1F6KA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords N-ACETYLNEURAMINATE LYASE
total genus 120
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f6kA00
3NQAA 3EWZA 1QPRA 2X1RA 3JS3A 2DZXA 2E77A 3W85A 1OFEA 3M9YA 3PB2A 5AOUA 3NZ1A 1TRIA 3CEPA 3W2LA 3V1PA 1PCWA 3ANYA 1ZY9A 2NX3A 2ZTKA 1ME8A 2Z1BA 4H6KA 3LCXA 4FNUA 1PHQA 1XUUA 1IXPA 5KTLA 1A5BA 3TW6A 3FYOA 3HMJG 1VLIA 4EF9A 3EXRA 5F4XA 1VZWA 3LB0A 2A4AA 4XWUA 1TPVA 3CPRA 3PG8A 1TTJA 3TSBA 3BW4A 4U4MA 3W72A 4JTFA 2H3BA 4NJHA 3NR0A 1FWWA 3QPZA 2A7NA 4GUJA 2A7RA 4IX0A 1TPUA 3KRSA 3HQ1A 4N9CA 4UNKA 1FX6A 4LVFA 4N2YA 1FWNA 3WK0A 4JYEA 5F2MA 3W70A 2E1DA 3O16A 3QFEA 4PFMA 2GVLA 5HQEA 2Y7GA 2ATSA 2WNQA 4RLIA 3CLMA 3I7RA 4K7VA 4GFSA 3BLEA 1ZAHA 3QC3A 1SO3A 2A6NA 1FXQA 3NNTA 3W88A 1KFCA 3C0JA 1SW7A 2NV2A 3TMQA 4NNAA 1VLWA 4JXCA 5D38A 4GJ1A 4JYDA 1XBVA 1W5MA 1ICPA 1JCMP 1KM0A 5D04C 1DQWA 2VELA 3NPXA 3S5OA 3MI2A 1Q3NA 3VFLA 5G2HA 1TIMA 1XDLA 4XTIA 3ZS4A 2B7OA 5DELA 3UWWA 3PWAA 2QAFA 4IWWA 2H3DA 2C0AA 4NXSA 3EX4A 3SGUA 4NJGA 4WOQA 3Q37A 2VENA 2GQ8A 2EF9A 1K03A 1EEPA 2YCEA 3WJXA 4HNVA 2XN2A 2ZRVA 4PODA 2X2GA 4JIQA 1P4CA 3SSJA 2JKEA 2QCDB 3SFKA 1B9BA 4N9EA 4NJIA 2ZZ4A 3RF9A 4AAJA 3LERA 4JICA 3N3MA 4GBUA 2WPBA 4UTHA 4UFIA 1OABA 3HG2A 3FKRA 3WK3A 4XKYA 1ME7A 5C55A 1B4KA 3GXNA 4RK8A 1TTPA 2ISVA 4LRTA 1X8FA 3GDRA 4HNUA 1YPIA 2I1OA 1HO1A 1JCXA 2B0MA 1F7BA 2F7FA 3P82A 3TQ0A 1KTNA 3NPVA 4K8EA 1SSGA 4QSHA 3UZJA 3N19B 3OVPA 3TKFA 2Y7FA 4MY8A 4AVFA 2P1FA 4JIPA 1KBJA 2DU2A 2E5CA 3BLIA 3I68A 4DPQA 4UR7A 5E93A 3NQVA 1LOLA 1W8SA 4BFAA 1H7OA 5ABTA 1FDYA 3LXAA 1RZMA 2F84A 3IIOA 2QUVA 5BW6A 5AYYA 3LHUA 4KFOA 5HWMA 3R12A 2V5BA 3GKFA 3TH6A 1LTDA 3KVLA 2QUUA 1W5NA 2A85A 1RQHA 3NPWA 1RD5A 3L5MA 5EKYA 5C2XA 1E51A 1YXDA 3O06A 2ISSA 2DP3A 3NL2A 1R2RA 2E6AA 4LUIA 1ALDA 3MYPA 4DF0A 2Y88A 4JTUA 2B7PA 4MFDA 1WOBA 3W1LA 1TQXA 3SECA 2D73A 2BX7A 3GNNA 2A6LA 5EY5A 1SW0A 2NUWA 2O7SA 1OFPA 3W22A 3SR7A 3TQKA 1K7FA 1EB3A 5F2IA 2PE4A 3W7QA 3KXQA 1QO2A 5H91A 2ZQ0A 1G69A 3NXFA 1JR1A 2WSYA 3TAOA 3W1AA 1LLZA 1IGSA 3NQDA 1Q6RA 3PBWA 4M6VA 3GXTA 4JN6A 1TSIA 2FPVA 5FF3A 5FEXA 4ZQPA 4C1KA 1H7RA 4XQ6A 3W84A 4HNTA 4K37A 5AHNA 3QH2A 3W1NA 3HJZA 1JCNA 1R47A 3W76A 2VOMA 2Y7EA 1UJPA 1G4SA 4TO8A 4RX0A 2YPIA 2QF7A 3N9SA 3P8IA 4AWSA 4BI5A 1KM1A 1WYIA 2FFCA 4IMGA 4UTMA 4WJEA 4JD4A 2CZDA 3NDOA 5KZMA 1TPFA 2JBMA 2WQPA 1AK5A 3IGSA 3TIMA 2EGZA 4IMEA 4O28A 3DHFA 3EX6A 4UR8A 4BR1A 2CLLA 3O07A 2ZRXA 2HTMA 3TA6A 1TCDA 3RK8A 3OG3A 1G6CA 2JKPA 2ISWA 3G1YA 4QISA 1EUNA 5LKYA 1S5WA 2HMCA 1NSJA 2ZRWA 1DV7A 1GQNA 1LRNA 3TQVA 4NNCA 4X2RA 5HINA 1OHLA 1XKYA 1G7UA 1R46A 3FJ6A 3CWNA 4LY8A 3TR2A 3LXBA 1QOPA 3QMTA 3M5YA 3SGZA 1KV5A 1H50A 3W2JA 2E6DA 3LI0A 2QAPA 3QW3A 4Y8FA 3TUUA 3P80A 1HL2A 3S1UA 4IXXA 4FNTA 5KITA 4LT9A 4LW7A 3H53A 3PUDA 4KFPA 3EX3A 4Q33A 4HSNA 4LNYA 1O4UA 3CB8A 3N73A 2VEPA 1H63A 3DXIA 4NT0A 2ATMA 3W7NA 3EKLA 2ZTJA 2QCLA 5T26A 4ORMA 4PH6A 1OYCA 4AXKA 1W1ZA 3TDFA 2V82A 2ZZ1A 1I45A 1FWTA 3TFCA 3C3NA 3NZRA 1GEQA 2W6RA 1KLZA 4BWLC 1ZALA 2QCGA 4Z1BA 3QJAA 1H7PA 4UTTC 1LBFA 1JCJA 3CIWA 3HG4A 1YDVA 1OG0A 3DFTA 3G1AA 1HTIA 3CU2A 1DORA 2VFFA 2JK2A 4JNMA 4MY9A 1VS1A 3HPSA 4E2DA 1R2SA 1L6WA 3SZ8A 1BKSA 2BSLA 1SO6A 4Z1CA 5I3IA 2E68A 5K4XA 5LHEA 2YZRA 4MFEA 1LZOA 1I2NA 4AF0B 3OEXA 1R2TA 2NXGA 5AYXA 4POCA 2ZZ5A 2CW6A 4OT7A 3RFAA 2FJKA 1ZFJA 5KSWA 4ALDA 3BARA 4IMFA 5AHEA 2FDSA 3MO7A 3MYOA 3A9IA 5I3FA 1RV8A 3W07A 3UXAA 1GVFA 5E1QA 3UY8A 2Z0IA 1O94A 2VFGA 4O4WA 2WJZA 1QO5A 3BG3A 3OHIA 2C16A 1B4EA 3UPBA 2Z6JA 3LX9A 3ZWSA 3G8EA 1MO0A 1F76A 1XCFA 2V30A 4HPXA 3TCEA 5D37A 4R34A 3RU6A 4LC8A 3C2FA 3OVRA 4UTTA 1LORA 4WD0A 2YGYA 4JTKA 1H1ZA 4N6FA 3UNDA 2E6YA 3LBCA 2GUUA 2P0OA 4IX2A 1CX9A 4A2RA 1GYNA 3BGGA 4LS0A 3P84A 2XFWA 4NU7A 1YXCA 3EEGA 1ZHAA 4GC4A 1B3OA 4MYAA 1JQVA 5C54A 3SIZA 2YDAA 3P74A 4OGZA 2RKXA 3TC6A 1VJIA 4UTWC 3Q58A 4MY1A 2NXHA 2C14A 3MP3A 2Q8LA 4O4VA 4O14A 2YX0A 1Q6LA 2DZWA 3NL6A 4ZQMA 3NL3A 4O17A 3EXSA 1G4PA 1TMHA 4UFMA 3HGOA 3WJZA 3LCGA 2R94A 1WAUA 5F4SA 4RJEA 5HUOA 2E6FA 5K3VA 3BGJA 5A5WA 1ZENA 4OHQA 3KAOA 1OFRA 3QZEA 1H7NA 2VKZG 7TIMA 4OBTA 3STCA 1EPXA 3IVTA 3W7HA 3M5XA 1OFOA 2EPHA 2ZCGA 1TTIA 3LHWA 1VCGA 5D09A 1IF2A 4WOZA 1L2UA 3PF3A 4K6AA 5AN7A 3CT7A 2QCHA 2Y62A 4NJKA 1F5ZA 3LTSA 2WKJA 4JX5A 3C6CA 5TIMA 3FFSA 4O1CA 3W87A 4JTHA 1Y0EA 2YYTA 1FWSA 4OWGA 3LBMA 4Z0JA 3GNDA 2GVJA 2V9DA 3KFTA 3DHDA 4O1DA 5FEWA 1I4NA 4UTUA 1TV7A 4Q32A 3BG9A 3WJSA 2V2HA 3FKKA 2RH9A 4LVBA 1M7PA 3O1NA 2TYSA 3W1MA 2GPTA 1LBLA 1FWRA 3S9YA 1ML1A 1U5JA 3MI3A 4P61A 4AF0A 3E0IA 4RV8A 4JTGA 3R13A 1MEHA 2QDGA 3HPZA 4CNNA 2GOUA 3P5ZA 5L6UA 4NUWA 3EXTA 4RZ6A 4UTLA 3HGJA 3R8RA 5HR7A 3R89A 5G4EA 3THAA 5LGXA 3KHJA 3B0VC 1OFDA 3PBYA 1HG3A 3FJLA 3HB9A 1AG1O 5FEZA 4FIRA 1ZCOA 3L66A 1OK4A 3G24A 4FX6M 1F6KA 3L5AA 3F4NA 2NWSA 2ZA3A 1W5QA 4LWWA 3W1QA 1YADA 1KM2A 1TPB1 4E0CA 4M6QA 4OQVA 5FESA 4DO6A 1H5YA 1FUYA 4D2JA 5K4ZA 1U83A 2XN0A 5G5IA 1C9DA 5CPMA 3O8AA 3IIZA 1LOSA 2ZYFA 3QM3A 4UNLA 3ELFA 3LCLA 4AEOA 4YXGA 3EWYA 2C1HA 3N34A 1RVGA 4HT3A 1MXSA 