1F6KA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords N-ACETYLNEURAMINATE LYASE
total genus 120
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f6kA00
2XN2A 4J9JA 2CZ5A 4JTGA 4MJMA 5I3JA 2YCEA 1YXDA 1TJPA 2ZFAA 1Q6OA 1PS9A 5KITA 1LORA 3CHVA 4H3DA 3MWAA 3KVMA 3NM3A 1B57A 1EUNA 1VQTA 4HPJA 5D2TA 3SZ8A 2DORA 4TX9A 5U4NA 2DZUA 4MY8A 4RV8A 1P4CA 3RF9A 1ADOA 3UZ5A 2A4AA 5FEXA 2QJIA 3D0CA 4LS1A 4JNMA 4BF9A 2RDTA 4RR4A 4PL2A 3EX3A 1AL8A 2X30A 4LU0A 1LYXA 1TQXA 3MUXA 4K36A 5K9DA 1KFLA 2V5BA 4N4PA 4HKPA 1TREA 1D3HA 4IMEA 4NJKA 3PR2A 4RCXA 4ZQOA 3TC6A 3UWYA 3W86A 3IV3A 3MI6A 4Z1DA 4I7UA 3EKLA 3SI9A 5D30A 2Y7GA 3N9SA 4K7YA 2E6FA 2A5HA 2QDHA 3JS3A 1G4PA 4GRSA 1XCFA 3QEZA 1X6UA 5F4XA 3N14A 3IEBA 5FI8A 3UY8A 5D2YA 3NNTA 2QCDB 3JR2A 4L4LA 4M6PA 4BWLC 1KLZA 3DGRA 2NUXA 3VE7A 2E5CA 3H53A 4WOQA 1OX5A 3QMTA 5BRBA 3OVRA 1DKWA 3BGJA 3TMLA 5D2XA 4NJGA 2V82A 5D03A 1G6CA 2NXGA 2EKCA 4Q32A 1V7YA 4GE8A 4AF0A 3R2GA 2JGYA 2VXNA 3NQ2A 4JTFA 4H4IA 2YW4A 1J4EA 1H61A 4JTHA 2PC4A 3M9YA 3DFSA 1VHCA 4FXRA 2ZA2A 3KVJA 1W31A 1TPWA 3CTLA 1W5QA 4ADTA 3PBYA 1FBAA 3DFTA 2B7NA 4YXGA 3TNOA 1LLZA 1MEIA 3GDKA 3RFAA 1BKSA 1G4SA 1WOAA 3V1PA 3E0IA 3EKZA 4CQAA 4AVFA 4AH7A 4WY0F 3N19B 2ZA1A 5HUPA 4WY0A 3LCGA 4Q33A 3GX9A 1D3GA 4Y8FA 1OHLA 3L66A 1LOLA 3I6RA 3WJXA 5CSRA 2HS8A 1VYPX 3CWOX 1YXYA 4CCDA 3U2OA 2A2IA 5DY3A 1GOXA 3LXAA 2OX1A 4O11A 1TO3A 3TW7A 1ZENA 1XFBA 3PVFA 3VFLA 4O1BA 1W5OA 2FLIA 5LKYA 3W23A 2ZDRA 3IGXA 1QDSA 3RLVA 5L9FA 2C18A 1LRTA 1K7EA 4EVZA 2JK2A 3NR0A 5D33A 3UWWA 1F5ZA 1EUAA 1PV8A 1W37A 1LP6A 1SO3A 3EWXA 1O95A 3C52A 2A21A 2WO5A 3C2VA 1WBHA 2O7QA 2JKPA 2DZTA 3STEA 2E6YA 3GKFA 1OF8A 5K3VA 1MZHA 5BOOA 4JN6A 2J6XA 4PODA 1MO0A 1I45A 1KW1A 4JTUA 3R5EA 3VCRA 5F2GA 3BV4A 1OYBA 1T99A 4Z1AA 2C0AA 4UTHA 4AAJA 2FPTA 4HNNA 3GDTA 5DBTA 4WXYA 3MYOA 3QSTA 5D2WA 1ZY9A 4YMZA 1O4UA 2FIQA 3PSWA 2Y85A 4HNTA 3YPIA 2WSRA 3B4UA 3W7JA 5G2WA 3SSJA 2CLKA 2QR6A 1H5YA 1T96A 5HWJA 1W5MA 1PHQA 2VOMA 2JGQA 1BTMA 1FDYA 1G4EA 2YR1A 1QPOA 1RQHA 4ORIA 4TMCA 4WY0B 1QOPA 1Z44A 4NJJA 4AHOA 1F2JA 5AYYA 4D2JA 2EGZA 2ZZ6A 5EBUA 3TKFA 1WAUA 3HGRA 3GDMA 1DHPA 3T7VA 3P82A 1H60A 1FWRA 4UFIA 5IM51 3WFAA 1Z42A 4UTIA 3P80A 2QCMA 1SQ7A 5F2MA 5EA9A 3UZJA 2CLFA 2CLLA 1Q45A 1SR9A 4LWWA 3C2OA 3F1QA 1FX6A 3M5XA 4OQVA 4Z0JA 1VPXA 1GZGA 4FF7A 2ZRYA 4KFOA 3LBCA 5HJLA 3W6YA 1B3OA 1LOSA 3TH6A 4BFAA 1IIHA 4S1FA 3QFEA 1W8SA 2Z6JA 2V0TA 1H7WA 2X1SA 3PF3A 1B4KA 4O16A 1K7FA 3UXAA 1IXOA 1L9WA 3W7GA 1PL9A 5AHLA 2ZZ7A 4P2VA 3WK3A 3H54A 1H63A 4Y9AA 1SU5A 3NO5A 4IOTA 4FNUA 1SW0A 2I1OA 1GG1A 1W0MA 2ZZ3A 1HG3A 2FB2A 4ONVA 1C9DA 3EXTA 4JTSA 5BW6A 1YADA 3ELFA 4LTSA 4YCPA 2Y62A 4WXZA 1IXNA 2EF9A 2WKJA 2P0OA 5KZMA 4I9AA 2BSLA 4FIRA 1SZGA 1SO5A 1GTHA 4JYDA 1VC4A 1OABA 3EXSA 1O5XA 2BXVA 1TRDA 1O94A 4Z08A 4RJEA 3G24A 4MLRA 4CQ9A 3I7RA 2DZWA 1E51A 3QW3A 4MZYA 3LOTA 1ZAIA 2CU0A 2DU2A 2DZPA 2QAPA 5A8GA 4DELA 4N6FA 2TPSA 3A22A 2Z0IA 4UFHA 3W3OA 1H1ZA 3PM6A 1XUUA 3OVPA 5CKSA 3RK8A 3HMJG 2C16A 1TQJA 4QITA 3NQCA 5TBOA 4FO4A 3LHVA 5AB3A 4O53A 5D32A 1WV2A 3M1ZA 2G5WA 1TJRA 1BWKA 2WNNA 4OHQA 2QDGA 3W1XA 2ZCGA 3HGOA 1EP2A 2Y70A 4DEFA 3LERA 3H55A 4TO8A 3PG9A 4X9SA 4O10A 1F6PA 4KFNA 3QW4B 1QPQA 3BO9A 3O8AA 3O6DA 1U83A 1OFOA 2C14A 1VCGA 3BK0A 4NUWA 5GVJA 3UYCA 1VJIA 2PRLA 2QCCA 3WJWA 2VFDA 3N9RA 2BX7A 4CNPA 1WXJA 1DJQA 1SSDA 2GQAA 1T8XA 3G8EA 1I2OA 4N02A 5BMWA 3L21A 3LHWA 5IBXA 5AN7A 3DENA 2B4GA 1RR2A 4O8RA 4L4MA 1LBMA 1QR7A 3BW2A 2X1TA 2A7PA 3CM4A 5DCDA 5D2VA 4UUIA 1H7PA 1S5VA 4GBUA 3TDFA 5I3FA 4FX6M 3FEMA 1FCUA 4JTJA 1HO1A 2NX1A 2VEKA 4N9EA 4Z1BA 3BG3A 3G1YA 1F74A 5LNUA 3BLEA 3C6CA 1PE1A 4GUJA 5A5WA 3GAYA 1KM5A 1KM2A 1AW2A 1QAPA 4K39A 3C4UA 3Q58A 2FB3A 3RMJA 1VCFA 3MP3A 1ICPA 4QSHA 3CPRA 1THFD 3B06A 1OK4A 4KWVA 2JKAA 2ISWA 2TRSA 2ZRUA 1KA9F 1OFBA 2A7NA 3GXPA 2OMAA 4R7JA 3B03A 4Y90A 1W3TA 1W54A 1JCNA 4M19A 1TPC1 3SECA 4MIMA 1L6YA 4MFEA 2GVLA 4GFSA 5AHEA 4RXFA 3LXCA 4O52A 3NL6A 6TIMA 2DP3A 3HPXA 3L65A 5J5DA 3S42A 1IXQA 1LDCA 1M7PA 3HB9A 2QCNA 4JD4A 4K7VA 4UTUA 1WA3A 1OYAA 1TMHA 1H62A 1LBLA 4A2RA 1T0OA 3KXQA 4CNOA 3M44A 3HQ1A 3DHFA 1TCDA 3MP4A 4ZZ9A 3W7EA 4NXKA 1B4EA 1FDJA 1TYGA 2QUVA 3CQ0A 1UB3A 3QQ1A 3CLMA 4AEOA 3NG3A 1V5XA 1VCVA 4NNAA 4UCGA 4OT7A 3OG3A 3W2LA 4H6KA 3LV5A 4FIQA 2FJKA 1G7UA 3C0JA 1TPVA 1AK5A 2ZQ0A 3DAQA 3P7YA 2NV2A 3ABRA 3GNNA 1TPUA 4O17A 4O15A 2OCZA 2J9ZA 4A2SA 4JR5A 3THAA 2YYUA 4X2RA 2R91A 3OIXA 3S1XA 3T4CA 4LY8A 4ML9A 4FNTA 4MUZA 4OBTA 1LCOA 1DJNA 5G5IA 1TTJA 2GQ9A 3MO7A 4RZ4A 3HOJA 1FWSA 4UTMA 2NZLA 1W5NA 1QPNA 3C2EA 2G95A 3QZEA 1K03A 2C15A 1Z41A 1VR6A 3R8RA 3BARA 2Y89A 3S1UA 3STGA 4GNJA 2ATSA 1LRQA 3TV8A 1LM1A 2AQWA 1KTCA 4XTIA 1QO2A 1TV5A 5DBUA 3W70A 4MY1A 3F4NA 2WV8A 3PB0A 2VEPA 1KTNA 3LHTA 3NQEA 4X3ZA 3DHDA 5BNKA 3T78A 1DL3A 4DBDA 2ABAA 1LRNA 2E68A 5HUOA 3TUUA 3MBFA 1QNVA 5FESA 1KFJA 1XI3A 2CLMA 2E5BA 5F2IA 1BWLA 2H3BA 4UC5A 1TPEA 3DH7A 4Z0SA 4KFPA 4K6AA 3LHYA 2EPHA 4AB4A 3P60A 3UXDA 3UQNA 3R89A 4NJIA 4B5NA 1Z48A 2XN1A 3W1RA 4KKXA 3S1WA 4FX7A 1I2QA 2DZVA 1OFAA 3NQ6A 