1F6KA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
b'MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 120
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f6kA00
1ML1A 4MZ8A 3H55A 1KA9F 3PVFA 1L9WA 1ICQA 3NPWA 3ABOA 3QZEA 3RLUA 2A2IA 2OMAA 3EX2A 1OABA 1H61A 3SSJA 3BLIA 4EIVA 1YADA 2NWSA 4WX2A 1WX0A 3TNOA 2CZEA 4QISA 4DBDA 5MHBA 1X1OA 3LI1A 3LCWA 2X1UA 2QR6A 1OX4B 3QSRA 1VS1A 1AW1A 1H1ZA 4UMCA 5F2IA 5IBXA 1G4EA 3GAKA 1Z44A 4MVAA 3W07A 2E77A 3EWXA 4LVFA 3W6YA 1UASA 3N34A 1N55A 4UTHA 6TIMA 1SZEA 4N4QA 3W86A 4O50A 1OYAA 2E5DA 5C6MA 2YXGA 1KM4A 1G6CA 1XBVA 2YGYA 3NL2A 3G1HA 2J9ZA 5FF7A 4LC8A 2C0AA 2BXVA 3NXFA 2RDWA 2DZWA 1RQEA 3CPRA 1OX5A 1UB3A 7TIMA 1JCJA 2YX0A 1JUEA 3I7QA 2FB3A 3NOEA 5EYWA 1FY6A 1KM3A 1LBFA 2CLEA 1RQBA 4DF2A 5BMXA 3W1XA 1LRQA 4M7SA 3NQ8A 3R12A 3GZ3A 3HG5A 3MP5A 3W7KA 2R91A 1JRCA 4LVBA 2DZPA 3HGOA 5AHEA 4Y96A 4JN6A 2VXNA 4WY0A 2YFOA 2ZFAA 3I68A 2DZXA 3M7WA 4PC8A 5D2VA 1W5PA 3TK7A 1MEWA 3U6WA 3OA3A 5HMSA 1H1YA 1MEIA 1O5KA 3MI6A 4ZQMA 4HSNA 4AMAA 2OJPA 3TXVA 2GVLA 3FA5A 1L6WA 4IOTA 3LLFA 4HPJA 4CQAA 3HG3A 1WA3A 3JRKA 1NSJA 3MBDA 5I3FA 2DU2A 2V5LA 4DELA 1TMHA 4JD4A 3B8DA 3IIOA 3QSTA 3I6RA 5AOUA 1JCYA 2NWRA 1OK6A 1BTMA 4ZQNA 3TH6A 5HINA 1JQXA 3SR7A 5LNWA 3BLEA 1F6PA 1G7VA 5LZLA 3HIJA 3C2FA 2WNNA 1X6UA 2H6RA 4M6QA 2P0OA 1GVFA 4GFSA 4QSHA 3GR8A 2QKFA 3TDFA 4CNOA 5FF3A 2NUYA 1OFEA 1SO3A 2Y61A 2X1RA 1LBMA 3NQDA 4Z0SA 2F84A 3NR0A 1JUBA 4DPQA 4A22A 3DGRA 1OFBA 4PCFA 2YPIA 3UWUA 4NJGA 3W1PA 4O57A 3W73A 5K2ZA 3Q2DA 3G8RA 1VLWA 4I7VA 2Y7GA 1LRNA 3KXQA 2J24A 2Y89A 3E0IA 3NG3A 1IXOA 3EXTA 3HBLA 4MZYA 4UTWA 1UJPA 3PAJA 4UNLA 4IMCA 3RLVA 3FIGA 4Z1DA 4JDBA 2HS6A 1P4CA 4DF1A 5G2HA 3E02A 3DKJA 3W1LA 2ZZ6A 5CGQA 2H8ZA 1G4TA 4O15A 4AB4A 4JEQA 3OVRA 4NXKA 4NU7A 4NX0A 3G1DA 4OWGA 1Z48A 1TPVA 3B0UX 3S1VA 2EKCA 4QIUA 2YW4A 3ZR4A 4IPIA 3G3DA 5DBUA 1IXNA 2ZYFA 4NVTA 2JK2A 1KFBA 3HQ1A 4FNQA 1OF6A 2XN2A 4ZVJA 3DFNA 3DKLA 5G1YA 2EF9A 4IXHA 3FLUA 2X1TA 1GEQA 2QCGA 1TSIA 5SWUA 4DPPA 2VC6A 4ZQCA 2QCHA 4UR7A 3MMTA 4UFIA 2D73A 1XCFA 2Y85A 3TU9A 1A5CA 3NQCA 3R89A 1FCQA 5K3VA 1NVMA 3S9YA 1OYBA 4AH7A 1JR1A 3IGUA 1OFAA 1MSSA 2QEZA 3W7CA 1W3IA 5A8GA 4MJMA 1V5XA 1ADOA 3VE7A 2ZRUA 1VPXA 3QF0A 3UY7A 1G67A 1ME8A 2ABAA 1OYCA 5F1UA 3EWBX 4IWWA 2Y63A 4Q32A 1XDLA 4O11A 2O7QA 1TPC1 3M5ZA 3W71A 3USBA 1KTCA 1LROA 3LBCA 4JIPA 2ZRZA 4ZMGA 4NZJA 1HUVA 4LS2A 2GJLA 4O16A 1OFRA 4RR4A 4MFDA 3TMQA 5HQEA 1VZWA 1W3TA 1E51A 1M5WA 1NFBA 3L21A 1F6KA 4WY0F 1QNVA 2WSQA 2ZZ2A 2ZBTA 4JTJA 5G5IA 1B9BA 1G4PA 4JY9A 3A22A 1TPUA 1GYNA 2Q3OA 2WV8A 2LLEA 1YTKA 2Q8ZA 3W1TA 2FPTA 4N9DA 3P5YA 4LWWA 3GLCA 1ZJIA 1IXQA 5D04C 5DY3A 5FF4A 3T4CA 1K7FA 4LS0A 1VYPX 1OFPA 1TPB1 3M5VA 3L0GA 2BTMA 1OX4A 3IVUA 3R5EA 3DENA 2A5HA 3T7VA 4IUOA 4PA8A 4PL2A 2FB2A 4WY0B 3OVQA 5BOOA 2RKXA 1SQ7A 4FXSA 3SY5A 5ABTA 3QMRA 4MLJA 3IGSA 4K7YA 3SGZA 1FWNA 1QO2A 3P62A 3V75A 3BARA 2X1SA 1EUAA 1LCOA 5I3HA 3G8EA 1O95A 4MY9A 4NJJA 4M5PA 4IPJA 1SW3A 2ZRVA 1ZENA 1ZCOA 3QYQA 5CZ0A 5EY5A 1CX9A 2WO5A 1EX5A 4UTKA 3DFOA 4IQLA 5DLCA 1SZNA 4RK8A 4HNNA 4W9TA 1JVNA 1M7OA 3W83A 4JTEA 1LOLA 3NQGA 3LERA 1MO0A 4BI6A 4Y6GA 4O10A 3B06A 3O06A 1GWJA 4LU0A 5K4XA 2YYUA 1PCKA 3M44A 4OQVA 5TIMA 4Q33A 4WJEA 3UZJA 3MHGA 2H90A 1RPXA 1K03A 4RX0A 3NQMA 5HUPA 3CTLA 5IM51 2BSLA 2E68A 2Z0IA 5C2XA 3W1AA 2B7OA 3IEBA 5G1TA 4CCCA 1X7FA 3LDVA 1NF7A 3NEVA 3ABRA 5KINA 2FDSA 2ZTKA 1PS9A 3UWVA 5D03A 5KTLA 5D38A 3QH2A 3G0XA 1KV8A 3W3OA 2QAPA 4UTJA 1C8VA 1ZALA 3LX9A 5AC7A 4YLWA 3G1AA 2Y6ZA 3A24A 3GAYA 3ATYA 2NLIA 2O7SA 1Z42A 5F1VA 3HG4A 1CW2A 3GNDA 4TR9A 3EXRA 3W1NA 3KRSA 2CZFA 1TO3A 3LTSA 1W0MA 2J6XA 4LUJA 3INPA 4RV8A 1GVRA 3NZ1A 4FHAA 3TQ0A 4PODA 1PHWA 4WD0A 4NNBA 1FXQA 4WQ6A 1FQ0A 4OV4A 3RNDA 2YYTA 1UUOA 3VFLA 3MP4A 2GOUA 3W7RA 1LDCA 2FTPA 4O4VA 5AHNA 4PL1A 3PBVA 1DORA 4S1FA 2BZNA 3O16A 4K7VA 4UIOA 2C3ZA 4POCA 4XUGA 1T0OA 3M41A 4TMBA 3LCLA 5CG7A 8TIMA 3BO9A 5LGXA 1HO4A 1K02A 3SECA 1XKYA 2AQWA 5G4EA 3RMJA 3GXNA 2QCMA 1FWSA 3GYEA 4TIMA 2H3DA 3FS2A 4DO5A 3LHZA 4B5NA 5KMYA 2RH9A 2V2HA 5KITA 2QUTA 4WZHA 1SW7A 1KFEA 1KTNA 2PRMA 3DH7A 5F2GA 1F5ZA 3OEXA 4Y90A 2I14A 3HO8A 1RV8A 3S8HA 3LXAA 4E0CA 4N2YA 2XN1A 5KZEA 1RZMA 3W75A 1LTDA 3T44A 1W5MA 1GT8A 4EVZA 1WOAA 1A5BA 1W3NA 3O05A 2A4AA 1SZFA 5DY2A 2EHHA 3PF3A 1DKWA 1SPQA 1GVSA 3QPYA 2QUVA 3STEA 2NUXA 5LGZA 1N8FA 2W79A 1NEYA 1EPXA 1LRTA 4N02A 3MO7A 5CZJA 1OK4A 4FF7A 1UBSA 1UCWA 3WJWA 4ZQRA 4X22A 1KFJA 2GVGA 3W2LA 3KAOA 1EP2A 1F73A 4FIRA 4JX4A 5AYYA 3IIPA 3PBYA 1AL7A 4UTLA 1FDYA 1W56A 4O54A 4DEFA 1KFLA 2J88A 2WSYA 1VCFA 5FEXA 1WBHA 2VKZG 2VEMA 3QEZA 1JULA 3W87A 2DZUA 1FX6A 4UFKA 3ABQA 4JYEA 1GZGA 3TSDA 4NUWA 3W2MA 3B04A 3NVTA 3W9ZA 2E09A 3LOTA 5HWMA 1H7NA 3EWZA 2C6QA 4PTNA 4LY8A 1F76A 4K8HA 4J9JA 4UNKA 2PCQA 3DZ1A 4X9SA 2JKAA 4S2BA 3S5YA 3KRZA 2YFNA 4AWUA 4NXSA 1HTIA 4MLRA 1AK5A 3BW2A 3IGXA 1LYXA 3WK2A 4Z08A 5D2WA 4UTWC 1VR6A 1Q6LA 5H91A 1O94A 4LOCA 2FFCA 1DBTA 5DCEA 2VENA 1TJRA 3LXCA 1QR7A 2E6FA 1D9EA 4RLIA 4UUIA 1BWLA 1R2RA 1JUKA 1YXYA 1ME7A 1K8XA 5DELA 1ZHAA 