6FA 5AV5A 1ZLAA 2YFVA 1M1AA 1HTAA 1EQZC 3WTPA 1F1EA 3A6NB 3AN2A 1BH9A 4H9PA 5B1LB 3LELC 2FJ7B 4KUDA 5CPJD 5B1LD 4J8XC 5CP6A 3WAAB 4KHAA 1P34C 5B0ZA 1BFMA 4JJNB 4LD9C 4JJND 1KU5A 4R8PC 4QLCC 3TU4A 5GT3C 3AZKC 5BS7C 1P3AC 1KX5C 1KX3A 4Z5TD 3MNNB 1P3FC 3MVDA 3LZ0A 5B2ID 3W99B 2HIOB 5AV8A 3REJC 5C3IC 2PYOB 5B1MA 5AV9A 1U35C 1P3OA 5JRGA 2PYOD 3REIC 1M18A 4Z66C 3AZHA 4XZQD 1F66A 4J8WD 3UT9B 2F8NB 1P3PD 3AV2C 4YM6C 3REKB 3AZMC 3UT9D 3LZ1B 1S32D 1AOIB 2NQBC 5BNVA 4X23C 3REKD 3X1SB 1P3BA 3LZ1D 3MGPB 4G92B 3X1SD 3WTPE 4J8UB 3WKJA 3KWQA 2NZDC 4DRBA 1P3IC 5GT0C 4J8UD 1M19D 4YS3B 3RELC 1P3KD 3X1UC 4Z2MG 4J8VC 5B32C 3R45B 3NQJB 5E5AC 3C1CB 1KX4C 5AV6B 5DNMB 3KXBD 5B33C 1P3MC 5AV6D 4WNNB 3AZJB 2HUEB 3AZED 3AZJD 5CPKD 1P3LB 3B6FC 3KSYA 3X1VA 4CAYB 3REHA 1EQZB 2FJ7C 3X1TA 3AN2C 1EQZD 5B40B 4KUDC 1A7WA 3LELB 3AZNA 3AYWA 4J8XB 3LELD 5B0ZC 4ZUXA 5FUGB 3B0DC 1P34D 5BNXA 4WV4B 1R4VA 4R8PB 3MNNC 4LD9D 5GT3B 3AZKB 4R8PD 4H9RB 2HIOC 4QLCD 3MGRB 3AZKD 4M6BA 1KX3C 4H9QB 3WA9A 3LZ0C 5DNND 5GXQA 1P3AD 1KX5D 1P3FD 3UTBD
chains in the Genus database with same CATH superfamily
5JRGC 2AROA 3REJD 2YFWA 3VH5T 1U35D 3REID 5B31D 3UTAC 1F66C 4Z66D 1H3OA 3AV1A 3B6GB 3LJAB 3MGPC 4G92C 4YM6B 3AFAA 3AZMB 1P3GB 3AV2D 2BG1A 4X23B 1WWSA 2NQBD 4YS3C 3W97A 4X23D 3KWQC 5B2JA 5B24C 2NZDB 3MGSB 5JA4B 1P3IB 1BH8A 4WU9D 1ID3A 5BO0B 2NZDD 1P3ID 5GT0D 4KGCA 5DNMC 3X1UB 3RELD 3AZGA 4E44A 2LY8A 5AY8A 5B32B 3X1UD 5F99A 3C1BD 4J8VD 5B33B 1P3MB 1TZYC 4WU8A 5E5AD 1KX4D 1JFIB 5GSUA 5AVCA 3B6FB 1B67A 5AV5B 1ZLAB 2YFVB 3X1VC 5CPIA 3W96A 5B40C 1M1AB 3REHC 3AZLA 3A6ND 3X1TC 5B32G 3WTPB 3AZFC 3V9RB 2CV5A 3AN2B 1BH9B 4H9PB 2FJ7D 3AZNC 3AN2D 5AVBA 4KUDB 3WAAD 5B0YA 1TAFA 4KUDD 4KHAB 4UUZB 5B0ZB 5B0ZD 3B0DB 3KFUG 3NQUA 3MGRC 3TU4B 3O62A 5CPJA 3MNND 1Z2CB 2W8SA 1KX3B 3W99D 1HQ3C 2HIOD 4XUJA 4H9SC 5GXQC 3LZ0B 3MVDB 5AV8B 3B0BA 5B1MB 1P3OB 5JRGB 1M18B 3MGQA 2IO5B 3B6GC 3LJAC 4CSRA 3AZHB 4Z5TA 3UTAB 1F66B 2F8ND 1P3GC 5B2IA 3UTAD 1F66D 4NFTA 3AFAC 1AOID 5BNVB 3MGPD 3MGSC 1P3BB 3W98C 2F2AC 5B2JC 3WKJB 4XZQA 3KWQB 4J8WA 5CHLB 3KUYA 5B24B 4YS3D 3VH5A 1P3PA 2JSSA 2F8NG 5B24D 2VQRA 1S32A 4KGCC 3LZ1A 3X1SA 5AY8C 3C1CD 5DNMD 2Y2JA 3B0CT 5G49A 1M19A 3B0CW 4WU8C 1P3KA 1TZYB 5AV5C 1ZLAC 1M1AC 1TZYD 1P3LD 2UWXA 2Y2NA 2BYMA 3WTPC 5CPIC 3R45A 3KXBA 3X1VB 3AZLC 3REHB 5AV6A 4Z2MH 3X1VD 3X1TB 5B40D 3AZEA 3AZJA 5CP6C 3AZFB 5CPKA 5AVBC 3AZFD 4J8XD 3AZNB 3AYWB 2J8PA 4ZUXB 3TU4C 2L5AA 5BNXB 1N1JA 4HGAC 3O62C 5GT3D 2F8NK 3MVDC 3MGRD 4H9OA 5AV8C 3EG5B 5B1MC 4XUJC 1ULYA 5AV9C 1P3OC 1P34A 3WA9B 1HQ3B 1M18C 5GXQB 2IO5C 1HQ3D 2XD5A 3AZHC 4LD9A 2AROB 3MGQC 2YFWB 4QLCA 4Z5TC 3VH6T 4H9RA 5BS7A 2DF4C 5DNNA 3VH6W 1H3OB 5B2IC 3LJAD 3B6GD 1P3AA 4H9QA 4H9NB 4YM6D 3AV1B 3AZMD 1P3BC 1P3FA 1KX5A 2Y2MA 3UTBA 1PZRA 1P3GD 3AFAB 3WKJC 3REJA 2BYKA 3AFAD 1U35A 3W98B 3REIA 5B31A 5B2JB 4Z66A 3MGSD 3W98D 3KUYC 3F6TA 5B2JD 1BH8B 4G91C 1S32C 4KGCB 3AV2A 3EPHA 4KGCD 5B32D 2NQBA 5AY8B 2Y2IA 4NE3A 5B33D 1P3MD 1M19C 4WU9A 1P3KC 4E45A 2NZDA 4WU8B 5GT0A 5KDMA 4WU8D 3RELA 5GSUB 3B6FD 2Y2LA 5AVCB 5AV5D 1M1AD 1ZLAD 3C1BA 4J8VA 5CPIB 3W96B 3AZIA 4WZSB 3AZLB 3WTPD 5E5AA 1KX4A 2JCHA 3AZLD 3AYWC 1W2EA 2CV5B 1JFIA 4EO5B 5CP6B 4ZUXC 5CPKC 4NE5A 5AVBB 5CP6D 5B0YB 1TAFB 5AVBD 3A6NA 5B1LA 3TU4D 2FJ7A 4HGAB 3NQUB 3V9RA 4AWLB 3O62B 3H0LC 5CPJB 3WA9C 3WAAA 3O62D 2ZM5A 1KX3D 4JJNA 3MVDD 3LZ0D 4UUZA 4XUJB 5AV9B 5AV8D 2AROC 1WWIA 2RVQC 5B1MD 4XUJD 5BT1C 5AV9D 1P3OD 5JRGD 1M18D 3MGQB 3AV1C 3AZHD 3MNNA 4CSRB 3MGQD 4Z5TB 5DNNC 3W99A 2HIOA 2ZY4A 2PYOA 2ZY5A 5B2IB 3UTBC 3W97C 4UPKA 1P3BD 1ID3C 3WKJD 5B31C 3KWQD 3UT9A 4XZQB 2F8NA 4J8WB 3KUYB 3REKA 4ZBJC 3AZGC 1T3UA 3UTAA 1P3PB 1AOIA 4G91B 3VH6A 3KUYD 1S32B 2DQNC 5F99C 3MGPA 4J8UA 4YS3A 4WU9C 5G49B 5GSUC 1M19B 5B24A 5AVCC 1P3KB 3W96C 3NQJA 3C1CA 2F8NH 5DNMA 3C1BC 2BYMB 3AZIC 3KXBB 3REHD 2CV5C 4WNNA 4EO5C 3X1TD 5B0YC 3AZEB 1TZYA 1P3LA 3AZND 5CPKB 3AYWD 4ZUXD 4CAYA 1EQZA 3A6NC 4AWLC 5CPJC 2RIQA 