3TJXA 1YXYA 4EIVA 5CKSA 4EF8A 4O52A 3VNDA 2TMDA 2FB2A 2Z6IA 3C52A 4MKNA 2Y61A 1SZFA 4LTSA 3LGEA 5HNRA 4MJZA 5CPNA 2J88A 1WX0A 4RCXA 4JTEA 1KFJA 1QPQA 5D33A 2O7QA 1M5WA 3DENA 1QMLA 3L67A 2NZLA 3CEUA 1VYRA 2E5DA 4Z1AA 2DZPA 3STEA 3ABQA 4Z0SA 1F73A 3B0PA 3S1XA 2Y7DA 5LNVA 2FIQA 4QITA 1UB3A 3BO9A 1ME9A 3ZR4A 3TSMA 3T44A 4N4QA 3KVMA 4ADUA 3L0NA 1QR7A 1IXOA 3M5ZA 2G97A 3L5LA 3E12A 4Z1DA 3NA8A 4UTWA 1YDNA 2OX1A 4O53A 2C6QA 2CLKA 4QQ3A 1ONRA 3IV3A 3ABRA 2PRLA 4LS1A 4AB4A 1K8XA 2VFEA 5LSMA 1KLYA 3SI9A 1KFKA 4K7YA 3W1XA 4FB7A 1K7EA 3KVKA 1VQTA 2A0NA 3W7OA 4DELA 2X1SA 3TE9A 3A24A 1LCOA 1XC4A 5I3GA 1WV2A 4O8RA 1KV8A 1HFBA 5A8GA 1EWDA 3W7GA 4N6EA 3W1PA 4WUIA 2CZ5A 3TW7A 1WBJA 3QSTA 3WFAA 3BG5A 4HNNA 3BW2A 1DJNA 1ZAJA 3O63A 4HHPA 4NX5A 1SR9A 1LM1A 3V75A 4DXVA 3M43A 3GK0A 5K9CA 5TQLA 2DZSA 3A5FA 3O15A 3NAVA 1AMKA 3UWUA 4UTJA 4UTIA 3NG3A 3TROA 4K8HA 3QSRA 5C5YA 2AGKA 3W7KA 3EX1A 3GR8A 2CLEA 2Q3OA 5AB3A 1OJXA 4RXGA 1K3UA 3EKZA 3LRLA 1GVOA 3EB2A 2Y6ZA 1SSDA 3N9RA 4OV9A 3P8JA 4NQ1A 1ICSA 5D02A 2ABAA 1GTHA 1QWGA 5CSSA 2Y70A 2A1YA 3C8FA 1JRCA 3LV6A 3G8RA 3TV8A 1J2WA 3KRUA 4TMCA 4LOCA 1QPNA 4O0KA 5HUPA 1S5VA 3IGUA 3CIXA 4GRSA 4K36A 4UFHA 3SY5A 3WK2A 1EP2A 5AC6A 1NF0A 4WY0A 1D9EA 4H3DA 5AFDA 2VFIA 4O1BA 1OFBA 1P0NA 1YYAA 1LOQA 3S8HA 3G18A 4KKXA 1WXJA 1SFLA 4U28A 2OT0A 2RFGA 3DAQA 4Q4KA 5HR6A 1F6PA 3TAKA 2V0TA 3LM7A 3P5YA 3S0CA 3K30A 5DCDA 1OX6A 1SU5A 3RLVA 3GLCA 4CCEA 1UCWA 1XUZA 5KMYA 4MZYA 3TXVA 5DXXA 1K02A 2HSAA 2W79A 2WO5A 8TIMA 1EUAA 2I14A 5D2XA 1VHNA 3LI1A 1GVQA 3DFQA 4UFLA 4EOUA 3B8DA 3PSWA 4J9JA 4BF9A 4LVAA 1KW1A 2NX1A 1I2OA 3LHVA 4IPIA 3AJXA 3LV5A 5CZ0A 1KM5A 3BW3A 4M7SA 2WNZA 3TJLA 4KFNA 1X7FA 2ZA2A 1EX5A 1O60A 3UYCA 6ALDA 4P2VA 4ZZ9A 3W7LA 1KFBA 5I3JA 3T78A 4PA8A 3W7IA 2VFHA 5KZDA 1ZNNA 5HULA 2Y63A 5D03A 2Q8ZA 3DU0A 3D0CA 4JS3A 4PC8A 1SQ7A 1L9WA 1XXXA 3TNOA 1SO5A 4LUJA 1VCVA 4JGDA 4M19A 4QJ1A 3BLFA 3MBDA 1QFEA 5BRBA 3PUOA 4FNSA 1XI3A 3LCHA 3PVFA 5D2YA 2XN1A 5LNSA 2R8WA 1XBXA 3S1VA 1K8ZA 1OF8A 2ZDRA 3C2EA 4Y90A 5AC7A 4IJBA 3N14A 1GPWA 3HOJA 4UMCA 2ZRZA 3QEZA 4O57A 5KZEA 4ORIA 1TO3A 1FCUA 1X1OA 3CQ0A 4FF7A 2ALDA 3SW6A 1L6SA 5EL1A 2V8ZA 5F4WA 1A5SA 4W9TA 3GAKA 2X1TA 3E96A 3DH7A 2YYUA 1SZEA 2QJHA 4JTTA 1JJKA 2J9ZA 4RZ4A 1W56A 2BLEA 3KVJA 4O13A 3GX9A 3W9ZA 1V7YA 1WOAA 1IIGA 3NM1A 1JUBA 3RNDA 3IIXA 1SUXA 3P7YA 2HS8A 2YSWA 3G3DA 1L6YA 3W7DA 2Y89A 4MYXA 3LCFA 1FCQA 1T96A 2GJLA 2R14A 3MMTA 2JGQA 4CNPA 3LRMA 3QQ1A 4XBKA 3SJ3A 3ABOA 3YPIA 2KZHA 3LRKA 4BK9A 3PULA 1GWJA 4UFKA 4YWIA 1BWLA 4DEFA 4S1FA 5AHLA 1CW2A 3PBUA 2H6RA 3W23A 1W54A 3I7SA 4DO4A 4TX9A 4NZFA 2OJPA 3S5ZA 3B4UA 1DOSA 4R7JA 4WZHA 4JX6A 3HF3A 1ZAIA 4S2CA 1XDMA 3W1TA 3TC7A 1LROA 2W0UA 4IUOA 5DCBA 4I7WA 3GR7A 1SO4A 3IRDA 3L2IA 2FPTA 3S5NA 5DN1A 1KM6A 1H62A 3PM6A 1GVSA 4OV4A 4R53A 3HIJA 3BPWA 1UUOA 3QQ0A 3W74A 4QNWA 2E5BA 3BV4A 3UPWA 1OF6A 3VI2A 4CCDA 2B7NA 2VEIA 3PBVA 4ZQRA 5HWNA 3N2XA 1TV8A 2CZEA 3MP4A 3EWBX 3M44A 5I3KA 1NFBA 1VYSX 1TPH1 4FXSA 5G4WA 1DVJA 3LTYA 3W7PA 3C2RA 1THFD 1GG1A 1YLVA 1G4TA 1RQBA 1QPOA 3G1DA 4ICNA 3KX6A 3GDLA 2WNNA 4UTKA 3VE7A 3PR2A 3TK7A 4AH7A 2X30A 1FQ0A 1KTBA 3MUXA 1JUKA 3M1ZA 1WQ5A 4DBDA 3CTLA 2CLHA 1VYPX 4JX4A 5LZLA 2J9YA 1OK6A 3A22A 1TQJA 4PCFA 1W3NA 1NVMA 1EA0A 3FEMA 1IXNA 3E9AA 1H7WA 2AQWA 2B4GA 1VRDA 3W7RA 2RDUA 2OMAA 4UFJA 2TPSA 5I3HA 4CLMA 4E2BA 4JY9A 3PB0A 1DBTA 1VHCA 1DHPA 3UQNA 3AO0A 5FF4A 4A22A 5EA9A 3OBKA 3L0GA 4C1LA 3B0UX 1G7VA 1T0OA 2YW4A 4NX0A 3WK1A 5F1VA 1YPFA 2A2IA 2CWNA 3I65A 1FXPA 3M47A 2H8ZA 3LCWA 4LVDA 3FYPA 3QF0A 2GQ9A 2R91A 2QCNA 3GKAA 4XUGA 2C13A 5D30A 1PIIA 4L4LA 3EWUA 1I2QA 5U7SA 1PE1A 2UV8G 3F1QA 3O6CA 1A5CA 1FCVA 4LV9A 1LYXA 4O10A 3M0ZA 5IBXA 4O19A 1NF7A 2BXVA 4K39A 1GG0A 2LLEA 4ZQCA 1Q6OA 2OCZA 5CZJA 1TREA 3HG3A 4O11A 4IPJA 1P0KA 1KA9F 5LNWA 2DZVA 3VKJA 4ZVJA 4GUGA 1HUVA 1KM4A 4RKAA 3QMRA 4JYFA 3O6DA 1H1YA 2G96A 4FHAA 1F2JA 1TRDA 3B03A 3CC1A 1FY6A 2NUYA 3W6YA 4MJMA 4MIMA 1I2PA 1JRBA 2QJGA 1K7XA 4UMAA 3EWXA 1PS9A 4IGHA 4FNQA 3NQ8A 4ADTA 1K8YA 1M6JA 4O15A 1EIXA 4JEQA 3UWYA 2AAMA 3KOFA 4AHOA 1XBZA 3LHYA 3NYZA 3MHGA 3QRHA 4FNPA 3JRKA 5F2GA 4HKPA 5CPOA 1NEYA 4MPQA 3NGJA 4MOZA 3FA5A 4DBEA 5FI8A 2QKFA 3G1XA 1TYGA 2ZBTA 2DZUA 5G1TA 4GWEA 4RXFA 1OYBA 1GVRA 3MI6A 1A53A 4QAIA 1X1ZA 1R30A 1Z42A 1GT8A 5C6MA 1WBHA 4LU0A 4NXKA 3C2VA 3GB6A 1QNVA 2C19A 4FO4A 1XL9A 1N55A 2NV1A 2QUTA 3A21A 3FLUA 3OVQA 3GAYA 4XZ9A 3NQFA 5CZTA 4M6PA 4WY0F 2QJIA 3UY7A 2VXNA 3IIPA 3CM4A 1FDJA 3FIGA 2B7QA 2WSRA 1Z41A 1TPDA 1LP6A 2OT1A 5FEPA 1IXQA 1VCFA 3MBFA 3PAJA 2QR6A 1T8XA 1A50A 3LOTA 4JDYA 3LLDA 2CLFA 3M41A 1W31A 3NQGA 3ZWTA 4CCCA 3EX2A 3N2MA 4A29A 4M5PA 3S1WA 1TJRA 1TTQA 4Z08A 4CQ8A 3PSVA 3BK0A 5FF7A 4TR9A 1N8FA 1MSSA 3UZ5A 2VC6A 5FF0A 2V2DA 2GQAA 3LHZA 3HGRA 4GE8A 5J5RA 2A5HA 2FB3A 3PC0A 4YCOA 5EYWA 4FXRA 1BEUA 1VH7A 1AL7A 4BI6A 5HMSA 5BOOA 1Q45A 2YXGA 2WV8A 1VC4A 1XFBA 4BWLA 4O54A 2QCMA 5BMWA 2H8XA 4EVZA 2Z2UA 3FS2A 1KM3A 2PC4A 3HG5A 4IMDA 1W37A 4UCGA 1Q6QA 4GNJA 3LLFA 1M7OA 3W83A 4ZMGA 3H55A 3NQ6A 2QCFA 4B5NA 2JGYA 1EP1A 