1F6KA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 120
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f6kA00
1XFBA 5CSRA 4LS0A 3G18A 1LOSA 1TTIA 1TREA 1K8ZA 2GQAA 3O1NA 1O60A 4A3UA 3PUEA 3DI1A 3GX9A 3LM7A 3GAYA 3LXCA 3MBFA 1KV5A 3NQFA 4N9CA 1DORA 1YXYA 2YFNA 1HL2A 3W76A 1SZEA 3GDLA 5G4WA 1HTIA 2V2HA 3N14A 3HB9A 3RFAA 2QDGA 1B9BA 3EKLA 3L5LA 3IGSA 1VLWA 1SZNA 3W2KA 3IEBA 3LTSA 1TPEA 3L9CA 2RHGA 2HTMA 4HSOA 5FESA 4OT7A 4NX0A 3PBVA 3UXAA 1M7OA 4IGHA 3E02A 2C3ZA 5LHFA 2OX1A 4H4IA 1KW1A 2HSAA 2A7PA 3O07A 2E1DA 3W1PA 4W9TA 2J27A 4JICA 4UTJA 1MEHA 1AMKA 3T55A 5LNVA 4RXGA 3BLIA 4ZQNA 3TIMA 5H2ZA 4IX0A 1MEWA 3MI6A 1XCFA 2CFFA 2QCMA 3ZWSA 1K7EA 4JD4A 1ZAIA 1OFEA 1I2NA 4FNQA 3BV4A 4CQAA 3DFOA 1RQHA 3E96A 4HNUA 4M5PA 3B0VC 5D02A 3BK0A 3TH6A 1UB3A 1VZWA 1AW1A 1GG1A 3P80A 4GBUA 2ZRXA 3KAOA 2WNNA 4CNNA 3NNTA 4JX5A 1TB3A 4PFMA 2ABAA 4R7JA 1H7OA 4O0KA 1NVMA 2Z6JA 1SW7A 4QIUA 5AYYA 2VC6A 4FNRA 1OX4A 4X9SA 4ONVA 3R13A 4RJEA 4TX9A 4AHPA 2BZNA 4JGDA 1L6YA 4KFOA 5D2WA 2A85A 2PURA 4UTWA 4UUIA 4M19A 3NR0A 4ADUA 1YPFA 1H7NA 3N2MA 1TV7A 1I2OA 1QPQA 5D33A 3I7QA 4HNTA 4RK8A 4LC8A 1ZENA 4UTKA 5C55A 3D0CA 3W7LA 2VEMA 1NAL1 1KBIA 1G4PA 3ZS4A 1PHQA 1F74A 3TJXA 4JTSA 1JCLA 3W70A 3W2MA 3GNDA 4JTKA 3G1DA 4R34A 2JGQA 1W3IA 4LT9A 4OBTA 4FXSA 1ZNNA 4M6QA 5AC8A 3E9AA 3QF0A 1YDVA 4GXMA 3VFLA 3UWZA 1NFBA 5BMXA 3W85A 1KTCA 1Q6RA 4GFSA 2I14A 5SWUA 3G1FA 1G7UA 1DQXA 2HS6A 4C1KA 2O7QA 4OQVA 5DLCA 4EWND 4Y9AA 3KRSA 3HO8A 4JTUA 1U5JA 4QNWA 3VKJA 2DU2A 2CLOA 3LGEA 2ZRVA 1DVJA 3EX1A 3DHFA 1GTEA 4KFNA 1XBZA 1BWLA 1D3GA 2RH9A 2VEIA 2WV8A 1TTQA 1KFCA 5AC7A 3A23A 3UQNA 1M7PA 4J9JA 1TTPA 5DN1A 1P4CA 3NOEA 4XKYA 1HO4A 3S1WA 3DI0A 3HGJA 4WY0F 1S5VA 2A2IA 1OJXA 2PRMA 1SZGA 1ZAHA 2WJZA 3GB6A 4IOTA 2Y7GA 4MIMA 1K8XA 3I6RA 5I3JA 4AH7A 4XQ6A 1ZFJA 4POCA 2DZVA 4NNAA 3DFSA 4MUZA 3W7OA 3M47A 3EEGA 2FQIA 1QO5A 1TPDA 4Y96A 3SGUA 3LCLA 3I68A 1GT8A 4N4QA 3WJXA 3QFEA 3MW7A 4AHQA 3CEUA 1W1ZA 1OHLA 4WD0A 5D04C 4R33A 4OE7A 4JTLA 1YTKA 2VFDA 1BKSA 3M16A 1A50A 1G4EA 5D03A 3LCHA 3P74A 3GKAA 3WK1A 5IM51 3S1XA 4IMGA 1G67A 4XBKA 3W72A 1ONRA 3W1XA 2TSYA 5F2IA 3O6DA 3NPXA 2QUTA 4NQ1A 3W7GA 3B03A 3A5FA 4TU1A 1P1XA 2PRLA 3LHTA 2A6NA 4QISA 