3NYZA 1RQEA 3RU6A 5EYWA 4LRSA 1KFCA 1TV7A 3SJ3A 4IUOA 4IMCA 4LV9A 3TSBA 4QQ3A 5I3IA 4UXDA 3TQKA 1CX9A 1ALDA 2ZZ5A 5HR7A 4QNWA 1HFBA 1WBJA 2QJGA 4NQ1A 2ABBA 2OZ0A 4CQ8A 1KM4A 3UWZA 1HTIA 3TR2A 2RDUA 3W7PA 2JKEA 3L5LA 3NPWA 1OYCA 5EPDA 2PCQA 3N34A 3STCA 2A85A 1CI1A 3MW7A 4A3UA 5L6UA 1J5TA 4NVTA 4DF2A 2ISVA 4HNUA 3W1AA 3KRUA 3L0KA 4QJ1A 1KV8A 3W1UA 4LS2A 1MEHA 3P74A 5F4SA 3NQAA 1A5AA 3P8JA 5KINA 3LLDA 4XBSA 2CLIA 4UIOA 4XKYB 4CNNA 3CC1A 3S5OA 3LCWA 4GXMA 3QRHA 1R2TA 4BK9A 2WNQA 3L9CA 3FKKA 3W7DA 3TQVA 5K9CA 4O0KA 3ZS4A 3W83A 4E2BA 3M47A 4ZQMA 3NPXA 5I3KA 2XFWA 3S5YA 4O13A 4WJEA 1G7VA 2X1UA 3G22A 2Z1BA 4UFKA 1J2WA 5CZSA 4A21A 1FDZA 3BGGA 2QCDA 2PRMA 2GOUA 4U4MA 1GVOA 4O1CA 1YLVA 4I7WA 4AMAA 3E9AA 5CG7A 1F73A 2W6RA 2E1DA 3KVKA 3PULA 3NQ7A 4NJHA 1P5BA 3LDVA 1SZNA 5LGZA 2QCHA 3U8GA 3EX2A 3MP5A 4N9DA 4CCEA 5K2ZA 1ZCOA 1IXPA 1S3HA 4BI5A 3O07A 1MSSA 2AGKA 1I2RA 3TFCA 4JX5A 3T55A 4FNPA 5DXXA 3SIZA 1IGSA 5D38A 2ZRVA 3CIWA 4NNCA 3CU2A 4LV4A 4EIVA 4M6VA 1XDLA 2D73A 4MYXA 4XQ6A 3L0GA 2X1RA 4DPPA 3NQDA 1OX6A 3IIPA 3LB0A 4W9TA 4XUGA 3IGUA 4QIUA 3CEPA 2GJNA 3SGUA 4AHPA 3EWWA 4QNEA 3G3MA 2Y63A 3WJZA 3S5NA 4BI7A 4O12A 3MHGA 3ZR4A 1UJPA 4ALDA 1RQBA 4UFLA 1FUYA 4YWIA 2NXHA 3SY5A 2KZHA 3G3DA 5FEWA 4HN4A 3B04A 1OX4B 2BTMA 1XDMA 3M7WA 3EEGA 4ORMA 1RPXA 3KOFA 1O5KA 4GWEA 4XKYA 3CB8A 2B7QA 3GB6A 1Q3NA 4IX0A 4LVFA 2QCLA 2GJLA 3EWUA 3M5YA 2GUUA 5LHEA 4O1DA 4HNVA 3W2UA 1XKYA 3P5YA 1I2PA 3TJLA 3WK0A 3G1VA 1SW3A 1DBTA 2WQPA 4PTNA 5CSSA 3B05A 5CPMA 5MHBA 1NVMA 3NPUA 1Y0EA 3G1HA 4UR7A 1QO5A 4UTWA 3RLUA 1KM3A 4NX5A 4UMAA 2YSWA 2Y7EA 4DO4A 3LLFA 2E09A 4UFJA 1JRBA 2Q3RA 1VHNA 4WOZA 4HHPA 3EX1A 4AXKA 1L2UA 3F03K 3G18A 1CW2A 2W0UA 2WJZA 2ZZ4A 1VH7A 4IMGA 1R30A 1HUVA 4LOCA 3OVQA 1X1ZA 3HG2A 1I4NA 1WQ5A 4JDBA 2ZRWA 5DN1A 3RNDA 5K9XA 1ZALA 4O57A 3STFA 3VI2A 3OEXA 1YYAA 3KX6A 4UTJA 1FCBA 3I65A 1QCWA 3KHJA 4MLJA 3W2JA 3BW4A 4ZL1A 1XBYA 2C3ZA 4RZ6A 3HG3A 1WDWA 2RH9A 3P84A 1JCLA 3NA8A 3PUDA 1I2NA 3QC3A 3GR7A 4DF0A 2CLHA 3FYOA 1Q6RA 1EP1A 1EWEA 3W73A 1FXPA 1RVGA 1SUXA 3NQFA 4JX6A 3FS2A 3W75A 4AF0B 1U5JA 3QSRA 1PIIA 3ABSA 4TIMA 2OJPA 5CPOA 1A53A 1GWJA 3TSDA 1UCWA 3R12A 4FEZA 4Y96A 3HGJA 2H3DA 4CCCA 4UMBA 3DZ1A 1OFEA 3SGZA 3QQ0A 3W84A 2H8XA 3W2NA 1K8ZA 5KMYA 3KRZA 1EP3A 4MZ1A 4WQ6A 1KM1A 2V2CA 3MMTA 5KZEA 1N7KA 2FFCA 4GUFA 3GLCA 4IGHA 2GPTA 3M6YA 3C61A 4LRTA 8TIMA 4GC4A 5D05A 1NF7A 2V30A 4RKAA 3M5ZA 2VFEA 1F7BA 3BVJA 3TXVA 1FWTA 3GK0A 4Y6GA 4FNQA 3GXTA 1RZMA 5F2LA 1GEQA 4AWTA 3B8DA 2VKZG 2CFFA 4R34A 2NWSA 3L68A 1ME9A 3GXNA 3W71A 1PCKA 3EWZA 3LI0A 3QJAA 2Q3OA 3E12A 3USBA 3G1SA 3HGSA 4ZQNA 3DFNA 5HULA 5K4XA 1R2SA 3W2KA 2HMCA 1ZAJA 3E02A 2YZRA 5LHFA 4NZJA 3B0VC 5CZ0A 4JGDA 5FEPA 2VEMA 3I68A 3G1XA 5FEZA 1RD5A 5HQEA 3G1FA 1H50A 4M6QA 4POCA 3N73A 3LGEA 3W07A 1OJXA 4OGZA 4R33A 1VLIA 4IPJA 3TAKA 1R2RA 4OWGA 2VC6A 2ZTKA 4XWUA 1R46A 2TSYA 4WD0A 3B0PA 4N6EA 5AHFA 1A5BA 5J5RA 5F1VA 3S9YA 2B7OA 1FXQA 5LGXA 3TC7A 2PURA 5KSWA 1M5WA 3PSVA 3PWAA 4N2YA 1EB3A 3INPA 1LLWA 3A23A 3OBKA 3GVGA 3ANYA 2EHHA 4OV4A 1KFEA 3O16A 2Q8LA 2Y7DA 5LNRA 3FIGA 2QCGA 1OFQA 4JIPA 4ZQCA 1VYSX 4U28A 2NX3A 1VZWA 4YCOA 3UY7A 4C1LA 1GVQA 4LUJA 1H7RA 3T44A 3FLUA 4RK8A 2ZRXA 5TQLA 5HR6A 2ZA3A 1VLWA 4DPQA 3G0XA 4GUGA 3W1LA 3ZFHA 3TIMA 3NDOA 5D09A 3ZWSA 1OF6A 5E0KA 1RV8A 2RHGA 1AG1O 4ADSA 3P81A 3HPZA 3HO8A 3NQVA 1SSGA 1MXSA 2QUUA 2ZBTA 3LCLA 3TW6A 5AC8A 4IJBA 5H91A 4QM1A 5G1YA 2NWRA 3BPWA 2E5DA 1LBFA 3L5AA 2YX0A 1M6JA 2HS6A 3TCEA 1NF0A 2NUWA 2J88A 2F7FA 2WOQA 3KRSA 5LNVA 4N9BA 4MJZA 3L67A 1UASA 2J9XA 1GPWA 5C6MA 3R13A 4DO5A 2YW3A 3TQ0A 3IRDA 4N9CA 4X22A 5KTLA 4AHQA 3O63A 5AC7A 2YFNA 4JTEA 1LTDA 3A5VA 3LCXA 1JQVA 3P8IA 1GYNA 2CLEA 4MFDA 2B0MA 3LX9A 4IWWA 1ME8A 4OE7A 4JDYA 4LNYA 4LT9A 2LLEA 3MHUA 4XZ9A 1AMKA 3LHZA 3LRLA 4FB7A 1SO6A 4Z1CA 4S2BA 5TIMA 5E1QA 4FNRA 1WOBA 1FWNA 3GZ3A 2VELA 1ICSA 2Z6IA 3MHFA 3JRKA 6ALDA 5KZDA 2ALDA 4LVDA 2QCFA 4UMCA 1N8FA 1K8XA 1C8VA 5LSMA 4MKNA 5BMXA 4FHAA 1TTIA 1QOQA 3DKJA 4PL1A 3VE9A 3I7QA 4IXXA 3LTSA 3OHIA 1JCYA 3OA3A 4M5PA 1S5TA 1W1ZA 4RXGA 4IXHA 2C1HA 1GVSA 4NNBA 1KM0A 2TMDA 3I7SA 4S2CA 2QEZA 4JTLA 2EAWA 1HL2A 3NPVA 4JXCA 4RLIA 5FF4A 3DU0A 4A22A 1DORA 5K4ZA 4NZFA 1QPRA 1WX0A 5DELA 3W2MA 4JYEA 3ABQA 3W1QA 3EB2A 3W7OA 1EX5A 4DO6A 1Q6LA 5EY5A 1P0NA 3N2MA 3W76A 3G0UA 2WSQA 1I8JA 5C55A 1JUKA 1JRCA 1KFKA 1SFLA 3S0CA 3HIJA 3NZ1A 1NFBA 3HBLA 2CZEA 2DJLA 3LRMA 4IPIA 3P61A 3PBUA 2J9YA 4LC6A 3LCHA 2ZZ1A 3NL3A 4Q4KA 3LCIA 4BWLA 1OFRA 3G1AA 3NZRA 2OT1A 3LRKA 4DQWA 4PA8A 3A24A 1LROA 1TV8A 5EMUA 2ZTJA 3TE9A 5D04C 2J27A 3O1NA 3QM3A 3TK7A 1PCWA 3AJXA 2GVGA 3CEUA 3C8FA 4JICA 1NAL1 2VFFA 5U7SA 2YYTA 4XTDA 2E6DA 1AW5A 3UPBA 3IIXA 1YTDA 4M7SA 3QPYA 2AAMA 4O28A 4ZQRA 4QISA 2E77A 1SO4A 4E38A 4LUIA 4I7VA 3GIYA 1L6SA 1P0KA 1FQ0A 2Z2UA 3S6DA 3W7RA 3BG9A 3WJYA 4A29A 2H6RA 3IGSA 1M7OA 3DKLA 3G0SA 5ABTA 2V81A 3BLFA 4LVBA 3LV6A 1EA0A 1BEUA 4K37A 3UWQA 5C54A 3FYPA 2G96A 4MY9A 4DBEA 3F4WA 1OX4A 2H8ZA 3PS7A 1EPXA 2VFHA 3DFQA 1EEPA 5F1UA 3PAJA 2NUYA 3VNDA 3O6CA 3Q37A 1GG0A 3QH2A 