4A21A 4UXDA 1S3HA 3NQMA 4ZQNA 4JY8A 1JQXA 2EAWA 3NQ2A 3MJYA 4HN4A 3LDVA 3I7QA 1NAL1 3DGRA 4LVGA 1WDWA 3TXZA 2EHHA 5L9FA 3MP5A 1FDZA 5KINA 3QW4B 3QPYA 5H2ZA 1RPXA 1SZNA 2Q3RA 4AWTA 4I7UA 2BZNA 3CWOX 3DFPA 3OIXA 3Q94A 4N4PA 2QCCA 2J9XA 3RMJA 3P60A 2FLIA 3C2OA 3U8GA 4MZ8A 2VEKA 4WQ6A 5K7JA 2WOQA 4X9SA 4ML9A 4G1KA 2PURA 3W71A 1W0MA 1TPEA 3M7WA 4OE7A 5CZSA 3GZ3A 3G3MA 4UUIA 1QCWA 2ZRUA 3NQ7A 4GUIA 3M16A 4O0ZA 5CG7A 1VPXA 4OU1A 4MLJA 5AYZA 1RR2A 3FOKA 2C15A 1IIHA 3H54A 1TB3A 3ATZA 1SZGA 4CQAA 1DL3A 3M5VA 4TMBA 3NPUA 4S2BA 3THQA 1H61A 2V2CA 3TMLA 3C56A 1O95A 4IMCA 4O18A 4PEKA 5J5DA 1N7KA 3P81A 4R33A 3G1FA 2CLIA 3UWQA 3P62A 3W1UA 2CLOA 3T40A 2CU0A 4UC5A 4FNRA 4FEZA 1OYAA 4FX7A 5U4NA 1JVNA 3DKJA 5D2VA 1X6UA 3PUEA 4ADSA 3W7JA 2PRMA 3M6YA 2J24A 3W7CA 2ZRYA 5CSRA 2C3ZA 4LRSA 3CHVA 4N9DA 3A5VA 1LDCA 5K9XA 1I8JA 4IOTA 3C61A 4MLRA 3HO8A 1JUEA 1D3HA 3STGA 2CLMA 4HSOA 4O16A 3GDMA 4QM1A 4PL2A 3S5YA 2ZFAA 1ICQA 5AC8A 3OA3A 4MUZA 3NEVA 3VE9A 4XKYB 1VGAA 4NZJA 3E49A 5EBUA 4LC6A 1JCLA 4BI7A 4QNEA 5AHIA 1XBYA 3W2NA 3G0UA 4NJJA 2J27A 2DZTA 1G67A 3I6RA 3MWAA 3O05A 3W3OA 1PCKA 3UD6A 5LHFA 5LNRA 1QOQA 2DJLA 3UWVA 3DI0A 3MW7A 1XM3A 3W2UA 2YW3A 1KFLA 3UXDA 1LRTA 1DKWA 3HGSA 3DZ1A 4LS2A 5F1UA 3L0KA 1P5BA 2YFOA 4WY0B 1TPWA 3QMSA 4EWND 3KRZA 5G1YA 3W73A 2NXIA 4E38A 3P61A 3UWZA 3G1SA 1YTDA 2E09A 4I9AA 3NM3A 1WA3A 6TIMA 3TFXA 1FCBA 3PY2A 1T99A 1VR6A 3B04A 3R5EA 2QDHA 4GXMA 2VFDA 3NVTA 4JTLA 4YLWA 1OVDA 1OX4A 3EWWA 5E0KA 1F05A 3ATYA 1EP3A 2ZA1A 3GXPA 4YMZA 4NVTA 1G4EA 3HBLA 4ZQOA 2ZZ6A 1GZGA 1H60A 4UMBA 3BVJA 4WX2A 4JDBA 3G1HA 3DFOA 5CGQA 5D32A 2G5WA 4O1AA 2RHGA 4RR4A 2FTPA 2Y85A 1OFQA 5SWUA 5G2WA 1SFJA 2RDWA 3NQCA 2PCQA 4LV4A 1SW3A 5DLCA 2ZZ7A 3W2MA 2G95A 3GYEA 4N9BA 4Y9AA 4X3ZA 4AWUA 1MEWA 3NQEA 3LXCA 3DFNA 4PL1A 3PG9A 2ZZ3A 4RZ5A 2RDTA 1AW5A 1YDOA 1LRQA 3IIVA 1C8VA 2BWGA 3B05A 1PL9A 5D2WA 4AHQA 3L68A 4DQWA 4DPPA 1TJPA 2WSQA 1V5XA 1DJQA 5K2ZA 1J5TA 1JULA 1J4EA 5AHFA 1W3IA 4Y96A 1HO4A 3S42A 1H7XA 3W86A 3TSDA 1YTKA 1MEIA 1CI1A 4H4IA 4O12A 3IEBA 5DY3A 3T55A 4JTIA 3MHFA 5BMXA 4ONVA 3A23A 1OFAA 1GJPA 1UASA 2OZ0A 1BWKA 4XBSA 2GJNA 3P67A 3B06A 1GTEA 4JTJA 4HPJA 3IVUA 1BTMA 2X1UA 5LNUA 1ZJIA 3INPA 2NLIA 2P10A 1LLWA 1O5XA 1GYLA 1PV8A 2X16A 3E02A 3TX9A 3IVSA 5CPLA 1Z44A 3NOEA 2NUXA 1AL8A 4GUFA 2TSYA 5EMUA 4MZ1A 4FX8A 1TPC1 2CZFA 2FPYA 1B57A 3G22A 3GIYA 3GDTA 3L65A 1S5TA 3HPXA 2YFNA 1A5AA 3WJWA 4DF1A 4TU1A 3DFSA 2NX9A 2A7PA 4L4MA 3R2GA 4PTNA 2V81A 1P1XA 1MZHA 2EKCA 3C4UA 3Q2DA 3F4WA 3GVGA 5DXYA 5IM51 4YL2A 1PHWA 2JKAA 2HS6A 2FQIA 2A21A 5GVJA 1OX4B 4ZL1A 1UUMA 5BNKA 3ABSA 4WXYA 1QDSA 2DJXA 1AW2A 1H51A 3T7VA 3TU9A 1W3TA 3NO5A 4X22A 5AHMA 3W7MA 3PS7A 3L21A 3ZFHA 4WXZA 1KFEA 1EWEA 5MHBA 3DKLA 5TBOA 2J6XA 4Y6GA 2V5LA 1QAPA 2BTMA 5G2IA 5DBTA 4AHPA 3VCRA 5IBXC 4HIBA 4XTDA 4K38A 1JCYA 2VEMA 1ADOA 3WJYA 3STFA 5K9DA 4MVAA 4NNBA 1KTCA 3JR2A 4CNOA 1W5OA 5FF2A 4O50A 5D05A 4UIOA 4N02A 1LBMA 1DQXA 1I2RA 4YCPA 4IXHA 1UBSA 4GUHA 1AW1A 1SPQA 3W2KA 3S6DA 4DO5A 5HWJA 1C29A 3G0XA 5EPDA 2QCEA 3LTPA 2PRHA 3LHTA 2GVGA 2DORA 3IGXA 3G1VA 4TIMA 3W75A 1PVNA 1W5PA 2CFFA 1O5KA 4A3UA 4M7TA 3NL5A 2TRSA 1Z48A 4DF2A 5DCEA 2IQTA 5HJLA 2ABBA 3GDKA 4KWWA 4I7VA 3O6YX 3QYQA 1GOXA 3MHUA 3F03K 3W7EA 2ZZ2A 4AMAA 3W1RA 1RQEA 2QEZA 5LGZA 3G0SA 1KBIA 3USBA 1F74A 3DI1A 3LCIA 1D3GA 1YTEA 5D2TA 1FBAA 2H90A 4IQLA 1OX5A 3U6WA 4KWVA 1TV5A 2C18A 3U2OA 2I9EA 4CQ9A 2QCDA 4JR5A 4JTSA 3L9CA 3T4CA 2YR1A 4FIQA 3RLUA 5DBUA 4A2SA 4QIUA 5DY2A 2NWRA 5F2LA 3DBPA
chains in the Genus database with same CATH superfamily
3NQAA 3EWZA 2BASA 3SCPA 2HISA 2X1RA 2ODOA 4JN8A 3T2QA 2DZXA 4NZ4A 1WDQA 4LF1A 1L2QA 3W85A 3M9YA 4H9UA 2J7BA 3VOHA 1TRIA 2OZ3A 4LFYA 1K9FA 2NX3A 2Z1BA 2PMQA 1YNYA 3LCXA 1I60A 1DJGA 3LMYA 4EF9A 3EXRA 2EXOA 2WC4A 5F4XA 3CLWA 1IT0A 5E0CA 2C8NA 3TSBA 4JTFA 3KCJA 3QPZA 4GUJA 3PK7A 1TPUA 4H9MA 3QZAA 2WBKA 2IQDA 4UNKA 4N2YA 4Q7BA 3VFCA 1MW2A 3O16A 1Q7QA 2OSWA 1OGBA 3HV9A 3VNIA 5FA5A 4IP4A 4HK5A 3CLMA 4GFSA 2HBVA 1ZAHA 2WHMA 2A6NA 1FXQA 3WLOA 1KFCA 4J1OA 2IPWA 2F6XA 2HK0A 2XM2A 2FMOA 4JTAA 4NNAA 3W6MA 4JXCA 5D38A 1XBVA 1W5MA 2QIWA 1JCTA 1HJXA 1JCMP 4XKMA 3T6CA 2UY5A 3BCFA 3NPXA 3MI2A 3B9AA 3CGTA 1UWSA 4KETA 3UWWA 4YWSA 4ERGA 3RLGA 2C0AA 3FW6A 2YA0A 2PWUA 3Q37A 4GX8A 1JPIA 1V93A 2GQ8A 4A8IA 1MUCA 1K03A 2YCEA 4HNVA 2XN2A 2ZRVA 3TOYA 2WWDA 3CS2A 3SSJA 3N6HA 2PWEA 3RF9A 2ZZ4A 3N3MA 4GBUA 3WK3A 5EBAA 4HYVA 5C55A 2W92A 3WL0A 4RK8A 2WHKA 2ISVA 4XZBA 3VDHA 4HPNA 1DJWA 1X8FA 3NO3A 2PGWA 2KAUC 2ZKMX 4HZMA 3S46A 3TQ0A 1Q63A 3V4BA 1KTNA 3NPVA 3TYUA 1MYRA 3VD9A 2AQVA 3OVPA 2Y7FA 1ISZA 4MY8A 4CNUA 4AVFA 4PUEA 3BLIA 4UR7A 1UMYA 4AZGA 3LXAA 1EF2A 3SBFA 2FZDA 1E6ZA 1MXDA 3IIOA 5BW6A 3LHUA 2FZNA 4KFOA 3R12A 3GKFA 3N4AA 2REQA 3SCWA 1W5NA 2OQYA 3H23A 3WX7A 1RD5A 3L5MA 5EKYA 2ISSA 2DP3A 3R58A 3LZ5A 3TJ4A 4F48A 2Y88A 3B3DA 3W1LA 1TA3A 4B3ZA 1N2VA 2NUWA 4OBRA 4GQRA 1ISWA 1SYTA 2PE4A 4BHYA 3CUJA 4ATLA 2Q02A 2WSYA 4F0LA 5E5CA 1JZ6A 3W1AA 1RUSA 1LLZA 5HNNA 1EDQA 1EO5A 1VFUA 3B8UA 5A8QA 4Q8UA 4A35A 2ONEA 