4ORMA 2G95A 4X2RA 2WQPA 3IVSA 1B3OA 1JCXA 3R2GA 1I8JA 2NXHA 1QR7A 4C1LA 3TXZA 4DBDA 3VNDA 1OFQA 1GOXA 3W7RA 3HGOA 5EL1A 2GUUA 1ZCOA 2HMCA 1XL9A 4RZ5A 1W3NA 4UFLA 4Z1AA 3G0SA 3PWAA 4FXRA 1TPVA 2C18A 4LS1A 1K02A 1TPB1 3LHWA 4TMCA 3G8RA 5LNRA 3K30A 1WQ5A 1QPOA 3A22A 4LVBA 2FPTA 4OV9A 2RDUA 4MKNA 3S5YA 1JCMP 1A5SA 3FJLA 2WKJA 3AO0A 1YXCA 1K8YA 2JK2A 3NVTA 3S5ZA 1EUNA 3WK2A 3W6YA 3FYPA 1KA9F 2PC4A 2CZEA 2E6FA 3W1AA 2PRHA 2C16A 2CLEA 2CLMA 5LHEA 3MMTA 5AHMA 4MJZA 2EGZA 1TSIA 4QJ1A 1SFLA 1LM1A 2A6LA 2W0UA 2NUXA 4O53A 4GUFA 4MY1A 4LNYA 2E5DA 1R47A 3DU0A 2XN1A 3M5ZA 2QCFA 4JTIA 5K4XA 3W2LA 3IVTA 3W84A 1KTBA 1IIHA 2ZYFA 4O13A 2ZA1A 3SFKA 3UPBA 3FKRA 2W6RA 2GVLA 1OX6A 1VRDA 4GWEA 3LCWA 3ZFHA 3RK8A 4HIBA 3GIYA 4O1DA 5D37A 4GRSA 1Q6OA 4UTMA 1J2WA 1LOLA 1T96A 1H7WA 3F03K 3W7NA 4OGZA 3NAVA 3THQA 3S0CA 2P10A 1W56A 2VFEA 4X22A 4ZMGA 5EPDA 4QNEA 5CZSA 4DF1A 5K9CA 2R14A 3OVRA 1KM5A 1ADOA 3STFA 1F73A 2J9XA 3L2IA 4LVFA 4IMFA 4QQ3A 3SR7A 3GDRA 5U4NA 3BGJA 3H54A 5BMWA 7TIMA 3DKLA 3UWVA 4M6PA 4K7YA 1JUBA 5A8GA 4LVAA 3F1QA 3R5EA 3TU9A 4H6KA 3WJWA 1SQ7A 2Y63A 1UASA 4UTTA 4E0CA 1YLVA 3O16A 1QCWA 4HNVA 1X6UA 2V81A 3M5VA 3T44A 2FJKA 5A5WA 4K37A 3TMLA 2A7RA 3KVMA 4RR4A 4TMBA 3S5OA 4CNPA 3QW4B 3PB0A 3JR2A 4K38A 4KFPA 4ML9A 4O4VA 4YCOA 3QH2A 3G3DA 1GVFA 4WJEA 1OYAA 4WXYA 4GUHA 1M5WA 1NF7A 3W23A 5J5DA 1OFBA 3W7IA 2ISVA 1X7FA 3W75A 5D38A 4GNJA 3C52A 4RLIA 2FPYA 1TRIA 3LRLA 1DJNA 3DFNA 3EWYA 3PB2A 1VHCA 3NQCA 2NUWA 3NDOA 3UWWA 2V2CA 4Z1CA 3TK7A 3W74A 4IMCA 5IBXC 3NQGA 3NQDA 4RZ6A 5F1VA 1KM2A 2X1RA 3IIPA 1PV8A 4ZQPA 4BWLA 1J5TA 1OVDA 2EHHA 3M7WA 4L4MA 4UIOA 3TV8A 4UNKA 5F2LA 4A2RA 3KVKA 5KZDA 2C13A 5DBTA 4P61A 4HN4A 3USBA 4JYEA 1XXXA 1UUMA 2YYUA 1QDSA 1OK6A 3I7SA 4HPXA 5F2MA 1OX4B 3UWYA 4CLMA 4FO4A 4BF9A 4JNMA 4EVZA 3LDVA 2OJPA 4E38A 2X16A 5TQLA 1X1OA 2NX9A 3M5XA 4R53A 3NM1A 3QC3A 2FFCA 3GDMA 2NWSA 1B57A 3LI1A 3LXBA 1KTNA 4O12A 3W1TA 2ZRZA 3EWZA 4IJBA 5HMSA 5TBOA 1UCWA 4IWWA 2H6RA 3N34A 4FX8A 4LVGA 4MYXA 4O17A 3P61A 3HPSA 3IGUA 3EX2A 3R8RA 3M0ZA 4GUIA 2RDTA 2YPIA 3G1SA 2NV1A 3PVFA 5AYXA 1FQ0A 1QOPA 4PEKA 2BX7A 2C1HA 1NSJA 2RFGA 3W1NA 3WK3A 2J6XA 4B5NA 3KRZA 1OF8A 2ZFAA 4LC6A 4DEFA 2BXVA 3TC6A 4OWGA 3W2JA 2C19A 