1F6KA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 120
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f6kA00
5G5IA 1AK5A 2GUUA 3THQA 4IJBA 1DVJA 3G1HA 2ZZ4A 5J5DA 2GQ9A 4LVAA 2ABBA 2R91A 3GDTA 1H7XA 1KFJA 3UPBA 2A7PA 2RKXA 3TAOA 2XN1A 1YXYA 3MUXA 5CGQA 5CZ0A 2QUTA 3IIZA 3Q37A 4Y90A 3GR7A 4K37A 1JUKA 1WAUA 1PHQA 5HR6A 4WJEA 3O15A 5EY5A 1KFBA 1DL3A 5D32A 4WZHA 1FCBA 2JKPA 5LGXA 4GWEA 2DU2A 2CW6A 3P82A 3W85A 2WOQA 3N9SA 3GDLA 2F7FA 1H7NA 1H51A 1RQHA 1G4SA 1SR9A 3SJ3A 3M0ZA 4JN6A 3W84A 4NJJA 3QRHA 5CPLA 1LYXA 3FLUA 3BLEA 2VFHA 1HUVA 4M19A 2VEPA 1T8XA 1FWRA 1TRDA 4O13A 3F4WA 3GNDA 3L65A 4JDYA 4FXSA 3EXTA 4FX8A 4IQLA 4O1BA 1AL8A 1WBHA 2V8ZA 3KVJA 4ZQRA 3PM6A 2E6AA 3G8EA 3HO8A 2G97A 3S5YA 3N2MA 5FESA 3M5ZA 3C2FA 3PR2A 4RV8A 2JK2A 4M7TA 1T0OA 3BGGA 4KFOA 2GJLA 2V0TA 2BSLA 1VCVA 3QSRA 1QNVA 1TREA 4CQ8A 1JJKA 2A5HA 2QR6A 3B0UX 4E2BA 5FEXA 4MJMA 2D73A 4UUIA 3VE9A 3W2LA 1KTBA 4O28A 4DELA 3HGSA 4JTKA 1W37A 1QOQA 4M7SA 4GE8A 4IMDA 3UD6A 1TMHA 2B7NA 3G8RA 2X1RA 1IXQA 4BI6A 2DP3A 4RKAA 5F2IA 3DHDA 4JR5A 4QM1A 1F74A 4JTIA 3R12A 4NUWA 2ZTJA 3C2VA 4NQ1A 1F2JA 3UWUA 4GUFA 2E5CA 4JY8A 1TPVA 3NO5A 3W7OA 2WQPA 3W9ZA 3M6YA 4NXKA 1L6YA 1G69A 1A53A 2ISWA 3FJLA 3EWBX 2VFIA 2CU0A 3SIZA 2ATSA 3F03K 1KM2A 2E77A 1V5XA 4UFIA 4EVZA 3I7RA 3MBFA 3N9RA 4I7UA 2AGKA 3FYPA 3L66A 3EKLA 5AHEA 4PH6A 3W76A 5I3KA 3EX2A 3W1XA 3KVMA 1C29A 1XFBA 4FXRA 2BWGA 3W2NA 2YZRA 1P0NA 2VFEA 1FX6A 3BO9A 2DZTA 4O4VA 1PS9A 2Y61A 1Z42A 2G5WA 4XBKA 4RK8A 5FEPA 1K03A 3GDKA 3WK1A 1R2RA 3N73A 2H90A 2DZPA 3IVSA 1LORA 4GJ1A 4R53A 1NF7A 5I3HA 3H53A 3G1FA 5U7SA 1NEYA 1EP2A 2H3DA 2ZBTA 1KA9F 1KM4A 1Q6LA 1RR2A 4K38A 3B05A 5SWUA 3DGRA 3NQ2A 5FF0A 3TSDA 2J27A 4QNWA 1PE1A 1WYIA 2TYSA 3DKLA 3IGXA 3LV6A 1EWDA 3TIMA 2ZFAA 1DBTA 4O4WA 3HPSA 3CWNA 4Y8FA 4ONVA 2WJZA 4I9AA 4W9TA 2PRHA 5K3VA 3NPVA 1LOQA 3PUOA 3DENA 4Q33A 1N8FA 3DKJA 3EX3A 1QPOA 4IMEA 1EP1A 3QPZA 2EHHA 6TIMA 2CZ5A 3QZEA 3PBVA 4NJHA 1OX6A 2V2DA 5D2VA 3LXBA 3W22A 1KLZA 3MJYA 1LDCA 1TPC1 4HNUA 2E68A 3LTPA 3HGJA 1B4KA 4MY8A 3TROA 4P2VA 5KZDA 4Z1AA 3TA6A 5LGZA 1VLWA 3RLUA 5TBOA 1FBAA 4JICA 3A5FA 3HPXA 2VOMA 3W1LA 3UWWA 2QCMA 3EX6A 4AF0B 2FPTA 3R8RA 2O7QA 4WOZA 3MHGA 5CPNA 1AW1A 4HNVA 3EWZA 4PA8A 3B03A 1SFLA 1H62A 4ZQPA 3W1AA 1IXNA 4Q4KA 4NZJA 3FS2A 3NQCA 3O6DA 3C61A 3NL5A 4O12A 1KLYA 3IIVA 3GXTA 2QEZA 1ICQA 1XBVA 3TE9A 4OV9A 1DORA 4Z0JA 2ZZ7A 2GQ8A 3W7NA 1OYCA 1XI3A 3WJYA 3OVPA 4FNQA 2B7QA 1SZGA 1I2NA 1KW1A 5FF3A 1XM3A 3QYQA 1I8JA 2JGYA 3L9CA 3RU6A 3M5XA 3TNOA 1FXQA 1RD5A 3LV5A 1RV8A 4U4MA 5H2ZA 2O7SA 1YDVA 3KVLA 4OU1A 1F5ZA 1H7RA 2C14A 4ZQMA 5D30A 1XBYA 3UNDA 1F6KA 3HBLA 4MIMA 1Q45A 2WV8A 1IXPA 1FY6A 1WDWA 1R47A 4RX0A 1ZNNA 2KZHA 5DLCA 3M5YA 1O5XA 2ZRXA 1FWWA 4N4PA 1KM3A 1JR1A 2P1FA 1ADOA 1WV2A 1OFEA 2A7RA 5EBUA 1LLZA 3K30A 4LW7A 3VI2A 3ELFA 3PC0A 3NL2A 4OT7A 4EWND 1X6UA 2BXVA 4RZ5A 2XFWA 2YYTA 4AWSA 1W5QA 4CCDA 4N9BA 1E51A 2ZA3A 4QNEA 5LNRA 4JD4A 1GTEA 4UTWC 3W7HA 2J9XA 4JTFA 4WY0F 2A2IA 4Y9AA 2GVJA 3L2IA 1NF0A 1I2OA 4A2SA 5I3FA 2YW4A 3IIPA 3UXAA 3TU9A 4O14A 5GVJA 1R2TA 2X2GA 5LNVA 4TMBA 3TJXA 1YTKA 3HMJG 4JX6A 3MP4A 1OK4A 5I3GA 2ZRZA 3UWVA 2E6FA 3W3OA 4MYXA 1OYAA 2Q8LA 4J9JA 5F4XA 2YSWA 3DFSA 4UFMA 5LNSA 1G4PA 1VYRA 2NLIA 3KHJA 2EF9A 3C4UA 3HIJA 1EX5A 3PAJA 4X9SA 3W86A 2ABAA 2X1SA 4LOCA 3LCIA 4A2RA 5K4XA 3N14A 5DBTA 1TPH1 1WOBA 1J5TA 5CZSA 3TW7A 4N6EA 3T44A 2NZLA 1PVNA 3W70A 1OG0A 1YDOA 3W7LA 4UTLA 1JQVA 4JX5A 3U8GA 2A85A 4NJKA 5CZTA 1TV7A 5KZMA 7TIMA 1JVNA 1UB3A 5LSMA 1TV8A 4JNMA 2QCEA 3PF3A 2CLEA 2C15A 4GNJA 4Z1DA 2QCNA 3TKFA 2EPHA 3KXQA 1QDSA 4HNTA 1JQXA 5L6UA 4UTIA 1JCXA 2QDGA 3THAA 3MHUA 3W1QA 5TQLA 1G7VA 1WXJA 2LLEA 3NQMA 1W5NA 1XBXA 2QUVA 4MYAA 5G4WA 4POCA 3QW3A 4DBDA 3IEBA 3G0SA 4E2DA 2FPYA 3TC7A 3C3NA 1VPXA 4CQAA 3M43A 3DU0A 4UMAA 3G3MA 4ALDA 1WQ5A 3FOKA 2ISVA 2ALDA 4K7VA 4EIVA 1D3GA 4ZMGA 4O18A 4XTIA 1OF6A 3C2OA 3UWZA 3TFCA 3W7KA 1MEHA 1L2UA 2DZUA 3N2XA 1JCNA 1EIXA 1FWTA 1XUUA 3QFEA 4TR9A 4Z08A 2ZCGA 3AJXA 4UTJA 3TMLA 4OBTA 1TV5A 5FEWA 1OABA 4IMFA 3B06A 1JUEA 4LV9A 3PSVA 4MLJA 3TXVA 2ZZ3A 4ADUA 3H55A 3LERA 4Y96A 5KSWA 4O1DA 5D09A 1FDZA 1NFBA 5T26A 3W2UA 4R7JA 5G1TA 5AHLA 1PHWA 3S5NA 3EX1A 4MKNA 2Y63A 3E9AA 3CB8A 2RH9A 4GUGA 4MJZA 1SZFA 3R13A 4HN4A 2NUWA 2I14A 1FQ0A 1DV7A 2QDHA 1SUXA 3I65A 4CLMA 4XZ9A 2QCCA 3G1VA 3KAOA 3BLFA 1P0KA 2Y7GA 1OFQA 4FX6M 3M7WA 1LOSA 3FFSA 4M6PA 1H60A 4GXMA 4K39A 3P62A 4UR8A 4KWWA 1SO6A 3MI2A 1DQXA 1UBSA 4WX2A 4LVBA 3EB2A 3S1UA 3TQ0A 4JGDA 3W7RA 1TPFA 4BF9A 2X1TA 2HTMA 2ZZ1A 4ML9A 3YPIA 4WXZA 2W6RA 4PODA 2ATMA 1TPB1 4G1KA 2H3BA 1BWKA 3MI6A 1JCJA 1I4NA 4WD0A 3G22A 4X22A 2DZSA 5AHMA 3I7QA 4JX4A 2QF7A 5H91A 4ICNA 1LOLA 2EGZA 5HUOA 1W3IA 3CHVA 1SFJA 4OE7A 4YWIA 3PSWA 3DAQA 3EWWA 5D03A 1O4UA 3PWAA 3OIXA 2NX1A 3DBPA 4ZZ9A 1GVFA 5K2ZA 4LY8A 1IXOA 1VLIA 4RR4A 1KTCA 2Z1BA 4BWLC 2FDSA 3W07A 4PCFA 5HR7A 4NT0A 2GQAA 3SI9A 2VEMA 2QCFA 5LNUA 1M7OA 3G1XA 3O1NA 5DN1A 3PBYA 4TMCA 5ABTA 3W88A 5DBUA 3TK7A 2XN2A 4R33A 2A0NA 1W5OA 3OG3A 1G7UA 3W6YA 1L6SA 5FEZA 