5B40A 5B1LC 1N1JB 3LELA 1B6WA 4DRAA 3AZFA 3WAAC 4J8XA 4NE6A 4H9OB 4JJNC 5FUGA 3WA9D 5GXQD 1P34B 3EPKA 4R8PA 5GT3A 2AROD 3AZKA 4LD9B 2RVQD 5BT1D 3MGRA 4QLCB 3W99C 2PYOC 3AV1D 5DNNB 1P3AB 1KX5B 1P3FB 1HQ3A 4H9SA 3UTBB 3W97B 4XZQC 3REJB 2BYKB 5C3IB 4J8WC 3W97D 1P3PC 1U35B 3UT9C 3REIB 5B31B 1ID3B 4Z66B 2Y2QA 3B6GA 3LJAA 3REKC 1ID3D 3VH5W 4YM6A 3LZ1C 3AZMA 4ZBJB 1AOIC 3AZGB 3A1KA 1P3GA 3X1SC 4H9NA 4X23A 3AZGD 3AV2B 2ZY2A 5F99B 4J8UC 5AY8D 2NQBB 5F99D 3MGSA 5JA4A 1P3IA 3W98A 5BO0A 4WU9B 2XD1A 5B31G 2CWEA 5GT0B 3X1UA 3EPLA 5GSUD 5KDMB 3KXBC 2G5HC 5AVCD 5B32A 3RELB 3C1CC 5AV6C 5CPID 3W96D 5B33A 3C1BB 3AZEC 1P3MA 4J8VB 3AZJC 3AZIB 2HUEC 5E5AB 1KX4B 3AZID 2CV5D 1Q9CA 2Y2KA 2ZY3A 1P3LC 5B0YD 3B6FA 5AV5A 1ZLAA 2YFVA 1M1AA 3H0RC 1HTAA 1EQZC 3WTPA 1F1EA 3A6NB 3AN2A 1BH9A 4H9PA 5B1LB 3LELC 2JE5A 2FJ7B 4KUDA 5CPJD 5B1LD 4J8XC 5CP6A 3WAAB 4KHAA 1P34C 3H0MC 5B0ZA 1BFMA 4JJNB 4LD9C 4JJND 1KU5A 4R8PC 2Y2OA 4QLCC 3TU4A 5GT3C 3AZKC 4DQYB 5BS7C 1P3AC 1KX5C 1KX3A 4Z5TD 3MNNB 1P3FC 3MVDA 3LZ0A 5B2ID 3W99B 2HIOB 5AV8A 3REJC 5C3IC 3P5JB 2PYOB 5B1MA 5AV9A 1U35C 1P3OA 5JRGA 2PYOD 3REIC 1M18A 4Z66C 3AZHA 3AL0C 4XZQD 1F66A 4J8WD 3UT9B 2F8NB 1P3PD 3AV2C 4YM6C 3EPJA 3REKB 3AZMC 3UT9D 3LZ1B 1S32D 1AOIB 2NQBC 5BNVA 4X23C 3REKD 3X1SB 1P3BA 3LZ1D 3MGPB 4G92B 3X1SD 3WTPE 4J8UB 3WKJA 3KWQA 2NZDC 4DRBA 1P3IC 5GT0C 4J8UD 1M19D 4YS3B 4WJ3C 3RELC 1P3KD 3X1UC 4Z2MG 4J8VC 5B32C 2FFFB 3R45B 3NQJB 5E5AC 3C1CB 1KX4C 5AV6B 5DNMB 3KXBD 5B33C 1P3MC 2G5IC 5AV6D 4WNNB 3AZJB 2HUEB 3AZED 3AZJD 5CPKD 1P3LB 3B6FC 3KSYA 2Y2GA 3X1VA 4CAYB 3REHA 2Y2PA 1EQZB 2FJ7C 3X1TA 3AN2C 1EQZD 5B40B 4KUDC 1A7WA 3LELB 3IP4C 3AZNA 3AYWA 4J8XB 3LELD 5B0ZC 4ZUXA 2Y2HA 5FUGB 3B0DC 1P34D 5BNXA 4WV4B 1R4VA 4R8PB 3MNNC 3FDDA 4LD9D 5GT3B 3AZKB 4R8PD 4H9RB 2HIOC 4QLCD 3MGRB 3AZKD 4M6BA 1KX3C 4H9QB 3WA9A 3LZ0C 5DNND 5GXQA 3A1IA 1P3AD 1KX5D 1P3FD 3UTBD
chains in the Genus database with same CATH topology
5JRGC 2AROA 3REJD 2YFWA 3VH5T 1U35D 3REID 5B31D 3UTAC 1F66C 4Z66D 1H3OA 3AV1A 3B6GB 3LJAB 3MGPC 4G92C 4YM6B 3AFAA 3AZMB 1P3GB 3AV2D 2BG1A 4X23B 1WWSA 2NQBD 4YS3C 3W97A 4X23D 3KWQC 5B2JA 5B24C 2NZDB 3MGSB 5JA4B 1P3IB 1BH8A 4WU9D 1ID3A 5BO0B 2NZDD 1P3ID 5GT0D 4KGCA 5DNMC 3X1UB 3RELD 3AZGA 4E44A 2LY8A 5AY8A 5B32B 3X1UD 5F99A 3C1BD 4J8VD 5B33B 1P3MB 1TZYC 4WU8A 5E5AD 1KX4D 1JFIB 5GSUA 5AVCA 3B6FB 1B67A 5AV5B 1ZLAB 2YFVB 3X1VC 5CPIA 3W96A 5B40C 1M1AB 3REHC 3AZLA 3A6ND 3X1TC 5B32G 3WTPB 3AZFC 3V9RB 2CV5A 3AN2B 1BH9B 4H9PB 2FJ7D 3AZNC 3AN2D 5AVBA 4KUDB 3WAAD 5B0YA 1TAFA 4KUDD 4KHAB 4UUZB 5B0ZB 5B0ZD 3B0DB 3KFUG 3NQUA 3MGRC 3TU4B 3O62A 5CPJA 3MNND 1Z2CB 2W8SA 1KX3B 3W99D 1HQ3C 2HIOD 4XUJA 4H9SC 5GXQC 3LZ0B 3MVDB 5AV8B 3B0BA 5B1MB 1P3OB 5JRGB 1M18B 3MGQA 2IO5B 3B6GC 3LJAC 4CSRA 3AZHB 4Z5TA 3UTAB 1F66B 2F8ND 1P3GC 5B2IA 3UTAD 1F66D 4NFTA 3AFAC 1AOID 5BNVB 3MGPD 3MGSC 1P3BB 3W98C 2F2AC 5B2JC 3WKJB 4XZQA 3KWQB 4J8WA 5CHLB 3KUYA 5B24B 4YS3D 3VH5A 1P3PA 2JSSA 2F8NG 5B24D 2VQRA 1S32A 4KGCC 3LZ1A 3X1SA 5AY8C 3C1CD 5DNMD 2Y2JA 3B0CT 5G49A 1M19A 3B0CW 4WU8C 1P3KA 1TZYB 5AV5C 1ZLAC 1M1AC 1TZYD 1P3LD 2UWXA 2Y2NA 2BYMA 3WTPC 5CPIC 3R45A 3KXBA 3X1VB 3AZLC 3REHB 5AV6A 4Z2MH 3X1VD 3X1TB 5B40D 3AZEA 3AZJA 5CP6C 3AZFB 5CPKA 5AVBC 3AZFD 4J8XD 3AZNB 3AYWB 2J8PA 4ZUXB 3TU4C 2L5AA 5BNXB 1N1JA 4HGAC 3O62C 5GT3D 2F8NK 3MVDC 3MGRD 4H9OA 5AV8C 3EG5B 5B1MC 4XUJC 1ULYA 5AV9C 1P3OC 1P34A 3WA9B 1HQ3B 1M18C 5GXQB 2IO5C 1HQ3D 2XD5A 3AZHC 4LD9A 2AROB 3MGQC 2YFWB 4QLCA 4Z5TC 3VH6T 4H9RA 5BS7A 2DF4C 5DNNA 3VH6W 1H3OB 5B2IC 3LJAD 3B6GD 1P3AA 4H9QA 4H9NB 4YM6D 3AV1B 3AZMD 1P3BC 1P3FA 1KX5A 2Y2MA 3UTBA 1PZRA 1P3GD 3AFAB 3WKJC 3REJA 2BYKA 3AFAD 1U35A 3W98B 3REIA 5B31A 5B2JB 4Z66A 3MGSD 3W98D 3KUYC 3F6TA 5B2JD 1BH8B 4G91C 1S32C 4KGCB 3AV2A 3EPHA 4KGCD 5B32D 2NQBA 5AY8B 2Y2IA 4NE3A 5B33D 1P3MD 1M19C 4WU9A 1P3KC 4E45A 2NZDA 4WU8B 5GT0A 5KDMA 4WU8D 3RELA 5GSUB 3B6FD 2Y2LA 5AVCB 5AV5D 1M1AD 1ZLAD 3C1BA 4J8VA 5CPIB 3W96B 