2Q01A 2FPVA 5FEXA 4ZQPA 3S1GA 3THDA 3OODA 1YHTA 2XH4A 2V68A 1R47A 2VOMA 4LF2A 3M07A 4M8UA 1ZRQA 3BJSA 3D47A 4KF1A 2QF7A 4BI5A 4J3TA 2FFCA 3VZZA 1M01A 4IMGA 3EMZA 1MQPA 3T0BA 1KGUA 1UD4A 2IKJA 5KZMA 2VMFA 2VX4A 4CEXC 1U5HA 3IGSA 3B0XA 1EJTC 4O28A 4D6GA 4UR8A 1TJ1A 1NWRA 2ZRXA 1R9YA 1CBGA 1PKNA 1TCDA 3EEZA 1E72M 1WNOA 2JE8A 1XSIA 1D3CA 1B1YA 1NP2A 3GHUA 1ZL1A 2PWDA 4AD0A 1LRNA 3TQVA 4ROPA 3VD4A 2XIQA 3APYA 3BXWA 1OHLA 1J01A 1R46A 4DJDD 1DHKA 4LY8A 4XSMA 1ZS2A 3V0SA 1KV5A 4GI9A 2E6DA 3SUWA 3LI0A 2QAPA 3COTA 4Y8FA 2DT0A 3GC5A 4LPCA 4B90A 5CJNA 4LW7A 4KFPA 3O9NA 1UH2A 2BFGA 2YCLB 1O4UA 4G9PA 2VEPA 3DXIA 3QY6A 1KC7A 2F6UA 1A5LC 4E8DA 4GCXA 3EZ4A 4UWMA 1ZJAA 3NZRA 1GEQA 1O6IA 4L56A 3UJ2A 3IJIA 1ECEA 1KBBA 3P0WA 1KLZA 3BZGA 3QJAA 4UTTC 2V3EA 3RCNA 3DFTA 1HTIA 4IFOA 2G41A 2ZX9A 3VNLA 4MY9A 3HPSA 1RJRA 3ENLA 4GZIA 1QNQA 4HCLA 3SZ8A 1SO6A 1IR1A 2OVLA 5LHEA 2VDHA 1PTGA 4HMNA 2DFAA 3NFUA 5BYWA 4QG8A 1LZOA 1XKJA 4WGHA 1E1CA 4UQAA 2CW6A 1KD0A 4Y9PA 3CBWA 5C2CA 3SQSA 3BARA 1XLDA 3EOUA 1RV8A 4UB9A 3HFYA 5E1QA 3R43A 2Z0IA 1O94A 2VFGA 3WNNA 3PZTA 3GNRA 2VR2A 3G8EA 3AXKA 1V02E 1XCFA 2REQB 3CUFA 2GGHA 1K6AA 3PZVA 3PP7A 2E8YA 5D37A 1EC8A 4KIEA 1XS2A 4LC8A 3RU6A 2WLYA 3WBXA 1JZ7A 3C2FA 2WYSA 3TTYA 1LORA 4WD0A 5REQB 4D8AA 3KTSA 1M53A 4IGNA 3UNDA 3KBMA 3VX1A 3RRAA 1VAHA 2P0OA 1CX9A 2O55A 3GH5A 5BRPA 5HNTA 4F0MA 1J5SA 1TV4A 4NU7A 1YXCA 1FWFC 3MV11 4MYAA 5C54A 1XYFA 4UCFA 1VJIA 1UPMB 2NXHA 2OYKA 1JPKA 3ALGA 2C1GA 4UTFA 4O14A 4ECLA 1TMHA 3BE7A 1YBQA 3HGOA 1T8QA 2Z1XA 5F4SA 4RJEA 2E6FA 5K3VA 1JGMA 1V3LA 1A5MC 4HYRA 3URBA 3BQ5A 2VKZG 1W9BM 3IUHA 1R7AA 3STCA 3Q4DA 3IVTA 2ZCGA 4C6IA 5D09A 4WOZA 5AN7A 3DX5A 3R10A 5GQBA 4B3KA 4DBWA 1F5ZA 2XZ9A 3LTSA 4WJ8A 1OQFA 2CHRA 1W32A 4JX5A 3BQ6A 3FFSA 3UBPC 4BS0A 1VENA 2YYTA 1FWSA 1EL3A 2V9DA 3DHDA 6TAAA 4Q32A 3DG6A 4MG4A 2V2HA 2RH9A 2QJJA 3O1NA 1FWRA 1P0DA 1J6OA 3MI3A 5I0DA 1GKQA 4F8XA 4GVGA 4MB1A 2RJHA 1Q13A 4CQBA 4CVUA 1Q6FA 4UTLA 3FGCA 3VKAA 1MNSA 5HR7A 3EDEA 5LGXA 2J7FA 1XJBA 1OFDA 2PU1A 3JU2A 1FWEC 4ZCWA 2IQ0A 1EGVA 2J7HA 1AG1O 2VCBA 3N18A 2FHFA 3EPNA 1JDFA 4FX6M 3F4NA 2ZA3A 1W5QA 1C91A 4M82A 3ZMRA 4LWWA 1KM2A 4E0CA 4M6QA 4OQVA 4DO6A 3ICJA 4D2JA 5K4ZA 5MF5A 2XN0A 1PWMA 3CZLA 3LG3A 4ILSA 2XZ7A 1NWSA 5CPMA 3VIFA 4EACA 1NARA 3EGJA 3VGDA 4YS1A 1ELSA 3W26A 4UNLA 2XIIA 1F4HA 3AAMA 4XISA 4GY1A 4KQNA 4AEOA 2OYMA 5CAKA 3EWYA 2C1HA 4WVXA 1JZ8A 4EIVA 5CKSA 3BSHA 2C1IA 4YTUA 2BY3A 3VMOA 2CWXA 1Z69A 4E6MA 3IAQA 3C52A 4MKNA 1SZFA 4LTSA 1OSEA 4GZJA 4JL2A 3N4EA 3RUBL 3M6DA 4LCSA 5CPNA 2J88A 1LT8A 5D33A 2WWCA 1J11A 3L67A 1B3WA 1R3RA 1VYRA 3ISIX 3F2BA 4OUEA 2E5DA 2XGIA 4J3SA 1RJQA 2G3NA 3CZEA 4C6QA 4QITA 4C7FA 1MW0A 5DRCA 1TWWA 3KOZA 3KVMA 4TXEA 3TN4A 2OB3A 3OLDA 3L0NA 3QY7A 2DSVA 1OD0A 3E12A 1VBJA 3NA8A 4UTWA 2V5KA 2OX1A 3WEZA 2CLKA 3UJEA 4QQ3A 4W88A 1QPKA 4E4FA 4AB4A 3IJ8A 3ZIZA 3B40A 3KVKA 1VQTA 4DXKA 4GYJA 3UEQA 1PX4A 3WLTA 2ZWYA 1PB0A 4QS5A 1WV2A 2R1KA 4LX4A 3AMGA 1F9CA 1HFBA 3W7GA 5I07A 4WUIA 4JAWA 4M81A 3WFAA 3UJFA 1DJNA 4NX5A 5FIPA 2VUYA 1LM1A 3V75A 1TVPA 3RG6A 3R6IA 1GEHA 3ABXA 4RDWA 1E4IA 4H2CA 1Q66A 1VP5A 4K8HA 2FGZA 5C5YA 3W7KA 1YE6A 4KCTA 3GR8A 1HVQA 2CLEA 4KEMA 2Q3OA 7TAAA 3EKZA 1CXLA 3EB2A 3P2VA 1OIMA 2Y6ZA 2QGYA 3P8JA 5BROA 3VOCA 2ABAA 4MSSA 4QFUA 2VO5A 3SUVA 4L1GA 2GL5A 2Y70A 3THUA 2A1YA 4XZHA 2J7GA 3ALFA 3C8FA 3LV6A 3TV8A 5HUPA 1S5VA 3IGUA 4OOZA 3AZSA 3VINA 3URNA 3TTEA 1EP2A 6XIAA 3OYZA 1D9EA 2CKRA 5AFDA 1OFBA 3GTNA 1BG9A 1LOQA 1QTWA 4U28A 3PTDA 2J7EA 5AZ1A 2VRKA 4NZ1A 1F3XA 4MAZA 3TAKA 1AJ0A 3CUGA 2Z28A 4B5WA 2DT2A 4HGXA 1TFVA 6REQB 2FZBA 4XAZA 3P5YA 3S0CA 5FJTA 2QJNA 2I17A 4B2DA 2AMXA 3RLVA 1XIJA 8TIMA 2W79A 2WO5A 1UROA 4J9JA 4FXJA 1KW1A 2NX1A 3AJXA 3LV5A 2EPNA 4KFNA 1LL7A 4AIEA 1BXCA 3UYCA 5I3JA 3T78A 1M7XA 1LT7A 5KZDA 1ZNNA 5HULA 1ZP3A 3DU0A 2HXTA 4CKQA 4JS3A 1L9WA 4NZ3A 2R6OA 4LUJA 1VCVA 4M19A 4QG9A 1EGMA 4YJ5A 2PBGA 1W17A 2WPGA 2GGIA 3QTGA 1BYDA 3MUY1 1Y8BA 9RUBA 2XVGA 1XI3A 3PVFA 5D2YA 4LYRA 5A1AA 2SFPA 5EU9A 2R8WA 1ODUA 1KRAC 3OJGA 4L65A 3GE7A 1X6NA 2WSKA 4LAZA 5LA1A 2ZRZA 5KZEA 4C6CA 3DHUA 4ORIA 3A12A 1X1OA 2WHLA 4FF7A 1HJQA 2BB0A 2GSEA 1GOKA 4JTTA 1JJKA 3PHAA 5CBIA 3GX9A 4IIDA 1G5AA 5D9OA 2J78A 1J0HA 3IIXA 2YSWA 3MVIA 1JYWA 4REQB 3PANA 4ZFCA 3MMTA 3WQDA 2JGQA 1IT7A 3T08A 1CXEA 4XBKA 1O7AA 3ABOA 3YPIA 3AS2A 4ICCX 4BK9A 1W1A1 4JQ4A 3PULA 2G3MA 4A4AA 7PTDA 4G56A 1S2VA 2PB1A 4DEFA 2BODX 3OB8A 5AHLA 3FHAA 4DAIA 3M0JA 1AFSA 4DO4A 1O68A 4TX9A 3BICA 3S5ZA 4R7JA 4WZHA 4S2CA 3HF3A 3LU2A 3GG8A 1KCXA 1OEPA 3TC7A 3UR5A 4AIBA 3WQ5A 4D6EA 4IUOA 3IRDA 2O9OA 2FPTA 1KM6A 1H62A 3QGAC 4CVWA 1CTNA 1EC9A 4H04A 2X0HA 3N13A 3W74A 2E5BA 4IF2A 2FHBA 2NQLA 2OR2A 2Q09A 1E6PA 2J8FA 3QXBA 4U31A 5HWNA 1ZGDA 1TV8A 2CZEA 3EWBX 2EBNA 3I3BA 5I3KA 3H7VA 1VYSX 4YIWA 1TPH1 4FXSA 3LTYA 4NP7A 3S2JA 4ICNA 1PX3A 2RDXA 3RO8A 3UU0A 3VE7A 4F0SA 3PR2A 1JYVA 1CGXA 4IG2B 3TK7A 1IR2A 1WZMA 5BXTA 3ITYA 1EXPA 3S2NA 2GLKA 1ESWA 1QNOA 3BLOA 3I4KA 3A3HA 4J40A 2PTDA 1W3HA 3VIPA 2AQOA 4PCFA 1W3NA 3P3BA 1CECA 3VD3A 