4K7YA 1A5BA 3M44A 1YLVA 2Y7EA 2NV1A 1GQNA 1TPEA 3LCGA 2YFOA 1FWSA 1QCWA 2OCZA 4IXXA 4K8EA 4DF0A 1XBZA 3WK3A 4DPQA 1VR6A 3N19B 1TQJA 2Y62A 3DFTA 4N6FA 2A4AA 3PBUA 3R2GA 3MYPA 2DZVA 4AHPA 4KWVA 1FCVA 1KM0A 4N02A 1Z48A 4O16A 4QIUA 2CZEA 4HPJA 4IGHA 4UIOA 3QQ1A 4AHQA 3DI0A 1TRIA 5EA9A 3N3MA 2HMCA 4GUJA 1BWLA 2CLFA 3L5MA 5CKSA 1HL2A 3LLDA 1KBIA 3ABSA 5K7JA 3A9IA 3LOTA 4MY1A 2FIQA 3SFKA 2WNNA 1PIIA 2HSAA 2V2CA 1SZNA 4B5NA 1OFBA 3LBMA 4NNAA 2WSQA 4MVAA 1YYAA 3O07A 4IPJA 5EKYA 3D0CA 1LROA 5HULA 2QCGA 3NPXA 3LTYA 1DHPA 5AHNA 1X1OA 3HOJA 4OWGA 1LBMA 4K36A 1LRTA 3FYOA 2QAPA 1KV8A 3TC6A 2I1OA 4UFKA 3LLFA 1X1ZA 1ME9A 1OFPA 1LBLA 4HT3A 2CFFA 4PC8A 4LVFA 3W7GA 1RVGA 4X2RA 3MW7A 4UNLA 4LVGA 1HFBA 4BI5A 1RQBA 4O17A 3CEUA 1TTQA 4IWWA 1TYGA 3DHFA 5DCDA 4LRSA 1J4EA 1O60A 2V81A 1FWNA 4O1AA 1NVMA 3BG5A 1VYPX 3W74A 1GYLA 1XC4A 1X7FA 5C5YA 3S1VA 2NWSA 3NXFA 1LRNA 3ABQA 4R34A 3V1PA 5FI8A 4AXKA 3B0VC 1C9DA 5F1VA 1CX9A 5CSRA 1ONRA 4JTTA 3GYEA 3W2KA 1K3UA 3SR7A 5G2HA 3CPRA 2FPVA 2YW3A 4FNSA 1W5PA 2R8WA 3LHVA 4LUIA 4JTJA 2CLLA 3O16A 1I2PA 1LZOA 1OFOA 2EKCA 3GIYA 1C8VA 5HWMA 3NL6A 4AF0A 2NUYA 4A3UA 3MI3A 3P8IA 3EXSA 3NL3A 4HSNA 3TUUA 3L0GA 2NXIA 1ZFJA 1OK6A 1S5VA 5F2LA 3RFAA 2YGYA 1FCQA 3E96A 3WJXA 1EP3A 3NPWA 1EEPA 4QJ1A 2R14A 4HNNA 1FUYA 3KX6A 5A8GA 1QR7A 2YXGA 1P1XA 2FB3A 3EWUA 3ZWSA 5J5RA 1CI1A 3LGEA 1Z41A 4O8RA 4JYEA 2Q8ZA 1A5CA 2NX3A 2OX1A 3MO7A 3R89A 1HTIA 3QSTA 3MWAA 3LRKA 5HNRA 4MZ8A 4NXSA 2A7NA 1K7EA 4CQ9A 1JRBA 5G1YA 1H5YA 1AW5A 2E5BA 5HWNA 1U5JA 1HO4A 5D33A 1AW2A 5HUPA 1VJIA 2IQTA 3W7PA 3BLIA 3G0XA 4GUHA 2I9EA 1VCFA 4UTWA 5AHFA 2J24A 4FNRA 1LBFA 2W79A 2WNQA 2ZDRA 2DJXA 4XKYA 1QPNA 4DQWA 1VZWA 5FF2A 3IGUA 1ME7A 4FO4A 1QMLA 2QCDB 3TSBA 4S1FA 4N9CA 1K8XA 4UR7A 3IRDA 4FNPA 5D02A 1FDJA 3JR2A 3HB9A 1G4EA 3O63A 4TU1A 4DF2A 3H54A 1PV8A 3NG3A 2UV8G 4UC5A 3OEXA 4FNTA 3KOFA 3MMTA 1N55A 1EPXA 4QAIA 3STCA 1GVOA 2ISSA 2FB2A 3BV4A 5AOUA 4AHOA 3MYOA 3W1PA 1GVSA 2QKFA 3QMSA 2R94A 3ZR4A 3P80A 2DZXA 2JKEA 1JCMP 2YPIA 4AMAA 1K8YA 1FCUA 2CLMA 1LRQA 2P0OA 3NM1A 3W75A 1H63A 4XKYB 5AC8A 3LRMA 4BR1A 4O52A 1KM1A 1RQEA 2J9ZA 1K8ZA 2JBMA 1JCYA 1I2QA 2YYUA 3NQGA 3G1SA 3BPWA 5F2GA 1F05A 4DXVA 1YPFA 3GDRA 3E49A 3I68A 1GG0A 4UTTC 1DJNA 3W2MA 3SGUA 1UJPA 4NZFA 1PL9A 3V75A 3VFLA 2QJGA 3DH7A 4WXYA 2C6QA 1MSSA 3NQ7A 1VQTA 2Z0IA 3W72A 1ZJIA 4IX2A 1OFRA 3VKJA 3KVKA 3LXAA 3P8JA 2OT1A 3EEGA 3C56A 4AEOA 3O05A 1WA3A 1ALDA 2H8ZA 3NEVA 3NQ8A 1JUBA 4YCPA 3NPUA 4YCOA 5KMYA 3T40A 3UY7A 1ME8A 4K6AA 3E12A 2NXGA 5F1UA 3WJZA 4YMZA 3W1NA 2DZWA 1ICSA 4FX7A 4RLIA 5D2XA 2FFCA 3T4CA 4O54A 3G3DA 3L0KA 1SZEA 5E1QA 1OF8A 3L67A 3R5EA 1SU5A 1W5MA 5I3JA 1YTEA 3OBKA 1OFAA 4E0CA 4N2YA 1EA0A 5F4SA 3U2OA 2HS6A 4HHPA 2GPTA 2CLHA 3GK0A 1GYNA 1MZHA 1OHLA 1MO0A 5HQEA 1DJQA 3WK0A 3AO0A 5LKYA 2B0MA 3LDVA 1VHCA 1KBJA 1F6PA 4CCCA 3A22A 2G95A 3Q2DA 3LB0A 1VS1A 3HG3A 4NJIA 1EUAA 4FF7A 3STFA 4HIBA 3TCEA 3ZWTA 3TH6A 5KITA 1TCDA 2B7OA 4E38A 1VRDA 3P7YA 2VKZG 5D04C 3S8HA 3TAKA 3TQKA 2QAFA 1B3OA 3JS3A 2YX0A 1QO2A 4DO5A 5G4EA 4MFEA 3LHTA 3JRKA 4ZQOA 2NWRA 3NAVA 2C0AA 3TX9A 4MLRA 1QPQA 2E6DA 3LXCA 3ANYA 2WNZA 1S3HA 1SO5A 2ZZ5A 3QH2A 1B4EA 3USBA 1OJXA 1XKYA 1GG1A 5AN7A 4FIRA 1BKSA 2V9DA 4Z1BA 2TMDA 5LHFA 2AAMA 2ZYFA 4WUIA 1TSIA 3HGOA 4DPPA 3NZ1A 5MHBA 4XWUA 2FLIA 2RHGA 2VFDA 4FB7A 4UTMA 1W3NA 2Q3OA 4LS1A 2GJNA 1R30A 2FJKA 4LS2A 4O0ZA 1F73A 3DFQA 3TR2A 3CWOX 4BWLA 3EX4A 1IIHA 5DCEA 2V5LA 1H7WA 1LLWA 3W1UA 2Y6ZA 3L0NA 4TO8A 5DY2A 2C13A 5HWJA 4KKXA 3NYZA 4FIQA 4MY9A 5IBXC 4LRTA 1FXPA 3W7IA 3NVTA 3LCXA 1FDYA 5DCBA 3LCHA 4S2CA 6ALDA 1CW2A 3P60A 1T96A 1D9EA 3LHYA 3LX9A 1TPDA 1XCFA 4NU7A 1UCWA 5E93A 3CT7A 2FQIA 4M6QA 3GKFA 2Z6IA 3FIGA 3MP3A 3RLVA 1AL7A 5BMXA 3W1RA 3DFPA 2H8XA 3OHIA 1QO5A 3ABRA 4RZ6A 4PEKA 2FTPA 3UZJA 2HS8A 1R2SA 1W8SA 3W1TA 1ZAIA 3NR0A 1TB3A 2Z2UA 1RZMA 3GXNA 1GEQA 3P67A 4JIPA 3LCFA 3RMJA 2C3ZA 4OV4A 3PVFA 1K7XA 1TPWA 5D2WA 3ZS4A 1DQWA 3B8DA 1S5TA 1QAPA 1JULA 1Q3NA 2VFGA 3LBCA 5AHIA 1SSGA 2CLIA 1L6WA 3VCRA 1ZY9A 1KFCA 4EF8A 2RDUA 4NNCA 4O10A 2EAWA 4GUIA 3P81A 1TTJA 1X8FA 5K9XA 4MPQA 4QQ3A 2PRLA 5EPDA 1ZAHA 3S6DA 4ZQCA 5DY3A 1G6CA 4Z1CA 2VFFA 1P4CA 2OZ0A 1YDNA 2VELA 5LNWA 2VC6A 1D3HA 4AAJA 3HG2A 3S9YA 2C18A 1DKWA 3QQ0A 2CLKA 3TDFA 1VC4A 2X16A 1T99A 2QUUA 3LHUA 3IVUA 1AG1O 4FHAA 3O6CA 3SZ8A 5KTLA 1Q6OA 1YTDA 4H6KA 1KTNA 2WKJA 3BG9A 4UFHA 4H4IA 3UWYA 3NQFA 3WK2A 2YDAA 4GC4A 4M6VA 3TQVA 4X3ZA 4N4QA 4S2BA 4JTGA 3INPA 2P10A 3UZ5A 5D05A 5KINA 5FF4A 5AYYA 3QMTA 2G96A 2VXNA 4XUGA 3UQNA 1VGAA 4OGZA 3HG4A 5F4WA 3RF9A 3GR8A 3GAYA 1ML1A 1QOPA 2ZA2A 2ZQ0A 1O95A 3NM3A 3GX9A 1XDMA 4JDBA 3GNNA 5IM51 2BX7A 4JYFA 1LCOA 3NOEA 1P5BA 4WY0A 1TIMA 4A29A 3P74A 1OYBA 1M7PA 4JTHA 3GZ3A 4RZ4A 3GXPA 3IIXA 1F7BA 1YADA 5AC6A 3OA3A 4LC6A 5HMSA 2XN0A 4IUOA 1GWJA 3W7DA 1IGSA 1SO4A 4N9EA 1GVRA 1SSDA 1MEIA 1TTIA 1EUNA 4TX9A 4JY9A 2ZZ6A 5AYXA 3NQEA 2Y70A 4AH7A 1U83A 2Y7DA 3ABOA 3C2EA 1TO3A 2QCLA 1TTPA 3W2JA 1XXXA 3O6YX 2C1HA 4UFLA 2J9YA 3T7VA 5AFDA 1W3TA 1NSJA 2X1UA 5E0KA 3W23A 3A21A 1H1ZA 2B7PA 2ZRVA 