2FPYA 5LHFA 4BK9A 3MI3A 1SFLA 2FQIA 4N6FA 3LV5A 3KOFA 1TJPA 1FWRA 2Z6JA 1XDMA 5F4SA 5CZSA 1XFBA 3BPWA 3WK0A 3HOJA 4RJEA 3SZ8A 2OT1A 2GJNA 1BKSA 3PY2A 3UQNA 1Q6RA 4M6VA 5A5WA 2CZDA 3LCHA 3TA6A 1PL9A 3IV3A 4O18A 2ZZ7A 4K37A 3W70A 2ATMA 1H62A 1KBIA 3TMLA 3W7IA 3W1MA 1KV5A 1TTIA 4JTFA 3CEPA 5CPOA 4UFHA 1T99A 3W7NA 2Y88A 3NM1A 3CWOX 4WUIA 4BF9A 3NGJA 3C56A 4QQ3A 4LNYA 3A23A 1JJKA 5I3IA 2DORA 4UTMA 2ZQ0A 4O12A 1EUNA 1L2UA 3QW4B 5AHIA 5FEZA 5LNSA 2JGQA 4FNPA 1QPRA 4QITA 2ABBA 3W85A 1WOBA 1GTEA 5D05A 2C19A 4UFLA 1BEUA 4YCPA 3TW7A 2R94A 3B03A 3MJYA 2E1DA 5I3KA 2V8ZA 3F4WA 3NPXA 3C6CA 3PUDA 4GUGA 1AMKA 3A5VA 3T40A 3NQFA 3P61A 1VC4A 4NJKA 2CLMA 5K9DA 4DXVA 2CLIA 4ADSA 3DHDA 1KTBA 4DQWA 4A21A 5DN1A 4QNWA 3GK0A 4AHPA 4HIBA 3WK1A 1PE1A 3BG9A 3BK0A 4CQ8A 5G2IA 3BGJA 3P67A 2Q8LA 1T96A 4N9BA 5D2YA 1QPNA 4FO4A 5AHLA 1H5YA 1KLYA 2GUUA 4NQ1A 1L6SA 4FX8A 5HJLA 2A1YA 1SZGA 3P8JA 3HGRA 5HNRA 2EGZA 2YR1A 1WDWA 4YWIA 1IF2A 3W23A 2B7PA 4MY1A 2VEKA 5HWNA 2XFWA 3UWWA 2PRHA 4GBUA 3PULA 3BG5A 3I7SA 4E38A 2QJHA 3MUXA 1QAPA 3UPWA 3L5MA 2V2CA 3N73A 3DBPA 2WSRA 4XKYA 2GQAA 1FBAA 3L2IA 2J9XA 3LHWA 3CHVA 3MYPA 4YMZA 3HPXA 3LHTA 4JIQA 2Y70A 3LCIA 1KFKA 4LW7A 1G7UA 1V7YA 3W2KA 1MEHA 3UZ5A 3C61A 3WFAA 2NXGA 3PS7A 4A2SA 3O6DA 4LTSA 3TSMA 2DZTA 1H60A 1PHQA 4ZL1A 3LBMA 4JTLA 3TR2A 3ZWSA 1F74A 3SW6A 3VCRA 3W88A 2X16A 1LOSA 1L6YA 4Z1AA 3EX4A 4TO8A 3DFQA 4JTIA 4M6PA 3NO5A 3TW6A 1I2NA 5D02A 1ZFJA 4QJ1A 3TXZA 1RR2A 3TX9A 2ZRXA 4RXGA 3Q94A 1QO5A 3PR2A 1PCWA 1N7KA 2QAFA 4LV9A 3CC1A 3CIXA 1TPH1 2ZA3A 3BVJA 3G24A 3NAVA 3LB0A 4GUJA 3PWAA 3W7PA 3DXIA 3M0ZA 3GDLA 3E96A 1O5XA 3UPBA 2ZTJA 3EKLA 3GDTA 4O1DA 1PVNA 4GUIA 3S1UA 1TIMA 5E1QA 4H6KA 2VFEA 3FFSA 3DAQA 3C2OA 5CPMA 4C1LA 1DL3A 3CQ0A 3G3MA 2EAWA 4UC5A 2ZCGA 3TROA 5EPDA 4JICA 4FIQA 2QUUA 2OCZA 3S0CA 1K8ZA 2C1HA 1VCVA 2QJGA 3W76A 4UFJA 3P8IA 2CW6A 3H53A 3KFTA 4NJIA 3PG9A 1OFOA 4JX5A 4BFAA 5F2MA 3GDRA 1VYRA 1JCLA 3HGSA 2G96A 1WXJA 3TUUA 1JCNA 4UTUA 4XBKA 2NX1A 3EWUA 1LP6A 4FX6M 3N19B 3KVMA 2ISWA 2RDTA 2FPVA 2FJKA 3BLFA 3CLMA 5DCBA 4KKXA 4OBTA 4PH6A 1HFBA 3G1SA 5D30A 2RHGA 1B4EA 1K7XA 3NA8A 1I2PA 2WKJA 2ZDRA 1LORA 5G2WA 1YPFA 3SGUA 1Q6QA 4GUHA 1PIIA 1TQXA 1K8YA 1OHLA 4AWSA 4BWLC 4R34A 1BWKA 4CNPA 4K8EA 3O15A 3GXTA 1Q6OA 3KVLA 4I7WA 4WXZA 1QMLA 1FUYA 1ZY9A 2WNQA 3L67A 4HNVA 5HR7A 4RKAA 3PUOA 2TPSA 1VCGA 4XZ9A 2CZ5A 3PG8A 4MYXA 2Z6IA 5I3JA 1AW2A 3GX9A 1U5JA 2DJXA 4BR1A 4JTUA 3VNDA 4O0KA 4LT9A 1X1ZA 2DJLA 3THQA 1TTPA 3UY8A 3W22A 3Q58A 1H7OA 1YXCA 2Y7DA 3TAOA 3M5YA 4IXXA 1W31A 2R8WA 2DZSA 3P82A 4JTSA 3UWQA 4LUIA 2G5WA 3FJ6A 3TAKA 3EXSA 2A7NA 3UNDA 3LHUA 2YDAA 5FESA 3W7LA 2VFDA 4LRTA 4UTIA 3KHJA 4OE7A 1UUMA 5D2XA 1IXPA 2QF7A 3QMSA 1VRDA 4JR5A 1FWWA 3DHFA 3LRMA 1VJIA 4DO6A 3DFSA 3GDMA 3VE9A 2YSWA 1YLVA 1W5QA 4CCDA 1SO5A 2B7QA 3KVJA 3CT7A 3JS3A 1TREA 3PSWA 1LBLA 5F4XA 2V9DA 3DU0A 3SI9A 1S3HA 2VEIA 2CFFA 1F7BA 4DF0A 3HJZA 2G97A 2YW3A 4O0ZA 4BI5A 4MKNA 5C54A 1TB3A 4MY8A 4RCXA 1I8JA 3ZWTA 1KM2A 3S1WA 2QCCA 2JKEA 3CEUA 3N9SA 3GB6A 3ANYA 3AJXA 3QFEA 5LHEA 4NZFA 3TE9A 4X2RA 4A29A 2CLKA 3TKFA 4ALDA 4CQ9A 4BI7A 1ALDA 3T78A 2BLEA 2B7NA 1P0KA 4XKYB 2NX3A 3LCFA 2C18A 3FYOA 3UYCA 3TFCA 4P61A 4O1CA 5AYXA 3MYOA 3M43A 2NUWA 2HTMA 4WXYA 3OBKA 1XM3A 4MUZA 4MZ1A 1S5VA 3W1UA 3TQVA 3UWYA 5AB3A 3C4UA 3TCEA 1G69A 4IX2A 4ORIA 5DXYA 1I2RA 1TTQA 1KM1A 3EX3A 1HG3A 3THAA 3HG2A 2QCFA 4I9AA 4AVFA 4GUFA 1THFD 2VFHA 4QNEA 3W2NA 3O1NA 5FF0A 4RZ4A 4ZQPA 1JQVA 3PC0A 1H7XA 3EX6A 3L0KA 3L5AA 4EF8A 4BWLA 1VYSX 3BW4A 5C55A 1JCXA 3NQEA 6ALDA 1TRIA 2A7RA 4AXKA 3RF9A 4UCGA 2JGYA 3E9AA 3PB2A 1I2QA 1KFCA 3C0JA 4O17A 2VEPA 2ATSA 4EF9A 4L4MA 4O1BA 2C14A 3CIWA 3KVKA 4ORMA 1GYLA 5GVJA 1W8SA 1A5AA 2GVJA 4IMFA 4JTKA 3S5OA 2ZA1A 2A21A 1X8FA 1R30A 3QJAA 1SUXA 1TPFA 2QCLA 1VQTA 4OU1A 4U4MA 5CZTA 5BMWA 1OF8A 1OFDA 3B0PA 4NJHA 4AWTA 5HWJA 2V2DA 3GR7A 2WPBA 5D32A 3NQ2A 1TPEA 3TSBA 2E6AA 4ZQOA 1LOQA 4R33A 5E0KA 1WQ5A 3WJSA 1FCVA 4IMEA 1Z41A 4K39A 4JYFA 1ONRA 1LZOA 4XBSA 3BV4A 4K38A 5EKYA 3WJXA 3N2XA 1QOPA 4O53A 2CLLA 3ELFA 3L66A 2GQ8A 3LGEA 2NV1A 5D33A 3DI0A 1DJNA 1O4UA 4LVDA 1GG0A 2E6DA 3WJZA 1W1ZA 5AC8A 4KFNA 3ABSA 1W5NA 2F7FA 2VFGA 3W74A 1C9DA 1CI1A 4JTGA 5HUOA 4Z0JA 3G1YA 2H8XA 5LNUA 3NM3A 1J2WA 1KW1A 4O52A 2JBMA 5FI8A 1MXSA 3M1ZA 3IRDA 4CLMA 1WBJA 4IX0A 1YXDA 3QM3A 1DQXA 3CU2A 3RU6A 3S42A 3MI2A 4A2RA 3C2VA 3C3NA 4KWVA 4N9EA 5BW6A 3S6DA 2Y7FA 5DCDA 1QDSA 2ISSA 5LNRA 4LV4A 1H63A 4Z1BA 4HHPA 1H50A 1EP3A 2ZZ1A 2YZRA 3G0SA 1EWDA 1EP1A 5L6UA 3N2MA 3RK8A 1KLZA 5K9XA 3LRLA 3BGGA 3W2JA 4HPXA 3NDOA 2JKPA 1H7WA 3N14A 3NNTA 2B0MA 4K36A 2V5BA 2P10A 3P5ZA 2Q3RA 3M5XA 3P80A 4UMAA 3TQKA 3R8RA 3HF3A 3Q37A 4L4LA 4U28A 2V0TA 3NPVA 3EEGA 3WK3A 3WJYA 1EA0A 1H7PA 3EKZA 1TCDA 1I2OA 2TYSA 1TTJA 2RFGA 1EB3A 3LHYA 4XTIA 3STFA 3I7RA 4IMGA 3HPZA 3NQ7A 1GG1A 3SIZA 1AL8A 1P0NA 3HMJG 4M7TA 1S5WA 1R2SA 3M6YA 3MBFA 3DFPA 3BW3A 1FDJA 1ICPA 4KFPA 4Z1CA 4N9CA 3W7MA 1OFQA 3W7DA 4O4WA 2W6RA 4AF0B 2WOQA 1FXPA 4UR8A 3G0UA 4JTHA 2ZRWA 4ZZ9A 4ICNA 3QW3A 1VHNA 2QCDA 5HULA 5D37A 2IQTA 