2QAFA 1GTEA 1W5PA 1ME7A 1H7XA 3M5VA 4ZMGA 3FA5A 1TRIA 3LI1A 4MZ8A 3FJLA 4O19A 1TPDA 2PE4A 4R53A 3BLIA 5AYXA 4PCFA 5D37A 3LXBA 3N2XA 2V2HA 4FNSA 3MJYA 3W7IA 3WK1A 3IIVA 1JQXA 4WUIA 1JJKA 5AHNA 4QAIA 2V2DA 4N4QA 2Q8ZA 3NQMA 2A1YA 3TA6A 1YXCA 1FY6A 4BR1A 3P5ZA 2J24A 3LHUA 5I3HA 2BZNA 2RDWA 4IX2A 3W1TA 1L6WA 1YDNA 3LTPA 1OFPA 4MVAA 4O1AA 1S5WA 1G67A 4M7TA 2E6AA 3W88A 2Y61A 3A9IA 1SZEA 5G4EA 1F6KA 3A21A 1OG0A 1IIGA 2YGYA 3ABOA 4JYFA 5T26A 1XBXA 1GT8A 1NSJA 4FX8A 1DOSA 3DI0A 4C1KA 3NL5A 3W9ZA 1XBZA 2DZXA 3L5MA 2FPYA 4EF9A 1A5CA 3W87A 4LC8A 4YL2A 4UFMA 3W1NA 2Y6ZA 1P1XA 2FTPA 3C2RA 1TPB1 1XL9A 3UNDA 4DXVA 2O7SA 1B9BA 1UUMA 1ZFJA 4XBKA 2X2GA 3W22A 4UTTA 2WNZA 1GYLA 1TPH1 2DJXA 1KFBA 2V8ZA 3IVSA 3W7LA 3S1VA 5DCEA 1KM6A 2C13A 3W74A 3NGJA 1JULA 3IVTA 3PY2A 3LBMA 4YLWA 1JUEA 1JCJA 4HSOA 4O54A 1SFJA 4JY9A 5SWUA 3NAVA 3GYEA 2ATMA 2P10A 3W72A 1ZAHA 1XC4A 2RFGA 4BI6A 3CT7A 1EIXA 3N3MA 1F76A 4KWWA 3W7MA 2QF7A 2GQ8A 3T40A 4G1KA 3FFSA 1JUBA 4MPQA 3C3NA 3M16A 2WSYA 3M41A 3VKJA 4WZHA 3CIXA 5CPNA 1X1OA 4O18A 3PUOA 5AHIA 4RX0A 5H2ZA 1KV5A 4JTKA 4JTTA 3KFTA 4DF1A 3UWVA 1ICQA 3TSMA 2G97A 3LCFA 3NOEA 3PG8A 3G8RA 1SW7A 1XBVA 3NL2A 1C29A 3C56A 1LOQA 3KVLA 2V9DA 3DFOA 3W1MA 5DLCA 1R47A 3TMQA 2YFOA 3K30A 1UBSA 3O06A 3NM1A 1G69A 4ZVJA 1TIMA 2CZFA 2R14A 1OK6A 3Q2DA 4RZ5A 4GUIA 1GQNA 1TB3A 5F4WA 3WK2A 2RKXA 3SR7A 2Y88A 5DCBA 3W1PA 1XM3A 4K38A 3TU9A 1QFEA 4K8EA 1IF2A 4NT0A 1TTPA 1A5SA 5DY2A 3NEVA 3U6WA 2YDAA 3PC0A 1UUOA 4EWND 3W7NA 1OVDA 2NLIA 3HF3A 3PBVA 3MBDA 1G4TA 1NEYA 2CZDA 2R8WA 2NXIA 2FPVA 4OU1A 1JCMP 4ADUA 2A6NA 4PH6A 3LM7A 1MEWA 1X7FA 3IVUA 1VS1A 1JVNA 3L2IA 2R94A 2FQIA 5CGQA 2C6QA 4EOUA 4IQLA 2V5LA 5AFDA 1OFDA 1PVNA 1PHWA 2BLEA 4EF8A 3W7HA 1FCQA 1KBIA 5CZTA 1Q6QA 3BG5A 1ZNNA 4UTTC 4ZQPA 5DXYA 3W7QA 4LS0A 4OV9A 7TIMA 5LZLA 1VGAA 2JBMA 1W56A 1KTBA 3UWUA 5EL1A 1O60A 3NXFA 1TPFA 4MOZA 4P61A 3DFPA 2ZRZA 3IIZA 2UV8G 3G1DA 4K8HA 3QF0A 5FF3A 3HJZA 4IMFA 3KAOA 5K7JA 3HG5A 1VRDA 4UNLA 2A6LA 2VFGA 3TROA 1WYIA 4CLMA 4NXSA 3HPSA 4UNKA 1XUZA 3V75A 4JEQA 5G2IA 1W3NA 1K8YA 5LNSA 1EWDA 1F05A 4AWUA 1GVFA 2QUTA 1DQXA 4GJ1A 1QMLA 3W85A 4PC8A 3QPZA 1ONRA 1YDVA 3O05A 2C19A 2HSAA 1XXXA 1JR1A 3CWNA 1A50A 2A7RA 1K02A 4O14A 1SPQA 3NQ8A 4TU1A 3LTYA 3SFKA 3M0ZA 3QYQA 2B7PA 2TYSA 3GR8A 4WX2A 5I3GA 1YTEA 4HIBA 2Y7FA 3ATYA 2NX9A 3C2FA 3EXRA 5CPLA 4JTIA 3FKRA 1HO4A 3TX9A 2VFIA 3GNDA 5FF2A 3M43A 1LZOA 1JCXA 4NU7A 2FDSA 1AW1A 3QMRA 1K3UA 5AOUA 1YPIA 4UTLA 1KBJA 4TR9A 2CLOA 1D9EA 3EWYA 3TXZA 3PUEA 4ICNA 2I14A 4NX0A 4LVGA 4O50A 5D02A 5LNWA 4JS3A 1QWGA 4GUHA 3DBPA 1H7OA 1TSIA 4JIQA 4MYAA 2CW6A 1DQWA 1DV7A 2NV1A 4FXSA 4O4VA 1YTKA 4IMDA 3P67A 3O6YX 4HPXA 2YXGA 5G1TA 1ZJIA 3WJSA 5CZJA 5AYZA 3E96A 2VENA 3UD6A 3EX6A 2H90A 3B0UX 2F84A 3QMSA 3TFXA 3P62A 4JX4A 5HNRA 1FWWA 3UPWA 2ISSA 3MI2A 5AC6A 3O15A 1N55A 1SZFA 2GVJA 4LW7A 5HMSA 1YPFA 3S8HA 2XN0A 2OT0A 2HTMA 4UR8A 2ZZ2A 3SW6A 3GDLA 3PB2A 1TTQA 1ZHAA 2VEIA 5G2HA 2A0NA 2ZYFA 2WPBA 3DI1A 3EWBX 3GKAA 4HSNA 3TJXA 1W3IA 2BWGA 3DXIA 4HT3A 3GDRA 3ZWTA 3ATZA 1H51A 2PRHA 3A5FA 4LVAA 2X16A 3AO0A 4PFMA 4TMBA 5IBXC 3L0NA 5HWNA 3FOKA 3W7CA 1AL7A 5C2XA 1ML1A 3PBWA 1X8FA 3Q94A 1GJPA 2CWNA 1FCVA 2W79A 4PEKA 1KLYA 1H1YA 5HWMA 5G4WA 5FF7A 3S5ZA 3HG4A 2DZSA 2QCEA 1H7NA 2IQTA 4UTKA 2P1FA 2I9EA 4UTWC 1GVRA 3EX4A 3IIOA 4O0ZA 3NQGA 3MI3A 3NVTA 4AWSA 3E49A 5HINA 1K7XA 3MYPA 3THQA 1DVJA 3FJ6A 5E93A 4E2DA 5C5YA 5FF0A 2YPIA 3W7KA 4O4WA 3BW3A 5EKYA 4JY8A 3GAKA 4E0CA 5AHMA 2QJHA 2QKFA 1VYRA 1YDOA 3TAOA
chains in the Genus database with same CATH superfamily
2XN2A 1TJPA 3V18A 3B8WA 5D9NA 1Q6OA 1FWIC 1PS9A 3KOZA 4HU3A 5FD0A 3OU8A 3CH9A 1OT1A 1VQTA 3SZ8A 4KMQA 1P4CA 1TWZA 3RF9A 4H9MA 3KUMA 2A4AA 3IARA 1MUWA 2QJIA 4LS1A 4JNMA 3ORWA 1JD9A 4P8WA 2IMRA 2X30A 4GGHA 2BBFA 2IKGA 3EMZA 1TV3A 4LU0A 3IJIA 3PJWA 1CB7B 4MWAA 4H2CA 1TQXA 3ZMRA 4G7EA 2HVMA 3MUXA 2V5BA 3HMCA 4HKPA 4HMCA 3MB9A 1D3HA 1XLEA 2WHJA 3UWYA 4B2DA 3IV3A 3PZOA 4Z1DA 1LG2A 3SI9A 2OWWA 4ACYA 3N9SA 3SCRA 3SCSA 1JXJA 1TMLA 2QDHA 1G4PA 3QEZA 3QZAA 4FZIA 5F4XA 2YDRA 1VFFA 5D2YA 3NNTA 4M6PA 1A49A 3IRSA 3H53A 3BE7A 2V3FA 3BGJA 3TMLA 2PA6A 4R5EA 5D03A 4DAFA 2NXGA 5HMDA 3QOMA 2D0FA 4JTFA 3T9PA 2YW4A 1J4EA 1BVZA 4JTHA 1ITCA 3ZM8A 4DY1A 3DFSA 2ZA2A 4QS5A 3RO8A 1UH4A 1W5QA 1TMQA 4GPNA 4JHZA 4Z1YA 3DFTA 5HPCA 4KCTA 4E5TA 3TN3A 1FP9A 3N12A 4D6HA 2E67A 3RFAA 2UY3A 1W1YA 4MDPA 3E0IA 1UQYA 3BGAA 4CQAA 3LCGA 1D3GA 1JI2A 3I6RA 3WJXA 3UXKA 3WF4A 3KTSA 2GGEA 4U2ZA 1R87A 4Q8QA 1IWAA 2PGRA 1XFBA 2ZUNA 1KGWA 4O1BA 1W5OA 1OEPA 1NWTA 2FLIA 3QXBA 5LKYA 3DUGA 3W23A 1E40A 4OIFA 1QDSA 2OQLA 4JQ1A 2C18A 3NR0A 1XLMA 4FXFA 3UWWA 2XVKA 3ZR6A 1XIDA 3EWXA 3B8VA 5TAOA 4LALA 2DZTA 3STEA 3CLWA 5BOOA 4JN6A 1R7OA 4PODA 1KW1A 1Q4NX 1Y5VA 3N11A 3R5EA 2PGFA 2PDFA 2I5QA 3BV4A 3URNA 1T99A 1G5AA 4Z1AA 1SJAA 4AAJA 3T1GA 3GDTA 3MYOA 3QSTA 1ZY9A 4YMZA 1TWSA 1YQ2A 1CLVA 4HNTA 3B4UA 1DEDA 3T09A 3SSJA 4ACZB 2QR6A 1H5YA 1T96A 4S3FA 1JZ4A 2HNHA 1UH3A 5E9XA 4WY0B 1Z44A 5AYYA 2C1IA 3TA9A 3TKFA 4X9YA 1D7FA 2J25A 3DG6A 1H60A 