4QITA 5C2XA 4WY0B 3W73A 4YXGA 2W0UA 2BLEA 5DELA 1UUOA 1QPRA 5DXYA 3N34A 2CZFA 4JTUA 5KZEA 1W31A 5C6MA 4A22A 3ATYA 4IMCA 2RDWA 1KM5A 1G4TA 5BOOA 1IIGA 1B57A 2BTMA 1GJPA 2OT0A 3O06A 4AWTA 1XL9A 4OQVA 2ZRYA 1ICPA 1Q6RA 3C52A 3LHZA 3KRUA 3NQVA 3PB0A 4IPIA 2PE4A 1L9WA 3CIWA 1QWGA 3LCLA 4I7WA 4NJGA 1WX0A 2A6NA 4XBSA 2J88A 1GTHA 2C16A 2WSRA 3G1DA 4C1KA 2E5DA 1LM1A 3PBWA 2Y88A 3G0UA 5HINA 1N7KA 1HG3A 3A24A 3LCWA 5D37A 1YPIA 3S5ZA 1UUMA 2WPBA 3HPZA 4O11A 8TIMA 3UWQA 1H50A 3SW6A 4MOZA 4L4MA 5CPOA 4UTHA 4O53A 1GVQA 1GOXA 3FKRA 3TSMA 2NXHA 4CNNA 3M16A 5K9DA 4Y6GA 3DFNA 1WBJA 3QPYA 1LP6A 3GVGA 3CM4A 4UCGA 3QM3A 3GKAA 3RNDA 2QJHA 4IXHA 4JIQA 1PCWA 2JGQA 2QCDA 2TPSA 3G18A 3IVTA 3TW6A 3WJWA 4EF9A 1O5KA 4OHQA 5EYWA 3ATZA 3VNDA 4AVFA 4QSHA 5LZLA 3KRSA 5FF7A 5K4ZA 5BMWA 3MHFA 4BFAA 3P5YA 1SW0A 3IIOA 5LHEA 4YLWA 4JS3A 3EKZA 4RXFA 4HSOA 2BZNA 2DORA 5DXXA 4UTTA 4PL1A 1W0MA 2PCQA 1Y0EA 3B0PA 2CWNA 2PC4A 3P84A 1VHNA 4RCXA 3S5OA 3TFXA 2CZDA 3QMRA 3BVJA 3CLMA 3Q94A 2NV2A 1IF2A 1SPQA 2JKAA 3CU2A 1Z44A 4CCEA 3C6CA 3PULA 3EXRA 1O94A 4LT9A 4HPXA 4TIMA 3BW2A 5EL1A 4D2JA 2V2HA 3L5LA 1BEUA 1SQ7A 3M41A 1R46A 3QJAA 1OX4A 2QJIA 2B4GA 4MFDA 5TIMA 4A21A 4UNKA 1A5AA 1M6JA 3W71A 3C0JA 4ZQNA 3GDMA 2WO5A 4UFJA 3FA5A 3P5ZA 4RXGA 4H3DA 4DEFA 3Q58A 3CC1A 3GAKA 3EWXA 3HGRA 4NX0A 4BK9A 4DO6A 5AC7A 3W7MA 4LWWA 3M9YA 2ZZ2A 4JTEA 1UASA 3GB6A 5F2MA 1TJPA 4KFNA 3L68A 3PUDA 5G2WA 1A5SA 3LHWA 4GFSA 2V5BA 4JYDA 1DOSA 5I3IA 3NQAA 1ZAJA 3NZRA 2ZRUA 3E02A 4O50A 4YL2A 1EB3A 4CNPA 4M5PA 3PS7A 4KFPA 1OX5A 3O8AA 3L5AA 3TMQA 4MZ1A 1OX4B 3LM7A 4PFMA 3LTSA 4JEQA 4HKPA 4LS0A 2V30A 3KFTA 3LI1A 1F76A 3WFAA 1H7PA 3MBDA 3SECA 3W7EA 3P61A 3HG5A 2Q3RA 3M47A 1VH7A 4GRSA 2YR1A 2WSYA 1H1YA 4PTNA 3CTLA 2Y89A 1YXDA 2V82A 2YFNA 4O15A 4C1LA 1TPUA 1VYSX 5BNKA 4NX5A 3NA8A 4LNYA 4DO4A 4PL2A 2ZRWA 4LV4A 4WOQA 1KV5A 1XDLA 5K9CA 1PCKA 5L9FA 1W56A 4U28A 1MEWA 4UMCA 3BK0A 1SO3A 3CIXA 3BARA 3STEA 3CQ0A 1YXCA 5C55A 2C19A 3S1XA 4QISA 3EWYA 2NX9A 4EOUA 3C8FA 3BW4A 3NGJA 2AQWA 2F84A 3W7CA 4DBEA 4ORIA 3NDOA 4LVDA 3L21A 2RFGA 3BGJA 1JRCA 1ZHAA 5CG7A 2E1DA 2Z6JA 1GZGA 4IX0A 4UMBA 3F1QA 3F4NA 2GOUA 4UTKA 4LUJA 4XTDA 4O0KA 5G2IA 2CLOA 4O1CA 4ADTA 5IBXA 1OVDA 4CNOA 4RJEA 4MZYA 2OJPA 1HO1A 5AYZA 3HF3A 4L4LA 5U4NA 3G1YA 1M5WA 1OFDA 3LRLA 4DF1A 2E09A 3FKKA 1KFKA 2Y85A 4ZL1A 3TXZA 2J6XA 3I7SA 1ZENA 3M1ZA 1V7YA 3A5VA 5CSSA 4JTSA 4JXCA 3U6WA 3LI0A 3KRZA 3NQ6A 3W7JA 4LC8A 1RPXA 2ZTKA 4P61A 4Z0SA 3PB2A 2ZA1A 1Q6QA 4LTSA 4XQ6A 1W1ZA 1G67A 1I45A 3HQ1A 2GVGA 1MXSA 3UYCA 3A23A 3UXDA 2E6YA 3DZ1A 2A21A 2RDTA 4NVTA 3DXIA 3S42A 3ZFHA 1LTDA 2TRSA 3S1WA 4I7VA 4ORMA 3IGSA 4IMGA 4AWUA 5C54A 1B9BA 3BG3A 3B4UA 1JCLA 1ZCOA 2DJLA 3B04A 4Q32A 3OVQA 1GT8A 1KM6A 2GVLA 2H6RA 3FEMA 4NNBA 5AB3A 1W54A 1EWEA 3CEPA 3IV3A 1TJRA 3HJZA 3SSJA 2YCEA 2TSYA 3MP5A 4ZVJA 1SW7A 1KFLA 3UPWA 3PG8A 3W7QA 2PURA 1XUZA 1GPWA 4FNUA 5HJLA 3S0CA 1AMKA 3PY2A 4K8HA 3SGZA 5EMUA 4AB4A 4UTUA 3GLCA 3UY8A 1WOAA 1J2WA 1QFEA 3E0IA 3QEZA 3TJLA 3RK8A 4WQ6A 1S5WA 4O19A 1BTMA 3NQDA 3T78A 3STGA 4JTLA 4LU0A 4UXDA 3DFOA 3QW4B 2A6LA 2PRMA 3I6RA 3SY5A 3BW3A 2NUXA 5D2YA 5A5WA 3NNTA 1NAL1 1TQXA 2X30A 5CPMA 1K7FA 1VCGA 3W87A 4FEZA 3WJSA 2OMAA 4MUZA 1ZALA 5D38A 5CZJA 3TV8A 4O57A 3QF0A 1SW3A 1A50A 2VEIA 1H7OA 3W83A 3VE7A 1H61A 3C2RA 1THFD 3PG9A 2A1YA 3DI1A 4BI7A 4IOTA 3M5VA 1KFEA 2VENA 3G1AA 4ADSA 5D2TA 3W1MA 5BRBA 1I2RA 3T55A 4GBUA 2QCHA 5BW6A 3FJ6A 1K02A 4N9DA 3PUEA 3OVRA 3QC3A 2Y7FA 3G24A 2VEKA
chains in the Genus database with same CATH superfamily
5G5IA 3AISA 1AK5A 3WF4A 5CH9A 2L5HA 4RE2A 3DN5A 1XLLA 3W6MA 5BXRA 2AQVA 5DANA 5LXEA 4ZE4A 3SEPA 5M1TA 4L65A 1YXYA 2WZEA 4H8NA 1TFVA 1WNOA 4GBDA 3WO8A 1VPQA 4X0VA 4Y90A 3FX4A 3O0KA 1UC4A 3AHYA 1WAUA 1PHQA 1XKJA 2JKPA 4GWEA 1PJ9A 4NF7A 1VBRA 2DUAA 2WOQA 1SR9A 1RQHA 1PTDA 4W85A 1E71M 3SJ3A 5I07A 3HJEA 3HA1A 4JN6A 4XZLX 4X0NA 4A3YA 3QRHA 4ZXLA 3WDJA 3FLUA 2VFHA 1S2VA 2OFJA 2PLMA 1BVWA 1EQPA 3QVQA 4S3BA 3L65A 3PNZA 4FXSA 4IQLA 3PTDA 3KVJA 2V8ZA 2E6AA 3G8EA 4MMWA 4GINA 4RV8A 4DHGA 4LCSA 1CZ1A 3DHUA 2BSLA 3VCNA 3QSRA 1TREA 2HJPA 5E9AA 1CXEA 4YU1A 4B2DA 1JXJA 4JTKA 2DV0A 2G41A 2V67A 1X6LA 1K9FA 1KRBC 4GE8A 2R1LA 4IMDA 1UWUA 1TMHA 2GQ3A 5JBDA 4UB9A 4NZ5A 2B7NA 4S38A 1ZTVA 3WIJA 3EOOA 3H26A 3OBEA 3M0VA 4CD7A 4LUYA 1FP8A 4XIAA 4RKAA 3DHDA 7ODCA 2EO7A 4C7DA 3BOFA 2QJJA 4J3TA 4GZEA 3J7HA 4B5XA 4JTIA 1PWLA 3R12A 2DFAA 4NUWA 4YTSA 1DWHM 1TJ2A 2Y4SA 5CBIA 1RA5A 1TPVA 3NO5A 3W7OA 4NXKA 3WNNA 3KTXA 1ZS2A 2ISWA 1DP0A 2ATSA 4AEEA 1V5XA 2XISA 3LPGA 3N9RA 3FYPA 5AHEA 3W76A 5D9PA 3MCMA 3EX2A 1TJ0A 3KVMA 5CJMA 4CU8A 1XFBA 4ZO7A 1Y8BA 2YZRA 4Q22A 2VFEA 1RH9A 2GL5A 1EO5A 3WLTA 4O4VA 1PS9A 3WH8A 4GGHA 4HOXA 3GDKA 3WK1A 2OYLA 1XLDA 1GGOA 2I17A 3AHXA 2DZPA 4H9TA 4EK7A 2V5KA 2XWEA 1NF7A 3IJ8A 3XISA 4AIBA 1NEYA 4FA3A 5AVHA 8XIAA 1V6WA 2E9LA 5JUVA 1DJWA 2V3FA 1UD2A 2C79A 4HHHA 3LQLA 1TV2A 4WGHA 5EU9A 3LV6A 3TIMA 3FSUA 2ZFAA 4F2TA 1DBTA 3MZNA 4O4WA 1E6SM 3HPSA 3CWNA 1ISVA 2OLHA 4ONVA 4C6PA 4CGTA 4W5ZA 5DMMA 4GH1A 2VR5A 1OINA 3A4WA 