1W3TA 3C56A 2Y70A 2V2DA 2NXIA 4MPQA 5D30A 4AWUA 1Q6QA 1P0NA 3W7QA 3CQ0A 3W7MA 1MXSA 4MZYA 1KM4A 2Q3OA 1P0KA 3FEMA 1EP1A 1Z44A 1K03A 3FJ6A 3R89A 3QQ0A 1LZOA 2X1SA 4Q32A 5CSSA 4O57A 4MJMA 3M44A 3UD6A 2YW3A 5HR7A 1LBFA 3G0XA 3EXTA 1PE1A 1A5CA 2QR6A 2DZUA 3NPUA 3V1PA 3UZ5A 1YDOA 3QRHA 4KWVA 4NZJA 4AVFA 4IUOA 4TO8A 1O95A 2V82A 2O7SA 1OK4A 5K7JA 3WK0A 1F7BA 4N02A 3KXQA 2R94A 1OG0A 3W1UA 4XKYB 3LV5A 2Y62A 3STGA 3QYQA 3NQEA 3PM6A 1CW2A 3MYPA 3VE7A 2V8ZA 2V0TA 2Y88A 5HWJA 2ZA2A 4N2YA 1DQWA 2FB3A 4UXDA 3TJLA 2DORA 4PC8A 2Z0IA 4ORIA 4LU0A 3PBWA 1LROA 1WXJA 3O06A 1RQBA 1ALDA 4AF0B 4ADTA 4DELA 1Z48A 3LB0A 2QCDB 1HG3A 2BTMA 4M6VA 4O11A 3GNNA 1OFRA 4GE8A 1AL8A 1AK5A 3WJSA 2F84A 5FEPA 4JTTA 3QW3A 2ZZ2A 1AL7A 2A7NA 3SSJA 3LXAA 4EOUA 1H7RA 1VHNA 3TNOA 2H3DA 3E0IA 1QNVA 4D2JA 3L0KA 3C8FA 1DHPA 3W88A 5BW6A 1RR2A 4JXCA 4YWIA 1QFEA 4JX6A 1LBLA 1IXOA 3CEPA 3BW3A 2CLFA 2QCNA 3BGGA 1C29A 2TPSA 5J5RA 2B7PA 2ZZ7A 4JR5A 3G1YA 1FXPA 3LHZA 3RNDA 1TO3A 2YCEA 2QDHA 1T99A 2J24A 1X8FA 3BPWA 3AJXA 4N9DA 2V5BA 2UV8G 4FNTA 3SW6A 5F4SA 2V9DA 4JTFA 1CI1A 4A21A 2W79A 4NZFA 1Q6LA 2WSQA 3WJZA 1YYAA 1OFOA 4LUIA 1RD5A 4UR7A 3IIXA 3B06A 3QMSA 4NJIA 4MOZA 4FNSA 3P8JA 3TW7A 4IX2A 3G3MA 3CHVA 4PA8A 1S5TA 2NX1A 3QPYA 4OU1A 5G4EA 3G22A 3UY8A 5CPLA 3QM3A 4CCCA 3CM4A 5BOOA 4FEZA 4LUJA 2OT1A 2E68A 1VC4A 3N9SA 1W31A 5K2ZA 3TCEA 2QCEA 4LV9A 3W71A 5AB3A 3TFCA 1ZJIA 4N6FA 5G2HA 2Z2UA 4K39A 3PY2A 4HNNA 1SUXA 1H61A 5EY5A 3L5AA 4AB4A 4QAIA 4I7WA 1N8FA 4AWTA 3NL5A 4UCGA 4Z0SA 1M6JA 3W22A 1UJPA 3A24A 1WAUA 2DZWA 1PVNA 3EX3A 1JUEA 3L68A 1H51A 3IV3A 1XUZA 4Z0JA 1OFDA 5F4XA 3HMJG 3EX6A 3CTLA 3NGJA 1VYPX 4PODA 4WX2A 2Y61A 3LI0A 1H60A 1IF2A 1EWDA 4WY0A 3MO7A 1FDZA 3W07A 1LRNA 3YPIA 3L65A 3FYOA 1GVSA 1OFAA 4JTJA 3R12A 4WZHA 2WNQA 3LRKA 3O6CA 3I7RA 2VENA 1IXNA 2A1YA 2DZPA 3M41A 5D2YA 2E6AA 2EF9A 4AWSA 1W5MA 4JYFA 1ME9A 2QF7A 4HT3A 4EF8A 2Y89A 2JKAA 3NQ7A 2WSYA 3KRUA 2A21A 5FF0A 1ZY9A 1FDYA 3JRKA 4NJJA 1GVOA 3S1UA 3B04A 2QCGA 4UTHA 5AHLA 1LCOA 3W73A 1YDNA 3LLDA 1EEPA 4JIPA 4JTHA 4Z1BA 4DO4A 1P5BA 2V5LA 5D2XA 2FIQA 3EX4A 4K36A 3LBMA 4S2CA 1O4UA 1EP3A 4CCEA 5DELA 3HJZA 5FF7A 1B4KA 1ML1A 4NNCA 4NUWA 1H62A 2JGYA 4CQ8A 4AXKA 2ZRWA 4JTEA 3DAQA 