1IIHA 3CB8A 4JNMA 1QCWA 1QWGA 1NF0A 1R47A 1WYIA 3V1PA 3LM7A 1GOXA 4JS3A 5HR6A 5AYZA 1R46A 4YCOA 4D2JA 1YYAA 3QQ1A 3VKJA 3FKRA 2A6NA 3GVGA 2TMDA 5AHMA 5TQLA 4MFEA 1AW5A 3OG3A 2X2GA 1FDZA 1R2TA 1YDNA 1H51A 1XBXA 5KSWA 2J9YA 4HN4A 2NXIA 3MWAA 2C13A 3IIXA 2E5BA 3NQ6A 4O1AA 3TV8A 1WAUA 3PB0A 4NNAA 5FEPA 4UMBA 2V81A 3NZRA 4KFOA 4LVGA 3O6YX 3DFTA 1TYGA 2CWNA 2ISVA 3OIXA 2AAMA 4GXMA 3T55A 3B0VC 5K9CA 2V30A 3ZS4A 4JYDA 4MJZA 1PV8A 1W5OA 3S1XA 1TPWA 1XC4A 4UFMA 4ADTA 5K4ZA 4TMCA 5I3GA 1VH7A 3STGA 1DJQA 1AG1O 3E12A 4RXFA 4XWUA 1DV7A 3LTPA 1YDOA 2W0UA 1XL9A 1U83A 1EEPA 3NQAA 1J5TA 1RQHA 2DP3A 2WQPA 5D2TA 2Y7EA 4Y8FA 1QFEA 2WJZA 4GRSA 3NL3A 2HMCA 3B4UA 1KBJA 3UXDA 4NX5A 4Y9AA 2RDUA 2ALDA 1WV2A 1VHCA 1SO6A 4DBEA 1TV7A 1XUUA 3PBUA 4RZ5A 3FKKA 4QAIA 3W72A 5U4NA 3K30A 2NV2A 1LLWA 3LXBA 3LCGA 3PSVA 2BX7A 2A7PA 1SO4A 1FWTA 2C16A 4JDYA 5DBTA 3M16A 4WOQA 4UTTC 3P74A 3SJ3A 3TC7A 4EWND 1LLZA 4LS1A 2OT0A 3P81A 3N9RA 3H54A 1QOQA 1W54A 2CU0A 1H7RA 3F4NA 3GDKA 4FEZA 2V82A 1DHPA 3A9IA 4JXCA 2GQ9A 3JR2A 2ZZ4A 3FYPA 2TSYA 1D3HA 3IVSA 3HPSA 3L68A 2ZRYA 2E5CA 1Y0EA 4A3UA 2I1OA 1KM6A 3G18A 1FCUA 3M47A 1JRBA 3MP3A 1B3OA 2Y62A 5TBOA 4HNTA 4YL2A 1I4NA 1XXXA 1ZAIA 2EPHA 3U2OA 3B05A 3O6CA 3I65A 3L65A 2Z1BA 1QPQA 4JGDA 5F4WA 5FF2A 3C2RA 3GNNA 3QPZA 5D09A 1LM1A 1Q45A 3KX6A 4OT7A 2QCNA 1ZNNA 2NZLA 2X30A 3TFXA 3W7HA 1YTDA 4DO4A 3QRHA 3NYZA 2QCEA 2Z2UA 4O8RA 1A5SA 3C52A 3KRUA 2QDGA 4KWWA 4LC6A 1SSDA 2G95A 3G1XA 2VFIA 4ONVA 3YPIA 1ME9A 4WOZA 3R2GA 4N4PA 1B4KA 4FX7A 5CPLA 4FNTA 2XN0A 1M7PA 1S5TA 3EWYA 5KZMA 2PC4A 1SW0A 3LI0A 5EL1A 3W7EA 1D3GA 4R7JA 4R53A 1TPDA 2A6LA 1VLIA 1VGAA 4C1KA 4CCEA 1GQNA 3R13A 2ZZ3A 4FXRA 5CKSA 1YTEA 3BG3A 2UV8G 4UXDA 5EMUA 4H4IA 4G1KA 4M19A 3UD6A 3NQVA 4OGZA 3MHFA 1XBZA 3N3MA 3MW7A 2FLIA 4E2BA 2HS8A 3NL6A 5H2ZA 5EBUA 3GKAA 4P2VA 5AC6A 1ZAHA 2CLFA 1DVJA 5T26A 4K6AA 4S2CA 3TJLA 1OJXA 3G1FA 2QCDB 4LRSA 4UTTA 3W7GA 5CPNA 2DZVA 3M9YA 4XQ6A 3P60A 3VI2A 4MPQA 3GXPA 4H3DA 3W2UA 4FNRA 2ZA2A 4NT0A 3W1QA 3LTYA 3NL5A 5AHFA 4O14A 3F1QA 1F05A 1YDVA 3L0NA 1KM5A 4I7UA 3U8GA 3G1VA 4ADUA 1I45A 3L9CA 5EA9A 3UWZA 3ATZA 4HT3A 1TQJA 3IIVA 1P5BA 1OVDA 3P84A 4O19A 3UXAA 4LVAA 3LCXA 2PURA 1SFJA 4FNSA 3RFAA 1O60A 3G22A 5CSSA 2P1FA 1XBYA 2NXHA 4GJ1A 4RZ6A 1RD5A 4AF0A 4EOUA 2I9EA 5LKYA 2PE4A 4PEKA 3LV6A 2QJIA 5BNKA 1IGSA 1F2JA 3LHVA 2CLHA 3STCA 3TIMA 3O07A 1GTHA 1XI3A 3OHIA 3S5ZA 1SSGA 1IIGA 1DQWA 3DI1A 3P7YA 3F03K 5LNVA 2OZ0A 1P1XA 1B57A 3D0CA 4CNNA 1ICSA 3NPUA 4OV9A 5CSRA 5BRBA 2A85A 2VOMA 1GVOA 4FB7A 5K7JA 1OX6A 4HNUA 3W7JA 3ZFHA 4ML9A 3L5LA 4IJBA 1K3UA 2AGKA 2YCEA 3C2EA 1C29A 3GIYA 3W84A 3W7OA 1HO1A 3FJLA 4MYAA 5IBXC 2J27A 3EWWA 4AEOA 4GE8A 1TV8A 3W1RA 1GPWA 4N6EA 4IMDA 5F2LA 1GJPA 2VELA 1TV5A 5KZDA 5U7SA 4HKPA 1ZAJA 3PUEA 3C8FA 5LSMA 4E2DA 4X3ZA 3CWNA 4O13A 1SR9A 4PFMA 1YPIA 3TJXA 3FOKA 3AO0A 1EIXA 5J5RA 2VFFA 4TX9A 1KM0A 4JY8A 3HB9A 2B4GA 3EB2A 1W37A 3PM6A 5FEWA 4MOZA 4MIMA 4JTTA 3IVTA 1MZHA 3IIZA 2H3BA 2GPTA 2PRLA 2HSAA 4IGHA 3E49A 5E93A 1TRDA 4Q4KA 4XTDA 1K7EA 1M6JA 1Q3NA 1QPOA 4GC4A 4NNCA 5AFDA 2C15A 3A21A 5J5DA 3SFKA 1J4EA 1G4SA 3QMTA 1FCBA 1XUZA 2CLOA 2FIQA 4FNUA 2NX9A 5DXXA 2QDHA 2E6YA 3QQ0A 4TU1A 3O8AA 4JX6A 1NAL1 3HGJA 4HSOA 3PBWA 1GVQA 3S5NA 4GWEA 4AHOA 2BWGA 5AN7A 3GKFA 2KZHA 2TRSA 5G4WA 5C5YA 3EX1A 2OX1A 4GNJA 1SU5A 4QM1A 3MHUA 3W7QA 3TC6A 3OVPA 3LLDA 5L9FA 4AHQA 3A5FA 1RVGA 2A0NA 3CM4A 1T8XA 4OHQA 1A50A 3LRKA 2R14A 3O63A 2ZZ5A 3FEMA 1JCMP 3QC3A 4O28A 4AAJA 1EWEA 2WNZA 1OG0A 1HL2A 4YXGA 1A53A 1DOSA
chains in the Genus database with same CATH superfamily
4GHRA 4IQDA 3ABOA 4RDVA 2XUCA 1Z69A 3KBJA 3V36A 3SSJA 1H61A 4ACYA 1WX0A 4CD5A 3QN3A 1F3WA 4GYFA 4QISA 3TJIA 1W1IE 1X1OA 3E2SA 2YBTA 1YBQA 4K68A 3E2VA 1K4HA 4A05A 3QSRA 3JZUA 4ZE4A 4PULA 3ZJ7A 1UASA 2WPGA 2CHRA 3CTTA 4WEVX 4BQ5A 1V02E 4AVOA 4O50A 1NOFA 1OYAA 1HJXA 1VEPA 4GISA 1XWYA 1YKWA 4EAMA 3CASA 4AMCA 4LC8A 4U5IA 3MA8A 2HNEA 3MQTA 1IZJA 2RDWA 1JUEA 3DC0A 3CO4A 4S3FA 3VOHA 4HCLA 3DOPA 1BPLB 4KIEA 4DF2A 3W1XA 1LRQA 3GZ3A 3LQGA 3CUJA 2D3NA 5HNTA 3TCSA 5JMUA 4DJFC 2R91A 4NL1A 1JRCA 4D8LA 5CC7A 4LVBA 2PF8A 4IIBA 4JN6A 2VXNA 3VNJA 1W5PA 2PTXA 2WAGA 3ISIX 1O68A 2YB4A 1EGVA 4ZQMA 4HPJA 4CQAA 1WA3A 4MNMA 2POZA 1HF6A 2V5LA 4YS1A 1WP6A 3B8DA 4GOAA 3QSTA 3DESA 2JE8A 3O9NA 3SCNA 5REQB 1JCYA 1KQZA 2ZUMA 5HINA 2UY2A 2WZMA 3SR7A 1XKJA 3BLEA 3D5HA 4MB3A 1PZ1A 1F6PA 4Q7NA 1G7VA 1JDAA 3ANUA 1GOOA 5BWFA 4C6BA 2QLYA 5AYIA 1YMYA 3BURA 3B3DA 3HIJA 3GO2A 2PC8A 4B2DD 3C2FA 1X6UA 1UA7A 1MW1A 1V3IA 4IP7A 2QKFA 1UQZA 4TV5A 1O12A 1SO3A 1J9YA 1JAEA 1KRBC 1AH4A 1EJWC 3NQDA 3I6EA 4Z0SA 2F84A 4LB4A 4XD6A 2GVYA 5CJ5A 4PCFA 4H9TA 2CYGA 3UWUA 5DMMA 2PSNA 5LA2A 1VLWA 4I8YA 4JFVA 1V7AA 2Y7GA 4AZ5A 3WELA 2WVSA 3KXQA 5ENLA 4HTYA 3NG3A 4CN4A 3EXTA 3HBLA 4LEFA 4MZYA 3TQPA 3FIGA 3R4IA 1UD2A 3FW6A 5PTDA 2HS6A 1C8YA 1P4CA 4DF1A 4UOJA 5CGQA 2BV9A 3B9OA 2H8ZA 1B5TA 4AB4A 4NXKA 3G1DA 4OWGA 1WAWA 5G1MA 1T40A 2YW4A 3ZR4A 1IXNA 3BJTA 4AIEA 1UQYA 4PUEA 1KFBA 2XN2A 3DFNA 3DKLA 3WBWA 2EF9A 5CQ1A 1TZ7A 1A5NC 4ZQCA 