3AZIA 4WZSB 3AZLB 3WTPD 5E5AA 1KX4A 2JCHA 3AZLD 3AYWC 1W2EA 2CV5B 1JFIA 4EO5B 5CP6B 4ZUXC 5CPKC 4NE5A 5AVBB 5CP6D 5B0YB 1TAFB 5AVBD 3A6NA 5B1LA 3TU4D 2FJ7A 4HGAB 3NQUB 3V9RA 4AWLB 3O62B 3H0LC 5CPJB 3WA9C 3WAAA 3O62D 2ZM5A 1KX3D 4JJNA 3MVDD 3LZ0D 4UUZA 4XUJB 5AV9B 5AV8D 2AROC 1WWIA 2RVQC 5B1MD 4XUJD 5BT1C 5AV9D 1P3OD 5JRGD 1M18D 3MGQB 3AV1C 3AZHD 3MNNA 4CSRB 3MGQD 4Z5TB 5DNNC 3W99A 2HIOA 2ZY4A 2PYOA 2ZY5A 5B2IB 3UTBC 3W97C 4UPKA 1P3BD 1ID3C 3WKJD 5B31C 3KWQD 3UT9A 4XZQB 2F8NA 4J8WB 3KUYB 3REKA 4ZBJC 3AZGC 1T3UA 3UTAA 1P3PB 1AOIA 4G91B 3VH6A 3KUYD 1S32B 2DQNC 5F99C 3MGPA 4J8UA 4YS3A 4WU9C 5G49B 5GSUC 1M19B 5B24A 5AVCC 1P3KB 3W96C 3NQJA 3C1CA 2F8NH 5DNMA 3C1BC 2BYMB 3AZIC 3KXBB 3REHD 2CV5C 4WNNA 4EO5C 3X1TD 5B0YC 3AZEB 1TZYA 1P3LA 3AZND 5CPKB 3AYWD 4ZUXD 4CAYA 1EQZA 3A6NC 4AWLC 5CPJC 2RIQA 5B40A 5B1LC 1N1JB 3LELA 1B6WA 4DRAA 3AZFA 3WAAC 4J8XA 4NE6A 4H9OB 4JJNC 5FUGA 3WA9D 5GXQD 1P34B 3EPKA 4R8PA 5GT3A 2AROD 3AZKA 4LD9B 2RVQD 5BT1D 3MGRA 4QLCB 3W99C 2PYOC 3AV1D 5DNNB 1P3AB 1KX5B 1P3FB 1HQ3A 4H9SA 3UTBB 3W97B 4XZQC 3REJB 2BYKB 5C3IB 4J8WC 3W97D 1P3PC 1U35B 3UT9C 3REIB 5B31B 1ID3B 4Z66B 2Y2QA 3B6GA 3LJAA 3REKC 1ID3D 3VH5W 4YM6A 3LZ1C 3AZMA 4ZBJB 1AOIC 3AZGB 3A1KA 1P3GA 3X1SC 4H9NA 4X23A 3AZGD 3AV2B 2ZY2A 5F99B 4J8UC 5AY8D 2NQBB 5F99D 3MGSA 5JA4A 1P3IA 3W98A 5BO0A 4WU9B 2XD1A 5B31G 2CWEA 5GT0B 3X1UA 3EPLA 5GSUD 5KDMB 3KXBC 2G5HC 5AVCD 5B32A 3RELB 3C1CC 5AV6C 5CPID 3W96D 5B33A 3C1BB 3AZEC 1P3MA 4J8VB 3AZJC 3AZIB 2HUEC 5E5AB 1KX4B 3AZID 2CV5D 1Q9CA 2Y2KA 2ZY3A 1P3LC 5B0YD 3B6FA 5AV5A 1ZLAA 2YFVA 1M1AA 3H0RC 1HTAA 1EQZC 3WTPA 1F1EA 3A6NB 3AN2A 1BH9A 4H9PA 5B1LB 3LELC 2JE5A 2FJ7B 4KUDA 5CPJD 5B1LD 4J8XC 5CP6A 3WAAB 4KHAA 1P34C 3H0MC 5B0ZA 1BFMA 4JJNB 4LD9C 4JJND 1KU5A 4R8PC 2Y2OA 4QLCC 3TU4A 5GT3C 3AZKC 4DQYB 5BS7C 1P3AC 1KX5C 1KX3A 4Z5TD 3MNNB 1P3FC 3MVDA 3LZ0A 5B2ID 3W99B 2HIOB 5AV8A 3REJC 5C3IC 3P5JB 2PYOB 5B1MA 5AV9A 1U35C 1P3OA 5JRGA 2PYOD 3REIC 1M18A 4Z66C 3AZHA 3AL0C 4XZQD 1F66A 4J8WD 3UT9B 2F8NB 1P3PD 3AV2C 4YM6C 3EPJA 3REKB 3AZMC 3UT9D 3LZ1B 1S32D 1AOIB 2NQBC 5BNVA 4X23C 3REKD 3X1SB 1P3BA 3LZ1D 3MGPB 4G92B 3X1SD 3WTPE 4J8UB 3WKJA 3KWQA 2NZDC 4DRBA 1P3IC 5GT0C 4J8UD 1M19D 4YS3B 4WJ3C 3RELC 1P3KD 3X1UC 4Z2MG 4J8VC 5B32C 2FFFB 3R45B 3NQJB 5E5AC 3C1CB 1KX4C 5AV6B 5DNMB 3KXBD 5B33C 1P3MC 2G5IC 5AV6D 4WNNB 3AZJB 2HUEB 3AZED 3AZJD 5CPKD 1P3LB 3B6FC 3KSYA 2Y2GA 3X1VA 4CAYB 3REHA 2Y2PA 1EQZB 2FJ7C 3X1TA 3AN2C 1EQZD 5B40B 4KUDC 1A7WA 3LELB 3IP4C 3AZNA 3AYWA 4J8XB 3LELD 5B0ZC 4ZUXA 2Y2HA 5FUGB 3B0DC 1P34D 5BNXA 4WV4B 1R4VA 4R8PB 3MNNC 3FDDA 4LD9D 5GT3B 3AZKB 4R8PD 4H9RB 2HIOC 4QLCD 3MGRB 3AZKD 4M6BA 1KX3C 4H9QB 3WA9A 3LZ0C 5DNND 5GXQA 3A1IA 1P3AD 1KX5D 1P3FD 3UTBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG C;  2ARO A;  3REJ D;  2YFW A;  3VH5 T;  1U35 D;  3REI D;  5B31 D;  3UTA C;  1F66 C;  4Z66 D;  1H3O A;  3AV1 A;  3B6G B;  3LJA B;  3MGP C;  4G92 C;  4YM6 B;  3AFA A;  3AZM B;  1P3G B;  3AV2 D;  4X23 B;  1WWS A;  2NQB D;  4YS3 C;  3W97 A;  4X23 D;  3KWQ C;  5B2J A;  5B24 C;  2NZD B;  3MGS B;  5JA4 B;  1P3I B;  1BH8 A;  4WU9 D;  1ID3 A;  5BO0 B;  2NZD D;  1P3I D;  5GT0 D;  4KGC A;  5DNM C;  3X1U B;  3REL D;  3AZG A;  4E44 A;  2LY8 A;  5AY8 A;  5B32 B;  3X1U D;  5F99 A;  3C1B D;  4J8V D;  5B33 B;  1P3M B;  1TZY C;  4WU8 A;  5E5A D;  1KX4 D;  1JFI B;  5GSU A;  5AVC A;  3B6F B;  1B67 A;  5AV5 B;  1ZLA B;  2YFV B;  3X1V C;  5CPI A;  3W96 A;  5B40 C;  1M1A B;  3REH C;  3AZL A;  3A6N D;  3X1T C;  5B32 G;  3WTP B;  3AZF C;  3V9R B;  2CV5 A;  3AN2 B;  1BH9 B;  4H9P B;  2FJ7 D;  3AZN C;  3AN2 D;  5AVB A;  4KUD B;  3WAA D;  5B0Y A;  1TAF A;  4KUD D;  4KHA B;  4UUZ B;  5B0Z B;  5B0Z D;  3B0D B;  3NQU A;  3MGR C;  3TU4 B;  3O62 A;  5CPJ A;  3MNN D;  1KX3 B;  3W99 D;  1HQ3 C;  2HIO D;  4XUJ A;  4H9S C;  5GXQ C;  3LZ0 B;  3MVD B;  5AV8 B;  3B0B A;  5B1M B;  1P3O B;  5JRG B;  1M18 B;  3MGQ A;  2IO5 B;  3B6G C;  