3H53A 3G24A 3TC7A 1G6CA 4I7UA 2DZTA 3RLUA 5EBUA 3W2NA 3BARA 4UFHA 1EIXA 2PCQA 1WDWA 4DPQA 2NX3A 2QUVA 3F4WA 4BFAA 1PCKA 3QPZA 4A29A 2QAPA 1X1ZA 5HQEA 2QUUA 4PTNA 1O5XA 4JN6A 3W2UA 1WBJA 3P84A 3MP4A 2Z1BA 1XBYA 2RKXA 1IIGA 2YX0A 1L9WA 3P81A 4DBEA 3LHVA 4UC5A 1O5KA 3GXPA 4WOQA 1KM3A 4LY8A 3N3MA 1FCVA 2WPBA 3S8HA 3BLFA 4UTWC 2ZZ3A 3TA6A 3PULA 4WXZA 1U83A 1KBJA 3W1RA 1XI3A 5K9XA 3FOKA 3CLMA 2B7OA 1CX9A 3E49A 3QZEA 2H90A 3HGSA 3PSWA 4RZ4A 3P5YA 3MWAA 3Q94A 3HGRA 1D9EA 4EF9A 1XBXA 3HG3A 4NXKA 3LERA 5DBUA 1YXDA 2Q8LA 1VCGA 3DFQA 3L0GA 1ME8A 4BI5A 3P8IA 1KLZA 4JEQA 1Q3NA 5HUOA 1SU5A 2ZRUA 1GZGA 5DXXA 3CU2A 4O4WA 6TIMA 2CZFA 1YTEA 1I45A 1ZAJA 2X1TA 3JS3A 2FLIA 1FDJA 1I2PA 1XDMA 1FWNA 4M7SA 5U7SA 3LCIA 1C8VA 2YXGA 4A2SA 1YTDA 4YCPA 3FLUA 2OCZA 1LYXA 5AYZA 3U2OA 2VOMA 3EB2A 1H1ZA 3M43A 5LSMA 4ZL1A 1JUKA 1NF0A 4PH6A 3QMRA 3W86A 3TSDA 3C2FA 2BLEA 3TX9A 4PL1A 1HO1A 5KMYA 1JCNA 3THAA 3IRDA 4UTIA 1PIIA 2NXGA 4XBSA 2EAWA 1RZMA 1GG0A 1EB3A 1XBVA 3A21A 5KSWA 8TIMA 2QCHA 1RV8A 3G1AA 5D2VA 5EYWA 1R2RA 3HPXA 4HPJA 1GYLA 5KTLA 4ADSA 2WOQA 3LTPA 2CLKA 4N6EA 5LNUA 2I1OA 4AEOA 1W54A 2QJIA 3O15A 3A5VA 1VCVA 4Y6GA 3FS2A 4FX6M 1SW3A 2C6QA 1ZALA 3B0PA 1LP6A 1DL3A 2Q3RA 1MZHA 1XC4A 1WX0A 2OT0A 4O52A 2Z6IA 1BEUA 3TROA 4S2BA 2GVJA 3W83A 4MY8A 2VXNA 2YFOA 1UUOA 4LV4A 1SW0A 4Q33A 1QOQA 3PBYA 3UY7A 1H63A 3DHDA 4N4PA 4K8HA 5CGQA 2NV2A 3L66A 3CB8A 1R30A 4OV4A 1VJIA 1FY6A 3TUUA 4ZQRA 1LDCA 5F4WA 4K8EA 5D2TA 2QCLA 4RCXA 1Q45A 1GWJA 2JBMA 5DY3A 1TYGA 5FEWA 3P60A 4TIMA 3M6YA 1DOSA 5HR6A 2LLEA 1LRTA 5I3HA 4Q4KA 3ABOA 3P7YA 4O15A 1N7KA 2WSRA 5G5IA 2ABBA 4MLJA 2ISWA 4Z08A 5KITA 1XKYA 5CZTA 1BTMA 2ZZ5A 3UWQA 1K3UA 3DFTA 3DH7A 1OFPA 3PG8A 3SZ8A 3OG3A 1WYIA 1L6WA 2G96A 5G1YA 5LGZA 3LCFA 3TDFA 3NL2A 2QEZA 3ABSA 5F2GA 3DXIA 3HG5A 2ZTJA 3W7PA 1KFKA 3FKKA 3IGXA 3RLVA 4NVTA 1TPH1 4JDBA 4UFKA 5CPMA 4XZ9A 4ICNA 2CWNA 5DXYA 2ZRYA 5G2WA 4BI7A 4XWUA 1V5XA 5DY2A 5HNRA 1JR1A 5D09A 3WFAA 3ATYA 1OYCA 5E1QA 4QM1A 5CZ0A 5AHEA 5CKSA 1N55A 1TQJA 1OYBA 2ZZ6A 5FF2A 3B0UX 3QMTA 5AOUA 5I3GA 3SECA 3W3OA 1DKWA 2OMAA 3G0UA 4XUGA 4GC4A 2YGYA 3NQ6A 5I3KA 2NUYA 2IQTA 3VI2A 1YADA 2ATSA 1WA3A 3BW2A 1GTHA 5AFDA 1S3HA 4E2DA 3GR7A 2CZDA 3STCA 5E0KA 1TV5A 