4GY1A 2D73A 3JU2A 2XIBA 3ITOA 3NQCA 1FCQA 3A4WA 1A47A 1NVMA 1E9LA 3RU8X 1OYBA 1KBBA 2QEZA 2XIJA 3TEVA 1W3IA 3CT2A 1YHTA 5A8GA 5LIYX 2ZRUA 3CMJA 4WDWA 3WQ8A 1QNOA 3UR8A 1GK8A 1OYCA 4IWWA 4BKNA 3CQJA 3BLDA 1US2A 4US5D 3USBA 1KTCA 1LROA 4XD3A 1XLCA 4JIPA 2W91A 4C60A 1VEMA 1CNVA 4YVPA 2X0SA 1E5NA 4NZJA 2OO6A 2AQVA 4LS2A 5A6BD 3MMDA 1EFZA 3IJ7A 4P8UA 3LENA 1UYQA 1HKMA 3TMQA 4CVWA 3VKCA 2DUAA 4AIOA 1CBGA 3HQNA 1VZWA 1LG1A 1M5WA 4GH3A 4EWJA 4WY0F 3GH7A 2J7CA 4JY9A 3A22A 2VZVA 4PRTA 5MF5A 2C7FA 2LLEA 3UJSA 1YTKA 3PJWA 2D2HA 5FAGA 3TP4A 5BROA 3VILA 3GLCA 2NVAA 3WLHA 5D04C 5GNXA 3T4CA 3FK4A 1K7FA 1VYPX 1OX4A 3R5EA 2IKIA 2A5HA 4AWEA 3TYZA 1JPIA 2VQUA 2ZX8A 4LAOA 4LBSA 3R0DA 1H1NA 4WY0B 4I90A 4X9YA 3SY5A 4LCSA 3DC8A 5A8QA 3EOOA 1E0XA 1QO2A 5I07A 3P62A 3BARA 1RALA 1EUAA 4KW2A 2PDJA 4LBUA 3NFUA 4IPJA 2INFA 4EK7A 1ZCOA 3OA5A 1XF0A 4MSSA 3UW6A 1KWGA 4L64A 3VIIA 1JAKA 1EX5A 2OO0A 1JVNA 1F4AA 4J3WA 2GFTA 4C6KA 1UMYA 3B06A 4AX6A 2YYUA 4YTTA 3PUGA 1MI3A 4JQ1A 1WZAA 3UZJA 1RPXA 5JBEA 4AEEA 2GWGA 2GDVA 2VX5A 3UG8A 5C2XA 1XRTA 3W1AA 3VUSA 3LDVA 1NF7A 3GNXA 9CGTA 2DSZA 1RAKA 3BLKA 2O4MA 2IPWA 4KEZA 3VKDA 5LIXX 2E8ZA 3UWVA 2VEFA 1JF5A 3AXXA 1KV8A 1U33A 4BZYA 1H5VA 4C5ZA 4V1XA 3S2MA 2Y6ZA 3ATYA 2NLIA 3OVGA 2CXEA 1Z42A 1ESWA 2IW0A 3HG4A 3GNDA 4G7EB 4TR9A 3EXRA 5TD4A 4W93A 2YLAA 2CZFA 1TO3A 4GX8A 4PRWA 3ZSTA 4F2TA 1PHWA 4NNBA 1AQ0A 4GQRA 2RDXA 3W7RA 3XIMA 3T2PA 5AHNA 2IQDA 4DJFD 1LL6A 3GM8A 4POCA 1ZGDA 4QG9A 8TIMA 4FK9A 1P0EA 3N13A 3W24A 2OFJA 1NDYA 1K02A 3AUOA 1KFWA 3CUZA 2AQWA 2QCMA 1SMAA 1V3JA 4DN1A 4TIMA 2H3DA 4GO8A 1XCXA 1F07A 1KB3A 3LHZA 2FGZA 1SW7A 3G5EA 3H23A 5CBJA 1F5ZA 3EDJA 4O1EA 5FJRA 1RV8A 3LXAA 4GCAA 4N2YA 2XN1A 3VC6A 3BAYA 1BG4A 4ZOEA 1V8EA 3OLEA 1KCXA 1A5BA 1W3NA 3ZXWA 2CESA 3KBWA 4C5YA 5A6KA 2OLAA 4KBXA 4G8TA 1SPQA 3QPYA 1GVSA 4HU0A 2QUVA 1R9YA 5KETA 3AYTA 2AL2A 1N8FA 1CXLA 1J8VA 4ZFMA 1OK4A 4FF7A 1K6AA 4X2PA 2QYGA 4ZQRA 2GVGA 3W2LA 2G3JA 4FIRA 4JX4A 3PBYA 4GABA 3WMCA 1LT8A 4HA0A 1W56A 3OG2A 2E9BA 2X8RA 3FXGA 4IH3A 2VR4A 1E6PA 3WQFA 3DECA 1KC7A 2G4JA 3KTCA 2DZUA 1FX6A 1UG6A 4M80A 3GC5A 1YIXA 1W2VA 3STPA 4UZUA 3KTXA 4NUWA 3W9ZA 3HURA 1GOQA 3R0KA 4X0NA 1F76A 3ZT5A 3G6MA 3ITXA 4X9SA 2Y8VA 4GLEA 5HAOA 1AK5A 1XCWA 1XLEA 4UTWC 4XVEA 1O94A 4LOCA 2FFCA 1KXHA 4AISA 1TJRA 3PJXA 4HHMA 4RLIA 5FJTA 4HZ8A 2I7GA 4UUIA 1BWLA 5T91A 1JUKA 3VYLA 4Z2KA 1K8XA 2FPYA 1AMYA 1E0WA 3MI3A 4UQEA 3AHZA 3RX4A 1NELA 4JQ3A 3LV5A 3KOFA 4GYPC 4C91A 2WWCA 1XDMA 3BPWA 1E6NA 2OT1A 2GJNA 3PY2A 2XGBA 1UPMB 4Q4OA 2NT1A 5A5WA 2V3DA 4KT2A 5IFTA 1CLXA 5DANA 4A8IA 3MMWA 3M6DA 5H8UA 2REQA 3IRSA 3W7IA 4JIEA 1KV5A 4JTFA 2J8FA 3CMFA 3UGRA 4BF7A 5JXQA 3CWOX 4BF9A 4QQ3A 4LNYA 4Z2IA 3OBAA 1JJKA 2RGLA 2CHOA 4O12A 2I56A 1XIBA 2GGGA 4FNPA 1QPRA 4B3LA 4AEFA 5D05A 1UW9A 2C19A 2WJDA 4K1WA 4GVHA 5I3KA 3F4WA 4GUGA 4NIRA 1AMKA 3NQFA 3P61A 1HX0A 4JIHA 4YYCA 1BG9A 2CLIA 4D1JA 2YXXA 4A3RA 4ZXOA 2JEPA 4DQWA 1VAHA 5DN1A 3ABXA 1XPYA 1XPGA 5G2IA 1T96A 5D2YA 1H5YA 2PP3A 1S2AA 1B90A 3KOYA 2PDPA 4TTGA 2E4TA 1N8WA 2P53A 1XH1A 2B7PA 4IICA 8RUCA 3CUHA 5HWNA 4V1YA 3VGEA 3UWWA 2PRHA 4F66A 4E38A 2QJHA 1QAPA 3UPWA 1A4MA 3DBPA 2WSRA 1W9VA 3G77A 1C91A 2J62A 2EQDA 4AZ7A 1RLCL 2P50A 3SB0A 4JIQA 1XIFA 2ODOA 3LCIA 4XZHA 4E8GA 2VJXA 4C6PA 3UZ5A 3GHRA 3PS7A 3O6DA 3UJFA 2X05A 1LF1A 4LTSA 2DZTA 1H60A 4ZL1A 4JTLA 4J3TA 2V3EA 3VCRA 4Z2HA 3W28A 2X16A 3EX4A 4M6PA 1ZFJA 1RR2A 2ZRXA 2CLPA 1QO5A 1VIZA 1N7KA 4HD5A 3ZYZA 4AY1A 1VFHA 3LB0A 3NAVA 1EJRC 3WNOA 3DEQA 3DXIA 3MC5A 4MAVA 3W7PA 3GDLA 3TZNA 5I78A 3GDTA 4HJWA 4TX6A 2BODX 3S1UA 4H6KA 2VFEA 2Z27A 3GG1A 4ZOCA 1UWRA 1UBPC 4KRTA 3M0IA 2ZCGA 5EPDA 3BCDA 3GNRA 2OCZA 3KCLA 1A0CA 1VBJA 1AD1A 2QJGA 3W76A 1BTCA 7REQB 3RCNA 3H53A 4OFCA 3EOUA 3PG9A 4RE2A 1VYRA 3P14A 1U2YA 4M51A 3TUUA 4UTUA 3EWUA 1SGJA 1LP6A 2VI0A 3EPOA 1E6QM 2G8ZA 4QLKA 3WNPA 4ZO8A 3KVMA 1NDVA 2RDTA 4U10A 1QNQA 3PZ9A 2OKOA 3CLMA 3E1F1 3N11A 4KKXA 1UD8A 1R3RA 1E6XM 1P7TB 3DX5A 1BLIA 2WK2A 1A3XA 2I57A 1W6TA 1JPDX 1WPCA 1YPFA 4MJ2A 1W1TA 2C79A 1DJGA 1K8YA 2XPKA 1WXYA 4BWLC 1J01A 1BVNP 1F6YA 3GXTA 2WKGA 4I7WA 4WXZA 1QMLA 4HOZA 5HPOA 1V3MA 3TWAA 5B80A 1W9PA 4RKAA 2TPSA 1KR0A 4NRSA 2DJXA 1C8QA 2CBVA 1EZ2A 4UQAA 4E8DA 4O0KA 4M56A 3Q58A 1YXCA 4M3PA 4ZOAA 4X63A 3WQ5A 1AJ2A 1EA9C 4YU1A 2DV0A 3A3HA 1M3UA 3FJ6A 3S2LA 2I5GA 3WLIA 3ZM8A 3N17A 1ODZA 3KHJA 4OE7A 1UUMA 1VFMA 2OG9A 2QF7A 2BGNE 3I3EA 4LQ1A 3DHFA 4DO6A 4GZJA 1VJIA 1YRRA 3DFSA 4RNHA 5EB8A 3VE9A 2IXVA 1WE5A 3DYOA 3KVJA 1O66A 3CT7A 5D8ZA 1TREA 3PSWA 3OGVA 1LBLA 5F4XA 5I09A 1PEZA 5HATA 2V9DA 2Z1XA 3AWNA 5I02A 1ELSA 3SI9A 3VKKA 1F7BA 3GBEA 4P7NA 3CB3A 4S23A 3MT1A 1J0ZA 3I3DA 3DFYA 2YW3A 3URQA 1LWJA 3CV6A 5AECA 3NURA 5BU6A 5C54A 4RCXA 1DE5A 3ZWTA 2PWUA 3CEUA 1DWIM 4XZWA 1C9WA 1XIEA 1IGWA 3ANYA 3KTSA 1EJXC 5M5DA 4CQ9A 4HU4A 4NZ3A 1A5LC 1BF2A 4ZBCA 2ZUSA 3UYCA 3TFCA 1XD1A 4O1CA 1Q85A 1Q2RA 3OBKA 1GZJA 1XM3A 3GZAA 5CC3A 4EE9A 1S5VA 2WSKA 4IFKA 3UWYA 3TCEA 4IX2A 1DXEA 3W02A 3VCNA 1ENUA 1XX1A 1E15A 4I9AA 4Q8MA 4AVFA 3W2NA 3HFYA 4W8LA 4CQBA 