1UMLA 3IACA 4IMEA 4A05A 4C6BA 4IQDA 1W91A 3QZEA 4WIWA 4NJHA 5D2VA 1EYWA 3LXBA 5TF0A 4LUSB 3W22A 3IUDA 1V02A 1JF6A 3I3BA 1UD5A 3EOSA 3LTPA 3AMDA 3LGDA 1B4KA 4MY8A 5I0DA 4P2VA 5TBOA 3R10A 3AZRA 4JICA 3HPXA 4UQ9A 3UWWA 2QCMA 2P88A 1XF0A 4HN8A 4XISA 2FPTA 4WOZA 5A94A 4HNVA 4HP5A 4REQB 4PA8A 4B90A 4Q8VA 4D6FA 4Q4KA 3FS2A 1MI3A 3MWCA 2WHMA 3NQCA 4UOJA 1FWEC 3C61A 2TODA 4O12A 3GXTA 1GOWA 1ICQA 1XBVA 3KBWA 1UR1A 4OV9A 3W7NA 1XI3A 2VRJA 3JZEA 1SZGA 4DB7A 5FF3A 4JPGA 2JF7A 3L9CA 2G3MA 2QVHA 3H4WA 4W8BA 3M5XA 2PBGA 1NY1A 3TNOA 1PO9A 3C0SA 1RD5A 3MVTA 1BQGA 3BCDA 2O7SA 2PZ0A 4HTYA 1F5ZA 3AIBA 1L0PA 1F6KA 4FLSA 1F07A 4Q4OA 4I90A 4MM1A 1K9DA 3L23A 1UP2A 3M5YA 1GPFA 1O5XA 4XK2A 3E0VA 2ZRXA 1KM3A 2P1FA 5EBUA 3WLPA 3K30A 2X2YA 3B9AA 1BXNA 4EWND 1EJXC 1GQIA 2BXVA 3T2QA 2Y2WA 2XFWA 5DEZA 1US2A 2J47A 2UY3A 3B9EA 4CCDA 3GH5A 3AWNA 3ITVA 2ZA3A 1TUFA 1YNQA 1K70A 5LNRA 4JD4A 1GTEA 3DYOA 2J9XA 1CGYA 4QDPA 2QGYA 4A2SA 3TYZA 3IIPA 3UXAA 3KM8A 5M17A 2BY0A 4O14A 3NZGA 4DJDD 4L6OA 5HAOA 2ODOA 2YA0A 2O55A 4JX6A 3ZR6A 1JDDA 2ZRZA 3UWVA 3RGTA 4F0RA 4MYXA 3WZ0E 2E25A 3PJWA 1G4PA 4CD5A 3U7VA 1HNYA 4AD5A 2NLIA 4NZ1A 4ZEPA 3UEQA 1A49A 3PAJA 4GCAA 3LCIA 5K4XA 3HQOA 1TPH1 4S3AA 2WMIB 3SDOA 3T44A 1A5NC 3U5YA 1JQVA 3WDPP 3KBVA 3LSCA 1NQKA 3CMJA 1UB3A 2QCEA 3SJNA 3PF3A 4D8AA 4Y9OA 3LA4A 5CCZA 1FWJC 4Z1DA 2B31A 3TKFA 3O2LA 1GONA 3OGRA 4HNTA 1JQXA 5L6UA 1DJXA 1N8WA 3CZEA 4UTIA 4PUWA 3MHUA 4ROPA 4MNMA 3CUIA 1E5JA 1WXJA 3NQMA 1FWBC 4MYAA 4DYKA 2DSZA 1Q66A 2DH3A 3IEBA 1KCKA 3A3WA 3G0SA 1A3XA 3C3NA 3M46A 2WK2A 3H7UA 3IPWA 4ZSTA 3RO6A 4UMAA 2ZUUA 3G3MA 3FOKA 2ISVA 4EIVA 3VC5A 3W7KA 3L4VA 1NIUA 1MEHA 4ICMA 3GU9A 1EIXA 1XUUA 4Z08A 4TR9A 4RDZA 4UTJA 3AJXA 3S9ZA 1DJHA 3MKKA 1TV5A 3B06A 1JUEA 3NZPA 3NSMA 4LV9A 1E1EA 4ADUA 3H55A 2WC7A 3W2UA 3LMZA 4R7JA 1G5AA 4QLKA 3LNPA 4W84A 4AVOA 3EDEA 4MJZA 3MCOA 4FZIA 3SM0A 4HN4A 2X0SA 3IWPA 2I14A 2GDQA 1WKEA 2FVKA 2QCCA 3G1VA 1M01A 1BRLB 3URAA 1CBGA 1LOSA 3D6NA 3FFSA 4PMOA 4HCDA 1T6MA 3MI2A 1DQXA 4GI8A 4PUEA 4B5VA 4LVBA 1EPVA 3EB2A 5DX7A 2ZC1A 2ZX6A 2VDIA 4PUUA 1GOQA 1FWIC 3YPIA 4WXZA 3HM7A 4PODA 1LF1A 2GLKA 4M51A 1BWKA 1PDYA 3BAYA 3I7QA 1XR2A 2WYSA 1KGUA 2ONEA 4FLRA 4QRNA 3KBMA 5HUOA 5A6AA 3EA1A 1SFJA 4OUEA 4HHLA 3WN6A 3N15A 1O4UA 3KW3A 1XH1A 2J7DA 2Z1BA 3WBYA 4ERGA 4FMVA 3E0LA 2J7BA 4GOAA 5HR7A 2XTKA 1XIMA 4HGXA 2VC5A 5LNUA 1M7OA 3O1NA 3OP2A 3ONCA 5DN1A 3KDNA 1AMYA 3VIPA 4TMCA 2D0FA 4Q7IA 3W88A 3OGSA 2GK1A 1BFNA 4DN1A 4EANA 1W5OA 1JDFA 1L6SA 4K7YA 1A5BA 3QGAC 1YLVA 3ZR5A 1QNRA 2DW7A 2YCJA 2YFOA 4NI8A 1QCWA 2WMJA 3N19B 2Y62A 3DFTA 5HMFA 3CAWA 4N6FA 4HU8A 4XAFA 1ITUA 1NELA 1KM0A 2YB4A 4N02A 1Z48A 1A47A 2BHZA 2GGEA 2QMKA 4C6KA 3WL0A 4WHBA 3N3MA 4GUJA 1QXLA 3L5MA 3JW7A 6XIAA 1A4LA 5CKSA 3CAVA 3ABSA 3H23A 4YTRA 1KQYA 1Q6GA 4YTTA 2V2CA 2BBFA 4MVAA 1YYAA 4IPJA 3QLLA 2J62A 3WEZA 1R3WA 2QCGA 3RCNA 4RPPA 2JFEX 4G7FA 2P3EA 2ZVIA 5HPCA 2I1OA 1IYXA 3TYDA 1C8QA 3VYLA 3H22A 1EGVA 2CFFA 2EPOA 4X2RA 1IT7A 1RK6A 1XDJA 4BI5A 1RQBA 4GXPA 2J75A 3OZPA 3KCJA 1TYGA 2R9RA 4KPLA 1J4EA 1MVYA 1UP0A 4QG9A 1O60A 9XIAA 1RY0A 2HRWA 5BZAA 3SN1A 4LB4A 1CXKA 3FJ4A 3W74A 2XZ9A 5I02A 1X7FA 1FKXA 3NXFA 3OHMB 1LRNA 1YE6A 1E3ZA 4AXKA 1C9DA 2WHLA 3SCSA 4XAGA 4GQGA 5CSRA 4JTTA 1B31A 4W86A 2GVEA 5G2HA 3RYSA 1W5PA 3GC2A 4CNUA 5ABEA 4PMVA 3CS2A 2CLLA 3ZZ1A 4XVEA 2NUYA 1O5RA 3NL3A 4HSNA 3PHAA 4UR9A 3RFAA 5AYIA 1P6CA 3E96A 1EP3A 2RGMA 2CYGA 5KETA 1EEPA 1QI2A 3MSYA 1QR7A 2BVYA 1JFHA 3UG5A 3LGEA 1HJQA 4IG2A 2Q8ZA 1A5CA 4Q6JA 1TE1A 2OX1A 4F8XA 4IFKB 3LRKA 5HNRA 3RDKA 4A8IA 1PZ0A 2FVMA 1PSCA 3UVAA 1EOKA 4AW7A 4AY1A 5A8MA 1LT7A 5EMKA 4I5XA 1J0IA 4Q8PA 1UD3A 2B81A 1KNWA 2AL1A 2YL5A 4PMYA 3GTIA 1AW2A 2BG5A 4V2XA 1VJIA 4ACZB 4GX9A 2IQTA 4M3PA 1Q4WA 3W7PA 1GUVA 1DJGA 3TLLA 3A4JA 3FGCA 4GUHA 2X0HA 3VIIA 4UTWA 3C0LA 4DYEA 4QG6A 1IE7C 1EBHA 2WNQA 1QPNA 1VZWA 3GYCA 3IGUA 3BJTA 4QLLA 3D46A 1F61A 1Y5XA 4UR7A 1W1A1 3CB3A 1G9HA 2CBUA 3W82A 3C5QA 3O63A 2J79A 4QX4A 1D8WA 4QEEA 2UV8G 3KWSA 3Q67A 3GFZA 4BA0A 3ZSTA 1MW2A 1GVOA 2PDNA 3T8QA 4DWSD 1HJVA 3W1PA 4QDWA 3LK6A 3OBAA 1VBJA 3VNLA 3G5EA 4DAFA 2W67A 3T08A 1JCMP 4PE8A 2YPIA 4YHGA 2CLMA 1X97A 4AYSA 3FXYA 2VX6A 4XKYB 3LRMA 1LL7A 5HOSA 3EZ4A 2JBMA 2I5IA 7ENLA 2VCBA 3G1SA 1RBAA 2FYMA 3QOMA 4DXVA 4ATLA 3I68A 2R82A 1H11A 4W88A 3W2MA 3Q4DA 1XCXA 3CZLA 4ZBCA 4WXYA 2C6QA 3W72A 4XX6A 1H1NA 5HK4A 4WKFA 4IX2A 1P0EA 1UKPA 1OFRA 2C71A 3LXAA 2REQB 4KMQA 1ALDA 4DUVA 4HTBA 3NQ8A 1JUBA 3NPUA 2HEJA 3PJUA 3EB4A 4JIIX 4GIRA 5D2XA 5CPSA 3WBWA 3L0KA 3VGHA 1O68A 1OF8A 3EDKA 1QNQA 2QMJA 1SU5A 5CC6A 2JALA 5TAOA 1NH6A 1W5MA 5I3JA 1OFAA 3SB0A 4AD3A 5C2GA 5F4SA 3MV01 3N3TA 1G0CA 3U2OA 5GJMA 1UIPA 4QLJA 4HHPA 3WQ6A 3MT1A 3I4EA 2B0MA 3LDVA 3W38A 1KBJA 1F6PA 1EJUC 4G56A 3MVIA 4L4OA 2G95A 6REQB 3BMWA 4YN5A 1G01A 3GVRA 4J3UA 4JL1A 4HIBA 3ZWTA 2WKGA 1KXHA 2HISA 1S38A 4Q7BA 1QO2A 4IGSA 4MFEA 2OWXA 3LHTA 3CL7A 1R6WA 2C0AA 4MWAB 1TZ9A 3AHZA 1QPQA 2E6DA 2AMGA 1J18A 4A8LA 1PZ3A 3LMYA 1B3VA 1GG1A 3R7MA 4FIRA 1PTAA 3G6LA 1L6FA 5LHFA 4H8UA 