1Z6KA 4D1JA 1H7WA 2CCRA 1VRDA 3T09A 4JY9A 3WMSA 4DYEA 1R9ZA 3UJSA 4JFWA 3AO0A 5EA9A 4C1LA 4PTXA 1G7VA 3RPDA 3L23A 3T0AA 5FAGA 4R7WA 3I65A 1FXPA 3KOWA 4V2XA 1S1PA 4JCLA 3E2RA 2YA1A 5BRQA 4LVDA 4CNSA 4LUSB 4I3GA 1ISYA 5BCAA 2VVSA 2R91A 3OBAA 3TONA 3S5SA 1UQYA 4GNVA 4EP8C 1PIIA 4L4LA 3EWUA 1I2QA 5U7SA 3F1QA 3G2GA 4D71A 2PU0A 4LV9A 3CV6A 4CD8A 4Q7NA 3M0ZA 5DFAA 4S38A 4WSHA 3M0IA 5FJRA 4R7OA 3BMVA 2OQLA 4O19A 2BXVA 1TV3A 2ISDA 4W5ZA 3MA8A 1AODA 1R9XA 3M0MA 3SRDA 4ZQCA 5IXEA 4JTDA 1FWBC 2PDKA 1TREA 4HB7A 1TG7A 1XW8A 4MTVA 1WXYA 4JOMA 4HVXA 5LNWA 3IUIA 1VEPA 5GJPA 2ICSA 2YB4A 4TV5A 2G96A 1F2JA 3CC1A 3W6YA 2FVLA 2VD9A 2WLZA 3AFBA 1PS9A 4IGHA 3NQ8A 4ADTA 4ZO7A 1K8YA 1M6JA 1EIXA 4FK9A 3BAKA 4JEQA 2Y2WA 3WF3A 4D6DA 2VURA 1E3ZA 1IEWA 4PMRA 1SZRA 1J2BA 3SN1A 1FWAC 3R4IA 4KCWA 3BUVA 1NEYA 4MPQA 4PCNA 4LBSA 1W8GA 2IKIA 2PF0A 4AD5A 2PDBA 3AMKA 3BLPX 3QR1A 1OD8A 2GDVA 5I06A 2QIIA 1WBHA 1YE4A 2Y24A 3GB6A 4IL2A 4AZCB 4FO4A 3CV2A 3CUXA 2NV1A 1E1FA 4AZIA 5I5RA 1T41A 3NQFA 5CZTA 4M6PA 3JZUA 2AL2B 1P48A 2WSRA 1Z41A 1UWIA 4LAOA 3AU2A 1LP6A 1ZJBA 3VNMA 1HJWA 1QW7A 4XO7A 2ACSA 2QR6A 3KZPA 1ZQ5A 1BD0A 5I2UA 3M41A 1W31A 3NQGA 4B3LA 2J13A 2V38A 3GXFA 4KT2A 4MPKA 4Q4SA 5C70A 4TR9A 3L4XA 2NT1A 4RE0A 3VGFA 2VC6A 1TWSA 3PZNA 5MKGB 4L61A 2A5HA 2FB3A 3PC0A 3VYLA 1BEUA 3EB3A 4DJDC 1GQIA 1S5MA 1VH7A 1AL7A 4K8GA 3QLDA 4BI6A 3L4WA 5BOOA 2QCMA 1H41A 2H8XA 2AGTA 3WD4A 5FKYA 2PC4A 3HV8A 4X0NA 3HG5A 4IP5A 2ALRA 1SGJA 3XIMA 1M7OA 3W83A 4DYJA 4LB3A 1E5NA 3NQ6A 1DWGM 4NZ5A 2A3AA 2QCFA 4B5TA 1J0JA 3ZVIA 4UXDA 3F5LA 2XFFA 3F5JA 1JQXA 4QHRA 4BQ2A 3IK2A 3PJTA 3I7QA 3NCOA 3P0XA 3S9IA 1U1HA 3O3RA 3DGRA 3TXZA 3KOYA 2WNWA 3SCRA 3QPYA 2VZUA 3NEHA 1SZNA 3CAWA 2BZNA 3DFPA 3Q94A 2J9XA 1G1YA 3P60A 3WQWA 5KZ6A 2FLIA 3ZM8A 4ML9A 4G1KA 4L1XA 5HA7A 4GG9A 4US6A 4YTRA 4MWAB 3W28A 1Q4NX 3GZ3A 4UUIA 3CH0A 2BOFX 3NQ7A 5CG7A 4OU1A 4MLJA 1W3JA 3FOKA 3SAZA 2C15A 3BCDA 1F6YA 3PWIA 4EE9A 2YB1A 3RJYA 3NPUA 3VOFA 2WMIB 1H61A 1K1DA 3GFZA 4O18A 4PEKA 2CNCA 2OKTA 4MM1A 1UIPA 4C6BA 4J27A 4L7ZA 1SFSA 3AWNA 3NTYA 4ATWA 4INFA 3B9NA 3P62A 1LWJA 2CLOA 3T40A 4FNRA 2G8ZA 4FX7A 1KCLA 2VGFA 1X6UA 4GGHA 3W7CA 3MUZ1 1HP4A 1HKIA 5CSRA 2C3ZA 4LRSA 4UQCA 5K9XA 2GSJA 4MLRA 1JUEA 1AH3A 4O16A 4QM1A 4KCVA 3W0KA 4PULA 1NM9A 4MUZA 3RIKA 4NZJA 1KRMA 4LC6A 1S39A 2CEQA 1OCNA 1QI2A 4PMOA 4BI7A 4QNEA 2A3HA 1EKOA 3RX4A 4MMWA 1UH4A 3PFRA 4K68A 1QOQA 3UWVA 3MKKA 4K2SA 2YW3A 4H6RA 2L5HA 4KBXA 3UXDA 4C5YA 4Z42C 4PYSA 4LS2A 1PWLA 4WY0B 1D7FA 3TN5A 1UC4A 4CQCA 3W73A 3IJLA 4E38A 3P61A 2FYMA 1FTXA 4RW3A 4Z2GA 1S5NA 1HW6A 1YTDA 1LQAA 2POTA 3NM3A 1WA3A 1RSCA 3TFXA 2PAJA 4HU8A 1T99A 1W6TA 1HQTA 4MADA 4W8AA 1A0CA 3LYEA 4D8ZA 1L8PA 3A4AA 4PE8A 2VFDA 2VEFA 2FHCA 3IWPA 4HMCA 2CERA 1N8WA 4YLWA 1EYWA 5I00A 1VJSA 4PMNA 2OWXA 3NURA 3ATYA 2VZTA 4JTRA 3ITXA 2WMKA 1G4EA 3T2OA 4EK7A 1M7JA 1BVWA 4WX2A 2BOEX 1PSCA 1F07A 3DFOA 2JFEX 4O1AA 2RHGA 2FTPA 4P7RA 1SFJA 3NQCA 4D6CA 1RD6A 3JZEA 1GOQA 3TW9A 4LV4A 5DLCA 3U9IA 1YBQB 1BHGA 1P0BA 3GYEA 4N9BA 4X3ZA 3NQEA 4PL1A 2VTFA 3GVWA 3CV1A 5D9PA 1UBPC 1C8VA 4FLSA 3AMCA 4AHQA 1CGUA 3G6MA 4H00A 4DPPA 2WSQA 3H2MA 3FAWA 5C71A 4V15A 1IE7C 1HO4A 1US2A 4MNMA 4AZ7A 2X7VA 1MEIA 2F61A 3CK5A 5J8LA 4H4IA 4DUVA 3OVGA 3T55A 4DLFA 2OZ0A 2Z7KA 4CN1A 2GJNA 2CYGA 4WDUA 5LIYX 2CHNA 2VC5A 3FAXA 3W01A 4GVFA 5A6SA 1ZJIA 2NLIA 3LGGA 2VGIA 4QE1A 4DJFD 3TX9A 1IZJA 3C5QA 3REQB 5CPLA 4IICA 3NOEA 2NUXA 2Z1WA 3GYCA 3VCNA 5EMUA 4MZ1A 3QLLA 5CCZA 4XZNX 1FWCC 2GWGA 3Q65A 3HPXA 1A5AA 1GOWA 1JAEA 3OLGA 2E8ZA 4XZLX 3VNYA 2NX9A 3R2GA 2PLMA 3U5YA 1C7TA 3EBVA 4J2MA 3ITVA 2VNCA 2PP1A 1MZHA 3KM8A 3Q2DA 3F4WA 3GVGA 5DXYA 4YL2A 1PHWA 3W00A 2HS6A 3EWCA 2ZUUA 5GVJA 3H6OA 5BNKA 1P6BA 1JZ2A 1C93A 4K3ZA 2G4JA 1H51A 3TU9A 2QPXA 5AZ0A 1W3TA 3SRFA 1MUWA 4BJHA 3SURA 3ZQ9A 3C0LA 2E28A 3ARYA 3ZFHA 5MHBA 3F5KA 1UWQA 5TBOA 3RPTA 2V5LA 3PZMA 2BTMA 4AHPA 4XD3A 1XRFA 4HIBA 4HOWA 1C3FA 2WKLA 3H2OA 1MVYA 4LAMA 5HDRA 2CKSA 4NNBA 2QYGA 5CC6A 3W4RA 3B8WA 4NKCA 4GH1A 3KUMA 3DEQA 2C0HA 5BXPA 4XZIA 4DO5A 5HWJA 3H4XA 3G0XA 1HT6A 5EPDA 1RCQA 3LTPA 3LHTA 1QATA 1CYGA 4XG1A 2GVGA 1VBGA 2DORA 2OX4A 3G1VA 2ZXDA 1PVNA 1W5PA 2VZVA 1ONWA 1PZ1A 2WMJA 4RV3A 3M4HA 4DB7A 5EB8A 3FYYA 3WLKX 4GLEA 2IQTA 3V0UA 4ERIA 1IV8A 2PZ0A 4QJ4B 3GFXA 3QYQA 3MHUA 3F03K 3W7EA 2FZ8A 2PLJA 3W1RA 1RQEA 4DWSA 3PZUA 5LGZA 1KBIA 1V79A 2NQHA 3KL0A 1BQGA 1JDDA 1FBAA 4O8AA 3QVQA 1UIOA 4FA3A 4BQ5A 1YEYA 1B9ZA 1TV5A 4Q22A 3SB0A 2VDGA 2I9EA 1SFTA 4MKSA 3T4CA 3L9CA 2D1ZA 4LSBA 4A2SA 4QIUA 3QTPA 4S3BA 2NWRA 1LG2A 1BYBA 1POKA 5HK4A 1VKFA 2OYLA 3TC3A 1XIGA 2WZHA 2G3FA 3WDPP 1EDTA 1OFEA 5C2GA 1QI3A 3MZNA 3W2LA 4UQDA 1O5RA 1PCWA 3JW7A 2ZTKA 3AS0A 3CUIA 4HZ7A 1CGWA 1PHQA 1XUUA 5KTLA 4HHHA 2XU2A 4PB3A 4WCJA 2VRJA 1TVLA 4GFIA 3HMJG 1W1B1 1VIWA 5GNZA 3GHSA 4F0HA 1VZWA 1XH2A 2A4AA 3LB0A 3PG8A 4C7GA 1TTJA 3IANA 4U4MA 3W72A 4C6FA 1J6PA 1B2YA 4IX0A 3HMCA 4GJIA 4N9CA 1FX6A 5REQA 1FWNA 3H24A 1V0NA 4AC1X 4GYPA 1VFOA 3W70A 3IARA 3LSBA 3ME3A 2ATSA 4PMJA 4PGLA 4K7VA 3VTRA 1SO3A 2I5QA 3W88A 4AVOA 