3LJA C;  4CSR A;  3AZH B;  4Z5T A;  3UTA B;  1F66 B;  2F8N D;  1P3G C;  5B2I A;  3UTA D;  1F66 D;  4NFT A;  3AFA C;  1AOI D;  5BNV B;  3MGP D;  3MGS C;  1P3B B;  3W98 C;  5B2J C;  3WKJ B;  4XZQ A;  3KWQ B;  4J8W A;  5CHL B;  3KUY A;  5B24 B;  4YS3 D;  3VH5 A;  1P3P A;  2JSS A;  2F8N G;  5B24 D;  1S32 A;  4KGC C;  3LZ1 A;  3X1S A;  5AY8 C;  3C1C D;  5DNM D;  3B0C T;  5G49 A;  1M19 A;  3B0C W;  4WU8 C;  1P3K A;  1TZY B;  5AV5 C;  1ZLA C;  1M1A C;  1TZY D;  1P3L D;  2BYM A;  3WTP C;  5CPI C;  3R45 A;  3KXB A;  3X1V B;  3AZL C;  3REH B;  5AV6 A;  4Z2M H;  3X1V D;  3X1T B;  5B40 D;  3AZE A;  3AZJ A;  5CP6 C;  3AZF B;  5CPK A;  5AVB C;  3AZF D;  4J8X D;  3AZN B;  3AYW B;  4ZUX B;  3TU4 C;  2L5A A;  5BNX B;  1N1J A;  4HGA C;  3O62 C;  5GT3 D;  2F8N K;  3MVD C;  3MGR D;  4H9O A;  5AV8 C;  5B1M C;  4XUJ C;  1ULY A;  5AV9 C;  1P3O C;  1P34 A;  3WA9 B;  1HQ3 B;  1M18 C;  5GXQ B;  2IO5 C;  1HQ3 D;  3AZH C;  4LD9 A;  2ARO B;  3MGQ C;  2YFW B;  4QLC A;  4Z5T C;  3VH6 T;  4H9R A;  5BS7 A;  5DNN A;  3VH6 W;  1H3O B;  5B2I C;  3LJA D;  3B6G D;  1P3A A;  4H9Q A;  4H9N B;  4YM6 D;  3AV1 B;  3AZM D;  1P3B C;  1P3F A;  1KX5 A;  3UTB A;  1P3G D;  3AFA B;  3WKJ C;  3REJ A;  2BYK A;  3AFA D;  1U35 A;  3W98 B;  3REI A;  5B31 A;  5B2J B;  4Z66 A;  3MGS D;  3W98 D;  3KUY C;  5B2J D;  1BH8 B;  4G91 C;  1S32 C;  4KGC B;  3AV2 A;  4KGC D;  5B32 D;  2NQB A;  5AY8 B;  4NE3 A;  5B33 D;  1P3M D;  1M19 C;  4WU9 A;  1P3K C;  4E45 A;  2NZD A;  4WU8 B;  5GT0 A;  5KDM A;  4WU8 D;  3REL A;  5GSU B;  3B6F D;  5AVC B;  5AV5 D;  1ZLA D;  1M1A D;  3C1B A;  4J8V A;  5CPI B;  3W96 B;  3AZI A;  4WZS B;  3AZL B;  3WTP D;  5E5A A;  1KX4 A;  3AZL D;  3AYW C;  2CV5 B;  1JFI A;  4EO5 B;  5CP6 B;  4ZUX C;  5CPK C;  4NE5 A;  5AVB B;  5CP6 D;  5B0Y B;  1TAF B;  5AVB D;  3A6N A;  5B1L A;  3TU4 D;  2FJ7 A;  4HGA B;  3NQU B;  3V9R A;  4AWL B;  3O62 B;  5CPJ B;  3WA9 C;  3WAA A;  3O62 D;  1KX3 D;  4JJN A;  3MVD D;  3LZ0 D;  4UUZ A;  5AV9 B;  4XUJ B;  5AV8 D;  2ARO C;  1WWI A;  2RVQ C;  5B1M D;  4XUJ D;  5BT1 C;  5AV9 D;  1P3O D;  5JRG D;  1M18 D;  3MGQ B;  3AV1 C;  3AZH D;  3MNN A;  4CSR B;  3MGQ D;  4Z5T B;  5DNN C;  3W99 A;  2HIO A;  2PYO A;  5B2I B;  3UTB C;  3W97 C;  1P3B D;  1ID3 C;  3WKJ D;  5B31 C;  3KWQ D;  3UT9 A;  4XZQ B;  2F8N A;  4J8W B;  3KUY B;  3REK A;  4ZBJ C;  3AZG C;  3UTA A;  1P3P B;  1AOI A;  4G91 B;  3VH6 A;  3KUY D;  1S32 B;  5F99 C;  3MGP A;  4J8U A;  4YS3 A;  4WU9 C;  5G49 B;  5GSU C;  1M19 B;  5B24 A;  5AVC C;  1P3K B;  3W96 C;  3NQJ A;  3C1C A;  2F8N H;  5DNM A;  3C1B C;  2BYM B;  3AZI C;  3KXB B;  3REH D;  2CV5 C;  4WNN A;  4EO5 C;  3X1T D;  5B0Y C;  3AZE B;  1TZY A;  1P3L A;  3AZN D;  5CPK B;  3AYW D;  4ZUX D;  4CAY A;  1EQZ A;  3A6N C;  4AWL C;  5CPJ C;  5B40 A;  5B1L C;  1N1J B;  3LEL A;  1B6W A;  4DRA A;  3AZF A;  3WAA C;  4J8X A;  4NE6 A;  4H9O B;  4JJN C;  5FUG A;  3WA9 D;  5GXQ D;  1P34 B;  4R8P A;  5GT3 A;  2ARO D;  3AZK A;  4LD9 B;  2RVQ D;  5BT1 D;  3MGR A;  4QLC B;  3W99 C;  2PYO C;  3AV1 D;  5DNN B;  1P3A B;  1KX5 B;  1P3F B;  1HQ3 A;  4H9S A;  3UTB B;  3W97 B;  4XZQ C;  3REJ B;  2BYK B;  5C3I B;  4J8W C;  3W97 D;  1P3P C;  1U35 B;  3UT9 C;  3REI B;  5B31 B;  1ID3 B;  4Z66 B;  3B6G A;  3LJA A;  3REK C;  1ID3 D;  3VH5 W;  4YM6 A;  3LZ1 C;  3AZM A;  4ZBJ B;  1AOI C;  3AZG B;  1P3G A;  3X1S C;  4H9N A;  4X23 A;  3AZG D;  3AV2 B;  5F99 B;  4J8U C;  5AY8 D;  2NQB B;  5F99 D;  3MGS A;  5JA4 A;  1P3I A;  3W98 A;  5BO0 A;  4WU9 B;  5B31 G;  2CWE A;  3X1U A;  5GT0 B;  5GSU D;  5KDM B;  3KXB C;  3REL B;  5AVC D;  5B32 A;  3C1C C;  5AV6 C;  5CPI D;  3W96 D;  5B33 A;  3C1B B;  3AZE C;  1P3M A;  4J8V B;  3AZJ C;  3AZI B;  2HUE C;  5E5A B;  1KX4 B;  3AZI D;  2CV5 D;  1Q9C A;  1P3L C;  5B0Y D;  3B6F A;  5AV5 A;  1ZLA A;  2YFV A;  1M1A A;  1HTA A;  1EQZ C;  3WTP A;  1F1E A;  3A6N B;  3AN2 A;  1BH9 A;  4H9P A;  5B1L B;  3LEL C;  