2ZYFA 4WUIA 1R9XA 5MHBA 4F9JA 4HPNA 1KRMA 1MRAA 2FLIA 2RHGA 2VFDA 4LSBA 3VK5A 3WL1A 4FB7A 1W3NA 4ZR8A 2JIEA 3DFQA 4C7FA 4UTFA 5DCEA 1EJ7L 1LLWA 4WGXA 2AMXA 3LS9A 3VABA 5CGMA 1SR0A 1EDGA 5I78A 2VDGA 2O0TA 1VB9A 3VX1A 1T96A 1D9EA 4H9VA 3NJ3A 3LX9A 2XIIA 4NU7A 4LBSA 2FQIA 2IKGA 3TA9A 4MB4A 2J78A 5BMXA 2PODA 3N9KA 3W1RA 1FH8A 2IS7A 3OHIA 1CIUA 1QO5A 4RZ6A 1E1FA 2FTPA 4PEKA 4LH8A 3SUUA 1W8SA 3MMDA 2D22A 2WSPA 3NR0A 1RZMA 1VFUA 3P67A 4JIPA 2OEMA 5AKQA 1JGIA 1HL9A 3CAKA 1R0MA 1R3RA 1K7XA 3B97A 4WDXA 5D2WA 4IHCA 3VTRA 2WZTA 3SCRA 1E0VA 3LBCA 3KZSA 2CLIA 1ZY9A 2D0HA 4U5IA 1WDQA 2VQUA 3H6OA 1XLIA 1OCNA 2EAWA 3E5PA 3N12A 2ZX9A 1TTJA 1WUEA 1V77A 2DGAA 1JGMA 1JPIA 2MUCA 4DJDA 2H9AB 1J0JA 5BOFA 4YJ5A 1ZSXA 1MXDA 1ZBCA 2OZ0A 1VRXA 1YDNA 2VELA 4GVGA 5LNWA 2VC6A 4F79A 4D6CA 1B3WA 2ON3A 4GIEA 4ZOEA 4B3KA 3TDFA 2DIEA 3WBAA 2QUUA 4K2SA 3IVUA 4ZO6A 3O6CA 4XAZA 3AIVA 1WZMA 4GCXA 3H2CA 4H6KA 3IARA 4H4IA 4PUJA 2ZXQA 3FDKA 3LLXA 3WFZA 2WWDA 3UZ5A 2P10A 4KCUA 5KINA 2AAAA 3PZNA 2PTXA 4NKCA 3QMTA 5JIPA 4XUGA 1VIWA 4OGZA 1M3UA 2Y8VA 4E4FA 3RF9A 4JFVA 1AH4A 1ML1A 1QOPA 2ZQ0A 2PDHA 3NM3A 3K4WA 1Y7VA 3GX9A 3BLLA 4LCRA 2BX7A 4WDWA 1P5BA 4WY0A 1EZ2A 2OO0A 3P74A 4A29A 3N1AA 4IMAA 1QI4A 1M7PA 3H2NA 4JTHA 1BYAA 3K8MA 3GZ3A 2Z7GA 3AIWA 2X1IA 3CPUA 3OODA 1YADA 5HMSA 2XN0A 1R7AA 2XH0A 1GWJA 3GG0A 4HZ7A 4AC1X 1MEIA 2QUNA 4JY9A 3F5LA 5AYXA 3E74A 3NQEA 2BGNE 3CMGA 4AH7A 2Y7DA 3E1F1 4PBEA 2QCLA 3W2JA 1XXXA 4HOWA 3O6YX 1FVPA 3N18A 2BY1A 2C1HA 3RJYA 1DWFM 2F6UA 3CAQA 1H1ZA 4QROA 1OM0A 2ZRVA 2O9RA 3VNYA 3GC5A 2QUMA 4PBGA 1UUOA 4PCNA 3FK4A 3WUEA 1E15A 3GQYA 3ATYA 4IMCA 3MSDA 1GOOA 4A3QA 4XZWA 1XQLA 2EKGA 1B57A 4M24A 2AKZA 4JOMA 1ICPA 4AZHA 3NQVA 1RPKA 4HA1A 3BZGA 3CIWA 1QWGA 4RDVA 3FHAA 1XIIA 4HJWA 4DJFC 4GD0A 1XIFA 1WX0A 4XBSA 5BYWA 2C16A 2WSRA 1YEYA 4ZE5A 2VEFA 3L4XA 3G0UA 1SJBA 5HINA 3LCWA 1YPIA 3ZQ9A 2WAGA 7REQB 4KCVA 3GBEA 8TIMA 3SW6A 4QCEA 4MOZA 3UG4A 4UTHA 3AC0A 4TVDA 1ZBVA 1GVQA 4Y6GA 4YVXA 3V7PA 1WBJA 3QPYA 1E9ZB 3MSRA 3LNMA 3GVGA 3UBPC 4ZENA 3GKAA 2QJHA 2BVWA 9XIMA 2JGQA 1XLMA 4JHZA 3NURA 3TW6A 1PX3A 1O5KA 1ONXA 4QFUA 3VNDA 4AVFA 2VCCA 2WC4A 4JTCA 7PTDA 2D2GA 4BFAA 1SW0A 2IPGA 1J10A 4PTDA 4XSMA 5CQ1A 4JS3A 2EG8A 4RXFA 2W4XA 4HSOA 3SO7A 5DXXA 4UTTA 4PL1A 3AYTA 1W0MA 2PC4A 1VHNA 4NZCA 5CPQA 4X9YA 4OJYA 4P8WA 2JKAA 1DJYA 3CU2A 1VFSA 2E3ZA 3LYEA 4AIOA 4S3DA 1ZBWA 3JU2A 3K46A 1JYNA 3C6CA 3EXRA 1J96A 3LZ5A 4C6OA 4LYRA 2W61A 3LGGA 4N42A 2B4GA 5TIMA 4UNKA 2F38A 5AC5A 3W71A 5A6TC 4KRTA 2BVTA 1EQCA 3PP7A 3P5ZA 4CN1A 5LIKX 3UXLA 3WQOA 4DEFA 2OGJA 1XIHA 3MPGA 3GAKA 1LL4A 3HGRA 4NX0A 4BK9A 1RSCA 2HK1A 1JZ3A 3EYPA 5C7HA 2ZZ2A 2D69A 3GB6A 3L68A 4ATDA 4JYDA 3CQIA 2R1NA 1ZAJA 3TJ4A 2ZRUA 4KWSA 1A5MC 4YL2A 3URQA 4WR3A 3LEPA 3PS7A 4JEJA 3QZAA 4KFPA 1CLKA 3L5AA 2VR4A 1RXOB 1OX4B 4PFMA 1PZ2A 3HV9A 4JEQA 2RJHA 4H9ZA 1HQTA 3LI1A 3PN8A 3WFAA 3MBDA 1FWCC 2Q3RA 2YR1A 4R5EA 1ECQA 3VD7A 1TUXA 3OZOA 2OQLA 3UPMA 1UD8A 1CGWA 4MG4A 5BNKA 4NX5A 3NA8A 3ABZA 2RGLA 4PL2A 3SQSA 1MDRA 2ZRWA 4LV4A 4J5NA 4JQAA 5L9FA 1W56A 2VRQA 2PDWA 3STEA 5FCZA 1AZ2A 4YYFA 3PWIA 3VKBA 2ZUMA 5A8QA 3RHGA 4ORIA 2Y24A 3NDOA 3THDA 3L21A 2RFGA 3BGJA 1NDYA 1GZGA 2DSVA 3UR8A 3F4NA 3DC8A 3TYBA 2GOUA 3ANVA 1UIOA 4O0KA 1RUSA 2PDXA 2CLOA 1VEOA 4CNOA 4XBJA 2OJPA 4PGLA 4CQCA 4L4LA 3G1YA 1B3ZA 4FSAA 3CNYA 1XH0A 3IJQA 3R0DA 1KFKA 1W8GA 1DIEA 3UJSA 2VR2A 3I7SA 1UMYA 4HD5A 3M1ZA 2NVAA 1OB0A 2HQAA 4JXCA 4RL3A 2D1ZA 2PI6A 5FJUA 5H8PA 3VX0A 3TC3A 4QGCA 4Z0SA 1F3TA 3EOUA 3PB2A 3OGVA 3R0KA 3F5KA 4XQ6A 3MUZ1 2PWUA 4PB4A 2VX7A 3WQPA 3ZOAA 1OC6A 4KBXA 4D71A 3DZ1A 1WDSA 2RDTA 3QV9A 3AFBA 1R3SA 1EIBA 4EACA 3RRAA 5LIWX 1VEMA 3DYMA 1QATA 2TRSA 4ZODA 3FW6A 4JN7A 4MNKA 4IMGA 4ERIA 1B9BA 1OGGA 3B4UA 2E67A 4Q32A 5C7VA 2GVLA 4US6A 2IW0A 3W27A 1EWEA 1TJRA 1S2UA 1SW7A 2D0GA 2PURA 1XUZA 5BWAA 2DZBA 3HN3A 1WXYA 3S0CA 1AMKA 3WNOA 4QP0A 2GSJA 3CTTA 4LX4A 3BOXA 1EGZA 3SCUA 3BGAA 4DBWA 1YPXA 3VNZA 1JDEA 4JNYA 3QEZA 4WQ6A 1KBKA 2PGWA 1S5WA 4BQ5A 1HVXA 2OXNA 4GJIA 3VGGA 4J2MA 4DBSA 4LU0A 3DFOA 2A6LA 2PRMA 3I6RA 3CASA 5LXXA 2NUXA 3RXZA 3NNTA 1TQXA 5CPMA 1R5YA 3JVAA 1FH9A 3W87A 3GXIA 4FEZA 2VT0A 1W1VA 4MUZA 1ZALA 1PTGA 3H24A 3TV8A 1DJZA 2Z4GA 2WPGA 3ZJ6A 1H61A 4IF2A 4IJRA 3TR9A 1PBGA 3UGVA 3WLOA 3GXDA 3M5VA 2IQ0A 1KFEA 2VENA 3W1MA 2BOFX 2HNEA 5BRBA 1QNOA 4GBUA 2HZGA 5BW6A 3FJ6A 4IIEA 5D9NA 5D8ZA 2Y7FA 3G24A 2XVNA 3WLRA 1UKTA 1DVJA 4IJBA 3AIUA 3R25A 5J5DA 3WH9A 5M3WA 4LVAA 2ABBA 3F4VA 1DWGM 1BVNP 4AFYA 1ISYA 1VD6A 3TAOA 5C9RA 1GKPA 3MUXA 3VGFA 3POHA 2YIHA 2QUTA 2PDUA 3IIZA 1B2YA 3SY1A 4K37A 5A6MA 2GYIA 2YA2A 1QT1A 5EY5A 2PS2A 4EPKA 1KFBA 4PUNA 2Q71A 1FCBA 1FHUA 1RBOB 1XYBA 4WDUA 4F0MA 2XSXA 1L6GA 1H51A 1G4SA 3R0UA 2FGBA 5FIPA 2PWDA 2HVNA 3W84A 1QHZA 1GQJA 1JYVA 2CBJA 2VP8A 1FWRA 3DX5A 4O13A 1E43A 4HZ8A 1PKNA 1KFWA 4H2HA 1TX0A 4JDYA 1EJTC 4R3UA 4FX8A 1HJWA 3TYUA 1WBHA 4ZQRA 4TV6A 3HO8A 3S5YA 1Q5MA 3M5ZA 3BGGA 2XFFA 2V0TA 2DT1A 2A5HA 4RNIA 4TX6A 1X96A 3GY1A 4E2BA 3RR4A 4U31A 1UZ1A 3ANUA 1JZ8A 2C7FA 4M7SA 2VCAA 4E8GA 