4ZZ9A 2CW6A 2GPTA 5LNSA 3OBKA 4UMBA 3ZWTA 1GEQA 2FB2A 4OHQA 1JCJA 1K7XA 1ME7A 2DJXA 4O50A 4L4LA 3G1HA 1KFLA 1R2SA 2JKEA 4UR8A 4YL2A 3N73A 3CWNA 1G69A 1KM6A 4Y90A 1H7XA 4I7VA 3VE9A 2YDAA 4AAJA 2AAMA 2A4AA 2OZ0A 4DO5A 4IMEA 1A53A 1VYRA 4WQ6A 2AGKA 1HFBA 4O8RA 4JX4A 2GVGA 2ZZ4A 1QO2A 2Y6ZA 2ATMA 5D05A 3MP5A 3GK0A 1JRBA 2VFGA 1FWSA 1WBHA 1K7FA 1GVQA 2GQ8A 3INPA 3WJYA 3T78A 3UPWA 3P67A 3NA8A 1VCFA 3NG3A 4E2BA 1XM3A 1THFD 1S5WA 1DJQA 4LS2A 3NQAA 4BWLC 2TYSA 1H1YA 1SZFA 1DV7A 2CZ5A 3ANYA 1HUVA 5EA9A 3IIZA 1T0OA 1W5QA 4H3DA 3KX6A 2YZRA 3T7VA 1R2TA 2DP3A 4WOZA 2R8WA 3BW4A 3NL6A 4KWWA 2ISSA 2NWRA 1EPXA 3LCGA 5I3FA 4DO6A 1MEIA 2BSLA 2WNZA 3NEVA 3W1QA 1O94A 2F7FA 4P2VA 1FX6A 3PR2A 3W7HA 3NYZA 2FDSA 4TR9A 4JIQA 4DPPA 3DBPA 3S42A 4LW7A 1TJPA 4FHAA 1T8XA 1XUUA 3LV6A 3FA5A 3TQKA 4QSHA 3GLCA 2B0MA 3KVJA 4FB7A 3TQVA 1VPXA 3HG4A 3A9IA 3HIJA 5AHNA 4UFIA 3KOFA 5AC6A 5LZLA 2PE4A 4RXFA 3PUDA 1JRCA 2CLIA 4NJHA 4CCDA 1JQVA 1L2UA 3LCXA 4O19A 3I65A 5AN7A 1PCWA 5H91A 3SI9A 2ZCGA 2Y7EA 3DENA 1L6SA 2E09A 3NQ8A 2CU0A 5AHIA 5LKYA 2D73A 2X1UA 4IQLA 1SO6A 4QITA 3HF3A 3TFXA 3EWXA 3MHGA 1Z41A 2TRSA 3NZ1A 1J4EA 5L9FA 1PHWA 2H8XA 1V7YA 3OEXA 3LRMA 2QJHA 1G4TA 3QEZA 3PG9A 1AW2A 2A5HA 5FF3A 3W7EA 2E5CA 4Z1DA 3IIOA 4O1BA 1QAPA 1SR9A 3PAJA 3KFTA 3M9YA 3PS7A 2C14A 3UYCA 2ZDRA 5TIMA 2YSWA 4O1CA 2CLLA 2EKCA 5HJLA 1GPWA 3L21A 5DCDA 1G4SA 2XN2A 1I4NA 3Q58A 2VKZG 4HKPA 4JS3A 3SIZA 2JKPA 4O1AA 4JY8A 5EKYA 3ATZA 1PL9A 1IGSA 3W1LA 4U4MA 1LLWA 1MSSA 5KINA 1OF6A 1A5AA 1FCBA 2ZTKA 3GKFA 5HINA 3EWWA 4RKAA 4LTSA 2P1FA 3BO9A 1KM1A 1VGAA 4UNLA 3QJAA 5CZJA 1EP2A 4NJGA 3GDKA 4MY9A 2I9EA 2YW4A 3OHIA 4LRSA 5LNWA 2Y7FA 2G5WA 3DGRA 2CLHA 3LHYA 1RPXA 3PC0A 5DCBA 5AHFA 1OX5A 4UFMA 4KKXA 2QAFA 4X3ZA 2ZQ0A 3VCRA 1KFBA 4ZVJA 3B4UA 1YPIA 3IIVA 2WO5A 4M7TA 5I3IA 3TAOA 3BG5A 4YMZA 1JVNA 2DZSA 3FFSA 1RQEA 1WOAA 3W1MA 3CT7A 1TPFA 3C61A 1AG1O 3G1XA 1VS1A 1FXQA 3QQ1A 4MYAA 4GJ1A 4U28A 4NNBA 3QSTA 2R91A 1TMHA 3L67A 2GJLA 3O63A 3PBUA 1VH7A 3HQ1A 4UTLA 1IXPA 2V30A 1VYSX 3W7KA 3H55A 3W87A 4JTGA 4AF0A 4HSNA 3GAKA 3SGZA 2QCDA 1W37A 1XDLA 4JY9A 1SO5A 4MVAA 4O54A 5FF4A 4N9EA 1W0MA 1JQXA 4WUIA 1QPNA 1SFJA 2VFFA 2VFIA 4MFDA 4XTDA 3GYEA 5C54A 4BK9A 1VLIA 