2FJ7 B;  4KUD A;  5CPJ D;  5B1L D;  4J8X C;  5CP6 A;  3WAA B;  4KHA A;  1P34 C;  5B0Z A;  1BFM A;  4JJN B;  4LD9 C;  4JJN D;  1KU5 A;  4R8P C;  4QLC C;  3TU4 A;  5GT3 C;  3AZK C;  5BS7 C;  1P3A C;  1KX5 C;  1KX3 A;  4Z5T D;  3MNN B;  1P3F C;  3MVD A;  3LZ0 A;  5B2I D;  3W99 B;  2HIO B;  5AV8 A;  3REJ C;  5C3I C;  2PYO B;  5B1M A;  5AV9 A;  1U35 C;  1P3O A;  5JRG A;  2PYO D;  3REI C;  1M18 A;  4Z66 C;  3AZH A;  4XZQ D;  1F66 A;  4J8W D;  3UT9 B;  2F8N B;  1P3P D;  3AV2 C;  4YM6 C;  3REK B;  3AZM C;  3UT9 D;  3LZ1 B;  1S32 D;  1AOI B;  2NQB C;  5BNV A;  4X23 C;  3REK D;  3X1S B;  1P3B A;  3LZ1 D;  3MGP B;  4G92 B;  3X1S D;  3WTP E;  4J8U B;  3WKJ A;  3KWQ A;  2NZD C;  4DRB A;  1P3I C;  5GT0 C;  4J8U D;  1M19 D;  4YS3 B;  3REL C;  1P3K D;  3X1U C;  4Z2M G;  4J8V C;  5B32 C;  3R45 B;  3NQJ B;  5E5A C;  3C1C B;  1KX4 C;  5AV6 B;  5DNM B;  3KXB D;  5B33 C;  1P3M C;  5AV6 D;  4WNN B;  3AZJ B;  2HUE B;  3AZE D;  3AZJ D;  5CPK D;  1P3L B;  3B6F C;  3KSY A;  3X1V A;  4CAY B;  3REH A;  1EQZ B;  2FJ7 C;  3X1T A;  3AN2 C;  1EQZ D;  5B40 B;  4KUD C;  1A7W A;  3LEL B;  3AZN A;  3AYW A;  4J8X B;  3LEL D;  5B0Z C;  4ZUX A;  5FUG B;  3B0D C;  1P34 D;  5BNX A;  4WV4 B;  1R4V A;  4R8P B;  3MNN C;  4LD9 D;  5GT3 B;  3AZK B;  4R8P D;  4H9R B;  2HIO C;  4QLC D;  3MGR B;  3AZK D;  4M6B A;  1KX3 C;  4H9Q B;  3WA9 A;  3LZ0 C;  5DNN D;  5GXQ A;  1P3A D;  1KX5 D;  1P3F D;  3UTB D; 
#chains in the Genus database with same CATH topology
 5JRG C;  2ARO A;  3REJ D;  2YFW A;  3VH5 T;  1U35 D;  3REI D;  5B31 D;  3UTA C;  1F66 C;  4Z66 D;  1H3O A;  3AV1 A;  3B6G B;  3LJA B;  3MGP C;  4G92 C;  4YM6 B;  3AFA A;  3AZM B;  1P3G B;  3AV2 D;  2BG1 A;  4X23 B;  1WWS A;  2NQB D;  4YS3 C;  3W97 A;  4X23 D;  3KWQ C;  5B2J A;  5B24 C;  2NZD B;  3MGS B;  5JA4 B;  1P3I B;  1BH8 A;  4WU9 D;  1ID3 A;  5BO0 B;  2NZD D;  1P3I D;  5GT0 D;  4KGC A;  5DNM C;  3X1U B;  3REL D;  3AZG A;  4E44 A;  2LY8 A;  5AY8 A;  5B32 B;  3X1U D;  5F99 A;  3C1B D;  4J8V D;  5B33 B;  1P3M B;  1TZY C;  4WU8 A;  5E5A D;  1KX4 D;  1JFI B;  5GSU A;  5AVC A;  3B6F B;  1B67 A;  5AV5 B;  1ZLA B;  2YFV B;  3X1V C;  5CPI A;  3W96 A;  5B40 C;  1M1A B;  3REH C;  3AZL A;  3A6N D;  3X1T C;  5B32 G;  3WTP B;  3AZF C;  3V9R B;  2CV5 A;  3AN2 B;  1BH9 B;  4H9P B;  2FJ7 D;  3AZN C;  3AN2 D;  5AVB A;  4KUD B;  3WAA D;  5B0Y A;  1TAF A;  4KUD D;  4KHA B;  4UUZ B;  5B0Z B;  5B0Z D;  3B0D B;  3KFU G;  3NQU A;  3MGR C;  3TU4 B;  3O62 A;  5CPJ A;  3MNN D;  1Z2C B;  2W8S A;  1KX3 B;  3W99 D;  1HQ3 C;  2HIO D;  4XUJ A;  4H9S C;  5GXQ C;  3LZ0 B;  3MVD B;  5AV8 B;  3B0B A;  5B1M B;  1P3O B;  5JRG B;  1M18 B;  3MGQ A;  2IO5 B;  3B6G C;  3LJA C;  4CSR A;  3AZH B;  4Z5T A;  3UTA B;  1F66 B;  2F8N D;  1P3G C;  5B2I A;  3UTA D;  1F66 D;  4NFT A;  3AFA C;  1AOI D;  5BNV B;  3MGP D;  3MGS C;  1P3B B;  3W98 C;  2F2A C;  5B2J C;  3WKJ B;  4XZQ A;  3KWQ B;  4J8W A;  5CHL B;  3KUY A;  5B24 B;  4YS3 D;  3VH5 A;  1P3P A;  2JSS A;  2F8N G;  5B24 D;  2VQR A;  1S32 A;  4KGC C;  3LZ1 A;  3X1S A;  5AY8 C;  3C1C D;  5DNM D;  2Y2J A;  3B0C T;  5G49 A;  1M19 A;  3B0C W;  4WU8 C;  1P3K A;  1TZY B;  5AV5 C;  1ZLA C;  1M1A C;  1TZY D;  1P3L D;  2UWX A;  2Y2N A;  2BYM A;  3WTP C;  5CPI C;  3R45 A;  3KXB A;  3X1V B;  3AZL C;  3REH B;  5AV6 A;  4Z2M H;  3X1V D;  3X1T B;  5B40 D;  3AZE A;  3AZJ A;  5CP6 C;  3AZF B;  5CPK A;  5AVB C;  3AZF D;  4J8X D;  3AZN B;  3AYW B;  2J8P A;  4ZUX B;  3TU4 C;  2L5A A;  5BNX B;  1N1J A;  4HGA C;  3O62 C;  5GT3 D;  2F8N K;  3MVD C;  3MGR D;  4H9O A;  5AV8 C;  3EG5 B;  5B1M C;  4XUJ C;  1ULY A;  5AV9 C;  1P3O C;  1P34 A;  3WA9 B;  1HQ3 B;  1M18 C;  5GXQ B;  2IO5 C;  1HQ3 D;  2XD5 A;  3AZH C;  4LD9 A;  2ARO B;  3MGQ C;  2YFW B;  4QLC A;  4Z5T C;  3VH6 T;  4H9R A;  5BS7 A;  2DF4 C;  5DNN A;  3VH6 W;  1H3O B;  5B2I C;  3LJA D;  3B6G D;  1P3A A;  4H9Q A;  4H9N B;  4YM6 D;  3AV1 B;  3AZM