4W87A 4Q4MA 3CYJA 1DTNA 2HV5A 2FJUB 1NFPA 2X1RA 3THUA 4S3FA 1EKOA 3Q45A 4FXJA 2PDCA 4L9XA 2PWFA 3AJ7A 1KCLA 3BAJA 3TTQA 4PTMA 4S23A 3S2NA 2ZTJA 4NQ1A 1F2JA 1R9YA 5FSEC 1EC8A 5GQBA 1O12A 2WM0A 3LPFA 4JY8A 5A8OA 1Q7ZA 1G69A 3FJLA 2VFIA 1KM2A 2P76A 3UYIA 1A80A 4PMZA 3D3AA 2OGYA 1E0WA 1Q8AA 4I7UA 1V7AA 2AGKA 2I9UA 3UVIA 1FFQA 4PH6A 5KZ6A 4KF1A 4KQNA 5I3KA 4FXRA 3W2NA 1KXQA 1P0NA 2OZ3A 1E1CA 4MTVA 1FX6A 1U2YA 4XBKA 2IKIA 5FEPA 1K03A 1LORA 4AVNA 1KWKA 5I3HA 1SZRA 1QW9A 3H53A 2CHOA 1MWOA 1EP2A 1RCQA 2OKTA 4MHBA 5C9XA 1KM4A 4K38A 2WHKA 3KBNA 1PE1A 4C6JA 3VOFA 1U5VA 1XSKA 4Y8FA 4I9AA 5H8UA 3VOGA 4W9TA 3GNPA 2PRHA 2YBVA 1LOQA 3PUOA 4EAMA 1B9ZA 4BEUA 2P5NA 1RK5A 1A0CA 2EG6A 3DKJA 3VGEA 4CU7A 2EHHA 2FH6A 2VWSA 4OECA 4LANA 1IZJA 3PBVA 1MNZA 2V2DA 3QOKA 3CYVA 1WKFA 3VNJA 2E68A 3HGJA 4EPBC 4Z1AA 5FACA 3B9NA 1VLWA 1A0EA 2EPLX 5LGZA 2I5QA 1FBAA 1UR3M 2ZE0A 3WMSA 4DLMA 1ESWA 1PB0A 3B03A 3QLDA 1SFLA 1H62A 4PRTA 4ZQPA 1ZP3A 3DIPA 4LB3A 1VFFA 2QEZA 3CH9A 4U10A 4W8LA 3WLIA 3BC9A 1C8XA 1PYFA 3SUWA 2ZC8A 1DORA 3CZKA 4Z0JA 4IG2B 1TA3A 1P7TA 3WJYA 2PPGA 3OVPA 4MJ2A 2B7QA 2J8GA 1I2NA 3CUFA 2VX4A 2A3LA 4DZHA 3RU6A 5MKGA 1J9YA 1FXQA 4IIGA 2DIKA 4DY1A 4D6HA 1RV8A 3CWHA 1YDVA 4OOZA 3MMWA 4WSHA 3CL6A 3UNDA 1XBYA 3FGCB 3HBLA 4MIMA 3WLQA 1Q45A 3E5BA 1M7XA 5CBBA 1XRVA 2WV8A 4GMEA 4F2UA 4RX0A 1ZNNA 2KZHA 3VIHA 2W66A 3DECA 1OZMA 2ISDA 3WLSA 1WV2A 3LENA 1LLZA 4J3ZA 4LW7A 3PC0A 3NL2A 4OT7A 1NARA 2ZWYA 2DPEA 4AWSA 3ARZA 1W5QA 4N9BA 2IKJA 4QNEA 4ZB2A 1VBUA 3VVGA 3KBJA 3B40A 3W7HA 4JTFA 2GVJA 3L2IA 1DE5A 1I2OA 3RG6A 3ITTA 4HA3A 2PAJA 5GVJA 5LNVA 4A35A 3VDCA 1V51A 2DT3A 4C1NB 4V1YA 1XISA 3ZXWA 2Q8LA 4J9JA 5F4XA 2A3AA 2YSWA 4F0HA 1DXEA 1OQFA 3SSZA 3VMPA 5I00A 1UPPA 4B3ZA 5I77A 3KHJA 5A2AA 4QE4A 1ZJAA 3BE7A 5BXTA 1HKVA 1EDTA 1OT2A 3AXHA 4AUBA 2ZKMX 3BANA 3W86A 4LOCA 4IL2A 1EJRC 1UHVA 4W7UA 1WOBA 3UZZA 3TW7A 3VKDA 1PVNA 2ACSA 3W7LA 4NJKA 4GQ0A 1W9PA 1JVNA 3SCWA 5LSMA 1TV8A 2O4MA 2PC8A 3RJXA 3ITOA 4J3XA 3NDZA 1KR0A 1AFSA 2QCNA 1QI0A 4KIRA 2EPHA 3KXQA 2PF8A 2VGGA 5AC4A 1MRQA 3A4XA 4KCWA 2QDGA 3THAA 3W1QA 5CLTA 5TQLA 2BMBA 2I7GA 4PULA 1W5NA 1WZLA 4JHMA 1U22A 3F2BA 1W1PA 3QW3A 1MQPA 4DBDA 3S47A 2FPYA 3TC7A 2PB1A 1O1ZA 1VPXA 3M43A 3NFUA 3BUVA 1WQ5A 3SRFA 2CPUA 4K7VA 4YHEA 4ZMGA 4O18A 4XTIA 2XJ7A 3QGKC 1BRLA 1T8QA 2R1PA 1Q6DA 1Q6FA 1JCNA 1TWSA 2W62A 1ZB5A 3VD9A 2ZCGA 4DUOA 1JI1A 3TMLA 5GNXA 3W81A 3VC6A 2V5JA 4OBTA 5FEWA 3K8LA 4OOUA 4Q4RA 4EAYA 3N4FA 2ZZ3A 5KSWA 4O1DA 1QI5A 2WVVB 1NFBA 3ISIX 4FALA 2NQHA 3S5NA 3L7RA 4HQVA 3CB8A 4GUGA 4KCTA 1SZFA 3R13A 3HQNA 1SUXA 2BHYA 2WMKA 3BLFA 3RM8A 3SQMA 1P0KA 2Y7GA 1OFQA 1V0LA 2JEQA 1H60A 3H2MA 4GXMA 4KWWA 1GHSA 1SO6A 4W7VA 4WX2A 4UQBA 5CJNA 3S2CA 2ZUSA 4C6QA 3ENLA 2X1TA 1G1YA 3TVAA 3VIJA 3L12A 1POJA 2W6RA 3T2PA 3UW6A 4ES4A 2ATMA 2C8NA 4G1KA 1T41A 1KCXA 1I4NA 4WD0A 2EJ1A 1V03A 5AHMA 4JX4A 2J7CA 4IIBA 5H91A 3CHVA 3IV8A 1Z69A 4OE7A 4KS0A 3PSWA 3HQPA 1BVZA 3PWAA 1HT6A 4L61A 1I9CB 2NX1A 5K2ZA 1IXOA 1UH2A 2XVPA 1KTCA 4RR4A 4BWLC 3U2EA 4Q7NA 4PCFA 3DG6A 1GVEA 2VEMA 1QU4A 4ZB0A 4XB3A 4XV0A 1UR9A 5H8MA 2XN2A 3SURA 5BXSA 1VBGA 1YX1A 4NI3A 1QOXA 3WY1A 4D1JA 1ZUAX 1BYCA 4NY2A 3QV7A 1XGZA 5ECVA 2Y7EA 3CHFA 4L1WA 1W9BM 3LCGA 1IQ8A 4IXXA 2OCZA 4K8EA 1VR6A 5IDIA 1TQJA 3OQ8A 1NOWA 1FH7A 3EOLA 2Q8XA 4JTQA 2A4AA 2Y8UA 2Z27A 3TW9A 3R2GA 3MYPA 4AHPA 1FCVA 2PWVA 3VKAA 2HE5A 8XIMA 1CECA 4O16A 4QIUA 1NM9A 2D20A 2G3IA 2CZEA 1K6WA 4HPJA 3NOYA 3QQ1A 2QV4A 2HMCA 3S4TA 2Y0FA 3LLDA 3Q65A 3SFKA 1FWGC 4B5NA 4US5D 1OFBA 1RJPA 1KKOA 1XLBA 3O07A 5EKYA 5RUBA 3D0CA 3G1RA 1ZCCA 5AY7A 3VNKA 3HOJA 4OWGA 3BTNA 3GUWA 5B7YA 2NQ9A 4U2ZA 2QAPA 3BJFA 1KV8A 4DYJA 3TC6A 4UFKA 4WDTA 4QS6A 3GNRA 4PMDA 1QWKA 4HT3A 4LVFA 5HA7A 1RVGA 6PTDA 4UNLA 3CUXA 1VENA 1EJSC 3CEUA 1UQZA 1TTQA 4IWWA 2DT2A 2PTDA 4PTVA 4B5TA 3P2VA 2G3NA 1NWUA 1V3KA 3W02A 4G8TA 2J66A 3URBA 2OYMA 2YCLA 1XC4A 5C5YA 3KOYA 4R34A 1C7TA 3K13A 4B15A 5F1VA 1CX9A 3IK2A 4GZIA 1E40A 4XUYA 4AZCB 1RLDA 1PZ1A 2R8WA 5ABFA 3LHVA 4NG3A 3TYCA 3O16A 1I2PA 1LZOA 1OFOA 4MNJA 3WQFA 4IP4A 1GOMA 3NL6A 4YTQA 4A3UA 1LT8A 4AF0A 1BXBA 3UXIA 1OD0A 3EXSA 1XGEA 3TUUA 1VF8A 1ZFJA 2F61A 2XIJA 4NYUA 4QJ1A 2R14A 1VKFA 4NRRA 4LF2A 3SCQA 2FB3A 3AMCA 3T0BA 3EWUA 1CI1A 3BCFA 5FL0A 2F2KA 4ACYA 2XZ7A 4O8RA 4E5TA 4JYEA 1WZKA 1H4PA 3TYEA 5A6BA 3HZ3A 4M29A 5H1WA 1XYCA 3MWAA 1FWFC 2A7NA 4B9YA 3UP8A 4AISA 3AUJA 2VD8A 3RITA 5J04A 1H5YA 4B91A 1HGYA 1XRFA 4AZGA 3TZNA 7XIMA 3MMUA 2ZXDA 5D33A 3CH0A 2D24A 1IV8A 3G0XA 4D9PA 5AHFA 5HNUA 5LIYX 3GTHA 3CPGA 3OLEA 1V6YA 4XKYA 1ITCA 2DJXA 2DQXA 2EQDA 3U5UA 5FF2A 1TCMA 1TMQA 3WQWA 1V3MA 4XD3A 1FDJA 3OJGA 2BP1A 3JR2A 5E6YA 4AQLA 4DF2A 2CBVA 3H54A 4J7RA 4E8DA 1E3XA 4FNTA 1EPXA 4R27A 4QAIA 3USZA 2FZNA 3AU6A 5AOUA 1FTXA 3MYOA 2KX9A 3ZR4A 1ZJHA 4X2PA 2DZXA 3MUCA 1K8YA 2ZE3A 3TNBA 1UZHA 1LRQA 3NM1A 1P43A 4H00A 3KE0A 5G1MA 4G2DA 2YXXA 5EMYA 3ZT7A 3VIMA 1RQEA 4FF5A 2XGBA 3WMBA 3V4BA 3AHVA 1FA2A 4ASTA 4PCTA 1F05A 1Q7QA 4DM2A 2G37A 3SGUA 1PL9A 3MZ2A 3ORWA 1CTNA 3V75A 3ONBA 1SM9A 2GWGA 2VZSA 