1YE6A 2YCJA 2XFYA 4UFIA 5IM51 3EDKA 2QJNA 3P80A 2QCMA 1SQ7A 4JCMA 1E5JA 2CLFA 4MNMA 1R3SA 3C2OA 1FX6A 4DIAA 1VPXA 4FF7A 3QQWA 4H6EA 4AD5A 1S3TC 3S6OA 4O8AA 1XYBA 1VEMA 1A5MC 5T8GA 3WBEA 2HWGA 1BYAA 2PWHA 2X1SA 1B4KA 1K7FA 3QKZA 2ZZ7A 4ZSUA 1C91A 2OKTA 3WK3A 1H63A 3NO5A 1XJBA 1SW0A 2I1OA 2I16A 2ZZ3A 1R8LA 1SMDA 5BW6A 1YADA 4PRRA 3RPDA 4YCPA 4AD2A 1IXNA 3TTSA 4NHVA 3HFTA 1SZGA 1GTHA 1I75A 1OABA 2Z2BA 1O5XA 4HK5A 2BXVA 1TRDA 1EJSC 4MLRA 4CQ9A 3ONBA 3E5BA 1J9YA 2DU2A 2PU1A 1MRQA 2HNEA 4PEEA 2AQOA 4ZR8A 3VOHA 2MNRA 2WJFA 5DMNA 3GH4A 4XX6A 3EWDA 5D9OA 3NQCA 1E9IA 4FO4A 2G8ZA 3FV9A 2XINA 4D6FA 2GFTA 5D32A 3M1ZA 3VMPA 5DX7A 3AS1A 4FOJA 1TJRA 2Y2WA 4CEXC 2XIMA 1HJQA 3H23A 3W1XA 3A3HA 4J3ZA 4DEFA 1Q6GA 1F6PA 4E4PA 1FHVA 3O6DA 1U83A 3BK0A 3BAXA 3K46A 1Z3NA 2A3BA 1S2WA 3WJWA 2VR2A 4F79A 4KEMA 2GQAA 4Z2KA 3TTOA 2Z7GA 3M6DA 4F66A 1AJ2A 2WVTA 3L21A 3LHWA 4CCZA 1E0XA 5AN7A 3WL0A 1RR2A 4L4MA 1CGUA 1LBMA 1WDQA 3OYXA 1QR7A 3RMEA 2X1TA 4DXXA 4XD6A 2PLKA 1J6OA 4U33A 1H7PA 3C3UA 2GSJA 4PTDA 4RNJA 1DJYA 1HO1A 2WNWA 1HJWA 2F2HA 2VEKA 4N9EA 4Z1BA 3BG3A 4JNZA 3IS4A 1PE1A 4GUJA 4Q4SA 4QGCA 1K1DA 2FGLA 3RILA 1QAPA 4K39A 2WMIA 3PBGA 3NZGA 4P7QA 1PZ3A 3CPRA 1XRSA 4MB5A 4JTAA 1A5NC 4XAYA 2TRSA 4GY7A 2W92A 1OFBA 1V7AA 2OMAA 1W3TA 1F3TA 4GYPC 3SECA 4MIMA 3PN8A 2DP3A 3HPXA 5J5DA 3S42A 3U57A 1M7PA 3UETA 2NQ5A 1JPIA 5CC6A 4H04A 4UTUA 3H2CA 1PKNA 1LBLA 3VILA 1CGXA 3BSHA 3KXQA 1ODUA 3APYA 3VABA 1FDJA 1TYGA 3I3DA 2QUVA 3CQ0A 3QQ1A 4L56A 2I57A 3CXOA 4H9XA 2J62A 1VCVA 3OZOA 4OT7A 3OG3A 2F8QA 1G7UA 2NT0A 2ZQ0A 3SRDA 3HQOA 1E1CB 3WEOA 3ABRA 4LUSA 1TPUA 5CC5A 2OCZA 1BD0A 1TZZA 3PZVA 4JR5A 4IQJA 4HMEA 4X2RA 3S1XA 4ML9A 3AIQA 1KXQA 1PKYA 3UBPC 3HOJA 1W5NA 4ZENA 1QPNA 3BJTA 1MI3A 2G95A 3QZEA 4WDTA 1K03A 3OBAA 3NQBA 2C15A 3MCOA 3R8RA 5CLWA 3FA4A 1A0CA 2POZA 3AMDA 2ATSA 3RR1A 1QO2A 1TV5A 4HJWA 4UTFA 3PFMA 3UR2A 3W70A 4MY1A 2VEPA 1KTNA 1B0IA 3GNOA 2VZOA 2PTYA 4DBDA 3S9IA 2WB5A 3F5LA 3BCJA 2E68A 1AQFA 2YKKA 4FF5A 2WCAA 4HTBA 5A6AA 3MBFA 1KFJA 1XI3A 4G5DA 2CLMA 1BWLA 2H3BA 4UC5A 3VK5A 4KFPA 3LHYA 4V15A 3P60A 3MY9A 4C7DA 2GDQA 4HA0A 3W1RA 4KKXA 2DZVA 3NQ6A 3GH5A 2HVOA 1EGZA 1RQEA 3TC3A 4LCSA 2V69A 4FP1A 3SJ3A 2HXUA 3RCMA 4LV9A 3HU7A 4QQ3A 3BOLA 4Q8VA 2X0YA 3CUXA 1HFBA 2WZHA 4D6CA 3QGVA 2QJGA 4WK9A 4NQ1A 1YMYA 1UWAA 1KWGA 1KM4A 3UWZA 4A8RA 4IICA 2RDUA 4OTKA 4X2PA 5DQPA 3SCPA 2RDXA 3AWNA 3L5LA 3UCQA 1OYCA 5HA7A 1YIXA 2OLAA 1S46A 2FHBA 3E74A 4DXKA 1XQKA 1N8WA 1WAWA 3MW7A 1YHTA 1UWQA 4UNIA 5L6UA 4NVTA 4EACA 2ISVA 4LS2A 1JZ6A 3P74A 4G7EB 3UGVA 5F4SA 4C6QA 1GKRA 1A5AA 4Z2IA 3KOXA 1DWIM 2OX4A 4UIOA 2YZ5A 3OA5A 3F4DA 4GXMA 3L9CA 3ARUA 2PDWA 1WKDA 1BSIA 5K9CA 1FH8A 4E2BA 3M47A 1PUDA 3NPXA 1JPMA 1GOOA 3G22A 5AZ1A 4A35A 5BOFA 1UD8A 4U4MA 4O1CA 3QY7A 1YLVA 2H9AB 1EO5A 2X09A 4GQ0A 3VX0A 3E2SA 4QFUA 4AIUA 1Z7AA 1P5BA 5LGZA 2QCHA 3UFYA 2WJDA 3U8GA 3MP5A 1IXPA 4K1GA 4BI5A 2VMFA 3TFCA 3B8UA 3SIZA 1UQZA 1K6AA 5JXQA 5D38A 2WMJA 3O3RA 1A5KC 2ZRVA 1MXDA 1RBOB 4HHHA 2EPLX 2BFGA 2ICSA 4DPPA 3EA3A 3IGUA 3CEPA 3GR4A 1XYLA 3EWWA 5CC3A 3K4DA 3WJZA 1UJPA 3WG6A 1E0VA 4L1GA 4RDYA 2NXHA 4E3VA 2XIOA 1XDMA 3IJ9A 4PYSA 4ORMA 5BWFA 1RPXA 4OJYA 2L5HA 3UNTA 3VX1A 4UB9A 2B7QA 3DOPA 3GB6A 4NSBA 1TVLA 1W17A 2GJLA 3M5YA 4L4OA 4HNVA 3TJLA 2P0IA 1U1HA 1SW3A 1BTCA 3M64A 2HK1A 3GE7A 3KL0A 2XFFA 3KHDA 3B05A 3WBXA 1TX2A 1EGMA 5MHBA 3G1HA 2VVSA 4DZAA 3NUKA 9RUBA 4NX5A 1UP2A 1KCKA 3AHYA 5I78A 3FY1A 2E09A 1JRBA 2PCEA 2Q3RA 4XAPA 5EU9A 3ALFA 3W53A 4HHPA 4AXKA 5FCZA 4WDWA 2OSXA 1BYBA 4IMGA 1HUVA 1X1ZA 2J7GA 2GGIA 1BFNA 4HK7A 3DCPA 3RNDA 3VI2A 3OEXA 4UTJA 3KX6A 2JEQA 4PUKA 3I65A 3VKDA 3KHJA 3N4AA 1XBYA 3FNDA 4TV6A 4AIBA 2CLHA 3FYOA 1EWEA 1FXPA 4WSKA 4JX6A 2Z1KA 3QN3A 4AF0B 7REQB 3D3FA 3NCOA 3GC5A 3QSRA 4PCTA 3WBAA 4BS0A 1A53A 1UCWA 4FEZA 1IZCA 5JBEA 1OFEA 1MDLA 2QV5A 1JPHA 3CQHA 3CZKA 1K8ZA 2WSPA 4ZFCA 4WQ6A 3GBEA 4FLQA 3MMTA 5J04A 2OQYA 2WM0A 3OGRA 1P7TB 3M6YA 3C61A 2VZTA 3UCDA 3W82A 2Q01A 1L8NA 3MMWA 3KDNA 4Y6GA 1X6LA 3EOLA 1RZMA 1GEQA 4AWTA 4PBGA 3SFWA 1PCKA 1AZ1A 3QJAA 3USBA 4YNGA 3HGSA 4ZQNA 2Z25A 3DFNA 2HMCA 4XZBA 1ZAJA 2V5JA 4JGDA 5DFAA 3G1XA 2WKGA 5HQEA 3QY8A 3N04A 1H50A 4POCA 1VENA 2QVNA 4KGJA 3IJ8A 3CZLA 4OOUA 5H1WA 1LF1A 1V8EA 3M07A 3EBVA 5LA1A 1RA0A 4LUSB 2E9LA 5AHFA 1A5BA 4QCFA 2VGGA 2X7VA 4RV3A 3AYRA 3WKZA 2OQHA 1BPLB 4F40A 3OBKA 4GZJA 4DJDA 1KFEA 2CEQA 3E1F1 4ZO9A 4Y9MA 4IPPA 2QGYA 2NX3A 1FRBA 1ISWA 4YCOA 2GDUA 3VYLA 3T44A 1FWHC 3VO0A 5TQLA 5HR6A 4D6JA 4DPQA 1GORA 2O56A 2VD8A 3PPFA 3ZWSA 5E0KA 2OGJA 2VUYA 1AG1O 1FHDA 1UP3A 2VRKA 2GJXB 1SSGA 2OOFA 2QUUA 2ZBTA 1TG7A 3LCLA 1YDYA 1UD5A 1W9BM 2XGBA 3W00A 1SFTA 4ENLA 1GJWA 1P6BA 5G1YA 2NWRA 3FDGA 1HKVA 2E5DA 3PTQA 1NDYA 3L5AA 2MUCA 2J88A 3KRSA 3TEVA 4N9BA 4MJZA 2GJPA 4HBKA 3R13A 2PU0A 4LAOA 2ZWYA 3KBNA 4N9CA 2PWFA 4INFA 5ABFA 4S3JA 3OZMA 1JQVA 3D47A 4XSMA 3RM9A 4WKHA 4CUCA 4LNYA 4LT9A 5TIMA 4LBRA 1UR2A 1CIUA 2GZXA 3GZ3A 4AISA 3SADA 5TD4A 1PZ1A 2WC3A 3GHTA 4UMCA 3WH9A 1EJ7L 1I60A 2NQZA 2C7FA 2WMIB 1TTIA 3ME3A 1QOQA 3DKJA 4PL1A 