D;  1P3B C;  1P3F A;  1KX5 A;  2Y2M A;  3UTB A;  1PZR A;  1P3G D;  3AFA B;  3WKJ C;  3REJ A;  2BYK A;  3AFA D;  1U35 A;  3W98 B;  3REI A;  5B31 A;  5B2J B;  4Z66 A;  3MGS D;  3W98 D;  3KUY C;  3F6T A;  5B2J D;  1BH8 B;  4G91 C;  1S32 C;  4KGC B;  3AV2 A;  3EPH A;  4KGC D;  5B32 D;  2NQB A;  5AY8 B;  2Y2I A;  4NE3 A;  5B33 D;  1P3M D;  1M19 C;  4WU9 A;  1P3K C;  4E45 A;  2NZD A;  4WU8 B;  5GT0 A;  5KDM A;  4WU8 D;  3REL A;  5GSU B;  3B6F D;  2Y2L A;  5AVC B;  5AV5 D;  1M1A D;  1ZLA D;  3C1B A;  4J8V A;  5CPI B;  3W96 B;  3AZI A;  4WZS B;  3AZL B;  3WTP D;  5E5A A;  1KX4 A;  2JCH A;  3AZL D;  3AYW C;  1W2E A;  2CV5 B;  1JFI A;  4EO5 B;  5CP6 B;  4ZUX C;  5CPK C;  4NE5 A;  5AVB B;  5CP6 D;  5B0Y B;  1TAF B;  5AVB D;  3A6N A;  5B1L A;  3TU4 D;  2FJ7 A;  4HGA B;  3NQU B;  3V9R A;  4AWL B;  3O62 B;  3H0L C;  5CPJ B;  3WA9 C;  3WAA A;  3O62 D;  2ZM5 A;  1KX3 D;  4JJN A;  3MVD D;  3LZ0 D;  4UUZ A;  4XUJ B;  5AV9 B;  5AV8 D;  2ARO C;  1WWI A;  2RVQ C;  5B1M D;  4XUJ D;  5BT1 C;  5AV9 D;  1P3O D;  5JRG D;  1M18 D;  3MGQ B;  3AV1 C;  3AZH D;  3MNN A;  4CSR B;  3MGQ D;  4Z5T B;  5DNN C;  3W99 A;  2HIO A;  2ZY4 A;  2PYO A;  2ZY5 A;  5B2I B;  3UTB C;  3W97 C;  4UPK A;  1P3B D;  1ID3 C;  3WKJ D;  5B31 C;  3KWQ D;  3UT9 A;  4XZQ B;  2F8N A;  4J8W B;  3KUY B;  3REK A;  4ZBJ C;  3AZG C;  1T3U A;  3UTA A;  1P3P B;  1AOI A;  4G91 B;  3VH6 A;  3KUY D;  1S32 B;  2DQN C;  5F99 C;  3MGP A;  4J8U A;  4YS3 A;  4WU9 C;  5G49 B;  5GSU C;  1M19 B;  5B24 A;  5AVC C;  1P3K B;  3W96 C;  3NQJ A;  3C1C A;  2F8N H;  5DNM A;  3C1B C;  2BYM B;  3AZI C;  3KXB B;  3REH D;  2CV5 C;  4WNN A;  4EO5 C;  3X1T D;  5B0Y C;  3AZE B;  1TZY A;  1P3L A;  3AZN D;  5CPK B;  3AYW D;  4ZUX D;  4CAY A;  1EQZ A;  3A6N C;  4AWL C;  5CPJ C;  2RIQ A;  5B40 A;  5B1L C;  1N1J B;  3LEL A;  1B6W A;  4DRA A;  3AZF A;  3WAA C;  4J8X A;  4NE6 A;  4H9O B;  4JJN C;  5FUG A;  3WA9 D;  5GXQ D;  1P34 B;  3EPK A;  4R8P A;  5GT3 A;  2ARO D;  3AZK A;  4LD9 B;  2RVQ D;  5BT1 D;  3MGR A;  4QLC B;  3W99 C;  2PYO C;  3AV1 D;  5DNN B;  1P3A B;  1KX5 B;  1P3F B;  1HQ3 A;  4H9S A;  3UTB B;  3W97 B;  4XZQ C;  3REJ B;  2BYK B;  5C3I B;  4J8W C;  3W97 D;  1P3P C;  1U35 B;  3UT9 C;  3REI B;  5B31 B;  1ID3 B;  4Z66 B;  2Y2Q A;  3B6G A;  3LJA A;  3REK C;  1ID3 D;  3VH5 W;  4YM6 A;  3LZ1 C;  3AZM A;  4ZBJ B;  1AOI C;  3AZG B;  3A1K A;  1P3G A;  3X1S C;  4H9N A;  4X23 A;  3AZG D;  3AV2 B;  2ZY2 A;  5F99 B;  4J8U C;  5AY8 D;  2NQB B;  5F99 D;  3MGS A;  5JA4 A;  1P3I A;  3W98 A;  5BO0 A;  4WU9 B;  2XD1 A;  5B31 G;  2CWE A;  5GT0 B;  3X1U A;  3EPL A;  5GSU D;  5KDM B;  3KXB C;  2G5H C;  5AVC D;  5B32 A;  3REL B;  3C1C C;  5AV6 C;  5CPI D;  3W96 D;  5B33 A;  3C1B B;  3AZE C;  1P3M A;  4J8V B;  3AZJ C;  3AZI B;  2HUE C;  5E5A B;  1KX4 B;  3AZI D;  2CV5 D;  1Q9C A;  2Y2K A;  2ZY3 A;  1P3L C;  5B0Y D;  3B6F A;  5AV5 A;  1ZLA A;  2YFV A;  1M1A A;  3H0R C;  1HTA A;  1EQZ C;  3WTP A;  1F1E A;  3A6N B;  3AN2 A;  1BH9 A;  4H9P A;  5B1L B;  3LEL C;  2JE5 A;  2FJ7 B;  4KUD A;  5CPJ D;  5B1L D;  4J8X C;  5CP6 A;  3WAA B;  4KHA A;  1P34 C;  3H0M C;  5B0Z A;  1BFM A;  4JJN B;  4LD9 C;  4JJN D;  1KU5 A;  4R8P C;  2Y2O A;  4QLC C;  3TU4 A;  5GT3 C;  3AZK C;  4DQY B;  5BS7 C;  1P3A C;  1KX5 C;  1KX3 A;  4Z5T D;  3MNN B;  1P3F C;  3MVD A;  3LZ0 A;  5B2I D;  3W99 B;  2HIO B;  5AV8 A;  3REJ C;  5C3I C;  3P5J B;  2PYO B;  5B1M A;  5AV9 A;  1U35 C;  1P3O A;  5JRG A;  2PYO D;  3REI C;  1M18 A;  4Z66 C;  3AZH A;  3AL0 C;  4XZQ D;  1F66 A;  4J8W D;  3UT9 B;  2F8N B;  1P3P D;  3AV2 C;  4YM6 C;  3EPJ A;  3REK B;  3AZM C;  3UT9 D;  3LZ1 B;  1S32 D;  1AOI B;  2NQB C;  5BNV A;  4X23 C;  3REK D;  3X1S B;  1P3B A;  3LZ1 D;  3MGP B;  4G92 B;  3X1S D;  3WTP E;  4J8U B;  3WKJ A;  3KWQ A;  2NZD C;  4DRB A;  1P3I C;  5GT0 C;  4J8U D;  1M19 D;  4YS3 B;  4WJ3 C;  3REL C;  1P3K D;  3X1U C;  4Z2M G;  4J8V C;  5B32 C;  