3C0JA 1HKJA 2NV2A 2P88A 1VLWA 1X97A 4CD5A 4GJ1A 1ICPA 5B7ZA 2PF8A 1PTDA 1X39A 1TWZA 1Q3NA 5G2HA 3CQJA 4XAPA 3U5UA 3CZJA 4ATDA 2DSWA 2FH6A 1Z89A 4TVDA 1NWTA 1EEPA 5CBJA 4KESA 4EKJA 4FS9A 3BMXA 3SFKA 2DZBA 4N9EA 1C90A 3J7HA 4GYFA 4UFIA 3FKRA 2PDWA 3EDJA 3A4XA 1B4KA 1OGGA 4XVEA 2QVNA 1JD9A 1HO1A 1JCXA 2F7FA 1WZAA 5AVHA 4K8EA 1SSGA 3N19B 3BJTA 4JIPA 1KBJA 2DU2A 3I68A 2P0IA 3WN6A 3VDGA 5E93A 1LOLA 1RZMA 2PDXA 3MQTA 2QUVA 3ZYZA 5HWMA 2VWTA 5I23A 3IJ7A 2V5BA 3TH6A 1LTDA 3K46A 3MANA 2E67A 5FCZA 2ZX5A 3REQA 2A85A 1RQHA 3NPWA 2VQUA 5C2XA 1MFUA 3TN6A 3MYPA 4DF0A 5KEZA 3WO8A 2W91A 4MFDA 3RGTA 2BX7A 3ZVHA 5HBFA 1UR0A 3SR7A 4HHMA 3TQKA 1YX1A 1GJWA 1QO2A 4J28A 1G69A 2AMGA 3NXFA 1VBRA 3VIKA 2ACRA 3GQYA 3TAOA 3MUCA 1IGSA 3PBWA 4M6VA 3CTTA 4EPKA 3M64A 4W5UA 4G7EA 5FF3A 5AY7A 4C1KA 1HVXA 1H7RA 4B5SA 3HJZA 7ODCA 4AWEA 3CZ8A 1G4SA 1HJSA 1E1CB 3N9SA 3P8IA 4AWSA 1KM1A 4C7DA 4UTMA 1F3WA 4TTUA 2FTWA 4JD4A 3VILA 3SY1A 3VXGA 5H8UA 2JBMA 4NRRA 4W84A 3DYMA 2WJEA 4JFVA 1AA1B 4IMEA 3DHFA 1XRSA 3OA5A 2CLLA 4Q8PA 4TV6A 1JYXA 4HZ8A 3UWEA 4G8TA 4IHCA 4DNMA 1LL4A 1XH1A 3UCCA 2GGEA 3UYIA 4X9YA 2ISWA 4QISA 1XGEA 2HMCA 1NSJA 1DV7A 1QHPA 1GQNA 4HN8A 2JF6A 1W1TA 1JPDX 4NNCA 3XISA 5HINA 4H9XA 1TZZA 1BTCA 1XKYA 1U5VA 1G7UA 3DIPA 4PN2A 3CWNA 4ZE4A 1CEOA 1ZB5A 3LSCA 3M5YA 4LUTB 3T8LA 1H50A 1HL2A 3E1F1 3CB8A 3MO4A 5JIPA 4HA3A 1PIFA 2ATMA 3TYCA 2P8BA 4QSFA 5T26A 1KXVA 2DQXA 2FMNA 2NQ5A 2ZZ1A 3AXIA 3FY1A 1WB0A 2W6RA 4FLRA 3NGFA 1TCMA 2QCGA 3EKGA 4Z1BA 1EFZA 4E4UA 1H7PA 3HG4A 2Y5EA 3VIMA 3WBWA 2JALA 3CU2A 1DORA 1XQKA 1NELA 2JK2A 3PPCA 5E9AA 2HCVA 1VS1A 3GXIA 4E2DA 5I77A 3UR7A 1R3TA 4Q6JA 5K4XA 1S2WA 1K6WA 4L6OA 2YZRA 1I2NA 1R2TA 5AYXA 1XYLA 3PJWA 3RR4A 4WRHA 2Y8VA 4IQDA 1PX8A 1FH9A 4DBSA 1YNPA 2Q71A 4GNKB 3NZQA 3MO7A 3MV01 4PBEA 4F79A 3W07A 1A3WA 3UXAA 4MDPA 3UY8A 4H01A 4AYGA 3VABA 3K4DA 4O4WA 2WJZA 2DIEA 3BG3A 3ES8A 4RW5A 3UPBA 2Z6JA 1UR4A 2PODA 1MO0A 1POJA 3VVGA 1F76A 3IACA 3BJFA 3TCEA 1WKDA 1JF5A 3MCNA 4R34A 1JFHA 3OVRA 5ENLA 2XIMA 3RM8A 2O92A 2YGYA 4BQ3A 4N6FA 3SUSA 1W3LA 4DN1A 2E6YA 3PPHA 4WIWA 4IX2A 5AC4A 2PTYA 1UKOA 3PPFA 5FSEC 4UBPC 3M7SA 4MKVA 3LQLA 4PMXA 3EEGA 1ZHAA 4GC4A 4FLOA 3SIZA 3P74A 1CLKA 2RKXA 1PDZA 4OGZA 3TC6A 4UTWC 4HCDA 1QI5A 1TKKA 2C14A 2DH3A 3MP3A 2Q8LA 3XINA 3W29A 2G3IA 4GPNA 1EZWA 1WZKA 1XLJA 5D9MA 1XLIA 1VFHA 3LCGA 3VOGA 2QV5A 2R94A 5HUOA 3TOPA 3E0VA 4WLCA 3BGJA 1Y65A 3S2CA 3E5BA 5A5WA 4OHQA 3KAOA 2Y1HA 5I7GA 1H7NA 4Q8QA 1E4LA 1EQPA 1S2UA 3LY0A 7TIMA 1VBHA 3LD5A 3M5XA 5CQ1A 3LHWA 2CETA 3GFYA 1XPYA 3BCJA 4K6AA 3CT7A 4ACYA 3MCOA 1UC5A 2Y62A 3VUPA 4PMQA 2W27A 3C6CA 4O1CA 3K8LA 2IMRA 1FWJC 1Y0EA 4Z0JA 4JPGA 1N82A 2HE5A 3S2MA 3B8SA 4LVBA 1ZUAX 4FZIA 3C0SA 1LBLA 1DJZA 1ML1A 4P61A 4AF0A 1HXJA 4RV8A 3IPWA 3R13A 4Q6XA 1ECQA 3KP0A 3KEHA 4AXNA 3HPZA 3ZLGA 3P5ZA 4NUWA 3WSUA 2DPEA 2V5JA 4I6VA 4MWAE 4AMCA 5HPOA 5G4EA 3GWQA 1HGYA 2PDMA 3GG1A 3B0VC 3ERPA 4BEUA 3PBYA 1HG3A 3FJLA 3HB9A 1UD2A 4GI6A 1DXEA 2A3EA 2X09A 1KRCC 3SADA 1TELA 1ZCOA 3L66A 4HMEA 1OK4A 3G24A 4HJWA 1QHZA 1A4LA 1W2VA 3AYRA 4P8WA 4Q8OA 2VHLA 4YYCA 2YCLA 4JEJA 2PDPA 1YADA 3QBUA 1QBBA 3TA9A 1CB2A 4J5NA 5G5IA 3GVVA 3MWCA 3ARXA 3O8AA 1LOSA 2O4MA 3QKEA 2DUZA 2E7FA 1QVBA 4RDZA 1P43A 3T0DA 3GTHA 2DY3A 4Y9NA 3BZJA 3E6EA 1UHVA 3H22A 1EBHA 4YXGA 3QR0A 1GVEA 4HT3A 2BXZA 1GQLA 1YXYA 5CC3A 4EF8A 2DW7A 3VAVA 2PWGA 2JIEA 3N04A 3KS6A 3VNDA 2TMDA 1I1XA 3D3AA 3NSMA 3E2VA 1WX0A 1UPPA 3SCQA 3DENA 7ENLA 1J0ZA 4I8YA 3CEUA 2MUCA 4AX6A 3UXKA 3STEA 3ABQA 4Z0SA 3PBGA 1MUMA 1DWAM 1X98A 2Y7DA 5LNVA 3R11A 1UWUA 1M1BA 1ME9A 1BXBA 2VC9A 5A6LA 3ZR4A 3DESA 4ADUA 1XC6A 5JU6A 2G97A 3L5LA 1GVYA 1GZJA 4O53A 3BAIA 1Q4WA 9XIMA 3ZXWA 3W27A 3F2DA 1K8XA 2VFEA 4PSRA 4LUTA 5B80A 1KLYA 1XIHA 1KFKA 3WD1A 1FVPA 4MWAD 1Q6GA 4MB5A 1YQ2A 1XINA 2RGLA 1E71M 2VX5A 5IHRA 3WNPA 2W62A 1KV8A 5AC5A 4FI4A 1EWDA 4N6EA 3W1PA 4YYFA 1WCGA 3QSTA 4HNNA 3BW2A 1ZAJA 3H4GA 2QPSA 3CPGA 1SR9A 3W6LA 4RNFA 1LG1A 4QDPA 3HFTA 3PN8A 1RP8A 4RNHA 3A5FA 3NAVA 3WUGA 1AMKA 2HVMA 2YL9A 2PPGA 3NG3A 3MSYA 3TROA 3ZSSA 2AGKA 4CN4A 3W37A 3LRLA 1ZZMA 3GNXA 1GVOA 3MU7A 3FDKA 8RUCA 1V3IA 4YN5A 5D02A 3QHMA 3TTQA 1J93A 1GTHA 5CSSA 4QCFA 1OCBA 1K9DA 1YW1A 4W87A 1RCXB 2DV0A 4IIEA 4NILA 3KRUA 4IISA 5ECUA 1ITUA 2HJPA 5FOOA 5DT5A 4UFHA 5I78A 3WUFA 1EJVC 1NF0A 4WY0A 1PBGA 1P0NA 1EJSC 1K9TA 1EJWC 1DWIM 3G18A 3OZPA 4NAFB 1DPMA 4CQDA 4FP1A 1Y5WA 2MNRA 1E55A 2VDIA 1F6PA 4E2OA 4IGMA 3VIJA 2YCKX 3VIIA 3TEVA 1GHSA 1SJCA 3FEQA 1OX6A 3MSGA 1XIIA 4CCEA 1UCWA 4MZYA 2PDIA 5DXXA 1K02A 5D8ZA 1UWTA 1EUAA 4AG0A 1E6RA 3LI1A 3FJNA 1GVQA 4UFLA 3B8DA 1QASA 1XLEA 4J3WA 3T8QA 1KM5A 4ZODA 4GXWA 2WNZA 1GKRA 2OLHA 4P2VA 3MT1A 4Z2HA 3W7LA 1R3VA 1KFBA 5C9ZA 4PA8A 2VFHA 4ZOCA 3TJIA 1R5YA 5D03A 3HPAA 3ZZ1A 1HKWA 3D0CA 2PWHA 1SQ7A 3VGGA 2WHJA 3PJUA 4JGDA 3KTXA 4QJ1A 1RY8A 3K13A 3MBDA 3GNPA 4ZOEA 1G0CA 2XN1A 4PZVA 3GBEA 1H5VA 3S1VA 3N2OA 1I0DA 3WH5A 3C2EA 4Y90A 4IJBA 3QEZA 4O57A 2NQJA 1WE5A 2V8ZA 3UG8A 4AD4A 1E15A 3TSDA 3GAKA 3E96A 5BU9A 2Y5JA 3KVJA 3ITTA 2GGJA 4O13A 2A79A 