1DIDA 1JQVA 3PC0A 1CLVA 5ABFB 2EBNA 2GJRA 2F61A 3SN4A 1VKFA 1JCXA 3O6AA 4BQ4A 3AU2A 2J6VA 2WWDA 4ROQA 4TX8A 4UCGA 3G6LA 3REQA 1ECEA 1KFCA 4O17A 2OELA 5IDZA 4O1BA 2C14A 1IEWA 3UXKA 1JXJA 5GVJA 1W8SA 2HE5A 2GVJA 3S5OA 1X8FA 5JBDA 1RJPA 3ZVIA 4DLFA 1OFDA 3C5QA 3COTA 3POHA 2PCEA 4UZSA 3RPTA 1MQPA 5HWJA 2WPBA 1E9YB 3TSBA 4ZQOA 1R7OA 2ZVRA 3SCRA 4LX4A 1TR9A 2YCIX 4XZNX 2IPGA 3VZXA 4JYFA 4D9PA 1LZOA 2PTDA 4U5KA 5HNUA 4DWSC 3N2XA 3B0XA 4O53A 1U22A 4PCTA 1UR1A 1WUFA 2NV1A 4GCXA 2I9UA 4AZBA 2E6DA 2QJNA 2E25A 1W5NA 2EPKX 3EMZA 5HUOA 1O1ZA 1XICA 3M4HA 4M1BA 1U1HA 2IUZA 1FP8A 1IQ8A 5FI8A 1NTHA 3IRDA 1ODUA 1YXDA 2QPSA 3SRFA 3V3WA 3MI2A 2BOGX 3UR2A 4A2RA 1F3XA 5GNZA 5BW6A 1XLMA 3ONBA 1QWKA 3O7UA 1S46A 1QDSA 2ISSA 1H50A 2GWNA 4GPNA 2ZZ1A 2V38A 3SCTA 5EU9A 3PTMA 3EPMA 2BP1A 3EA1A 1UOZA 3BGGA 2YIHA 1W1PA 1E3XA 3V5FA 1QI0A 2P10A 1GOIA 3GD6A 1KCLA 4B92A 2YOCA 2PDMA 4UMAA 1WKYA 5JH1A 4MUPA 2QMKA 3AMGA 4XIAA 1EA0A 3OZYA 3EKZA 1TCDA 2TYSA 2RFGA 2HISA 1EB3A 1FWFC 4XTIA 3STFA 3GH4A 3I7RA 3RMEA 5C2CA 3HPZA 2Z2BA 3CUXA 2PI6A 2XISA 2WMKA 3UR7A 1P0NA 1EXPA 1OFQA 4XIMA 3H2EA 1GJWA 4UR8A 4ATDA 4MDOA 5D37A 1GORA 3G1RA 3QV6A 4JS3A 3C0SA 4PE8A 2ICSA 4D2JA 4L61A 3IK4A 1XDJA 3ARQA 4QR6A 3VKJA 1BXBA 1Y7VA 3GVGA 1GONA 5TQLA 1AW5A 4GXWA 3OG3A 5LIKX 2WZIA 3RX3A 1XBXA 2XVPA 5T8GA 4HN4A 1POKA 4L4OA 3WEZA 4O1AA 1SJBA 2HPIA 3NZRA 1YE4A 2A3BA 4FPSA 3RM9A 4AD1A 4L7ZA 4WJ8A 4F0MA 2CWNA 2R1LA 4QGCA 1HP5A 2OGYA 3ZS4A 2H9AB 3WF4A 4DZ5A 3T1GA 4JYDA 1PV8A 4IIGA 1QK0A 4M29A 4XV0A 1NQ6A 1W8GA 1XYFA 3M07A 3STGA 1D3CA 1RJQA 4LH8A 5I5RA 3HJEA 1M04A 1VENA 1Q7MA 1YDOA 1UP2A 1WZLA 2W0UA 1U83A 1POJA 3KOZA 3L2MA 2DP3A 5C9UA 2Q02A 4GQBA 4JTAA 1FHVA 2HMCA 3CJPA 2ZICA 3MSGA 3SRKA 3NQBA 1HW6A 1WV2A 1VHCA 1SO6A 4RZ5A 5U4NA 3OYZA 3UPMA 2NV2A 3GR4A 1LL4A 3BOXA 3LXBA 2BX7A 4HCDA 4JDYA 3M16A 4UTTC 3P74A 1CDGA 3LY0A 4EWND 4Q4MA 3RPDA 5AC5A 2OT0A 3NO3A 1WZKA 4AQLA 3SADA 5ECUA 1L8NA 1QOQA 2V82A 1I6NA 3WLJA 3U0HA 3A9IA 4Q4RA 5E70A 4ZTXA 4JXCA 4LEQA 2ZZ4A 1ONEA 4ZB0A 1PYMA 2VT0A 2FMNA 3TWBA 1Y0EA 2AKZA 4GK8A 1Q7QA 3K8MA 3G18A 4Z2LA 3M47A 3UGVA 1B3OA 3H2AA 4F0HA 4YL2A 1XXXA 3WNNA 2VRKA 1LQ0A 3B05A 4M1RA 3TYUA 2FH8A 1V51A 5FF2A 4XAYA 4DYJA 2IPJA 3C2RA 3QPZA 2EG8A 1LM1A 5I06A 2DIKA 4UWMA 2QZRA 4V28A 3TONA 4LUTB 2E9LA 3RX2A 3WUFA 4Q8QA 1A5SA 2J74A 2OQHA 4LC6A 4WR3A 1DWGM 1SSDA 2CITA 3GTXA 2JIEA 3AHTA 2XIQA 4WOZA 3R2GA 1E56A 4B5SA 5BXTA 1VEOA 3WH8A 2XN0A 4CKQA 3VDGA 4GZ7A 1XYBA 3K5XA 4C6DA 1BYDA 1SW0A 5D9OA 3LI0A 5EL1A 3W7EA 3KOXA 3A47A 4MHBA 1IR1A 2FHFA 5CKSA 1WDQA 4UXDA 2ZKMX 1F61A 1WO2A 3N4EA 4IGSA 3UD6A 3EB4A 1R38A 5XIAA 1QOXA 2DDXA 1R3TA 4AZCB 4WKHA 3CPUA 3NO1A 3SGGA 4E3TA 4ZR8A 8XIMA 4P2VA 4AIBA 3GDBA 3ZLHA 3QHNA 2DT1A 1PZ2A 1DVJA 4S2CA 3AZSA 1OJXA 1FA2A 4AW7A 1ISXA 3IJIA 3W7GA 1UR4A 4XQ6A 1OB0A 1JGIA 5HJYA 4B5UA 4H3DA 2NQLA 3WD2A 1ZL1A 3A3WA 1XHGA 4JQAA 4XISA 3W1QA 3NL5A 4MWAE 1F05A 1QNRA 4R3UA 2VQTA 7ENLA 3FVDA 2HV5A 5C9RA 2BGSA 3BDKA 3WQPA 1I45A 3D47A 4XKMA 5EA9A 4HA1A 3FSTA 3OOQA 3MUIA 1D8CA 1P5BA 4I5XA 3P84A 1W91A 2TODA 3MY9A 3UVAA 2QT3A 3OZMA 2PURA 5EMKA 3RFAA 1MDRA 3G22A 5CSSA 1XBYA 2NXHA 5CGTA 4XX6A 4PGLA 2PE4A 3LV6A 1EPVA 1TJ1A 4PMOA 3GU2A 5A3HA 1EO7A 1V3HA 1XLKA 3QTGA 4NSBA 4I3GA 3S5ZA 3K4DA 1V6XA 3DI1A 3VNZA 3GUGA 5LNVA 1P1XA 3R43A 4PMVA 1YNPA 3VCCA 3B8WA 3U2EA 1GVOA 4FB7A 1OX6A 1CTNA 1XH2A 1M7XA 1JI2A 4ML9A 2YCEA 1C29A 5REQA 1RCQA 1DIEA 2WVTA 1UP0A 5IBXC 2J27A 1XQKA 3EWWA 2WMFA 4GE8A 4JTCA 2W9MA 2F9RA 2PAJA 1ZAJA 3PUEA 2R1NA 3HU7A 1L6FA 2J7FA 1SR9A 4O13A 2PLKA 3N4FA 5J5RA 4TX9A 5JVLA 3HB9A 7PTDA 2F2HA 3OB8A 1KRCC 3PM6A 3VGHA 1P6BA 2E8YA 1PKMA 4IGHA 3B9DA 4JL1A 4KESA 4TTUA 4EANA 3SAZA 5E09A 3OLDA 4B4HA 4CN6A 1QPOA 4D6HA 4NNCA 2YXOA 4DUWA 4NZCA 3NZGA 1Y65A 1NIUA 1ISWA 3WEMA 2KX9A 1S2TA 2JEQA 3UCDA 2VC9A 1J4EA 1T7LA 5B7ZA 1OINA 1XUZA 1Q4NX 4R5EA 3ITTA 2QDHA 2VCBA 3QQ0A 1KKRA 4JN7A 3HGJA 4HSOA 4AHOA 2BWGA 5AN7A 4ERAA 4I6KA 4OTKA 5E9XA 1L6GA 4P8XA 3ARRA 3OLGA 3MHUA 1JDDA 3OVPA 5L9FA 2W66A 2Q09A 2C1IA 2F6KA 4M82A 3WZ0E 2ZZ5A 3FEMA 2VDHA 1V93A 4YXGA 4J4KA 4NYYA 4L6HA 1ML1A 4MZ8A 3H55A 4LFYA 4IISA 3PVFA 1H49A 3AIEA 1J11A 2DFAA 3NPWA 3QZEA 4J2PA 4FR6A 4EIVA 4OBRA 4WX2A 1BD0A 1XQLA 4GKTA 4GO9A 4KS0A 4DBDA 4MNKA 5MHBA 3IJDA 3BQ6A 2X1UA 3V4BA 1OX4B 1VS1A 1H1ZA 5F2IA 3TJ4A 3W6LA 1E6ZA 2CBUA 3CLWA 3W07A 1PAMA 3W6YA 4ATWA 1XSIA 2I16A 3N34A 4DUOA 4UTHA 3RHGA 4ZGYA 4N4QA 3W86A 2XH7A 3NYDA 2E5DA 4C6OA 1G6CA 6REQB 2O55A 2YGYA 3FXYA 4DZIA 2VL4A 2Z1VA 1Q6CA 2J9ZA 4H41A 3GC2A 3A13A 1KGXA 2BXVA 3NXFA 1W3LA 2DZWA 1JCJA 2YX0A 1RH9A 2GYIA 2FB3A 1FY6A 5C70A 2CLEA 1RQBA 1S2UA 3H6OA 3WN6A 4LY4A 3NQ8A 3R12A 3KP1A 3THDA 4DUVA 4PMNA 1TV4A 3N2TA 3W7KA 1A4LA 1NWTA 3W29A 1FRBA 2FZ8A 5AHEA 3CZGA 4WY0A 1KCZA 4PC8A 3I68A 1EHAA 2DZXA 2ZXBA 3M7WA 3MMUA 1MEWA 3JW7A 3OA3A 2VTFA 1MEIA 1O5KA 2OJPA 3GXIA 3QY6A 3RR4A 3FA5A 3HG3A 2V68A 3JRKA 2FMOA 5A6SA 4JTRA 2X0YA 2QXWA 2DU2A 1DTUA 3IIOA 4NI3A 3CZEA 3I6RA 5FJUA 3R8HA 2EEXA 2NWRA 3CUGA 1OK6A 1BTMA 2VWTA 2G37A 1I0DA 1XD0A 3ITLA 3GWQA 4M6UA 