2FFF B;  3R45 B;  3NQJ B;  5E5A C;  3C1C B;  1KX4 C;  5AV6 B;  5DNM B;  3KXB D;  5B33 C;  1P3M C;  2G5I C;  5AV6 D;  4WNN B;  3AZJ B;  2HUE B;  3AZE D;  3AZJ D;  5CPK D;  1P3L B;  3B6F C;  3KSY A;  2Y2G A;  3X1V A;  4CAY B;  3REH A;  2Y2P A;  1EQZ B;  2FJ7 C;  3X1T A;  3AN2 C;  1EQZ D;  5B40 B;  4KUD C;  1A7W A;  3LEL B;  3IP4 C;  3AZN A;  3AYW A;  4J8X B;  3LEL D;  5B0Z C;  4ZUX A;  2Y2H A;  5FUG B;  3B0D C;  1P34 D;  5BNX A;  4WV4 B;  1R4V A;  4R8P B;  3MNN C;  3FDD A;  4LD9 D;  5GT3 B;  3AZK B;  4R8P D;  4H9R B;  2HIO C;  4QLC D;  3MGR B;  3AZK D;  4M6B A;  1KX3 C;  4H9Q B;  3WA9 A;  3LZ0 C;  5DNN D;  5GXQ A;  3A1I A;  1P3A D;  1KX5 D;  1P3F D;  3UTB D; 
#chains in the Genus database with same CATH homology
 5JRG C;  2ARO A;  3REJ D;  2YFW A;  3VH5 T;  1U35 D;  3REI D;  5B31 D;  3UTA C;  1F66 C;  4Z66 D;  1H3O A;  3AV1 A;  3B6G B;  3LJA B;  3MGP C;  4G92 C;  4YM6 B;  3AFA A;  3AZM B;  1P3G B;  3AV2 D;  2BG1 A;  4X23 B;  1WWS A;  2NQB D;  4YS3 C;  3W97 A;  4X23 D;  3KWQ C;  5B2J A;  5B24 C;  2NZD B;  3MGS B;  5JA4 B;  1P3I B;  1BH8 A;  4WU9 D;  1ID3 A;  5BO0 B;  2NZD D;  1P3I D;  5GT0 D;  4KGC A;  5DNM C;  3X1U B;  3REL D;  3AZG A;  4E44 A;  2LY8 A;  5AY8 A;  5B32 B;  3X1U D;  5F99 A;  3C1B D;  4J8V D;  5B33 B;  1P3M B;  1TZY C;  4WU8 A;  5E5A D;  1KX4 D;  1JFI B;  5GSU A;  5AVC A;  3B6F B;  1B67 A;  5AV5 B;  1ZLA B;  2YFV B;  3X1V C;  5CPI A;  3W96 A;  5B40 C;  1M1A B;  3REH C;  3AZL A;  3A6N D;  3X1T C;  5B32 G;  3WTP B;  3AZF C;  3V9R B;  2CV5 A;  3AN2 B;  1BH9 B;  4H9P B;  2FJ7 D;  3AZN C;  3AN2 D;  5AVB A;  4KUD B;  3WAA D;  5B0Y A;  1TAF A;  4KUD D;  4KHA B;  4UUZ B;  5B0Z B;  5B0Z D;  3B0D B;  3KFU G;  3NQU A;  3MGR C;  3TU4 B;  3O62 A;  5CPJ A;  3MNN D;  1Z2C B;  2W8S A;  1KX3 B;  3W99 D;  1HQ3 C;  2HIO D;  4XUJ A;  4H9S C;  5GXQ C;  3LZ0 B;  3MVD B;  5AV8 B;  3B0B A;  5B1M B;  1P3O B;  5JRG B;  1M18 B;  3MGQ A;  2IO5 B;  3B6G C;  3LJA C;  4CSR A;  3AZH B;  4Z5T A;  3UTA B;  1F66 B;  2F8N D;  1P3G C;  5B2I A;  3UTA D;  1F66 D;  4NFT A;  3AFA C;  1AOI D;  5BNV B;  3MGP D;  3MGS C;  1P3B B;  3W98 C;  2F2A C;  5B2J C;  3WKJ B;  4XZQ A;  3KWQ B;  4J8W A;  5CHL B;  3KUY A;  5B24 B;  4YS3 D;  3VH5 A;  1P3P A;  2JSS A;  2F8N G;  5B24 D;  2VQR A;  1S32 A;  4KGC C;  3LZ1 A;  3X1S A;  5AY8 C;  3C1C D;  5DNM D;  2Y2J A;  3B0C T;  5G49 A;  1M19 A;  3B0C W;  4WU8 C;  1P3K A;  1TZY B;  5AV5 C;  1ZLA C;  1M1A C;  1TZY D;  1P3L D;  2UWX A;  2Y2N A;  2BYM A;  3WTP C;  5CPI C;  3R45 A;  3KXB A;  3X1V B;  3AZL C;  3REH B;  5AV6 A;  4Z2M H;  3X1V D;  3X1T B;  5B40 D;  3AZE A;  3AZJ A;  5CP6 C;  3AZF B;  5CPK A;  5AVB C;  3AZF D;  4J8X D;  3AZN B;  3AYW B;  2J8P A;  4ZUX B;  3TU4 C;  2L5A A;  5BNX B;  1N1J A;  4HGA C;  3O62 C;  5GT3 D;  2F8N K;  3MVD C;  3MGR D;  4H9O A;  5AV8 C;  3EG5 B;  5B1M C;  4XUJ C;  1ULY A;  5AV9 C;  1P3O C;  1P34 A;  3WA9 B;  1HQ3 B;  1M18 C;  5GXQ B;  2IO5 C;  1HQ3 D;  2XD5 A;  3AZH C;  4LD9 A;  2ARO B;  3MGQ C;  2YFW B;  4QLC A;  4Z5T C;  3VH6 T;  4H9R A;  5BS7 A;  2DF4 C;  5DNN A;  3VH6 W;  1H3O B;  5B2I C;  3LJA D;  3B6G D;  1P3A A;  4H9Q A;  4H9N B;  4YM6 D;  3AV1 B;  3AZM D;  1P3B C;  1P3F A;  1KX5 A;  2Y2M A;  3UTB A;  1PZR A;  1P3G D;  3AFA B;  3WKJ C;  3REJ A;  2BYK A;  3AFA D;  1U35 A;  3W98 B;  3REI A;  5B31 A;  5B2J B;  4Z66 A;  3MGS D;  3W98 D;  3KUY C;  3F6T A;  5B2J D;  1BH8 B;  4G91 C;  1S32 C;  4KGC B;  3AV2 A;  3EPH A;  4KGC D;  5B32 D;  2NQB A;  5AY8 B;  2Y2I A;  4NE3 A;  5B33 D;  1P3M D;  1M19 C;  4WU9 A;  1P3K C;  4E45 A;  2NZD A;  4WU8 B;  5GT0 A;  5KDM A;  4WU8 D;  3REL A;  5GSU B;  3B6F D;  2Y2L A;  5AVC B;  5AV5 D;  1M1A D;  1ZLA D;  3C1B A;  4J8V A;  5CPI B;  3W96 B;  3AZI A;  4WZS B;  3AZL B;  3WTP D;  5E5A A;  1KX4 A;  2JCH A;  3AZL D;  3AYW C;  1W2E A;  2CV5 B;  1JFI A;  4EO5 B;  5CP6 B;  4ZUX C;  5CPK C;  4NE5 A;  5AVB B;  5CP6 D;  5B0Y B;  1TAF B;  