2FDMA 3QHOA 3V1HA 1AZ1A 3N12A 3VM7A 1SUXA 3P7YA 4GX9A 3W7DA 2Y89A 3MC5A 3LCFA 3QFWA 2VC7A 1G94A 2DEPA 2IPGA 3STPA 2O9RA 4CNPA 3LRMA 3QQ1A 4L4OA 1KB3A 2PDFA 2WC3A 3GUWA 1V6UA 1W9DM 4DM2A 1TZ9A 1GPFA 4WGXA 3MUIA 1A0EA 4S1FA 4LNCA 1CW2A 1X7IA 2H9AA 2AOSA 2AL2A 4JX6A 1ZAIA 1XLCA 2PLKA 4YHEA 4GBDA 1MDRA 2F8QA 4KS0A 6ENLA 2W0UA 3BANA 3SCOA 3GR7A 3N15A 3L2IA 3S5NA 5DN1A 1CNVA 4KRZA 1UUOA 3QQ0A 4BQ4A 3AYTA 3RYSA 2XFRA 3GH7A 3EA3A 4CCDA 3KZSA 1UMLA 3ZR5A 1LLOA 3PBVA 2GGGA 2PTXA 3TWAA 4ACZA 1XLBA 1F3TA 1XLLA 3MP4A 3AXMA 3APGA 2XSXA 1NFBA 2Y0FA 1RLDA 2OLAA 1DVJA 2GK1A 4BKNA 3ZT6A 5FJOA 1XCXA 3ARPA 1G4TA 4FPSA 3IV8A 4JIEA 1M3UA 3G1DA 4OVXA 3OTRA 1RK5A 5FL0A 4FXFA 4AH7A 3UVIA 2X30A 1KTBA 3MUXA 2CXEA 2BXYA 4W8BA 1GCYA 4W93A 3CIVA 3PTMA 2WAGA 5LZLA 4WKAA 2J9YA 1OK6A 3CNYA 2HE8A 3E9AA 2XGBA 4YTSA 1W1PA 2AQWA 4UFJA 2TPSA 2V3GA 5I3HA 4E2BA 2BG5A 1GHRA 1DBTA 1DHPA 5HQMA 3UQNA 5FF4A 4A22A 5CSUA 1Q65A 2YW4A 2ZADA 4NX0A 5F1VA 1GYMA 2W3ZA 2A2IA 4FMVA 2CWNA 1VFTA 3SUTA 2X2YA 3M47A 2H8ZA 4IGSA 2DVXA 3FYPA 2WMHA 1REQB 2GQ9A 2WBGA 2ACUA 3BAXA 1RXOB 4AZBA 1PE1A 4E5TA 3VDAA 1A5CA 3H2EA 4CD6A 4WSKA 1LYXA 3CYJA 4MNJA 4P7NA 4UZUA 3WFZA 3WNLA 2IS7A 1V77A 4JTCA 1Q6EA 3SJNA 1P0KA 4F0KA 1KA9F 1XYZA 4X63A 3VKJA 4GUGA 4LCQA 1HUVA 1KM4A 4RKAA 1ENUA 3O6DA 4HK7A 3VO0A 2PD9A 1TRDA 4EPDC 1KGXA 4J3VA 3T42A 3K1GA 4MJMA 4MIMA 1XLAA 1BVZA 2QJGA 1CPUA 1V3MA 1K7XA 2VI0A 3EWXA 3H8AA 4ASTA 2YCJA 4HA4A 4FNQA 3UWYA 2AAMA 2QMJA 2E9MA 3KOFA 3VD7A 2VZOA 3G6LA 3SO7A 4A3YA 2XIBA 1TR9A 3L4ZA 3TYEA 3UESA 1FHLA 1FH7A 1H2JA 1CDGA 1QK2A 4HKPA 3WLMA 4URIA 3NGJA 3WH8A 4MOZA 3FA5A 3WBAA 4DBEA 3FDGA 1FWGC 5FI8A 1TYGA 5E6ZA 2DZUA 4AY1A 2PI6A 3OOQA 3WD0A 2R24A 3MI6A 1GT8A 2ZUWA 4D8LA 4LU0A 3N11A 4NXKA 3C2VA 1OM0A 2C19A 2WSPA 3U0HA 5AKQA 4H8HA 3QN3A 1KWKA 1QNRA 2QUTA 5JVLA 3U2EA 3R94A 2D22A 3CL8A 2DIKA 3UY7A 3IIPA 4JN7A 4ML4A 4Q8TA 1DXIA 1JG9A 1TPDA 1IXQA 1U30A 1FFRA 4JNZA 4AIOA 3MCMA 4R88A 1AH0A 1T8XA 1A50A 1ZTVA 3TZNA 2CLFA 1TMLA 1P6WA 3ZWTA 3WBEA 3FSUA 4D1IA 2D2OA 2BDQA 4M5PA 3S1WA 1DIEA 4CQ8A 1C92A 3PSVA 3LPGA 2GZXA 1HIZA 2YBTA 2GUBA 4J35A 2VZSA 1EZ2A 4IJRA 3QYSA 4C60A 1QUMA 4GE8A 5J5RA 5EYWA 1U2YA 1ZSXA 3OZYA 3S9ZA 5HMSA 2ON3A 1WUFA 1XFBA 2NVAA 5BMWA 3K2GA 4H7CA 1CGVA 3FS2A 1MQQA 4CU7A 4UCGA 2E3ZA 4CN6A 4GNJA 3LLFA 3N6QA 4ZMGA 1R7OA 2HZGA 5JH1A 2NVDA 3WLJA 1WUEA 1NQ6A 2X0SA 3UCDA 1BRLA 3N25A 4ZQNA 2UY2A 3MJYA 5GJNA 3SSZA 4TX8A 1MQRA 2D23A 3TYBA 1G01A 5HXMA 3CWHA 2EHHA 5L9FA 5KINA 4TUFA 5H2ZA 1K4HA 1GGOA 3OIXA 4C6PA 3K5XA 2W66A 1ZBWA 4X2PA 3OQEA 5DO8A 4S3KA 1VD6A 5E09A 3BURA 2FVKA 3W71A 4QG6A 4OIFA 2ZXAA 5CC5A 5HJYA 1NU5A 3G3MA 2INZA 4YTQA 4XD5A 4GUIA 5C7VA 4GQQA 1XP3A 3IJDA 4O0ZA 1VPXA 1S3TC 4F2UA 1IHIA 3VMPA 1RR2A 3OO2A 5J04A 3R79A 1AH4A 4CQAA 3ZT7A 2WJDA 3M5VA 3OU8A 3THQA 2PDLA 3TMLA 3C56A 2ACQA 3A6OA 1UR9A 4B16A 4YTTA 3P81A 4R33A 3G1FA 4OZOA 3OW1A 3VOJA 3UWQA 3W1UA 2CU0A 1S2AA 1OYAA 2UZ9A 5U4NA 1JVNA 3ARVA 3DKJA 1TJ2A 1XR2A 5LXXA 3TQPA 1Z3NA 3WQVA 1XISA 4IL0A 1JNDA 1OC6A 1D3HA 2IPFA 4PTWA 4CCZA 4MF4A 3STGA 2YDSA 2PD5A 5ABEA 4HSOA 3GDMA 3WFLA 3F4DA 4JQ3A 1XICA 3UG3A 2ZFAA 1C9WA 5AC8A 3WH6A 3OA3A 2BMBA 1GNXA 3NEVA 3VE9A 2WCGA 4XKYB 3WQ8A 1W3KA 3TWBA 1OT1A 5JH2A 3VPLA 1XIDA 2XISA 1JCLA 3GRIA 4LY4A 1OC7A 1XBYA 3GW0A 1EEXA 3G0UA 4FR1A 1XYMA 3SCTA 1G67A 3O05A 5BU6A 4HNCA 3AWOA 2XG9A 1MZRA 3GG7A 3DG7A 1EO7A 4KCUA 2J62A 1KFLA 3R0KA 4IP7A 4MHBA 2IW0A 3O7UA 3VKDA 1YPXA 3ZT5A 3HGSA 5F1UA 4GVHA 3U57A 1P5BA 2YFOA 5CEWA 3QMSA 4M80A 3KRZA 3GTFA 3HN3A 1HKMA 3R7MA 3UETA 3TYDA 3OZOA 3MVTA 6TIMA 1O66A 1FCBA 4NRSA 4YVPA 3R5EA 5MKGA 2INEA 1VFLA 5FAJA 1H0IA 1V0MA 3NVTA 2AKZA 1TWDA 3NSNA 3LEPA 3RPMA 2ZUNA 5E0KA 2ZA1A 4NVTA 1G9HA 3U4AA 3HBLA 3U2CA 2P3EA 1GZGA 1GOMA 1NFGA 1H60A 4H9ZA 2OPJA 3R0DA 3BVJA 4JDBA 1UKPA 3M0YA 3SRHA 1V08A 4ZOAA 3G1HA 3W25A 1RK6A 4WKFA 1XGDA 4RR4A 4WR3A 2F6KA 4HA0A 5G2WA 3ES7A 2RDWA 1QWKA 1BSLA 3FK4A 2BVWA 1A3XA 2ZZ7A 3W2MA 2E9LA 2C7FA 4L9YA 4KGJA 4M24A 3LXCA 3DFNA 3PG9A 2ZZ3A 5PTDA 4YU1A 3BOFA 2RDTA 5T91A 3B05A 4H8UA 5D2WA 1PL9A 4NI8A 2P50A 1UKQA 4DQWA 2W4XA 3WUEA 1DJQA 8CGTA 5K2ZA 1E0TA 1JULA 1J4EA 5AHFA 1W3IA 1XLMA 3DHPA 1T6MA 1H7XA 3DFYA 1YTKA 4JFSA 2OELA 1CI1A 4IIBA 4O12A 1XLFA 3IEBA 4P8UA 4P8VA 3MHFA 1UASA 3ARSA 1FHVA 2CBJA 3QZ6A 3RXZA 3P67A 3B06A 4H8VA 4IM4A 4AU0A 1H49A 1HL9A 2I5GA 3PAOA 2PGEA 1GORA 2P10A 1LLWA 4TQTA 5DMYA 1PV8A 1GYLA 1VBUA 2X16A 3N4FA 2BHYA 4XUYA 1V51A 7REQB 4GUFA 1GQKA 3MS8A 1K9EA 4FX8A 5CJMA 4HBKA 4DZAA 2CZFA 2FPYA 3CHCA 5LXEA 2PUZA 5GJMA 4DJEC 3BSGA 3LMZA 2YFNA 3WBYA 4DF1A 1JAKA 1PKMA 5M3WA 1TVNA 3DFSA 1TIWA 4PTNA 4ZTYA 2XIOA 1NTHA 4J3ZA 3OQ8A 3VNJA 3L4YA 2RUSA 1OX4B 4ZL1A 1UUMA 4LBRA 3T7VA 1D2KA 3G1RA 3LENA 2ZVRA 3L4TA 3W7MA 3PS7A 4G5DA 1K8CA 4GOAA 3KRBA 1XRTA 3LPOA 3EMQA 1R8LA 4DJED 2J7CA 4LQ1A 4XTDA 1VFFA 3EAUA 5K9DA 2FVMA 3KWXA 1KTCA 2ZXQA 4KEZA 5A8OA 5F7UA 1DQXA 3TTSA 4YCPA 2XGZA 3N1AA 1UBSA 4IXHA 3VM5A 3AHVA 3CZGA 4GUHA 1HNYA 2POZA 3S6DA 1I0BA 1UUQA 1C29A 4FF5A 4MWAA 4Y9OA 2QCEA 4GQGA 4PUMA 4L5ZA 3B97A 2PRHA 