3DH7A 1KC7A 4JKLA 4DX3A 1W1YA 3VKJA 3P8JA 2OT1A 4GC3A 3C56A 1W3KA 3G2GA 3ARWA 3KDOA 3O05A 1XSIA 1WA3A 4A6GA 3E2QA 4QS5A 4BZYA 3NEVA 4YCOA 4UQEA 1B5TA 5KMYA 2GJXA 2PDBA 5F1UA 3W1NA 2DZWA 1ICSA 2Y8KA 4FX7A 3W53A 4RLIA 1E0UA 2X0YA 3G3DA 3L67A 2ZUTA 4Q4SA 3R5EA 2DUZA 4WKAA 2ZXAA 1RBLA 5DT5A 3OBKA 1XRTA 3VNMA 1KXVA 4E0CA 4DBUA 1EA0A 3GK0A 1A3HA 1GYNA 4TTGA 1OHLA 4N0RA 3UA4A 3PZ9A 4LCQA 3VM5A 1TWWA 1QI3A 3WK0A 3AO0A 4JTRA 5LKYA 3ZT5A 1VHCA 1A5UA 3RPDA 3M0XA 3Q2DA 4NZ4A 1FFRA 1UZ4A 1VS1A 2DDXA 2FVLA 4MDOA 4XO6A 3M0MA 4URIA 1AODA 1DXIA 3TH6A 2I56A 5KITA 4E38A 4IQJA 4MSSA 5D04C 3S8HA 2QAFA 1B3OA 1L8NA 3EPNA 4DJFD 5FJTA 1V3IA 3JRKA 2XIBA 3A4AA 3NEHA 2NWRA 3NAVA 1W1IE 1XPYA 1S3HA 3E38A 2GUBA 2F6XA 3ZLHA 1TR1A 2V3EA 4JCLA 3USBA 1JD9A 1JPHA 2QGHA 2V9DA 4GK8A 2AAMA 2OSYA 3IAQA 4GI9A 2ASHA 3ME3A 4CQDA 4UZUA 4XWUA 5I2UA 3ALGA 4GX8A 4AZ5A 4UTMA 4DRSA 2Q3OA 1DIKA 2GJNA 3MTWA 3RLHA 4Z42C 4LS2A 1YIXA 1F73A 1E0XA 2V5LA 8CGTA 3W1UA 3L0NA 2OQYA 4TO8A 3N6HA 3L4ZA 5JBFA 2EXOA 2PDKA 4KKXA 4W4QA 1ZGDA 4IPPA 3PPFA 1HGWA 3WH6A 4C6EA 5IBXC 2XVKA 3MUAA 3W7IA 3NVTA 3FHQA 3C0QA 1V0MA 2CETA 1FDYA 1J0KA 2PD9A 1CW2A 1F8MA 3P60A 2WZMA 3W6LA 1TPDA 3QQWA 3QTGA 2OR2A 1JD7A 3CT7A 2FFIA 4S3CA 3GKFA 3H4XA 2PA6A 4H6RA 4LBUA 3L4WA 2VUNA 2HK0A 3DFPA 4YWSA 5DMYA 3FA3A 5AVNA 1IT0A 4KWUA 4BHYA 1XRSA 1QBAA 3B3DA 3EOEA 3OQEA 4B92A 4DM1A 3TQPA 2Z2UA 3H7VA 1GEQA 3ARTA 2DVTA 2V3DA 4OV4A 3DFYA 4QR6A 3VA8A 3CV7A 1TPWA 3BV7A 1TVPA 3SRHA 1QAPA 1K4GA 4KETA 1JULA 1Q3NA 1CB7B 2OO6A 4O1EA 4AIEA 1L6WA 3BSGA 5LIUX 3VCRA 3GVWA 4IPNB 4RZBA 4HB7A 4NNCA 2OKOA 2HBVA 4AY8A 4FLOA 3RRXA 4GUIA 3P81A 1EGMA 5EPDA 3LG3A 1OIFA 4HHMA 3S6DA 3AMKA 1G6CA 2VFFA 3BLDA 1Q85A 1D3HA 1OY0A 4AAJA 3HG2A 2C18A 1DKWA 2IUZA 2CLKA 1VC4A 2X16A 2QDDA 3V0TA 2PSNA 2E8ZA 2Z26A 4D6EA 1T99A 8RUCA 3H21A 3VMOA 2VMFA 1OGBA 4Y7EA 5E9XA 4XZHA 2BHUA 3H4GA 3SZ8A 5KTLA 2P0IA 4WEVX 4D6DA 1KTNA 2PDGA 2WKJA 3UWYA 2XIQA 3WK2A 1EBGA 1V93A 4GC4A 1R3QA 4FP1A 1YKWA 1SVDA 3CZ8A 3INPA 5FF4A 5AYYA 1JYXA 2G96A 3UQNA 2PBOA 3HG4A 1MMFA 3P0WA 2ZA2A 3F2DA 3TZFA 4NHVA 4JDBA 3T4WA 4LYPA 2QPUA 3NOEA 3QTPA 2UZ9A 5CEWA 4KEZA 4OIFA 3KS5A 3NSXA 1VPYA 2WMFA 3GXPA 3BLOA 3OA3A 1P6WA 1XX1A 1NWTA 3WLNA 3UJEA 3C86A 3W7DA 1IGSA 1NFGA 1GVRA 1OWQA 3CT2A 2FMOA 3KUMA 4TX9A 3T81A 2Y70A 1ONEA 2ACRA 4DJDC 3GD6A 1VAHA 3C2EA 1TO3A 1TTPA 3W26A 3R8HA 3GHTA 3T7VA 5E0KA 2B7PA 4BQ2A 4ZFCA 4GG9A 1M1BA 4QITA 3TTEA 2W0UA 2PUZA 7REQA 1F6YA 5DELA 5DXYA 3N34A 2CZFA 5KZEA 1W31A 1OZQA 4H19A 2RDWA 4HOZA 3M6DA 3S2MA 4P7RA 5BOOA 1IIGA 3O06A 4AWTA 3CHDA 1XL9A 1OBAA 4ERAA 3C52A 3NO3A 3LHZA 4YVPA 1CB2A 2PE4A 1L9WA 4I7WA 2CC0A 4NJGA 1B54A 1RCXB 2A6NA 1GTHA 2GZXA 4HVXA 2OSXA 3OO2A 4MADA 1WB0A 2GSHA 5D37A 3WNKA 1UUMA 4O11A 1H50A 3EMQA 3FNDA 4DZIA 5CPOA 2P53A 4DZAA 2WVSA 2X7VA 3TSMA 5K9DA 3DFNA 1AVAA 1LP6A 1BXCA 2YL9A 3RNDA 5C70A 3ZT6A 1PCWA 4EE9A 2QCDA 2ZVRA 3ES8A 3WJWA 3LBOA 4CN4A 5LZLA 4GO8A 3KRSA 5FF7A 5H6HA 1E1CB 3UZYA 1CDGA 1BG9A 5A1AA 3E2RA 3W00A 5ABHA 1EL3A 2DORA 3I4KA 3V18A 1HKMA 4LAMA 4R9OA 3CBWA 4QEHA 4P5UA 3P84A 2CZDA 3ECQA 3QMRA 3BVJA 2NT0A 4GH3A 3TYAA 3T1GA 3BSHA 2NV2A 1IF2A 3UR5A 2QVNA 4CCEA 4HU3A 4FOJA 4Q6XA 1O94A 4HPXA 4D2JA 3L5LA 3WNPA 1SQ7A 3M41A 4HA4A 3QJAA 1OX4A 2JEPA 4NILA 4A21A 3SCTA 4PMQA 2OWWA 1A5AA 1B3XA 4WSKA 3T09A 3ZJKA 1SMDA 4H3DA 4H9UA 3Q58A 3WLKX 1R8LA 3AXIA 4HPGA 1J79A 4LWWA 2VI0A 4HZ6A 3M9YA 1DIOA 2WANA 1A5SA 4GFSA 5IDZA 4AG0A 5FJPA 1WZAA 3NZRA 3E02A 2J7GA 4O50A 4US5A 4CNPA 4M5PA 1KXTA 1WO2A 2DY3A 1EOMA 1MFUA 1DTUA 2GJRA 4RNJA 1DPMA 1POKA 3LM7A 4PYSA 1V3HA 3CHCA 4HKPA 5FL1A 4Y9MA 3FSTA 2WJFA 1D7FA 3SCPA 4E4UA 3MUIA 3W7EA 2OZ8A 3P61A 2PTZA 3M47A 1VH7A 1JZ2A 1DXFA 1SMAA 2WSYA 1H1YA 1EX1A 3CTLA 2Y89A 1YXDA 1TA3B 3KOZA 3AMGA 1P7TB 5DFAA 4GKLA 4TOQA 1QHOA 4LNYA 5E5CA 5D4YA 3ERPA 1NOUA 3UG8A 3OG2A 4K8GA 1PCKA 2IXVA 1BSIA 1E6PA 1P6BA 4EPDC 4UMCA 3CXOA 5MKGB 3U0HA 1SO3A 4FLQA 3ARYA 3CQ0A 3N11A 3RUBL 4QISA 4IL0A 4EOUA 4L5ZA 3C8FA 3BW4A 2AQWA 3BJSA 3B8WA 2F84A 1XLHA 2OU4A 4UNIA 2E1DA 4IX0A 4UMBA 4GY0A 2O92A 2OOGA 3UGRA 5A2BA 4LUJA 1G94A 4XTDA 3T9PA 1K1DA 4O1CA 3UCCA 1OVDA 3RPMA 3HF3A 4LQ1A 1AJ2A 1HJSA 1W9VA 3UJFA 5HATA 4H7CA 1NWRA 2Y85A 1YQ2A 5BU9A 1E6QM 3TXZA 1OCBA 4OBRA 1PEZA 2VZOA 5HNNA 4H9XA 4XSLA 5E0FA 2XWDA 3UG3A 3A5VA 4JTSA 3TONA 3SCOA 3U6WA 4GIYA 4H83A 3W7JA 5A69A 1IEXA 1RPXA 2YA1A 4PTXA 2ZTKA 4B9ZA 3TWBA 1KRCC 4DUXA 2X40A 1WP6A 3KOXA 1XPGA 3WBXA 3K1GA 1TELA 1HF6A 1G67A 2GVGA 1DYSA 2O9TA 3SUVA 2FHFA 3UXDA 3ITLA 3M0YA 1M65A 2NQZA 2W3ZA 4X63A 2XSBA 3RILA 3UETA 3WLLA 3VD3A 2OTDA 2NQLA 4I7VA 2WBGA 1DWIM 5I3DA 3W25A 5EGRA 1UWAA 5MF5A 1AD1A 1XYZA 2DJLA 3B04A 4M1RA 3OVQA 1KM6A 1OC7A 4V1XA 2H6RA 1W9DM 4S39A 5AB3A 3TP4A 4KRZA 1N8IA 2RUSA 1XLKA 3WH5A 3HJZA 3SSJA 2YCEA 4M6UA 2TSYA 3MP5A 4ZVJA 2D2HA 3UPWA 1HW6A 3PG8A 3W7QA 2J4GA 1C7SA 1BGAA 3PY2A 4K8HA 4EXAA 3QY8A 4U3CA 3APGA 3LD5A 4GQQA 1J2WA 2ICSA 3M64A 3RK8A 3F7JA 4JTLA 1UJQA 4DJEC 3BW3A 4JKKA 1MNSA 5D2YA 3GHRA 5A5WA 1NAL1 2X30A 1K7FA 3AXXA 1VCGA 1ZL1A 2OMAA 5DQPA 3BAWA 