2ALDA 3V75A 5C6MA 3DFPA 1I2RA 3TSMA 3ABQA 5D32A 3LLFA 1QMLA 5G2IA 1TPC1 5BRBA 5IBXA 4NXSA 1DBTA 1Y0EA 1TPUA 3C2OA 3LOTA 1IXQA 1FWRA 1EWEA 4AHOA 1F5ZA 3UNDA 1FUYA 1FCUA 3CIXA 5ABTA 1EUAA 1SO3A 5FI8A 2BWGA 2YYTA 5BNKA 5DCEA 4LWWA 1F76A 3CC1A 3CIWA 4XTIA 5HWMA 3EXRA 4FNUA 3OIXA 2Y7DA 3S5NA 1G7VA 3C3NA 2P0OA 5KZEA 1ICPA 2NZLA 3FIGA 1B4EA 3GVGA 3S1VA 3S6DA 2B4GA 3BLEA 1F6PA 3OVPA 4N9BA 3GZ3A 3G8EA 3LHUA 3LX9A 4LRTA 4MZ1A 2J9YA 1H5YA 2YR1A 3QSRA 4IXXA 4O28A 5HWNA 3M5YA 2C15A 3U8GA 1KFEA 5CPNA 3ABRA 3GDTA 5KZMA 3C0JA 3UWUA 3ZR4A 4EIVA 4NX5A 1W8SA 4DF2A 3SY5A 3EKZA 1F2JA 4UMCA 3O6YX 2GOUA 3KVLA 1KFJA 3Q2DA 5C2XA 3F4NA 2VEKA 1GJPA 2E6DA 3L0NA 5K4ZA 4YXGA 4NJKA 1EX5A 2E77A 3NPVA 1SPQA 3TQ0A 1TV8A 1GYNA 1WV2A 4O18A 3W9ZA 2G97A 2GJNA 1QPRA 1W5OA 3HBLA 4ZQCA 4BR1A 3EWUA 3OA3A 3RF9A 4CNOA 3O05A 4DF0A 2RDWA 4IXHA 1SSGA 1TIMA 4K6AA 1I2QA 3P82A 3NM3A 5L6UA 3TE9A 1Z42A 3P5ZA 3T4CA 4MZ8A 4JYDA 2QJGA 5GVJA 1TTJA 3C6CA 1TJRA 4DXVA 2C0AA 1GQNA 4HHPA 1KM0A 5T26A 4K7VA 4PCFA 3EWBX 1FWTA 4IMDA 3TW6A 2FTPA 3BVJA 3TKFA 3Q37A 5FEXA 3N2XA 3NL3A 4IPJA 1WOBA 1TCDA 3L5MA 1D3HA 3LTYA 1LORA 1F6KA 4UMAA 5G1TA 3NZRA 1W5NA 1LLZA 3PUOA 2QKFA 4NU7A 4RX0A 4DQWA 3LBCA 2FPVA 2DJLA 4BI6A 2E5BA 1LTDA 4FIQA 1TQXA 2J88A 5F1UA 2NLIA 2VFHA 3TAKA 4FF7A 3PF3A 3RU6A 1OABA 3B8DA 3M1ZA 3NXFA 1BWKA 1KV8A 2E6YA 5CPOA 4Y8FA 1TPWA 2KZHA 1H7PA 2X2GA 4YLWA 4MLRA 3TSBA 2X30A 3MJYA 3DZ1A 3W7CA 3NQMA 1C9DA 3PSVA 3W7DA 3N9RA 3UXDA 1JULA 4O16A 4G1KA 2AQWA 2B7QA 3HOJA 5CG7A 3BG3A 4PL2A 1QWGA 5LGXA 3KHJA 2GQ9A 3CWOX 1A5BA 1FCQA 3E12A 3C4UA 1FBAA 3G1VA 1JJKA 3RMJA 1W5PA 3B05A 3MYOA 1NEYA 3W7JA 4S1FA 4FX7A 4ALDA 3MP3A 4LVDA 2QCCA 3TMQA 1GVRA 3HG2A 3NPWA 4A22A 2DZXA 3U6WA 3MHFA 4FIRA 1ICQA 4O14A 2Q8ZA 1LBMA 3MHUA 4GUGA 2XN0A 4ZQMA 3TR2A 1F05A 3NO5A 3BG9A 4RV8A 2ZA3A 3MI3A 3C2RA 4O0ZA 3HPZA 3MBDA 4I9AA 1R46A 1ZHAA 2EPHA 6ALDA 2J9ZA 1KLYA 5K9DA 3P62A 1UBSA 3UZJA 2XFWA 1E51A 3GR8A 4O10A 1VR6A 3C2VA 3NQVA 1ICSA 1JCYA 3T40A 3C2EA 3S9YA 4FNPA 3TXVA 1FWWA 2TMDA 4WY0B 3CPRA 3SJ3A 5C5YA 3ELFA 4NT0A 1AW5A 3GXTA 3DKJA 1H50A 5EMUA 2ZBTA 3MUXA 1MO0A 1PS9A 2A0NA 1SO4A 2Y85A 4JDYA 2B7NA 4GUJA 1SSDA 3GXNA 2VELA 2ZZ1A 3EXSA 1LRQA 5HUPA 1RVGA 5K3VA 4ZQOA 2H3BA 3N19B 4UTTC 4AMAA 5HULA 5E93A 5FEZA 1EA0A 3STEA 3OVQA 1VQTA 2VEPA 4UFJA 4UTUA 4IPIA 3NQ2A 4CQ9A 2H8ZA 5MHBA 3MI2A 4MFEA 3IVUA 1TRDA 2HS8A 4LOCA 3O8AA 1LOQA