4C65A 3OA3A 5I03A 2UY5A 2WKLA 3UERA 3THUA 3CNYA 1KM0A 5EB8A 1XLFA 2GK1B 3HJEA 3DGBA 1ENUA 4GC3A 2EAWA 3WENA 5EGRA 3M0VA 3WDRA 3FX4A 4P8XA 3BLPX 1UZHA 5K4ZA 3T0TA 3WLQA 2AMGA 1ZB5A 4Q8PA 4AX6A 3R6IA 2PGWA 4PMXA 2AL1A 4U10A 2VC7A 5EY5A 1BGGA 3G0UA 2ZVIA 2TAAA 3OO2A 3LRMA 3BLOA 3PBUA 4RZBA 4LC6A 3ZJ7A 3GO2A 3NL3A 4Q4KA 5I79A 3LCIA 4ZBCA 4BWLA 1P1MA 3IUIA 2BVYA 1EL3A 1DJZA 1TKKA 3LRKA 4DQWA 4J40A 2PDJA 1LROA 1C8XA 1TV8A 5EMUA 4HQVA 2ZTJA 5D04C 1Q5MA 3O1NA 2Y8VA 6TAAA 4QG9A 1F3XA 3GTHA 1PCWA 4DWSA 4PUWA 2JF7A 2E6DA 1AW5A 3RX3A 1YTDA 4E4UA 2EPOA 3COTA 3VD3A 5A8MA 2AAMA 4NAEB 4O28A 4ZQRA 4QISA 5CZKA 1Y5XA 3VDHA 4HNOA 1QK0A 3MA8A 7ENLA 3GIYA 1JDAA 1P0KA 3WLOA 4A29A 1V6TA 3SCOA 3GVQA 4JOMA 1RA5A 3IGSA 1M7OA 3DKLA 5ABTA 2WZTA 3LV6A 1BEUA 3UWQA 4GH3A 4W4QA 3GH7A 4I8YA 3CZ8A 1CT5A 1NOUA 2QIIA 3GM8A 4DUOA 3UZYA 1TX0A 2QAFA 4MUPA 3TLQA 1TRIA 4O19A 2E9MA 4YTTA 3E2QA 3VKKA 4LEFA 1H1NA 4F0HA 3SCVA 5D37A 5LIWX 5DMMA 1C8YA 1I0DA 4BQ4A 2AKMA 5LIXX 1RCQA 3WNPA 1PX4A 1BG9A 2OYLA 4DUWA 2Q8ZA 3SUSA 4IJRA 2BV9A 2A1YA 1YXCA 3H6OA 1Q2RA 3W29A 5JMUA 8XIMA 3DYOA 3QR1A 3CH0A 3VD9A 3JVAA 4C6EA 1GEHA 3QBUA 1YNYA 2BZNA 3N25A 1LT8A 4IX2A 3W1TA 4R88A 4Q4OA 1YDNA 3AC0A 3LTPA 4N42A 4Q6XA 3TTEA 2NQHA 1C9WA 3W88A 1IEXA 1A5UA 3GG1A 3CZGA 3CTTA 3AYVA 4DWSC 7REQA 1IIGA 3ABOA 1XBXA 3POCA 1TUFA 5EMLA 1NSJA 4NG3A 2A79A 3AZRA 1IQ8A 3W9ZA 3RITA 4LX4A 2DZXA 1I1XA 2FPYA 3AALA 1O7AA 3W1NA 2Y6ZA 1QK2A 2FTPA 5DT5A 1XSKA 1HGWA 3P0WA 4DXVA 2W3ZA 1U1JA 2WVVA 1BQCA 3VIPA 3H2EA 3VKCA 5DCEA 4YN5A 3KWSA 4J4KA 1JULA 2QYGA 1S1RA 4ZTXA 1MFUA 3WH7A 1F61A 2H9AA 2ATMA 2VDHA 4DZHA 3HURA 4BI6A 3W7MA 2I5IA 3UVAA 4IFKB 3CL6A 2OLSA 4GYPA 3O9NA 4AC1X 5CPNA 1FOBA 1X1OA 4O18A 2PTDA 2PWEA 5BRQA 4JTTA 3T08A 1KKOA 3KFTA 2JEPA 3GFYA 4KWOA 3W0KA 3UR7A 4PMVA 1ICQA 2J78A 2P76A 3S2NA 3PG8A 1SW7A 3NL2A 1C29A 2VHLA 2G37A 3I3BA 2PLCA 5I07A 4MNJA 5I2UA 2G3NA 2QW5A 3GWQA 4JHOA 3AS2A 3S9ZA 3B9OA 3TYEA 4GVGA 2ESCA 1ZBKA 3AYTA 3O0FA 1GQNA 1VFLA 3HPAA 5DCBA 1E3ZA 1V6VA 1XM3A 2PDYA 3TU9A 4QS6A 1R3WA 4GABA 4DHGA 4ZE5A 1VAHA 1UUOA 4EWND 1G4TA 1B30A 1JL8A 1MVYA 1T6MA 3S83A 3AIRA 1Q2SA 1JCMP 3BQ6A 3LM7A 3GXIA 1MEWA 4KRTA 4R7OA 3I3EA 4ZOAA 2C6QA 1OCQA 1Q6DA 2OZ3A 1PVNA 4EF8A 1FCQA 5IHSA 4IQEA 4UTTC 4LS0A 4CVUA 1XGDA 4OV9A 4TTGA 7TIMA 2JBMA 5ABFB 3VXGA 4PMJA 2AQVA 4YPJA 1UZDA 4B16A 5A69A 1ISVA 3LEPA 2J74A 3UZWA 4CU7A 5FF3A 4PRWA 4IMFA 5K7JA 1VRDA 4UNLA 1DXFA 3C8NA 2WANA 3W6MA 5BYWA 2AL2A 2IQDA 2NT1A 1A80A 1W3NA 5E0CA 5LNSA 1EWDA 1RCXB 2QUTA 3FA3A 1ZCCA 3C86A 4GJ1A 6XIMA 3SJNA 3V5FA 1EDGA 3QPZA 3O05A 3MCMA 2C19A 3ES8A 3PZGA 3CHDA 4WGXA 4C5YA 3CWNA 1JR1A 2DVTA 1K02A 1ITUA 4YTUA 4AG0A 4AVOA 2OEJA 3OOQA 1CXKA 4TU1A 1W9DM 4GYJA 2VOTA 3SFKA 3M0ZA 2OSWA 4GNVA 4S39A 3QYQA 7PTDA 3GR8A 1BVWA 2W5FA 5I3GA 2CHRA 2BY0A 4GQRA 3C2FA 3TX9A 2VFIA 3GNDA 4QDMA 1LZOA 1SMAA 4NP7A 5PTDA 5CPQA 2VL4A 5KEZA 4UTLA 4FLSA 5I02A 2CLOA 2O9RA 3TXZA 4ICNA 2YXOA 4WSJA 3PZMA 4NX0A 3NIYA 3CGTA 1XHGA 5D02A 3NO3A 4F3HA 3PPCA 4JS3A 1QWGA 3QHOA 4JIQA 2PI6A 4DJEA 2PDIA 5IFTA 3ECQA 5I6SA 4O4VA 4WVXA 5G1TA 4M3PA 1XSIA 1TWWA 3VNZA 3MUZ1 3WQPA 1RK6A 3BAIA 1EDQA 3PPGA 2H90A 3B0UX 3HZ3A 2FFIA 3T07A 3P62A 1XH2A 1OGSA 1BYDA 2R1LA 1NTHA 1N55A 3ERPA 4PN2A 5FJRA 3H24A 2OZTA 4XIMA 2OB3A 2ZZ2A 3HQPA 4JIRA 3GDLA 3PB2A 3RX2A 1TTQA 1ZHAA 2VEIA 2A0NA 2ZYFA 4NASA 1KQYA 3CAQA 4QJ3B 1S2VA 2BWGA 2GJXA 2ZX9A 3ZWTA 3UJRA 3ATZA 5CJMA 3UYIA 4RPPA 5JH2A 3AO0A 1HJXA 3DHPA 4TMBA 5IBXC 5HNUA 5HWNA 1AL7A 3Q94A 2HEJA 1X8FA 7ODCA 1OCBA 3VMOA 4BQ3A 1GJPA 4HCLA 3KRBA 2CWNA 3AXXA 2OWXA 2W79A 3KDOA 1H1YA 5HWMA 4L7ZA 1ZGDA 4G6CA 1ECQA 3ZLHA 3WUGA 1H7NA 1NWRA 3KS5A 3A64A 3PZIA 2P1FA 4KH2A 2I9EA 3WQVA 1GVRA 4PULA 3IIOA 4O0ZA 2OOGA 3MI3A 4LQ1A 4JTRA 1K7XA 3RRAA 3G77A 4GHRA 3NFUA 2V6AA 3W7KA 3BW3A 4PTVA 3SUWA 1GQIA 4E0CA 5LYRA 1P0BA 5AHMA 1VYRA 3WFLA 4S23A 4D8ZA 3F5JA 4J9JA 4A8NA 2CZ5A 4JTGA 4MJMA 5IHRA 5I3JA 1XR2A 1YXDA 4UQEA 2ZFAA 3TZFA 1S2TA 3RM8A 5KITA 1EA9C 3CHVA 1VP5A 1UOKA 1C92A 1S39A 5I0DA 3PPHA 3S3GA 1QRQA 4E8GA 3VDBA 4MY8A 1ADOA 3UJSA 2J79A 1CWYA 5FEXA 3D0CA 1GQJA 3VC5A 3MSDA 1XG4A 3R79A 1V6XA 2E1WA 3DYPA 4FR6A 3EX3A 1E72M 4IH3A 1M7XA 3BMXA 4GY0A 2WJEA 3CHFA 3TJ4A 1JZ3A 3GXFA 3GUWA 3QYSA 3SN4A 4EAMA 4DJFA 5CJ5A 1XX1A 3SM0A 1A47A 4IIBA 4NJKA 3UG4A 2Y7GA 2F61A 4HA3A 3W37A 2E6FA 4RNIA 4ZOEA 4IFKA 5BZAA 4GRSA 1XCFA 4V1YA 1X6UA 4C7FA 1UR0A 4C7GA 2ZWZA 3IEBA 5FI8A 3UY8A 1QU4A 3VOFA 4EWJA 4QRNA 3GXDA 4NI3A 4L4LA 2J8TA 4R85A 1UKSA 5MKGA 1RHCA 3VE7A 2E5CA 4NAEA 1OX5A 3MSRA 5BRBA 1BXCA 3BOFA 1DKWA 4DLMA 4LUTB 4NJGA 2V82A 4AD3A 2EKCA 1N2VA 3GU1A 2VXNA 3GRIA 2PC4A 5JIPA 3M9YA 4WJ8A 4KERA 1VHCA 5FIPA 4FXRA 3IJLA 2Z24A 1W31A 3ZXWA 2DFAA 3CTLA 4ADTA 3PBYA 4J7RA 1RBLA 4V1XA 2B7NA 5T91A 4YXGA 3TNOA 3DIPA 3GDKA 1ZJAA 5EMKA 4IIGA 3MUAA 1CXFA 3MZ2A 2Z26A 6CGTA 4WY0F 5FJOA 2ZA1A 2P53A 3DESA 4Q33A 3AXIA 2YL6A 4Y8FA 5FSEC 3L66A 5DMYA 1RBAA 2WPGA 3OQEA 1QW8A 1VYPX 1O1ZA 5A8NA 1XCWA 4QEEA 1XS2A 1AMYA 5JH1A 5DY3A 3VZYA 1GOXA 4GX9A 1UG6A 4AEFA 4WEVX 4O11A 1MUMA 1TO3A 1ZENA 