5AVB D;  3A6N A;  5B1L A;  3TU4 D;  2FJ7 A;  4HGA B;  3NQU B;  3V9R A;  4AWL B;  3O62 B;  3H0L C;  5CPJ B;  3WA9 C;  3WAA A;  3O62 D;  2ZM5 A;  1KX3 D;  4JJN A;  3MVD D;  3LZ0 D;  4UUZ A;  4XUJ B;  5AV9 B;  5AV8 D;  2ARO C;  1WWI A;  2RVQ C;  5B1M D;  4XUJ D;  5BT1 C;  5AV9 D;  1P3O D;  5JRG D;  1M18 D;  3MGQ B;  3AV1 C;  3AZH D;  3MNN A;  4CSR B;  3MGQ D;  4Z5T B;  5DNN C;  3W99 A;  2HIO A;  2ZY4 A;  2PYO A;  2ZY5 A;  5B2I B;  3UTB C;  3W97 C;  4UPK A;  1P3B D;  1ID3 C;  3WKJ D;  5B31 C;  3KWQ D;  3UT9 A;  4XZQ B;  2F8N A;  4J8W B;  3KUY B;  3REK A;  4ZBJ C;  3AZG C;  1T3U A;  3UTA A;  1P3P B;  1AOI A;  4G91 B;  3VH6 A;  3KUY D;  1S32 B;  2DQN C;  5F99 C;  3MGP A;  4J8U A;  4YS3 A;  4WU9 C;  5G49 B;  5GSU C;  1M19 B;  5B24 A;  5AVC C;  1P3K B;  3W96 C;  3NQJ A;  3C1C A;  2F8N H;  5DNM A;  3C1B C;  2BYM B;  3AZI C;  3KXB B;  3REH D;  2CV5 C;  4WNN A;  4EO5 C;  3X1T D;  5B0Y C;  3AZE B;  1TZY A;  1P3L A;  3AZN D;  5CPK B;  3AYW D;  4ZUX D;  4CAY A;  1EQZ A;  3A6N C;  4AWL C;  5CPJ C;  2RIQ A;  5B40 A;  5B1L C;  1N1J B;  3LEL A;  1B6W A;  4DRA A;  3AZF A;  3WAA C;  4J8X A;  4NE6 A;  4H9O B;  4JJN C;  5FUG A;  3WA9 D;  5GXQ D;  1P34 B;  3EPK A;  4R8P A;  5GT3 A;  2ARO D;  3AZK A;  4LD9 B;  2RVQ D;  5BT1 D;  3MGR A;  4QLC B;  3W99 C;  2PYO C;  3AV1 D;  5DNN B;  1P3A B;  1KX5 B;  1P3F B;  1HQ3 A;  4H9S A;  3UTB B;  3W97 B;  4XZQ C;  3REJ B;  2BYK B;  5C3I B;  4J8W C;  3W97 D;  1P3P C;  1U35 B;  3UT9 C;  3REI B;  5B31 B;  1ID3 B;  4Z66 B;  2Y2Q A;  3B6G A;  3LJA A;  3REK C;  1ID3 D;  3VH5 W;  4YM6 A;  3LZ1 C;  3AZM A;  4ZBJ B;  1AOI C;  3AZG B;  3A1K A;  1P3G A;  3X1S C;  4H9N A;  4X23 A;  3AZG D;  3AV2 B;  2ZY2 A;  5F99 B;  4J8U C;  5AY8 D;  2NQB B;  5F99 D;  3MGS A;  5JA4 A;  1P3I A;  3W98 A;  5BO0 A;  4WU9 B;  2XD1 A;  5B31 G;  2CWE A;  5GT0 B;  3X1U A;  3EPL A;  5GSU D;  5KDM B;  3KXB C;  2G5H C;  5AVC D;  5B32 A;  3REL B;  3C1C C;  5AV6 C;  5CPI D;  3W96 D;  5B33 A;  3C1B B;  3AZE C;  1P3M A;  4J8V B;  3AZJ C;  3AZI B;  2HUE C;  5E5A B;  1KX4 B;  3AZI D;  2CV5 D;  1Q9C A;  2Y2K A;  2ZY3 A;  1P3L C;  5B0Y D;  3B6F A;  5AV5 A;  1ZLA A;  2YFV A;  1M1A A;  3H0R C;  1HTA A;  1EQZ C;  3WTP A;  1F1E A;  3A6N B;  3AN2 A;  1BH9 A;  4H9P A;  5B1L B;  3LEL C;  2JE5 A;  2FJ7 B;  4KUD A;  5CPJ D;  5B1L D;  4J8X C;  5CP6 A;  3WAA B;  4KHA A;  1P34 C;  3H0M C;  5B0Z A;  1BFM A;  4JJN B;  4LD9 C;  4JJN D;  1KU5 A;  4R8P C;  2Y2O A;  4QLC C;  3TU4 A;  5GT3 C;  3AZK C;  4DQY B;  5BS7 C;  1P3A C;  1KX5 C;  1KX3 A;  4Z5T D;  3MNN B;  1P3F C;  3MVD A;  3LZ0 A;  5B2I D;  3W99 B;  2HIO B;  5AV8 A;  3REJ C;  5C3I C;  3P5J B;  2PYO B;  5B1M A;  5AV9 A;  1U35 C;  1P3O A;  5JRG A;  2PYO D;  3REI C;  1M18 A;  4Z66 C;  3AZH A;  3AL0 C;  4XZQ D;  1F66 A;  4J8W D;  3UT9 B;  2F8N B;  1P3P D;  3AV2 C;  4YM6 C;  3EPJ A;  3REK B;  3AZM C;  3UT9 D;  3LZ1 B;  1S32 D;  1AOI B;  2NQB C;  5BNV A;  4X23 C;  3REK D;  3X1S B;  1P3B A;  3LZ1 D;  3MGP B;  4G92 B;  3X1S D;  3WTP E;  4J8U B;  3WKJ A;  3KWQ A;  2NZD C;  4DRB A;  1P3I C;  5GT0 C;  4J8U D;  1M19 D;  4YS3 B;  4WJ3 C;  3REL C;  1P3K D;  3X1U C;  4Z2M G;  4J8V C;  5B32 C;  2FFF B;  3R45 B;  3NQJ B;  5E5A C;  3C1C B;  1KX4 C;  5AV6 B;  5DNM B;  3KXB D;  5B33 C;  1P3M C;  2G5I C;  5AV6 D;  4WNN B;  3AZJ B;  2HUE B;  3AZE D;  3AZJ D;  5CPK D;  1P3L B;  3B6F C;  3KSY A;  2Y2G A;  3X1V A;  4CAY B;  3REH A;  2Y2P A;  1EQZ B;  2FJ7 C;  3X1T A;  3AN2 C;  1EQZ D;  5B40 B;  4KUD C;  1A7W A;  3LEL B;  3IP4 C;  3AZN A;  3AYW A;  4J8X B;  3LEL D;  5B0Z C;  4ZUX A;  2Y2H A;  5FUG B;  3B0D C;  1P34 D;  5BNX A;  4WV4 B;  1R4V A;  4R8P B;  3MNN C;  3FDD A;  4LD9 D;  5GT3 B;  3AZK B;  4R8P D;  4H9R B;  2HIO C;  4QLC D;  3MGR B;  3AZK D;  4M6B A;  1KX3 C;  4H9Q B;  3WA9 A;  3LZ0 C;  5DNN D;  5GXQ A;  3A1I A;  1P3A D;  1KX5 D;  1P3F D;  3UTB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...