3CYVA 1PPIA 4JFSA 4PUUA 4QTGA 3NTYA 4QSHA 3FY1A 3PWIA 1Z6KA 4CNOA 5FF3A 2NUYA 2Y61A 3R8GA 4GD0A 4GZEA 3WLRA 1JUBA 2EPLX 1KKOA 1YNQA 4GIEA 1D2KA 5DX7A 2YPIA 4HTBA 3SURA 1JZ4A 1OM0A 5K2ZA 5D9MA 1I1WA 4I7VA 2XFFA 2VZTA 3QKZA 1HJSA 3E0IA 3WMBA 3BZJA 1IXOA 4G7EA 3IWPA 3PAJA 3RLVA 3A6OA 4ZO6A 4IL2A 1XRFA 4K1GA 1EQPA 2D0GA 4RPPA 1HQTA 1QI3A 1XYAA 3DKJA 1G4TA 2WVVA 1G01A 3VKAA 3RUBL 1OADA 3B0UX 4K2SA 4ZE5A 3U5UA 3CV1A 2AL2B 3HQ1A 4GI9A 1OF6A 4ZVJA 4ZCWA 3MKKA 3FLUA 4UR7A 1XSKA 1XCFA 2Y85A 2UZ9A 3BSMA 3TU9A 1B30A 1UD6A 3ZJ8A 4LF1A 4AC7C 3WQEA 3S9YA 1JYXA 1JR1A 2D23A 2FZDA 1ISZA 1DEDA 1OFAA 1W3KA 1MSSA 3SIMA 3BMWA 3W7CA 2R9RA 4D6CA 1EO5A 4H19A 1I9CB 3VD5A 1ADOA 2QDDA 1VPXA 1EC9A 3VD7A 2V5CA 4FA3A 3POCA 4GIRA 1NFPA 4QDPA 5BZAA 2O7QA 3M5ZA 3W71A 1HJVA 3WD3A 3GVRA 3F2DA 2PLMA 3NWRA 2HK1A 4MKVA 1E1CA 3HV9A 4RR4A 1OFRA 4HA3A 2P76A 3WF3A 3N12A 2W61A 2Z1KA 3MUAA 1E51A 4PMUA 2VCAA 4YHEA 1JD9A 3HA1A 1QNVA 1LUCB 1JDCA 4JTJA 1G4PA 4F4RA 2J13A 1RBAA 1FHLA 1GYNA 2Q3OA 1MFVA 3EWDA 4W5ZA 4IIDA 1P6CA 2YB1A 2FPTA 3TVAA 3EDDA 2W5FA 4LWWA 4LB3A 1IXQA 3EZ4A 4H9VA 1AA1B 4LS0A 4QJ3B 4U3CA 1M03A 3ARTA 2BHZA 2OZTA 2BTMA 3IVUA 3DENA 1PBGA 4JN8A 4IUOA 5AC4A 4AXNA 3DN5A 4WCJA 5A6AA 5C8BB 5BOOA 4C6MA 2RKXA 1SQ7A 4FXSA 3ZJ6A 4FP1A 5BCAA 5I79A 2REQB 3LLXA 2XIMA 4HU3A 3QZ6A 3AHYA 1EYWA 3QYQA 4IF2A 1B3XA 1TFVA 1CX9A 4UTKA 3DFOA 3WDPP 3V18A 1G94A 1SZNA 1M7OA 1LOLA 3LERA 3NQGA 4Y6GA 4O10A 1GWJA 4LU0A 3K1GA 4Q8TA 1PCKA 4MF4A 3RGTA 4OQVA 2BVDA 1R7AA 3N04A 4WJEA 3ABZA 3L7RA 1V02A 1XJBA 2XFRA 1J6PA 2B7OA 4CCCA 4Y9NA 4A35A 1RXOB 3NEVA 6ENLA 1FVPA 1MQQA 4FMVA 2V67A 3QTPA 5D03A 3EOEA 2CKSA 3D3FA 3PPGA 1Q6GA 3VIMA 3W3OA 2QAPA 4UTJA 2XH2A 2J77A 2XVNA 3A24A 1DXIA 1R3QA 1TE1A 2MUCA 3LZ3A 1AZ2A 2O7SA 1OCBA 4OJYA 1EJVC 3MO4A 1FWEC 3W1NA 3KRSA 1W0MA 3LTSA 3VD3A 4LUJA 3INPA 4AIUA 5E0FA 1FXQA 4WQ6A 5AVHA 2AOSA 4OV4A 3L12A 2YYTA 1UUOA 3VFLA 1LDCA 1JF6A 1VFUA 1DORA 8XIAA 3O16A 4UIOA 2C3ZA 1TWIA 3SUTA 4XUGA 1JGMA 2HNHA 4YTRA 3T8QA 1UUQA 5BOEA 2Z24A 3BO9A 1HL8A 2DSWA 4YJ5A 5G4EA 4PCSA 3R7MA 2XVGA 2E40A 3IV8A 3RLHA 1E1EA 3RO6A 3USZA 4WZHA 2J47A 1KTNA 2PRMA 4ZFCA 5C71A 3W38A 3OEXA 3TYDA 3HO8A 4AYSA 2VGIA 3FDGA 3UVIA 5I6SA 1DQUA 2WKLA 1XH0A 3PF3A 1E70M 2YBVA 4F9JA 2PDGA 1DKWA 1UZ1A 2VD9A 3QZAA 5LGZA 4AD3A 1NEYA 4PMQA 3SM0A 3RDKA 4UR9A 2G3IA 5ABEA 1UCWA 1XYLA 4R88A 1W1B1 2HJPA 4X22A 4NAEB 1EP2A 2EXOA 4UBPC 3CHEA 1R0MA 3NUKA 4W7VA 3MANA 4O54A 4QXIA 1TUFA 1KFLA 4ECLA 1XLFA 4D6EA 2J88A 1E0VA 4D6FA 4HK6A 5FEXA 2VKZG 1UIOA 1UR9A 1JULA 3QEZA 4HMNA 4UFKA 1XP3A 4OIFA 1M01A 3W2MA 4CUCA 1QTWA 4K8HA 4J9JA 2QMJA 4UNKA 2PCQA 3BAIA 3DZ1A 1OGGA 1V6UA 4XAZA 4L4PA 4W89A 4M81A 2D22A 4DJEC 4H01A 1OY0A 4S2BA 3IUIA 4NXSA 1HTIA 3IGXA 2ZXAA 4HCHA 3ITVA 1CZ1A 2BS9A 2ZX6A 3LZ5A 3K46A 1QR7A 2FGLA 3BLPX 3CL8A 2PDHA 3AXKA 3L4ZA 3FVMA 2XSAA 5DELA 3E74A 5LHFA 1JNDA 1SFLA 2R6OA 2WVUA 5BU9A 5A2AA 2ZUNA 1DYSA 1TJPA 5KZ6A 3BAXA 4MAZA 2I5QA 2R1KA 2Z6JA 1XFBA 4TUFA 1ZBKA 1R3WA 3QLLA 3W4RA 1BKSA 1MQRA 3DDMA 2PDYA 3OQEA 3IV3A 4TVUA 4MTVA 2XWEA 2PWFA 4S3GA 1UD5A 2BY1A 3JUGA 4Q8WA 3DYMA 4RNIA 4U3AA 2Y2WA 3CEPA 5CPOA 4AD0A 4UFHA 3B8IA 3OQ8A 2Y88A 3NM1A 1AUSL 1GKRA 3NGJA 2QJMA 3QY8A 1AZ1A 2V3FA 4LYRA 2OWCA 4UTMA 1EUNA 5AHIA 3QW4B 5LNSA 5FEZA 1B0IA 1PTAA 4L6OA 1OQFA 4UFLA 4H7VA 2E1DA 2GZXA 1Y5XA 3C6CA 3NXLA 1FKWA 2HEJA 4JQ2A 1VC4A 4NJKA 1TWSA 5K9DA 3GHUA 3AMLA 2OKTA 4B5WA 1B1YA 3DHDA 2PDWA 3EEZA 4QNWA 4F79A 2OZ8A 1IT0A 3GK0A 4IFKB 7ODCA 4AHPA 3ZT6A 3BG9A 3KRBA 4CQ8A 1QPNA 4FO4A 1KLYA 2GUUA 4FX8A 2DIJA 3KE0A 1SZGA 5HNRA 2EGZA 2ACQA 3CK5A 4YWIA 1ONWA 3CXOA 2VEKA 3LM3A 2W4XA 3PULA 4QFUA 1MWOA 4QG6A 3MUXA 5JIWA 3L5MA 4INFA 4IQEA 2V2CA 2CHNA 3N73A 1EDQA 4GVGA 1ZJAA 3LHWA 4PYSA 4H9XA 1WCGA 3B9AA 3LHTA 4MJ4A 3WQOA 3CV2A 3WKZA 2Y70A 3WQGA 2WJFA 5GPRA 1KFKA 2FGBA 3G2GA 3GG0A 3H4GA 3W2KA 4JCLA 1EXBA 4NILA 2Z4GA 1DIOA 4P7LA 4I8DA 3TSMA 1PHQA 4C6LA 3LBMA 3SQMA 1RP9A 3PPCA 5ABFA 3AI0A 1XIJA 3MZNA 3N18A 1L6YA 2YA1A 3D46A 4Z1AA 4FAMA 4TO8A 4JTIA 3NO5A 2O92A 1I2NA 3BCJA 3QV8A 4LXFA 1GQKA 2EPMX 4QJ1A 4RXGA 4B9ZA 1B3VA 1QNPA 3Q94A 3TNBA 1FH8A 2QNEA 2QAFA 4PBEA 3CC1A 3G24A 3PWAA 1R85A 2VWSA 4MB1A 2IQ0A 1O5XA 3UPBA 4LF2A 3BSHA 3H7UA 4DBSA 4O1DA 1OIMA 3SCOA 5E1QA 4H83A 3DAQA 3N15A 1LL7A 1VBRA 3TTEA 1DL3A 3NZQA 1O7AA 4AYGA 4W8AA 1K8ZA 1CXEA 1UR2A 2OYLA 3SO7A 4I5RA 3MCNA 2WLYA 3U5YA 1X97A 2CW6A 2YA0A 1XYZA 1W3JA 4E6MA 4MDPA 5EMYA 1ZU8A 2FTWA 3WNKA 3VTRA 3EMQA 3MDWA 3ZLGA 3QGKC 4XBKA 1PX3A 3GG7A 2L5HA 4F0RA 2BNJA 1QW8A 1EL3A 3BLFA 5DCBA 3M0XA 4PH6A 3RO8A 3R11A 3G1SA 2OXNA 1ITQA 4MNLA 2BB0A 5DFAA 3S9IA 4R9XA 4FZIA 4XZBA 3LQLA 3DCPA 1K7XA 4DRSA 1CGUA 4XO6A 1O5QA 3N25A 2PU1A 4JL2A 5DMNA 2BOFX 4R34A 3O15A 2E1WA 4AD4A 1LG2A 2WBKA 2P3EA 4H9YA 1J2BA 3KS5A 5HR7A 2FHBA 1VCGA 2WMJA 4XZ9A 1KGUA 4MYXA 2Z6IA 6CGTA 1UJQA 4Z17A 4B9YA 3PBMA 4PCNA 5B7YA 2HPMA 3GX9A 2Y0FA 1CXHA 3QOKA 1PTGA 3L4YA 1F3EA 3WL0A 3UY8A 3SCQA 4NZ4A 2Y7DA 4FOKA 3TAOA 4KWUA 4IXXA 1W31A 1Q4WA 4Z1YA 2R8WA 4W85A 3P82A 1U30A 4JTSA 3TAKA 3EXSA 3UNDA 2WC3A 3LHUA 