4Z2HA 3VFLA 4MB1A 1W9XA 3KBMA 3M0YA 4C5ZA 3OZYA 4GY1A 1K7EA 2JK2A 3BV7A 2WCGA 5D33A 1US2A 1LP6A 1SO3A 4KWSA 2D1ZA 3N4EA 3FAWA 3LG3A 4CNSA 2DIJA 2WO5A 3C2VA 2ZUWA 3PNZA 3WCZA 1U1UA 2AL2B 5GJMA 4L4PA 1MNZA 5DRIA 1CGWA 1E4MM 2FPTA 5DBTA 1HKKA 1KCZA 1NELA 1QNOA 1MWOA 1O4UA 2GGHA 3PSWA 2Y85A 4GLEA 3YPIA 6REQB 1OIMA 5H6HA 2IKIA 1A3WA 1PHQA 2JGQA 2YR1A 3LENA 3AQUA 4L9YA 2DW6A 4NJJA 2ISDA 4LAKA 1DIEA 1IV8A 4D2JA 2WLYA 4MNLA 3EB4A 4W86A 1OBAA 1WAUA 2R1MA 2Y5SA 3P82A 1W1PA 1FWRA 2VZUA 4AYSA 2O4QA 3U4FA 4PRTA 1X97A 2X7WA 5F2MA 2QJMA 1A0DA 1OZMA 2PWVA 1CEOA 1K70A 3M5XA 4OQVA 1M01A 4CD6A 4XZWA 1GNXA 1W2VA 1QATA 1YE4A 5HJLA 3W6YA 3FN9A 1LOSA 8XIAA 4UQ9A 1CPUA 3TH6A 4A8IA 4Q8MA 3QFEA 2QVHA 5I09A 2Z6JA 3FJ4A 2V0TA 4PB3A 3PF3A 4O16A 1TZ7A 3UXAA 4B3LA 4M81A 2FVMA 1PL9A 5AHLA 4HYRA 3UWEA 3H54A 1SU5A 4IOTA 1GG1A 3WQ6A 1OC7A 4ZE4A 1J12A 4ONVA 1C9DA 4JTSA 4LTSA 5JU6A 2Y62A 4WXZA 3RLHA 2EF9A 2WKJA 3U0HA 5KZMA 1BVNP 1UA7A 4OOZA 1SO5A 3ICJA 1DIOA 3NEHA 3EA1A 4IQDA 1O94A 2VP8A 3IV8A 3I7RA 4ATDA 2J8FA 1U2YA 5AYBA 3QW3A 2FH6A 3LOTA 2CU0A 3P2VA 2DZPA 4BZYA 3UXIA 2TPSA 4YVPA 5RUBA 4UFHA 3AYSA 2VM8A 1CLKA 1H1ZA 3PM6A 3SCNA 3WD2A 5CKSA 3RK8A 5FSDC 2BASA 2C16A 4QITA 1UKTA 4HVXA 4O53A 2DIEA 3W01A 3ZJ8A 2QDGA 4CVWA 2ZCGA 1EP2A 2Y70A 1Q6FA 3LERA 3PG9A 5CG0A 4KFNA 3QW4B 1AFSA 3O8AA 2D0HA 4C6OA 1UHVA 1LLOA 2QCCA 1GPFA 5CSYA 1HJSA 2VFDA 2WK2A 5HJYA 3VNMA 3SQLA 1LL6A 4HP5A 2INZA 3FHQA 3WUEA 1JYWA 1BRLA 1SM9A 3CMJA 4F8XA 2Y5JA 1PYMA 4Z42C 1HJUA 3DENA 3OPSA 4O8RA 1DXIA 2A7PA 3TDFA 3EOOA 5I3FA 1QNQA 3FEMA 3BCFA 3FDKA 2NX1A 1EYWA 4L6DA 1A0EA 3F4VA 1F74A 1JDCA 3C6CA 1GHSA 5LNUA 1FP8A 5A5WA 1E3XA 3BH4A 4IUGA 4PMZA 1AW2A 2FB3A 4IPLA 3MP3A 5A6KA 3V7PA 3AROA 4Z2LA 1OK4A 3W26A 3T42A 1FH9A 3KBVA 4MTVA 1Q85A 2A7NA 4R7JA 2OSYA 4Y90A 3VIGA 1JCNA 3URBA 4H6RA 1L6YA 1E4IA 2GVLA 4D6GA 1E5NA 4RXFA 2XVLA 3GHRA 4JPGA 2VGFA 1LDCA 1VB9A 3OW1A 4S3BA 1MNSA 4MDOA 3ZT6A 5LA0A 4LAUA 1OB0A 1WA3A 4XISA 2P3EA 3AS3A 1H62A 3GNXA 3UG8A 4KW2A 4DX3A 1T0OA 3IACA 5M3WA 3V5OA 4CNOA 3SDOA 3DHFA 2REQB 3MP4A 2PLJA 1B4EA 4QXIA 2ZUMA 5MKGB 3C2YA 1UB3A 1WZMA 3IPWA 4UCGA 4HYVA 3W2LA 4H6KA 2YB1A 3LV5A 2XDFA 1XH1A 2FJKA 3FXGA 4BQ5A 2NV2A 3CV2A 4O15A 4A2SA 4LF1A 1TELA 1TFVA 3VTRA 3N17A 3OIXA 2R9RA 1IEQA 3ZSTA 1TWIA 4FNTA 4IP7A 2BG5A 4OBTA 4E3TA 4ICCX 5G5IA 1NQKA 1TTJA 2GQ9A 5CH9A 4RZ4A 4UOQA 3FW6A 3S5SA 1UZ1A 3L4ZA 4I5UA 1K9EA 3P93A 3RM4A 2D2HA 5H8MA 3BARA 4W8BA 1LRQA 1UD2A 1UA3A 4PMYA 2V5DA 2AQWA 3BXWA 1A5OC 2WMGA 3F4NA 2JQXA 1DIDA 3NQEA 3DHDA 1FWJC 4REQA 3T78A 2PTWA 3R4IA 4TQTA 1LRNA 3NZQA 3LPOA 1XGEA 3C5QA 1MMFA 1FHLA 3WQ5A 2E5BA 5F2IA 5AYIA 3IAQA 3DH7A 4K6AA 2EPHA 4AB4A 3FXYA 2QUMA 1W1IE 4H00A 3S1WA 1WZAA 4FX7A 1H5VA 1AH0A 4H8HA 1I2QA 1OFAA 2UBPC 2X2YA 4LRSA 3SRKA 1TV7A 3F5KA 3R43A 4GVIA 4C6CA 3VD5A 2ZE3A 5I3IA 3MKKA 3TQKA 4DBUA 4YHGA 4PMQA 2YIHA 5KZ6A 1M9HA 4QNWA 4XZIA 4HCDA 1C7SA 3F7JA 2YBVA 1HTIA 1IWPA 3W7PA 3CIVA 1J0KA 1S2UA 3TJIA 2GUBA 3SEPA 2W63A 1J10A 3PANA 2PCQA 3AS0A 4B5UA 1K9FA 3MKVA 3N34A 1YBQB 3STCA 4AXNA 1UWUA 4J2MA 3L0KA 4QJ1A 3W1UA 1MEHA 1YW1A 3SCQA 1VD6A 3O6AA 3NQAA 3H70A 5I06A 1V3IA 4HHMA 2IXUA 1X8CA 3O7UA 1V77A 4XKYB 4CNNA 4UOJA 4W5UA 2G3JA 4TOQA 2QJJA 2WQDA 1EDTA 3W7DA 3TQVA 1Z6KA 4DM1A 3ZS4A 1JZ8A 3N2CA 2XFWA 3S5YA 4O13A 5LA2A 2Z1BA 4A21A 1MW2A 2PRMA 2GOUA 3APGA 1H0IA 3MANA 1FWCC 4XK2A 1W1TA 2GSEA 4LYQA 4AMAA 5CG7A 3W81A 1F73A 3GYCA 1E6PA 3OYZA 5C8BB 1Q63A 1UMLA 2KX9A 1H4PA 1NH6A 2Z4GA 1J8VA 2J7DA 1Q8JA 1JF6A 4CCEA 5K2ZA 1ZCOA 4FNPA 1IGSA 5HNNA 3GIPA 4KQNA 2HBVA 4AWEA 2Q02A 4LV4A 3TYUA 5IXEA 2D73A 2W67A 4MYXA 4W7WA 1SJCA 4ES4A 3IIPA 4W9TA 3VKAA 3SGUA 1PJ9A 4E4FA 4AHPA 4KGLA 4ZODA 4L6OA 1PX8A 2VCCA 2Y63A 3S5NA 3VOGA 4US5D 3CYVA 3MHGA 5I5RA 5LIKX 4YWIA 2BOFX 2KZHA 3G3DA 1OX4B 4LYRA 5B7YA 2BTMA 1DXEA 4P8UA 2VDGA 3T81A 4PCNA 4CNUA 3KOFA 1O5KA 2YCIX 3CB8A 4IX0A 2CCRA 5FL0A 1XV8A 3EWUA 2GUUA 5LHEA 4Q8NA 1FKWA 1Z32X 3G1VA 2E28A 2PDGA 2GLKA 4U31A 4QROA 3BMVA 1Y0EA 4IG2A 4UTWA 4WIWA 3UG3A 4UMAA 3WMCA 2C8NA 1ITXA 3N2OA 3TP4A 2VEGA 4WOZA 3GW0A 2FGBA 2E3ZA 2O92A 2GVYA 3F03K 1CW2A 2W0UA 2ZZ4A 1VH7A 3ARSA 1R30A 1WKEA 4BQ2A 4UBPC 4JDBA 3VDAA 4WRHA 2ZRWA 5DN1A 1ZALA 1VIWA 2PDUA 2J77A 3LSBA 2XTKA 3K8KA 4MLJA 3W2JA 3BW4A 2G41A 2ZXQA 1JCLA 3P84A 1SFSA 2XU2A 2WXDM 4AD1A 6REQA 2CXGA 2ONEA 1SUXA 4UQAA 3W75A 4M6UA 5XIAA 4DLFA 4HJFA 1GWJA 3R12A 5FJIA 3MDUA 3EB3A 4Y96A 1WCGA 1H09A 3VUSA 3DZ1A 5DF0A 4RNHA 4H2HA 4DI8A 3O0KA 1WKFA 2BNJA 1QWKA 3KRZA 1KM1A 5HANA 2EPNA 2V2CA 3BWWA 5KZEA 1TV2A 2FFCA 3G5EA 4GUFA 2GPTA 3QGAC 2P50A 3QC0A 5D05A 1NF7A 2V30A 3M5ZA 2VFEA 2AKZA 1CENA 2F38A 4FNQA 1JG9A 3GXTA 3TW9A 2C91A 5F2LA 3ALGA 2VZVA 2VKZG 3AIBA 4L9XA 1KCXA 1OIFA 2P8BA 5C9XA 3W71A 2Q3OA 1C8QA 4NZ3A 4CKQA 1X38A 5LHFA 1RK5A 4ZXLA 5FEPA 2IPWA 3MVIA 1B3VA 4M6QA 1TWDA 3N73A 3LGEA 5FJPA 1HNYA 1D7KA 1VLIA 1QI2A 1V79A 4PBFA 4I5RA 1EH9A 4QE4A 1R2RA 4OWGA 4KRZA 3B0PA 4N6EA 5J5RA 5E6ZA 3TC7A 1NY1A 2Y4SA 5KSWA 3PSVA 2POTA 2YCKX 1LLWA 5ECVA 3RAOA 3A23A 2WMKA 2EHHA 4BEQA 2D2OA 5LNRA 2I17A 