2G0WA 1SW3A 1WE5A 3RIKA 3BMXA 4WJ8A 1THFD 1QRQA 3F4CA 2CNCA 4IOTA 4U33A 3WD3A 3G1AA 1PX8A 5D2TA 1I2RA 1P1MA 1E9YB 4HU4A 2VM8A 2YL8A 2VDHA 1HJXA 4N9DA 3DUGA 3OVRA 3QC3A 2VEKA 3RR1A 3SRKA 3P0XA 2GUUA 4CEUC 2ZZ4A 2INZA 1MQQA 2GQ9A 2R91A 3GDTA 3ZMRA 2IQDA 1BD0A 1KFJA 1WPCA 1XP3A 2RKXA 3E2VA 3ZIZA 5CZ0A 3Q37A 3GR7A 4QE5A 3MSGA 4DWSC 2HE8A 1ITQA 3ZLFA 4L6DA 1HX0A 4WZHA 1GK8A 4GIAA 5LGXA 2YDRA 2FH8A 3P82A 3MKVA 1IR1A 3N9SA 4ILSA 3GW3A 2F7FA 1XG4A 2PZNA 4F0LA 4XD6A 4KIEA 4NJJA 2PWEA 2ZOXA 5CPLA 4H1ZA 3BLEA 4M19A 1Q65A 4CNTA 3XIMA 4IIDA 1T8XA 2WBKA 2GOKA 1TRDA 3F4WA 5IFPA 2WZIA 4IGNA 4DJFA 1W17A 3PM6A 1XGDA 1PYMA 3N2MA 5FESA 1GHRA 4AZBA 3PR2A 2JK2A 4M7TA 2R1KA 1T0OA 3ZVHA 5PTDA 2GJLA 3PTQA 3RX2A 1VCVA 1ITXA 2J25A 1QNVA 3W01A 2QR6A 1QASA 3B0UX 5HJXA 5IFTA 1HXJA 4MJMA 5FEXA 4UUIA 1KTBA 4O28A 3B9DA 1GOIA 3U48A 1W37A 1TZ7A 5AECA 2CZVA 3UESA 2JF6A 2G8ZA 5JXQA 2POZA 4F3HA 4CD8A 4E4PA 4KW2A 3UR7A 2WJEA 3L2MA 1MW3A 2NVCA 3NVDA 4HMEA 3U57A 1F74A 2VGBA 1C3FA 2HBXA 3VOIA 4C6LA 3GO2A 2BXZA 3TTOA 6TAAA 2BVDA 3W9ZA 3N17A 1L6YA 1A53A 5XIAA 3EWBX 4EVZA 4B5UA 4WSJA 2VUYA 3MBFA 3L66A 3A64A 3EKLA 1O1HA 1HKJA 4BQ3A 1ISWA 4GABA 2F9RA 3VKCA 5A6SA 1DE6A 1IEWA 1NDZA 3IJLA 3QBUA 1SFTA 3BO9A 2DZTA 2Y61A 2CESA 1AUSL 3KCOA 2ISFA 3UR2A 4ZXOA 4V15A 3QHNA 3N73A 2H90A 3RCMA 1V3JA 4JN8A 4R53A 1LWJA 3CMFA 3CZJA 4MGGA 3E3HA 3LPOA 1KA9F 1TWDA 1Q6LA 5SWUA 3DGRA 5EMMA 3NQ2A 3QR3A 5FF0A 4JIRA 4V33A 2J27A 3TSDA 4QNWA 1OT1A 2TYSA 3KP1A 3UCQA 3CQKA 4TVUA 3TTYA 4FR6A 1HKWA 3DKLA 5E09A 2WJZA 2CEQA 4AX7A 2Y1HA 2YCLB 3H8AA 3SBFA 4YS1A 4Q33A 1N8FA 4BF5A 3EX3A 3QPZA 3UERA 2CZ5A 1Q6EA 3VGBA 5FKYA 1IEIA 1KLZA 3MJYA 3JZUA 1E4MM 1LDCA 1TPC1 5FD0A 1AQMA 3TROA 4HNCA 5ABFB 3TA6A 2GGHA 3S3GA 3WD2A 4HSHA 1UKQA 3A5FA 2IXUA 2VOMA 2V69A 4AF0B 3R8RA 4TV5A 2O7QA 1AW1A 3EWZA 3MQTA 3WUFA 2ALRA 1VBHA 3IUIA 2YL6A 3W1AA 3A9BA 4G9PA 3O6DA 4F40A 3NL5A 1KLYA 2YJQA 3EB3A 5I09A 4F2BA 4IUGA 3WBEA 4MUPA 3VD4A 2X09A 1OYCA 4H01A 1XS2A 5IHRA 2Z00A 4QXIA 3V1HA 4K1GA 5CC7A 5FJJA 3QYQA 1IWAA 1I8JA 2YCIX 1E9LA 3GG1A 5T91A 2HPIA 1EA9C 3V0SA 1HN1A 1V6TA 1ADSA 4U4MA 2QHAA 3GH4A 4RV3A 3KVLA 1UD4A 1BG4A 3II1A 3TN3A 1IXPA 1FY6A 3S5SA 4DXKA 1R47A 1C90A 3CUHA 4C1NA 3QR0A 1VFOA 2ZX7A 4L80A 1OFEA 3VAVA 2A7RA 1XIGA 4KEUA 1UG6A 3VI2A 3VDHA 2XM2A 1CT5A 4FAMA 5HBFA 1NDVA 4RZ5A 4Q3MA 3CHEA 5IOBA 2PU0A 4CUCA 2C1GA 3WKZA 2DVUA 3CO4A 4HA0A 2YLLA 2XH4A 5BWFA 2A2IA 5CZKA 1NF0A 5I3FA 1QPKA 1V6VA 1AQ0A 3S46A 1R2TA 1R3VA 2OYKA 1YTKA 2W5FA 3GG7A 1MW0A 4GISA 3MP4A 3I6TA 2E6FA 2EEXA 3W3OA 1BYBA 1EH9A 2P8BA 1OYAA 2G4JA 3L4TA 2CKSA 4IM4A 3VCCA 5LNSA 1HZYA 1VYRA 3BCJA 2E9BA 2F6KA 2GDVA 4MAVA 3KRBA 3HIJA 4X9SA 4MPKA 3MA8A 1YMYA 2ABAA 5HPOA 4A2RA 3N14A 1RJRA 2R1MA 4WJXA 5CZSA 4N6EA 4FI4A 2NZLA 3KL3A 4UTLA 5JH1A 3U8GA 3A12A 2YB1A 5CZTA 1TV7A 5KZMA 2GJXB 4AYGA 4JNMA 1EC7A 1JZ5A 1J12A 1WDDA 2CLEA 2C15A 3GWQA 1MYRA 2WVTA 1QNSA 4IJCA 4PMJA 1IWPA 1JCXA 3AHTA 2Y5EA 1G7VA 3WF3A 2WXDM 2WVVA 2LLEA 4H9MA 1S2TA 3KLLA 1BPLB 5G4WA 2Z1KA 2QDEA 4MF4A 3MO4A 1UA7A 1EO7A 1I1XA 3DESA 4CQAA 1QNPA 3C8NA 3GS6A 3DOPA 3APTA 3H2EA 4PCPA 1EXBA 2VX5A 2ALDA 3BURA 3UWZA 3GNXA 2FTYA 2DZUA 1W2PA 2XU2A 4GYPA 3QR1A 4WF7A 1RA0A 3QFEA 5FJOA 2ZUWA 4IMFA 1TE6A 3V36A 1JAKA 4Y8EA 3GFYA 3TXVA 5BOEA 2ZWZA 5I03A 4TVCA 3CV1A 1EF2A 1FDZA 2PEVA 5G1TA 5AHLA 1PHWA 3KEHA 4MKNA 3SN4A 2RH9A 1M7JA 2Z1SA 1FHLA 2EPKX 2NUWA 4GNVA 1E72M 4XZ9A 3NWRA 3KTSA 4FX6M 3M7WA 3DCPA 3B4YA 3WQ8A 3T0AA 3NO1A 1IEQA 3P62A 4UR8A 6CGTA 1TZZA 1TKKA 3K4AA 4XZNX 4J1OA 1E4IA 3CQHA 3LM3A 4JGDA 3TQ0A 2VGIA 3UT0A 4B4HA 1TPFA 3QY7A 4BF9A 5HMDA 2J13A 4ML9A 2AL2A 4H6QA 5BRQA 4OZOA 5DRCA 1S5MA 4Z2JA 1EEXA 3UFYA 7A3HA 3GTFA 2BDQA 4RW3A 3MI6A 4C91A 3WF0A 2Z1WA 2UY5A 4GQBA 1RJQA 3R79A 2QF7A 4ICNA 2EGZA 1W3IA 2XDFA 4C6NA 4F66A 1M41A 4YWIA 2QQ6A 3GTNA 5D03A 2WLZA 3OIXA 3DBPA 4ZZ9A 1A5KC 4LY8A 4W93A 2PU1A 2FDSA 3W07A 4X61A 1KB3A 2GFTA 3GHSA 4NT0A 4NAEB 3WLHA 4GGBA 1NJJA 4YVVA 3PBYA 3VZXA 5KEZA 3TK7A 1AA1B 4R33A 2A0NA 3CZGA 3W6YA 4P8UA 1AH0A 3M44A 3AIQA 1OCJA 1TPEA 1TR9A 1FWSA 4DF0A 4P7NA 3WK3A 4DPQA 2XYLA 5JU6A 3IJ6A 4QAWA 1XLEA 2DZVA 1JZ6A 2NQ5A 3ZLGA 5A6JA 3MC5A 3C3UA 4XZIA 3VKKA 4UIOA 3DI0A 5EA9A 1FHVA 1U33A 1BWLA 3DDMA 3ITXA 3LUTA 1Z7AA 1HL2A 1KBIA 5K7JA 1E4LA 3A9IA 3LOTA 2FIQA 5A8PA 1PIIA 4L1XA 2FGZA 3K8KA 1XSJA 2VL4A 4NNAA 2OEKA 3K5XA 2WSQA 1LROA 5HULA 4KEVA 3S1GA 3NPXA 3LTYA 1DHPA 5AHNA 3NZQA 4D8LA 5CLWA 4YIWA 3LLFA 2XM1A 5GPRA 4AZCA 1TX2A 1F3WA 3RPTA 1OFPA 4EPEC 3SGGA 1LBLA 1GKQA 3PBMA 2XIMA 3B8SA 4PC8A 3MW7A 4LVGA 3JUGA 3CQJA 4BF7A 1PIGA 2PGFA 3OYZA 5DCDA 1OC5A 4LRSA 5DMNA 2V81A 2OODA 4O1AA 3VOCA 2QPSA 3VOHA 1XIDA 1VYPX 1NOFA 1Z3NA 1GYLA 3R43A 3S1VA 1X98A 2NWSA 3ABQA 2O9OA 2FTWA 3LSBA 3B0VC 2ANUA 1AZ1A 4OVXA 1ONRA 3ZM8A 3W2KA 1ZU8A 1K3UA 3SR7A 4UQCA 1ISZA 3R6IA 4LUIA 3P3BA 4JTJA 3FCPA 4GO9A 1C8VA 1IGWA 5HWMA 4DWDA 3P8IA 3EDFA 3VIGA 1RP9A 1XG3A 4D6IA 2NXIA 1OK6A 1MUMA 3EGJA 2YGYA 5GJPA 1P0DA 2Z7KA 2GGJA 1FUYA 4EXBA 3KX6A 2YXGA 1P1XA 3ZWSA 3WEMA 2V6AA 1Z41A 2G50A 3MO7A 3EKGA