2YDAA 4S3BA 1GQLA 3VVGA 2PWVA 3NDYA 1IXPA 4P8WA 3ITYA 4PN2A 4JR5A 4PZVA 1IV8A 1VD6A 4LCRA 4NG3A 5GJNA 2V63A 1V0LA 4LUSA 4CCDA 1SO5A 2B7QA 4EPBC 2OYKA 3M0LA 4H9ZA 3II1A 2CFFA 1W17A 2ZDSA 1A80A 3W01A 3DG3A 3WSUA 2X0HA 3MPGA 2G97A 3WEOA 2PDNA 4BI5A 4MKNA 1KM2A 2PDIA 2QCCA 1JZ3A 3QFEA 5LHEA 3N9SA 3AJXA 4X2RA 4A29A 1XGZA 3NSXA 3PAOA 1CGXA 2EG6A 4IIFA 1JCTA 3BMVA 4BI7A 1ALDA 1US3A 3T78A 2BLEA 1S39A 3R79A 1P0KA 1ZLPA 1RA5A 3VD9A 2NX3A 4W87A 1EGZA 4P61A 2OSWA 1PWMA 3AYSA 5AYXA 2HTMA 5HMEA 3RRAA 4MZ1A 3W1UA 1UOKA 4ORIA 2H9AA 5FF0A 1THFD 4QNEA 1VFSA 1H7XA 3EX6A 4EF8A 4UQBA 4BWLA 4QS6A 2XFYA 3BW4A 1OD8A 1XYMA 3NQEA 6ALDA 2A7RA 2ZXQA 3S1GA 4F0SA 4AXKA 4HSHA 1J18A 3W37A 2DY3A 4W7WA 2DH2A 1NP0A 3PB2A 1I2QA 1X38A 1XGDA 3AHVA 3CIWA 5A8OA 1CXKA 1BQCA 4DAFA 1A5AA 4ICMA 4IMFA 1Q13A 3P0XA 5BMWA 3B0PA 2HE8A 4NJHA 4AWTA 4V2XA 2V2DA 2G50A 5CC6A 4DM1A 3NQ2A 9XIAA 3ORWA 1OG6A 4K3ZA 2E6AA 3BICA 5E0KA 4B90A 1FCVA 3KL0A 4PUJA 3TYEA 1ONRA 2QQ6A 3HPAA 3WJXA 2B31A 3AS2A 5CC5A 2AAAA 4CVUA 3LGEA 4F2UA 3WLOA 3DI0A 3RPMA 3UU0A 1GG0A 2QV4A 3WJZA 1W1ZA 3OP2A 4KFNA 3ABSA 2GUYA 1MUMA 1W9BM 2VFGA 2OSXA 5E9AA 3H22A 1TJ0A 5LNUA 3NM3A 3QR3A 4Q7IA 2P8BA 5C0QA 1MXSA 3URNA 1KCKA 4LUTA 4H6EA 3RU6A 3MDUA 2FKPA 2ZUWA 3Q45A 5DCDA 1H63A 1SZRA 4HHPA 2YZRA 2QPXA 3K2GA 4R85A 2F8QA 3VIKA 3IUDA 2W3ZA 1HJUA 1G1YA 5CEWA 3AISA 5K9XA 3W2JA 4HPXA 2R1MA 5C9XA 1TR1A 1V6WA 2B0MA 3WIJA 3P5ZA 1XIHA 3P80A 4HMCA 3W82A 3T07A 3TQKA 3R8RA 5H8PA 5AVNA 4L4LA 2GLKA 1BYAA 1H7PA 2NQJA 1I2OA 4AZCA 5FSEC 2Y8UA 2PB1A 3LHYA 4N0RA 4IMGA 2E67A 1BSIA 4ERGA 1GG1A 3SIZA 4WSKA 1TVNA 4WGHA 2GJXA 2INZA 4M7TA 3MBFA 1ICPA 3W7MA 1XS2A 3EA3A 2WHMA 3KDOA 4H8UA 4O8AA 4TXEA 2XVKA 3CAKA 4ICNA 4L80A 1VFTA 4JNMA 1QCWA 1QWGA 4MKSA 1NF0A 1R47A 1W32A 1Z89A 2ZVIA 3VXGA 4GINA 5AYZA 4YCOA 1K6WA 1MXDA 2DT3A 1WXZA 1QATA 4CNTA 4W84A 3WD4A 4NAFA 1DJHA 4GA8A 5AHMA 3SY8A 4HZ6A 4DWSA 5KSWA 1JZ7A 2ZC8A 4EPDC 2NXIA 3MWAA 1FWHC 3THUA 2VDGA 3TV8A 3PB0A 4YTUA 1VPYA 2IXUA 2X2YA 4UMBA 1V6YA 6A3HA 2DT0A 1O6IA 4KFOA 1X98A 5A8NA 1DTNA 1TYGA 2XDFA 2ZADA 2AAMA 3B0VC 3L23A 4XBJA 3SY1A 3MKVA 5C7HA 4AFYA 1W5OA 3S1XA 3QQWA 1US0A 1W1YA 5K4ZA 1CGYA 1VH7A 5FL0A 4BY3A 3F4DA 5A2BA 1AG1O 4G2DA 3E12A 4RXFA 4CD8A 1DV7A 2O56A 1XYCA 1GPFA 4Y9MA 3WENA 1J5TA 1VFFA 2WQPA 4QLJA 2P0IA 5D2TA 3RXZA 5F7UA 2Y7EA 4Y8FA 4HNOA 2DUXA 4NY2A 1QFEA 3NL3A 1IHIA 1OCNA 2ZUUA 3RN6A 3B4UA 3LPGA 4IUGA 4A3HA 2OQYA 2RDUA 3VO0A 2XSXA 1TV7A 1XUUA 4QAIA 3FKKA 4JIIX 2DQXA 2OQLA 4H8VA 1SJDA 1PX4A 4HGXA 3IS4A 1TELA 3KW3A 3LCGA 4FALA 2A7PA 4QE1A 1FWTA 4WOQA 4TV6A 4BA0A 2OGJA 2X7WA 1ZSXA 5I0DA 5JQ9A 4YN5A 1LLZA 3PZGA 1G5AA 3P81A 4BEUA 5HQLA 2CU0A 3BOFA 3NEHA 3GDKA 1Q8AA 2WHLA 2CCRA 5LXEA 3W00A 3WUEA 5C9ZA 3FYPA 2TSYA 2XSBA 3HPSA 3H2MA 4ZB2A 1T8QA 2ZRYA 5LIWX 2E5CA 5CPSA 4PSPA 4QEHA 2Q8XA 4H9MA 1KM6A 3CV7A 4TQTA 3CH9A 4LAKA 2Y62A 5TBOA 1V6TA 4GNVA 5HPCA 4HNTA 1BVZA 2F2KA 1ZAIA 1UIPA 2NT0A 3U2OA 1EQCA 3O6CA 1SJAA 6PTDA 2Z1BA 4JGDA 2NSXA 2PDCA 2ALRA 4QCEA 3H4WA 3ITCA 4JFUA 3KX6A 4FOUA 3VIJA 2C0HA 3LSBA 1U5HA 4ZOBA 3AJ7A 1FWCC 3QRHA 2TAAA 2Z2UA 3OW1A 1KWKA 1KD0A 3AALA 3G1XA 3L4TA 2Z28A 2VFIA 4C6FA 2OWWA 2X7VA 3V1HA 3N2OA 2HWGA 5LYRA 2BVTA 4KMQA 5CPLA 4FX7A 3B8UA 3CH0A 5E0CA 1M7PA 1S5TA 1K77A 2WM0A 5DT5A 3D3AA 4S3EA 1TPDA 5I7GA 3PHAA 4GFIA 4S3JA 1QK2A 3AROA 4H4IA 4G1KA 3E5BA 3V16A 5HBFA 1FWJC 2PGEA 4PB4A 3WBXA 3PBGA 3N3MA 2NSOA 3W81A 3M64A 3I6TA 4PBGA 5H2ZA 5EBUA 4H2HA 5AC6A 5FSDC 4G5DA 1XFCA 4V15A 2WB5A 2CLFA 2J7HA 1FHUA 2XU2A 3TJLA 1KXVA 4LRSA 2HK0A 3CL6A 4UTTA 5CPNA 1LQAA 3U2ZA 1DPMA 3W2UA 4PMDA 2XGZA 1R6WA 4MMWA 6REQA 5DMYA 3FJNA 3WBEA 3LTYA 4O14A 3L0NA 1RCOB 4PTWA 3VOIA 3KBNA 3U8GA 2HVOA 1XLLA 4ADUA 3L9CA 4U31A 3N9KA 3IGHX 3C3UA 2YKKA 3IIVA 1XLJA 3WCZA 2DQWA 4E4PA 4LVAA 3CIVA 4Q7BA 1SFJA 5E6YA 4KRUA 3QFWA 2WSPA 1RBLA 3FAWA 4PEKA 3LGDA 5BNKA 4RDZA 4Q4PA 3LHVA 5IHSA 3KLLA 4DZAA 2CLHA 3O07A 1GTHA 3OHIA 3VU2A 1DQWA 5DMLA 3KL5A 3P7YA 4WHBA 1BKHA 2PMQA 4IPNB 4CNNA 3NPUA 3S83A 5CSRA 2A85A 4MGGA 3EDKA 2VOMA 3WD0A 3K13A 1K4GA 4LUYA 4BS0A 2PDKA 1UH3A 4B15A 2AGKA 4XK2A 1OCQA 2YA2A 4DBWA 4HOWA 4O0QA 1NH6A 3GIYA 4MYAA 4IQJA 5CJNA 3M0VA 1AVAA 1E73M 4ZB5A 1YE6A 3C8FA 4CD6A 4RW3A 4X3ZA 4PFMA 3FOKA 3NDZA 3AO0A 1C93A 2VFFA 2XH0A 2O4QA 4HPNA 1TV2A 2PS2A 2WVVB 3AICA 1B2YA 3ARVA 5FEWA 4JTTA 2C71A 3CQHA 1MZHA 1NM9A 2PRLA 3U2CA 2HSAA 3BCFA 3E0LA 3F4CA 4DJDA 4FXJA 3VMPA 5A8MA 4QEEA 2WANA 4GKLA 4XTDA 1M6JA 1RY0A 3GY1A 1IEQA 3FHQA 1V0NA 2WC4A 3FEQA 3QMTA 2EG7A 2NX9A 5DXXA 3OIHA 3WUBA 3O8AA 1R9ZA 4JX6A 1YQ2A 1UKOA 1U1UA 4GWEA 3V5OA 1M1BA 3BE7A 2TRSA 5HOSA 1JPKA 1DXFA 4XSLA 4AZIA 1E1CB 2A3LA 2OX1A 4JKMA 4US6A 1SU5A 2BASA 2OLSA 3CYJA 1HVQA 4JPGA 2HXTA 3W7QA 3TC6A 3LLDA 2B81A 4OZOA 2EPNA 1RBOB 4DXXA 3GYCA 3BQ5A 4DB7A 5AZ1A 3RLGA 3AS0A 4IHCA 1SYTA 1A50A 1NY1A 2R14A 2RGMA 2VX7A 3QC3A 4O28A 1EWEA 2WNZA 1DOSA 2J7GA 4WKFA 2PLJA 1L9WA 4B5TA 1ICQA 2A2IA 5I24A 3VOGA 3EX2A 1OABA 3HPFA 1GVIA 3MTWA 3SJNA 3TNOA 2AL1A 2CZEA 3AFBA 2BG5A 4HPHA 1J0IA 3LCWA 2QR6A 4UMCA 1AW1A 5IBXA 1G4EA 3GAKA 