1BF2A 9XIAA 4TIMA 3W75A 1AMYA 1EQCA 1YDYA 2CFFA 4A3UA 1EOMA 4A3HA 3NL5A 4GIRA 3T9PA 4DF2A 4ZENA 3AYSA 3NYDA 8A3HA 2X42A 3FNDA 3UXIA 5M1TA 4AMAA 2HVOA 2VM8A 1TJ0A 1F74A 1A5UA 3DI1A 1D3GA 1W9UA 1YTEA 3ZOAA 5D2TA 5BZAA 2H90A 1OX5A 4DWDA 3QV7A 2X05A 4I6KA 2C18A 2QNEA 3U2OA 4CQ9A 1O1HA 1GQJA 5A8MA 2MANA 1OCQA 3RLUA 2V63A 3V35A 5C9UA 4F0RA 1QPRA 3A4JA 3NXLA 2BY1A 7A3HA 2G3JA 3B8TA 3JS3A 2QJMA 1QXLA 1IGWA 4PUUA 3NZ1A 3BL3A 3V1PA 2VD8A 1W2PA 1X1NA 2J75A 3VGEA 2BY2A 2Z00A 4FNUA 2E40A 1GK8A 1IXPA 1A5BA 3FYOA 4Z2JA 3P14A 3U2ZA 2I16A 4XWUA 4C65A 3RCMA 1DJHA 1TPVA 3BW4A 4DUOA 1YIXA 3NR0A 2A7NA 1ONXA 2A7RA 2WZMA 3HQ1A 2WANA 4LVFA 3WK0A 4AFYA 2YBVA 4JYEA 2CLPA 5F2MA 3QFEA 4E4PA 3Q45A 5HQEA 2Y7GA 2WNQA 3NZGA 4H1ZA 2XVNA 1ADDA 3I3DA 4U2ZA 1RLCL 2WXDM 3BLEA 3FSTA 2UY4A 1KGWA 1HZYA 3NNTA 1EC7A 5BXSA 2XH7A 3UCQA 3VZYA 5JQ9A 3TMQA 4GYKA 2XYLA 4JYDA 3WMLA 1DQWA 1HJVA 2VELA 3S5OA 2R1PA 3VFLA 3IJQA 1RA0A 3GM8A 2B7OA 3OGRA 3PWAA 4IFKB 2P3ZA 1FWIC 2VGBA 2H3DA 4NXSA 2OO0A 4RL3A 3WDQA 3EX4A 4WOQA 1E70M 1ZLPA 1MDLA 5HPCA 3OHMB 3TVAA 1V0KA 2VENA 1TX2A 2EF9A 4QE4A 4ZE5A 3WLHA 4AZHA 3WJXA 3FXGA 2VUNA 4PODA 2X2GA 3FV9A 3RHGA 2JKEA 1ZBKA 1B9BA 1X38A 3LERA 4JICA 4QS6A 5A6MA 2OTDA 3HG2A 1SM9A 1ME7A 1TTPA 4LRTA 4HTYA 1LF1A 2D0FA 5M03A 2VYOA 4I8DA 1CGTA 2I1OA 3ANVA 4WHBA 4I5UA 1F7BA 3S3GA 4U2YA 2YL5A 3UZJA 4QSHA 5C9WA 3TKFA 1JGIA 2P1FA 4F2TA 4J7RA 4DPQA 3U7BA 4BFAA 1H7OA 5ABTA 1EJUC 1FDYA 1SMAA 3ZJKA 2D2GA 2F84A 1H1NA 5AYYA 4ENLA 2J4GA 3H2CA 4GI4A 4LH8A 3KVLA 4JKKA 2JIWA 3DBNA 1E51A 1YXDA 1VPYA 1E6XM 3NL2A 1R2RA 2E6AA 2DQWA 4IPLA 3OIHA 2VL4A 4JTUA 2B7PA 5M17A 1WOBA 1UOKA 3GNNA 2A6LA 5EY5A 1SW0A 2O7SA 4XV0A 4D6FA 3W22A 1OWQA 3LN3A 1K7FA 4ZXOA 1EB3A 3NOYA 5F2IA 5H91A 1QJWA 5E0FA 5M2FX 4A05A 1Q6RA 1OY0A 2GJPA 4Q4QA 1XG4A 3GXTA 6XIMA 4JN6A 5HMFA 1TSIA 1PZ0A 2OEKA 4HNOA 3W84A 4HNTA 3WEOA 4K37A 2R1LA 1JCNA 2WVSA 3W76A 4BCEA 5A6TC 2Y7EA 3A4WA 2YPIA 1UP3A 3GXMA 2W61A 1UR8A 5DANA 1HF6A 3UG5A 1UD8A 4N7QA 3GD6A 4WJEA 1F4AA 4C90A 3MDUA 3NDOA 1JDAA 3T0TA 1TPFA 2EPOA 4Q8MA 1B54A 1AK5A 4US5A 2EGZA 2CC0A 3KBVA 1WDRA 4BR1A 3O07A 4LANA 3VK5A 1UQZA 4MDOA 4N42A 3RK8A 2HQAA 3VKBA 1G6CA 4PUNA 3PJXA 3G1YA 2BS9A 2CXGA 5T9CE 1S5WA 4AEFA 2H9AB 2OQHA 4X2RA 3FJ6A 3TR2A 4E3VA 4HU0A 3WQ6A 4R3UA 1L8NA 3OG2A 3QW3A 3TUUA 3P80A 1VFSA 3WDHA 2NQZA 3HA1A 1Q5MA 3S1UA 4UR9A 5KITA 5EMLA 1PPIA 2Z24A 3H53A 3EX3A 4Q33A 4KGLA 3RLHA 5HQLA 4LNYA 3AQUA 3WQCA 2I56A 4DHGA 4NT0A 4RNJA 3EKLA 2NV9A 1R3SA 4Q4MA 5A6KA 2WJFA 2XFYA 1A49A 1W1ZA 2BNJA 2YIHA 1I45A 5ABFB 2NSOA 3TFCA 2YBUA 3C3NA 3GIPA 1V6VA 3ARZA 1UKTA 1BXNA 3RO6A 2NT0A 1SR0A 3NQBA 4BWLC 4F66A 1ZBVA 1AD1A 1MXGA 4F2BA 5CLWA 3AHZA 3AIUA 4I9MA 2G50A 2OODA 1XRVA 2VFFA 4XBJA 1EIBA 2P5NA 4GQ0A 1R2SA 1JZ5A 2Z7GA 1L6WA 1BKSA 2BSLA 4Z1CA 1UZHA 5H1WA 2PDGA 1XSKA 4MFEA 4IUGA 3OEXA 4NI3A 2NXGA 2WCAA 2ZZ5A 4W85A 4Z2KA 3RFAA 1J96A 2FJKA 3BGAA 1CT5A 3U48A 2E0PA 4M56A 5KSWA 4ALDA 4QEHA 2FDSA 4Q8WA 3A9IA 1PIGA 5I3FA 2IXUA 4P8XA 4QAWA 1W9VA 2PCEA 5FACA 3OHIA 2C16A 3N9KA 4MGGA 3V36A 1VEOA 3VKKA 1B3YA 3ZWSA 3ZVHB 2P76A 2V30A 1AJ2A 4HPXA 1BSIA 1B31A 3FGCB 1PKYA 3QV8A 3P93A 4UTTA 3AS1A 4NAEB 1H1ZA 4PB4A 3LBCA 2IPJA 3CZKA 4PTVA 2GUUA 2HEJA 4EPBC 2EJ1A 4XIAA 4C6JA 2HWGA 1RVKA 2ZICA 4PBGA 4LS0A 3P84A 1DIKA 2EJAA 5CPQA 3OYXA 2VCAA 1B3OA 2B31A 4AQLA 3UVAA 3B8IA 3UERA 5FJUA 2DZWA 3NL6A 4ZQMA 4O17A 3GR4A 4UFMA 2O56A 4WF7A 1WAUA 3H7RA 1BFNA 3WL1A 2C71A 1E9ZB 5A3HA 4V1YA 2DUAA 3QZEA 3W7HA 4IZGA 4M29A 2DH2A 1OFOA 1TTIA 1JDCA 1AQFA 1RBLA 1E40A 1JIBA 1KR0A 3KL3A 3PF3A 2QCHA 3C8NA 4Q4PA 4ZA0A 2WKJA 3BLLA 5M5DA 5TIMA 4NSBA 1LWIA 4JTHA 4PCPA 3GNDA 2GVJA 3KFTA 4O1DA 3ZLFA 3H12A 1TV7A 4IQEA 4LB4A 3WDIA 1UWAA 3BG9A 3MMUA 3WJSA 1IEIA 3SN4A 3WLIA 3TYZA 1M7PA 2R82A 2TYSA 3VA8A 2GPTA 3ORWA 3NWRA 3E0IA 2WMFA 1MEHA 4H9VA 3I10A 4CNNA 3RMEA 3BDKA 3A9BA 5EMJA 3MB9A 3R8RA 2BGNE 2VOTA 4AW7A 3THAA 3KHJA 5TF0A 5BOEA 4AX7A 3BWWA 2OSXA 4GIYA 4WK9A 1Z7AA 4FOUA 3ITOA 1Q2RA 4PCSA 4NZCA 2NWSA 1E4MM 1IYXA 1CIUA 3H7UA 3W1QA 1TPB1 3GUGA 5FESA 1H5YA 2ZVIA 2P8CA 1U83A 3BAYA 1LQ0A 1GKPA 4LBUA 3ABZA 1MW1A 1W1YA 1XD0A 3QM3A 3V16A 4B91A 3KHDA 1J79A 3VGBA 3IK4A 1M68A 1PAMA 3EYPA 3TR9A 4DWSB 1E43A 2ZUMA 1RVGA 3GIQA 2Y8UA 5EGRA 4JIIX 4R9XA 1AVAA 3CQKA 3IJ9A 3IAPA 1MW3A 4H83A 4ZO6A 2FB2A 2Z6IA 2R1MA 3LGEA 4MJZA 4HOZA 4JTEA 3PTKA 2O7QA 3GHTA 2NZLA 5I02A 1JD7A 3QQWA 2D20A 2DZPA 3B0PA 5E70A 3CYVA 4RE4A 3QOKA 2FIQA 4MJ4A 4C1NA 3MMWA 1UR2A 1UB3A 1B3XA 2WB5A 1ZU8A 4JHMA 3KL5A 3M5ZA 5A6AA 1I1WA 4O0QA 4PUWA 4Z1DA 5JUVA 3RITA 4E2VA 1XV8A 3EMCA 2C6QA 1ONRA 3IV3A 4AZ5A 3ABRA 2EQDA 4ZGYA 3WQGA 5LSMA 3DG3A 4K7YA 3WUBA 3WLLA 1K7EA 4DELA 2FJUB 3V18A 3VC6A 3B9OA 3W7OA 2DT3A 4KMQA 2X40A 3TE9A 1SJDA 3A24A 1LCOA 3H2NA 1DE6A 4M1RA 2WM0A 3TLQA 4O8RA 4B5VA 2D69A 2D0GA 5A8GA 2CZ5A 5DQPA 3R8GA 1WBJA 3TW7A 2V3DA 3BG5A 3O63A 4IIGA 3ZLHA 3H4WA 2TAAA 4V33A 3OZMA 4DXVA 1BG4A 1CXHA 1XCWA 4S3JA 3WENA 2PLCA 4CD4A 5K9CA 3UWUA 4C6EA 1ITXA 4GHRA 3PNUA 4UTIA 1NIUA 2VGGA 4I5RA 3PZ9A 3EX1A 5AB3A 4RXGA 1K3UA 5A6BA 1GW9A