1OFQA 4PMDA 2DZBA 3LZ5A 4AFYA 1IE7C 1VPQA 3O2LA 3UY7A 4LUJA 4NF7A 5JIWA 5BXPA 4RK8A 2DGAA 2ZA3A 4JL1A 4GH1A 1B3ZA 3KL5A 5D09A 3NDOA 2BHYA 4I3GA 3T8QA 2RHGA 4KEZA 1MQRA 3TVAA 1T7LA 2NVCA 3R25A 1NWSA 4IJBA 4QM1A 1ONXA 4ZA0A 3BPWA 1LBFA 4AZGA 2VR4A 1M6JA 3AIVA 1JEZA 1NF0A 5E09A 3WQGA 2NUWA 4B9ZA 1Q65A 3VMNA 1QASA 2J9XA 5FJTA 5ABGA 4RDWA 4U3AA 2YW3A 3AI0A 3IRDA 4ZGYA 3M4HA 1H11A 2YA1A 4P7OA 2P8CA 4FOKA 5AC7A 2YFNA 3L2MA 4JTEA 3PNUA 4LAZA 3A5VA 4MAVA 3SGGA 2JIEA 3F2DA 1FFRA 1I1WA 3LX9A 4NZ1A 4OE7A 4JDYA 2LLEA 1V02A 2FTYA 2XSBA 3NWRA 4Y9NA 3BUVA 1J0HA 1C93A 3M0JA 3GY1A 4LFYA 1NP2A 2YA0A 1MW0A 6ALDA 3BANA 2QCFA 1ELSA 1N8FA 1EJTC 1XRTA 2WMHA 5CPTA 3REQB 5BMXA 4FHAA 2BY2A 3EDJA 4HZ8A 3URAA 4AYGA 1L2QA 2XFRA 4M5PA 1W1ZA 4RXGA 3GHSA 4IXHA 4ML4A 4NNBA 3KBSA 3WQWA 3I7SA 3GG7A 4S2CA 3UZXA 3IUHA 4LNCA 5JBDA 1O68A 3SBFA 2QHAA 1HL2A 2I7GA 2CIPA 5FF4A 3TNBA 1VBGA 4Z2JA 4DUVA 5A8QA 4LB4A 1WX0A 4DZIA 5DELA 3W2MA 3F4CA 3W38A 1EX5A 4DO6A 2ALRA 1P0NA 1I8JA 1A4MA 1KFWA 1JUKA 1JRCA 1KFKA 3KWXA 3S0CA 2ODOA 3HIJA 3HBLA 2OFJA 2D23A 4IPIA 4HA1A 3UJFA 2J9YA 1VBJA 2ZZ1A 3WF3A 3E3HA 3M0HA 4ICMA 1OFRA 3NZRA 1CBGA 1R3RA 3WBYA 4BJHA 4AQLA 2A3HA 2GYIA 1JYXA 4HPGA 4HOXA 4X63A 3TK7A 3AJXA 2EG8A 2CC0A 1LWJA 5EFDA 2VFFA 4XTDA 1Q8AA 2XHYA 3ITGA 1GK8A 5I77A 2ZC1A 2C79A 2NQLA 1GOIA 4LUIA 4I7VA 1W8GA 1L6SA 2V5KA 1KBBA 3UP8A 3E6EA 1A5LC 1UH2A 4M1RA 3WJYA 2H6RA 1US3A 2V81A 4XUYA 4LVBA 2CWXA 4MY9A 2VGIA 1OX4A 2H8ZA 2IQ0A 4BHYA 5CSUA 2NUYA 3O6CA 1H49A 3APTA 4OUIA 3BAYA 3FA5A 1PBGA 4H8UA 2FZDA 3BZJA 2QPUA 1AJ0A 3WLHA 5AYXA 1M65A 5MF5A 3QOKA 3SQMA 2WCSA 1TVNA 1EGVA 4FNSA 4IG2B 4CU8A 1X6NA 3BURA 3IIVA 4XZNX 1JQXA 4W89A 1JJKA 1DWAM 1H3GA 3U7BA 5AHNA 3L23A 2YLLA 2DV0A 3V1HA 1EPVA 1V3KA 2AAAA 3GG0A 4E6MA 3TA6A 4DJEC 1PTAA 2BHZA 3P5ZA 2D2JA 2EBNA 4QP0A 1BQGA 2J24A 3E0WA 1ZZMA 5I3HA 3THDA 1XISA 1JZ7A 4BF5A 3E38A 3U7VA 3T0BA 1L6WA 2FHFA 4OBSA 4DAIA 1UD6A 4LF2A 9XIMA 4O1AA 3QR0A 4Q3MA 4JFTA 5D4YA 3OLDA 3A9IA 1SZEA 2QMKA 4A8LA 3ANUA 1RUSA 1YBQA 4W84A 4JYFA 5T26A 1AH3A 2VX4A 1GT8A 1AQ0A 1U33A 3RCNA 1E6SM 1EF3A 3LU2A 3KLLA 4C1KA 3AZSA 3NL5A 3AOFA 3L5MA 4WDXA 5EBAA 1RLDA 1J11A 1A5CA 1DIKA 4W7VA 3RJXA 3C2RA 2O7SA 1RY0A 1UR8A 1B9BA 2X2GA 3H4GA 3SY1A 4EX4A 4UTTA 2WNZA 3IVSA 3W7LA 3QFWA 3PY2A 3IVTA 8RUCA 1ZPTA 6A3HA 1FH7A 4A3YA 3LBMA 4YLWA 4HSOA 1EX1A 3VIOA 5SWUA 2V68A 3NAVA 3GYEA 3QV6A 3W4RA 3CZJA 3W72A 3NDYA 3WL1A 4OVXA 1GVEA 3CT7A 2EPMX 2ACRA 2PDXA 4KWWA 4K2SA 2GQ8A 4B5WA 1L6GA 4OKDA 5LIYX 3M16A 4Y8EA 3M41A 4WZHA 2PTXA 3CIXA 3H2AA 4XD3A 4YTSA 1VFMA 3PUOA 4RX0A 2C1GA 3EYPA 3RJYA 2BY1A 1KRCC 2G97A 3LCFA 3U3HA 2D3LA 3EMQA 2V63A 3KVLA 1WXZA 3RO6A 2X0SA 3VIHA 2IPGA 3W1MA 1PTGA 5DLCA 3TMQA 1E55A 4H6QA 3NM1A 1G69A 2ZXBA 2DT0A 4RZ5A 1RP9A 3RU8X 1U5VA 1TB3A 1E6XM 1WZKA 1M41A 1TCMA 1EOMA 3W1PA 4NAFA 4K38A 3LS9A 1FWFC 2OTDA 1IF2A 4NT0A 1A5SA 2D69A 5DY2A 1R3VA 5BOEA 3U6WA 3S1GA 3W7NA 1JDFA 2J6VA 2NLIA 4ILSA 1NOWA 3EWCA 2FPVA 3C0QA 4OU1A 1Y65A 4GACA 4ADUA 2VWSA 5D8WA 4DJFC 4PH6A 1IGWA 4D1IA 1VS1A 1JVNA 2R94A 3OBEA 2EXOA 2V5LA 5AFDA 1OFDA 4XG1A 1L6FA 1V51A 4HOZA 1PHWA 2BLEA 4QLJA 1CECA 2PBOA 2WZMA 4Q4RA 4A3RA 3AIUA 3QV7A 1Q6QA 3BG5A 2VDIA 4DJDC 4PTWA 4E2VA 1US0A 5JUVA 4R3UA 3AWOA 1KTBA 3H12A 5HXMA 3UWUA 2V3EA 4H19A 1O6IA 4M8UA 3IJ6A 1CYGA 5CLTA 3NGFA 3GBDA 2PZNA 3IIZA 1RH9A 4K8HA 1PIFA 4XAZA 4DM2A 1GZJA 5HJXA 3KAOA 4FS9A 7CGTA 3WDQA 2NSOA 4B9YA 1WYIA 2QDDA 1HT6A 4NXSA 3HPSA 3PFRA 3TWAA 1OWQA 2VVNA 3A4WA 1XUZA 2BOGX 2ZC8A 3PBMA 2IKHA 5G2IA 3SY8A 1AQHA 2PP1A 3KOWA 5KETA 5H8UA 4JN7A 2X40A 4AWUA 1ZLPA 4W85A 4MF4A 5AC4A 1HN1A 3AZTA 2X8RA 3W85A 2J4GA 1ONRA 3P6LA 1GQKA 4QJ5B 2HSAA 1TE6A 1EJRC 3VU2A 4O14A 5D9MA 3MUCA 1SPQA 3NQ8A 1EKOA 2NQJA 4KESA 1ZS2A 3LTYA 2X41A 3G6LA 4XSLA 4YWSA 1BAGA 1JXKA 2TYSA 1M53A 3A4JA 3IGHX 3JZEA 3UESA 4HIBA 1XICA 2PDQA 4MADA 5CBIA 4AY8A 3GC2A 1VRXA 1Q7ZA 2FDSA 1AW1A 1JI1A 3H7UA 4H7ZA 4IF2A 3U5UA 4KF1A 1PXGA 3EWYA 1EBHA 4J1OA 1TA3A 2I14A 2HVNA 4ERIA 5A6TC 4JQAA 2VX5A 4AX7A 2UZ9A 5LNWA 4TX6A 3DBPA 1H7OA 4BY3A 2QMJA 1TSIA 2HXTA 3A12A 2IKJA 2R1NA 1DQWA 1DV7A 1MW3A 2C0HA 1UUQA 2XPKA 2YXGA 1MYRA 5CZJA 2ANUA 3E96A 2VENA 3K8LA 3UD6A 2PDBA 3EX6A 4Q4MA 4L1WA 2F84A 5CGTA 3HV9A 2BB0A 3EGJA 3UPWA 2FTWA 2ISSA 3V4BA 1T41A 5AC6A 3O15A 4I9TA 3MVTA 4L64A 2O55A 2DVUA 2FH8A 2HTMA 3V36A 4GJJA 5G2HA 1W3IA 2O9OA 4IGSA 1H51A 1ITQA 1TVPA 3A5FA 4LVAA 2X16A 1E1FA 1J0ZA 5FAGA 4X61A 4F0RA 1XIIA 5JBFA 3LGDA 2XH7A 4XVEA 2BGSA 1R86A 2IPFA 4GI9A 4MWAB 3LY0A 1PAMA 1CTNA 5FF7A 2D3NA 3HQNA 3S5ZA 4PMNA 1F07A 2DZSA 3GU9A 4LB3A 4D9PA 2IQTA 2Z28A 3WDIA 4Y9PA 3L4TA 3W02A 3QV8A 3NVTA 1B9ZA 2I5GA 3E49A 4KEVA 2DZAA 4XIAA 1DVJA 1HXJA 3JUGA 5E93A 4E2DA 2YPIA 1UZ4A 5CJNA 4LCQA 1LQAA 1YEYA 3GAKA 3KOYA 2HE5A 4H7VA 1YDOA 3TAOA 4FOUA 3NSMA 2YCEA 4AZCA 2A3AA 2PS2A 4J3UA 2DUAA 5I23A 3ITYA 2ZVRA 2Z00A 1EO7A 2WBGA 4H3DA 2V3DA 4H8VA 3MWAA 4CNTA 2XIBA 4PTXA 4Q8WA 1B57A 1JYNA 1EUNA 4HPJA 5D2TA 2DORA 4TX9A 5U4NA 4Z2GA 9XIAA 4IISA 4JNYA 4JFSA 2NW0A 3B8IA 1BF6A 5D9PA 3B9DA 3C0SA 1BLIA 3K8MA 4NKCA 