3NVDA 3VUPA 4MVAA 4HP5A 1MVYA 2E77A 3EWXA 1N55A 2HROA 1M65A 4AC1X 1SZEA 4L9YA 1QVBA 3FGCB 1ISYA 4X0VA 4GG9A 5C6MA 1LWIA 1KM4A 1OGBA 1E43A 1XBVA 2Q6ZA 4ASTA 1W9XA 3V7PA 5FF7A 4J3SA 1LUCA 1TZZA 2C0AA 4UOZA 3PJTA 1RQEA 1FHDA 1M7JA 1OX5A 3CPRA 1UB3A 1T6MA 1ZCCA 3I7QA 2ISDA 5EBAA 3E2QA 3NOEA 1KM3A 4J3UA 3R58A 3UETA 4M7SA 4OOUA 4IP4A 1NJJA 3MP5A 3RIKA 2NVDA 2GK1A 3HGOA 4XZIA 4KEUA 4Y96A 2G3FA 2YFOA 5D2VA 1O1HA 5HMSA 1MW2A 1H1YA 3MI6A 3OGSA 1J6OA 4HSNA 5JUVA 3TXVA 3R94A 2VP8A 4PMXA 3ES7A 2ZUVA 3LLFA 2XINA 1W9UA 2VEGA 5IDIA 5EFFA 1NSJA 3MBDA 2BHYA 1NOUA 1TMHA 4GJIA 1F4HA 4LJ3A 1E40A 4W86A 1CENA 1J0YA 4ZQNA 2NQZA 3TH6A 1JQXA 4MADA 1V79A 2DUZA 4YIWA 3FAXA 2XM1A 3H7VA 3VMOA 3GVQA 3BWWA 3UZYA 4JTQA 3LS9A 3KLKA 4PMYA 1JXKA 2HBXA 2WNNA 3E5PA 3CL7A 2OEJA 4M6QA 3HMCA 2P0OA 1GVFA 1S3TC 4GFSA 5J04A 3TDFA 1AODA 1EDGA 1PZ3A 4QS5A 2UY4A 3EAUA 1OFEA 4H6QA 3UBPC 4J7RA 4MWAA 1LBMA 4KGJA 1R86A 1DIKA 2VR5A 4A22A 1OFBA 3PANA 2DSKA 3W1PA 2DZAA 3Q67A 4J27A 3Q2DA 3G8RA 3VDAA 3AU6A 1GOKA 2VZOA 1X6LA 4OUIA 2Y89A 3PNUA 1UJPA 4UNLA 3OU8A 4JKLA 4ICCX 3QC0A 3KOWA 3AYRA 3AIRA 3E02A 1TV3A 3W1LA 4LNCA 4O15A 2OU4A 3BJSA 3CHFA 3OVRA 4NU7A 4NX0A 3SSZA 4QP0A 4U2ZA 2EKCA 4QIUA 4IPIA 2D0HA 4GIAA 5G1YA 3IK2A 4C1NA 1W2PA 1GEQA 5SWUA 4DPPA 3BUVA 1SMDA 1FFQA 2QCHA 3MMTA 3GXMA 2PZNA 2XTKA 1RLDA 4J3ZA 4NF7A 2VURA 3UP8A 1VJSA 1A5CA 4H00A 2W67A 2V69A 4N42A 3IGUA 3MJMA 2OZ3A 3T05A 1TKKA 1V5XA 4AUBA 3M0YA 3UY7A 3AS1A 1G67A 1B31A 4QE5A 5F1UA 1TMLA 3CZ8A 1HVXA 4Q32A 4DY1A 4O11A 3ARPA 2XZ7A 3BTNA 2ZRZA 5DEZA 1TWDA 3VKBA 2D3LA 3MB9A 2CETA 3KDNA 3T0CA 1A3WA 3BAWA 5G4HC 1W3TA 4NAEA 3JVAA 1NFBA 4WRHA 1TZ9A 3L21A 3T9PA 2VCCA 2ZBTA 1B9BA 2FHCA 3F5JA 1TPUA 3BSGA 3KWXA 3BC9A 1XIGA 3W1TA 4YNGA 1GCYA 1KBKA 3TTYA 3P5YA 3FA3A 3SUVA 2GSJA 1ZJIA 3CHCA 5C7VA 4AX7A 3L0GA 2G0WA 1JI1A 4WDXA 3T7VA 2GSHA 4D6JA 4PL2A 2FB2A 4D6GA 2WMHA 3J7HA 4LAUA 3AIBA 1VBGA 3UERA 2C91A 3QMRA 4MLJA 3UG5A 1K1DA 4K7YA 4ZO7A 3SGZA 1FWNA 5CAKA 3GUWA 3V75A 4KF1A 2X1SA 3XISA 5I3HA 2RUSA 3OLIA 3ENLA 4M5PA 2ZRVA 1ZENA 5EY5A 5HXMA 1KGWA 2WO5A 4IQLA 4L56A 1AD4A 5DLCA 3LU2A 4HNNA 4W9TA 3W83A 4BI6A 1MO0A 3FYYA 3O06A 5K4XA 1W1A1 3GIQA 1ZQ5A 4OVXA 3N2CA 1R3SA 4Q33A 3ANVA 2H90A 1K03A 3CTLA 4ROPA 2E68A 2O9OA 2Z0IA 2VZSA 3IEBA 3SQSA 3S47A 3ABRA 2PGRA 3VIPA 1PS9A 1UHVA 1JPHA 1Z7AA 5KTLA 5D38A 3QH2A 3G0XA 2Y5SA 4Q6JA 1N2VA 4PUMA 1P43A 2Z7GA 1C8VA 1H0IA 3LX9A 3G1AA 1B3YA 4L1XA 1GVEA 3GAYA 4CD4A 2ACSA 3Q4DA 1Y5WA 1PIGA 3UXLA 4ZO9A 3PK7A 1NU5A 3A4JA 1EF3A 3GIPA 3NZ1A 4CN1A 4PODA 1FQ0A 3RNDA 3MP4A 2GOUA 4B3ZA 1GKPA 5HK4A 2UY3A 1FH7A 4H8NA 4H9UA 4K7VA 4S1FA 4QSFA 4ES4A 1T0OA 1UZDA 4GIYA 2YL5A 2WLZA 4P5UA 3LCLA 1DWJM 5CG7A 2PU0A 2VYOA 1WB0A 4RNFA 1HO4A 5J8LA 3SECA 3CUFA 3SRDA 1XLHA 3GXNA 2WM1A 1FWSA 2Z7KA 3GYEA 3W6MA 4DO5A 1X8CA 4DVOA 5FKYA 3WQCA 1E55A 4LAMA 2RH9A 2QUTA 2ZUTA 3GHSA 5F2GA 4JHMA 5CG0A 1S5NA 3CAVA 5I2UA 1P0DA 3CZLA 1NQKA 4CNSA 2I14A 3PNZA 1EOKA 4JHOA 4X60A 3CZKA 4Q3MA 1J0HA 1YW1A 1LTDA 3T44A 1W5MA 1QRQA 2CPUA 1GT8A 3LMZA 3LYEA 1CWYA 3NSNA 3O05A 3IACA 1ADSA 3GQYA 3N1AA 4Q6XA 5DY2A 3GNPA 2EHHA 1BF6A 4H2CA 3F2CA 2YL8A 3M46A 2GGJA 1XLBA 1BXNA 2W79A 3SUUA 3WF1A 4N02A 3WY1A 2R82A 1NWRA 3SN1A 4U33A 5CZJA 5DQPA 1UBSA 4QQUA 2Q71A 5MKGB 3A64A 1P6WA 5CCZA 3FV9A 1KFJA 3KAOA 3Q65A 5ABHA 4NZ5A 3IIPA 4UTLA 1FDYA 3ERPA 4DEFA 3GE7A 2WSYA 1MNZA 1GOMA 5HJXA 1VCFA 3PWGA 2AGTA 1WBHA 3GC4A 3MVIA 2XH4A 5KEZA 1IZCA 4D72A 4A8RA 4XD5A 1G9HA 1IEIA 1GZGA 3TSDA 5I77A 4QJ5B 3LOTA 2QULA 4JIRA 1TVPA 1Q6DA 3VZZA 2C6QA 4LY8A 3H2FA 3LD5A 1H0GA 2BDQA 5D9PA 4JNYA 4X61A 1QW7A 4C65A 2JKAA 3V0TA 4WIWA 2P5NA 2YFNA 5ABGA 4MLRA 4ML4A 3WK2A 3ZMRA 4HYVA 5D2WA 2OR2A 4TVDA 3AUJA 1DWHM 5DCEA 3LXCA 2E6FA 4L1WA 3VIFA 1YXYA 3VZYA 2YDRA 1ME7A 4C6EA 2NQHA 4BK9A 2FQIA 3EBVA 1GHRA 4C7FA 4FI4A 1ONXA 3TLLA 3K4AA 3QGAC 3T81A 1FWRA 3LBOA 3UT0A 5CZSA 4RDYA 1E0TA 3P6LA 1E9ZB 3QR1A 3KBVA 1BHGA 1Q6RA 4M6VA 3UXIA 3CQIA 1PL9A 3SDOA 4FF5A 2PP1A 4LUSB 4O18A 2ZZ7A 1S2VA 4K37A 3W70A 2ATMA 1H62A 1KBIA 1XSJA 3UZZA 3C86A 3PZNA 3SFWA 5FACA 4OBSA 1T99A 3EOSA 1UZHA 3GTIA 1IE7C 2DT2A 3KCJA 3C56A 1UWUA 1HT6A 1ZJBA 4RDWA 3UG4A 5I3IA 4G1NA 3E6EA 2DORA 3R10A 3SBFA 1L2UA 2JGQA 5CBBA 4LYQA 4QITA 4AVNA 3W85A 1WOBA 1GTEA 4PFHA 1BEUA 2FTYA 5FIPA 4YCPA 3TW7A 4NKCA 3B03A 3MJYA 1MZRA 3PUDA 3NPXA 5A94A 3UZXA 4R7WA 2GDUA 3T40A 2CKRA 3O3RA 3KBMA 1PB0A 3CO8A 2CLMA 1TVLA 4O1FA 2F38A 4XUYA 1TA3A 4A21A 2YL6A 2VNCA 4YTQA 1A5OC 3I10A 3BK0A 3UA4A 4NQ1A 1L6SA 3TN5A 3APYA 2A1YA 5HJLA 2Y1HA 3HGRA 4RL3A 3SUWA 3W25A 1WDWA 1IF2A 2YCLB 2PBOA 1T5AA 3W23A 4MY1A 1IEVA 3CGTA 1BGGA 4HOXA 2FJUB 3W26A 1WUEA 3WUGA 4DJEA 4GBUA 2Z2AA 4FS9A 1HKKA 3BG5A 3I7SA 3WDHA 1JDEA 3UCCA 1PDYA 4OUEA 3DFHA 3MWCA 3H26A 1FBAA 2X40A 4ZSTA 2XZ9A 4YMZA 3HPXA 3ZSSA 3CBWA 5AKQA 3MUZ1 1V7YA 1MEHA 2NXGA 1PKYA 3EDFA 4A2SA 3CPGA 3I4KA 2MNRA 4L65A 3ZWSA 3IARA 1F74A 4DI8A 1GGOA 3GNOA 3W88A 2GGIA 2CERA 3VMNA 3H24A 3TW6A 4WSHA 5D02A 4A6GA 3TX9A 1PCWA 1UPPA 3CIXA 2E3ZA 5EFDA 2A3HA 7CGTA 3E96A 1HNYA 2X09A 4KCUA 2ZTJA 3EKLA 4XZLX