chains in the Genus database with same CATH superfamily
1WE5A 1GZ1A 3NEHA 4HGXA 2PGFA 3WQCA 1TTIA 5G4HC 4LFYA 1TREA 1E0VA 1CECA 4Q4MA 3BLPX 3DI1A 5CC6A 3GAYA 1UWAA 2EPNA 1UD5A 1YXYA 3KEHA 1RSCA 3GDLA 2V2HA 1B9BA 1ECQA 3EKLA 1VLWA 1SZNA 2I5IA 3W2KA 1SFTA 3MB9A 2YLAA 3M0HA 2RHGA 2OOFA 5FESA 4ZODA 3UXAA 4IGHA 3TYCA 3E02A 2YB4A 4H4IA 3QY6A 3H2MA 1KW1A 2DUXA 1GZJA 3S83A 4H9VA 2WMJA 4FLOA 3W1PA 3HURA 4NL1A 4W9TA 5TAOA 1HJUA 3OZMA 5LNVA 3BCDA 3GVVA 3HFYA 1RBLA 1BYBA 1MEWA 1XCFA 1RBAA 3BMVA 1K7EA 2C91A 2GWGA 1OFEA 3BV4A 1RQHA 3E96A 3AMDA 1E40A 2BGQA 2E4TA 2BODX 2EG7A 3OPSA 1GG1A 1OGSA 2WNNA 4Q4OA 1Q6EA 3KP0A 1CLVA 3IS4A 4HA4A 1XLIA 1S46A 4JTDA 2BVWA 2ABAA 2VX4A 1H7OA 3GG8A 3VNZA 5C7HA 1SW7A 2R9RA 5A95A 2DIEA 4WR3A 2XSBA 4FNRA 4S3AA 5I06A 3REQB 4KFOA 4XIAA 5D2WA 2PURA 4UTWA 4UUIA 4M19A 2J62A 5CGTA 1LG1A 1I2OA 4MDOA 3I7QA 1ZENA 4UTKA 4Z2IA 1O7AA 3CV2A 4PGLA 4GYPA 2REQA 5A2CA 4J3UA 1KBIA 2GGEA 4LF1A 3U7BA 3ZS4A 1F74A 4W88A 4JTSA 2OWXA 4IFRA 3W70A 3W2MA 1QI0A 4GFIA 4JTKA 3G1DA 4A8LA 2BV9A 1ZNNA 2NLYA 4M6QA 1B31A 3CGTA 1NFBA 4NRSA 4DXXA 3E5BA 5BMXA 4UR9A 4QS6A 1IHIA 5SWUA 1XYLA 1A3HA 4PCSA 1DTUA 3WNNA 5TNVA 2I56A 4OQVA 4UQEA 3HO8A 1XR2A 2DU2A 5CJ5A 2CLOA 2C1GA 4ZXOA 1GTEA 5E9AA 1D3GA 2VEIA 1KRMA 3LPFA 3KBMA 3UQNA 2VWSA 4W87A 1L0PA 3OBAA 1TTPA 1P4CA 4XKYA 3S1WA 4GYJA 1S5VA 3UW6A 1BVNP 1R0MA 4RZ4A 4JFUA 4WSKA 4AH7A 4XQ6A 1ZFJA 4POCA 4M6UA 3M0XA 2GDQA 4GLEA 4NNAA 1FKXA 3W7OA 4EPDC 3SGUA 4PE8A 2PS2A 2PGWA 4OE7A 1K9EA 2VFDA 4JQ3A 3QY7A 4US5D 4DZ5A 1SMAA 3LCHA 1FHLA 4FXFA 3S1XA 4IMGA 1G67A 2IPJA 1US2A 3W1XA 4OJYA 1FWBC 3O6DA 4NQ1A 3VILA 2ZX5A 3BDKA 3A5FA 1EXBA 3V36A 2A6NA 3DG6A 4GGBA 4NASA 3IVSA 1AJZA 1JCXA 4IIDA 3R2GA 3FDGA 2VCAA 2NXHA 1QR7A 3U2ZA 1NP0A 1OFQA 4QLKA 3RR4A 3HGOA 3R0KA 1QRQA 3URQA 2GUUA 1W3NA 1KNWA 2WXDM 2P0IA 4MWAB 2FZBA 2OWCA 1TPVA 2C18A 1K02A 1CGXA 3T1GA 5J04A 2Z4GA 5LNRA 1GKPA 1R86A 5C2CA 3S5YA 1JCMP 3FJLA 1OIMA 2JK2A 2WBGA 2QF8A 3WK2A 3FYPA 3K4DA 2PC4A 4BEUA 4GZJA 4PMYA 4W86A 3VUSA 2YCLA 4KWSA 5MKGB 2PRHA 2XIBA 4FOUA 