1AL8A 4UQDA 1LYXA 3LA4A 4WSHA 2OO6A 3GTIA 3CT2A 1O66A 1V03A 2OGYA 5K9DA 1KFLA 4IHCA 4N4PA 3BDKA 3H2OA 2DT3A 1XIMA 4MPKA 1JNEA 3PR2A 4RCXA 4D8AA 3TC6A 2QV4A 4ZQOA 3MI6A 3RLGA 4I7UA 3EKLA 3Q4DA 5D30A 4RDZA 4JN8A 2XISA 1Q66A 1GZ1A 4K7YA 3D5HA 1DWHM 4Z17A 4LBSA 1XGZA 1EIBA 1XLDA 4DI9A 4L80A 3M0LA 2ACUA 4D1JA 1VFOA 3II1A 3EDDA 1XLLA 3DGRA 2EPKX 2NUXA 4RL3A 4WOQA 5H8PA 4QR6A 3CUIA 3N2TA 5BU9A 1ZBCA 1UWIA 3OVRA 1EZ2A 9CGTA 1G6CA 4Q32A 1V7YA 4GE8A 3OLGA 3M0MA 3MSYA 2JGYA 4H4IA 1AZ2A 4C6IA 4A4AA 1H61A 1KRMA 3ARPA 3KVJA 1TPWA 4DRSA 3MZNA 3H8AA 1O12A 2F6KA 4UZUA 5REQB 4XZMX 1QI0A 1LLZA 2QDEA 4YTRA 4NZCA 1SGJA 1MEIA 3BQ5A 1G4SA 1WOAA 4ACZA 1M04A 4TUFA 1KXVA 3R0KA 3WMSA 1CXHA 1OY0A 5HUPA 4WY0A 2V5CA 4KCUA 3GFZA 1OHLA 1E0UA 3NO1A 1LWIA 2GK1A 3CWOX 1B3YA 2FYMA 4CEUC 1FVPA 3PZUA 4XAGA 4HSHA 1W9VA 4HMDA 3LXAA 2OX1A 2DSWA 1I6NA 4XBJA 1Y5WA 1WP6A 2PF0A 3ARYA 1NDVA 4XO7A 4CQBA 1WKYA 3L4YA 1U30A 2ZDRA 5L9FA 5B80A 1LRTA 1L0PA 5HK4A 2WC4A 1JDDA 3CPUA 1EUAA 3FCPA 2BXZA 1B2YA 4G1NA 4HHLA 1W37A 2RAGA 4ZSTA 3V0UA 2OEKA 3CQKA 4KETA 3TONA 1XLBA 4UWMA 3C52A 3QR3A 1WBHA 2JKPA 3CL7A 2BGNE 2E6YA 3GKFA 4QQUA 5K3VA 1MZHA 4FPSA 4WLCA 3RPTA 2J6XA 3WLPA 4JTUA 4DWSB 1OYBA 4MHBA 3T0DA 4HOWA 4UTHA 3MSGA 3NURA 4HNNA 4Q7IA 4QCEA 7XIMA 2FDMA 1D8CA 1QBAA 2DW7A 3DDMA 1BYCA 3RPMA 5G2WA 3STPA 2HPIA 5FJUA 5HWJA 1W5MA 2VOMA 3KP1A 1BTMA 3CPGA 3N29A 1QPOA 1RQHA 4ORIA 1QOPA 3CASA 2X42A 1F2JA 4LSBA 4F0KA 2G4FA 3I4KA 4HNLA 1DHPA 3T7VA 3FVMA 1N82A 1WXYA 4PFHA 1RCOB 4I90A 3QV9A 5EA9A 3UEQA 2CLLA 1FWGC 5DMLA 4LWWA 3F1QA 2RJHA 4Z0JA 3RR4A 4LEQA 3K4WA 3S46A 4X60A 2ZRYA 4KFOA 3LBCA 1NP0A 1B3OA 2ASHA 2XH4A 5A6SA 3DEQA 4GO9A 5XIMA 1W8SA 3I6EA 1ECEA 2YLAA 4LAMA 4RE4A 1DJGA 1L9WA 3W7GA 2J7FA 4P2VA 4K8GA 4BA0A 3RIKA 4Y9AA 4FNUA 3K1DA 1V6UA 1W0MA 1PYFA 5IDZA 1V0NA 1XIBA 4JFWA 2CITA 4US6A 1OT2A 5IRPA 3V16A 1VFHA 3HTWA 4JYDA 1VC4A 3CV7A 4ERAA 4MNKA 3P14A 3G24A 1IWBA 5AZ0A 1QNSA 2DZWA 4G9PA 2HROA 4P7NA 4PUUA 3USZA 4ZOBA 3KLKA 2ZX7A 2DT2A 3QTPA 3QKEA 1QW9A 1ZL1A 3GVWA 2JF6A 5A8GA 3A22A 1VFTA 1P6WA 1HIZA 1C7TA 5C7VA 3W3OA 1UYQA 5TBOA 3AXHA 1HZYA 2J13A 3ITCA 1WV2A 4C1NB 2G5WA 3L4XA 2HRWA 3PWGA 2WNNA 4OHQA 3W6LA 1REQB 1A3XA 4EP8C 4TO8A 2XH0A 3BO9A 2RJGA 2D2GA 1V0MA 1OFOA 2C14A 5GVJA 3UYCA 4XVDA 1VJIA 2PRLA 4GCAA 3G1RA 4B5VA 3N9RA 4DO7A 1W1VA 1DJQA 2I56A 1T8XA 3G8EA 3OZPA 4N02A 5BMWA 4AZCB 4QE5A 5IOBA 3TN4A 2B4GA 1PDZA 1E1CA 1YKWA 3CUZA 3OLEA 1X7IA 3WDPP 3BW2A 1UR1A 4HPHA 1DJIA 3EOEA 5T9CE 3WNNA 1FCUA 5A95A 2DQXA 3H2NA 1X96A 1QI5A 3R11A 3BLEA 1JZ5A 3GAYA 2PWGA 2AGTA 3C4UA 3Q58A 3IJDA 1VCFA 4WHBA 3ZSSA 1QUMA 4QSHA 3WLMA 1THFD 2F9RA 4KWVA 4B3KA 4C6DA 5CBBA 1R85A 1Q13A 4K68A 1TJ0A 3UZZA 1P0EA 3SN1A 1POKA 1TPC1 5M1TA 4IIDA 4MFEA 4GFSA 5AHEA 4GOAA 3LXCA 4O52A 3NL6A 6TIMA 1KXHA 3L65A 2DVXA 1IXQA 5ABHA 1TUXA 1WO2A 1BHGA 4K7VA 1FFQA 1XLJA 2FHCA 1CXIA 1TMHA 2PMQA 7TAAA 1B1YA 4RW5A 1VIZA 4K3ZA 4YVXA 3M44A 5JVLA 1TCDA 3V0SA 3W7EA 5GNYA 3TYDA 3MU7A 1E6QM 2XM1A 3VZZA 4E8CA 1J2BA 4GINA 4AEOA 3AFBA 1V5XA 3D46A 5HPOA 4GCXA 5CAHA 4NY2A 3LSCA 4M56A 4ZB5A 4M80A 3C0JA 1ZUAX 4ZO7A 3S47A 3DAQA 1EFZA 4GKLA 4O17A 3GNNA 2J9ZA 3THAA 1JIBA 2BHUA 4N0RA 2R91A 3T4CA 3ABZA 2Z7KA 4LY8A 3CUFA 4IFRA 1Q6CA 3GQYA 3RN6A 1LCOA 1RAKA 5CGMA 1DJNA 4LANA 3MO7A 1FWSA 2OZ8A 3T2QA 3C2EA 3RRXA 4OECA 4CQCA 1IZJA 4ATWA 1RJPA 4JIHA 2EG6A 1LQ2A 3STGA 4GNJA 1FKXA 3TV8A 1LM1A 4KS0A 4DWSD 1KTCA 1RJRA 4I5XA 4CD4A 3PB0A 2HK0A 2CBIA 5EMYA 4L5ZA 4Q8OA 2ABAA 3WNOA 5HUOA 3TUUA 3CUGA 1QNVA 5FESA 2YL5A 5C2CA 1JFXA 4DBWA 3AU2A 3KS6A 4QHRA 4DN1A 4A3HA 1FHUA 4Y7EA 4Z0SA 4HA4A 3HPFA 4PCPA 3VFCA 3UQNA 3R89A 1KGUA 4DJFD 1FTXA 1Z48A 4AC7C 1KQZA 4I6KA 3AHVA 5B7ZA 3WLIA 1J01A 3U4AA 3E0FA 5EYWA 1S2AA 1KFCA 4IMCA 2G3MA 3TSBA 4A3QA 2Z1XA 1CX9A 1ALDA 2YL8A 4NIRA 4O1EA 2ZZ5A 2EQDA 1WBJA 4C6BA 2X0HA 4RDVA 2PD5A 2OZ0A 3OJGA 4F2BA 5E70A 3TR2A 3OQ8A 3H2FA 5AECA 4KEUA 1VKFA 3WUFA 4I8DA 4BCEA 4A3UA 3KCJA 4HNUA 3W1AA 1KV8A 2PGEA 4AD4A 1OADA 3VIIA 3CQJA 1E1EA 1QJWA 1R3QA 5KINA 3EDEA 3LLDA 4IPNB 4XBSA 1XRVA 3WN6A 2CLIA 2BS9A 1DYSA 2CKRA 3S5OA 3LCWA 4FAMA 4WJXA 4IP5A 1R2TA 4BK9A 2WNQA 1HQTA 3FKKA 4YU1A 3BJFA 4QAWA 4S3EA 3GTFA 1KCLA 4ZQMA 3GG8A 4J3VA 4WJEA 1G7VA 4UFKA 1DE5A 1J2WA 1G1YA 2PWUA 1FDZA 6ENLA 3ZQ9A 2HISA 2V67A 3DX5A 3KP0A 4HCHA 3AHZA 1BXBA 1KB3A 3E9AA 3CV1A 3GS6A 3F2BA 3PULA 3NQ7A 4JEJA 1SZNA 3VM5A 4G2DA 3WLTA 3EX2A 2ZX5A 3A3XA 2AGKA 1B3XA 2DT1A 3T55A 4JTQA 1XDJA 2NVDA 4S3GA 5DXXA 3NSNA 3CIWA 3EKGA 4NNCA 5REQA 4M6VA 4XO6A 4PUJA 3L0GA 5FAJA 3LB0A 4XUGA 1E56A 4Q7BA 2GJNA 3ARTA 1RP8A 3VNIA 3QHNA 2VCAA 4QTGA 4O12A 4ALDA 1OINA 4GFIA 4C6JA 3CAVA 4UFLA 1PKLA 1R9YA 4BEUA 5A1AA 3EEGA 2F6XA 1X1NA 3VNLA 2RUSA 3T8LA 3TYZA 4PTMA 3MQTA 1EQCA 2PEVA 1Q3NA 4LVFA 1HKJA 2QCLA 3E2RA 4KCWA 4O1DA 1XKYA 1I2PA 3WK0A 3WD0A 4PZVA 2OG9A 1J79A 2DIKA 4WKAA 4GIAA 1AODA 4PTNA 5CSSA 3IWPA 3PJTA 1J96A 1NARA 1NVMA 4G8TA 1K9DA 1D2KA 2WVSA 1QO5A 1GHRA 1KM3A 3DHUA 4DO4A 2OPJA 4UFJA 3LM3A 3UXLA 3VDGA 1J93A 3G18A 2WJZA 1YNPA 2GSHA 4LOCA 3LNPA 3VOCA 3ZT7A 3WD3A 1I4NA