2CLMA 5AHMA 3VD4A 4MG4A 3ZYZA 1KB3A 3CAQA 1SFLA 4DNMA 7A3HA 3D5HA 3OLGA 1R47A 2VDIA 3M5ZA 4XVEA 2QCFA 3CUHA 3E1F1 1V7AA 2AL2A 3SCSA 5C70A 1W6TA 4AIBA 3UPBA 4TVCA 4FXJA 1QT1A 1GQJA 5A6AA 2A3EA 1RP8A 2P53A 3ZFHA 3IACA 3RK8A 1T41A 4F4RA 4GRSA 2ZUSA 1LOLA 2EKGA 2PF8A 3NAVA 1K77A 4LUYA 2P10A 3WLMA 5EPDA 2G4JA 2ZUNA 3K1DA 3RITA 4HMEA 3KE0A 2J9XA 1UKQA 3H54A 1IGWA 5BMWA 3DKLA 4M6PA 4E3VA 1EKOA 4X2PA 3ARWA 3V0UA 4G6CA 1AJ0A 4XZIA 4U2ZA 1ITCA 4UQAA 4I9TA 5TF0A 3UJEA 3TMLA 2A7RA 3KVMA 3S5OA 4CNPA 1B3WA 1R8LA 3TYDA 1VAHA 3USZA 4O4VA 1GORA 2GUBA 1GVFA 4OOZA 3IAQA 4WJEA 4D6CA 4GYFA 5J5DA 5CH9A 1M41A 1ZBCA 1CXEA 4QFUA 2ISVA 4MSSA 1A3XA 4LUTA 5D38A 1AD4A 4RLIA 4ERIA 4MNJA 2BGNE 1E9ZB 3TK7A 1XISA 1KKOA 4RZ6A 5F1VA 3F4CA 1PV8A 2OXNA 1J5TA 4GACA 1OVDA 5A8MA 3GU2A 4L4MA 4IGMA 5F2LA 1R3WA 5LXEA 1EOMA 5DMLA 1H2JA 4HN4A 5A6BD 3OO2A 4HPXA 1QDSA 5EFDA 3TW9A 1M01A 3UWYA 1MWOA 4FO4A 4EVZA 4E38A 5TQLA 2MNRA 1RCXB 2WCGA 3AU6A 4S3BA 3QC3A 3GC5A 5IDZA 1PYFA 1V3HA 4J3ZA 1KTNA 3W1TA 4DXKA 1UCWA 4L9YA 4PMVA 4OBSA 2YL5A 1B3YA 2P76A 2REQB 4FAMA 1QI3A 3GC4A 4W8AA 2RDTA 4YTUA 3G1SA 2NV1A 1FQ0A 3R4IA 1OC7A 1RAKA 2BX7A 2DSZA 5CSYA 4YYFA 1HKKA 1PTDA 3ZSTA 2RUSA 3KRZA 3M0LA 4LC6A 4DEFA 2BXVA 3TC6A 3W2JA 2C19A 2F8QA 4E2OA 4NYUA 4QX4A 4AWUA 3RLGA 4DHGA 2XH7A 3EKGA 4GG9A 1Z44A 2WJDA 3R89A 1S2WA 3MO4A 1QVBA 3MV11 1RA0A 2GGGA 2YW3A 4ENLA 4AY1A 1Z9AA 1CWYA 3G0XA 3EXTA 1PE1A 2R1KA 3UZ5A 1V3JA 2FDMA 4IIHA 1L2QA 3GG7A 3UG5A 2OO6A 3KDOA 2R94A 2R1LA 4XKYB 1J0HA 3STGA 3QYQA 1EXPA 3QPEA 1DJIA 3APTA 2PODA 1LQ0A 2XIIA 1XG3A 4V1YA 2ZA2A 3TJLA 1J0IA 1IR1A 3RYSA 2DORA 2Z0IA 4ORIA 5IFTA 2EPKX 2BHZA 3L2LA 1YQ2A 1RQBA 2QGHA 1ALDA 2VT0A 3QR1A 1RLCL 4ADTA 2QCDB 4CN6A 2BTMA 1A49A 3GNNA 1JFXA 1F61A 4GE8A 1AL8A 1OADA 2GWNA 4AEEA 3ITCA 4JTTA 1X6LA 1P6WA 3EMZA 2PDUA 4JZ5A 4LCRA 3TNOA 5GJPA 4CKQA 1QNVA 3L0KA 3C8FA 4HU4A 4YWIA 2HVNA 4A8IA 1IWPA 3R43A 4N7QA 1KXHA 4N42A 2JFEX 3QLLA 2VVSA 4H7ZA 1TUXA 2ZZ7A 5CQ1A 3N17A 3TN5A 1FXPA 1AZ2A 2XIJA 3C0QA 1TO3A 2QDHA 1T99A 1CXKA 3AJXA 3M0IA 2V5BA 1XW8A 5D9OA 2V9DA 3A3HA 4A21A 1NWUA 2PLKA 4NZFA 3HN3A 1SGJA 1YYAA 2YCLB 3T8LA 4DYKA 2P3ZA 4DNHA 3H7VA 4F0HA 3B06A 3QMSA 4F0MA 4NJIA 2CCRA 3TW7A 4W5UA 3G3MA 3CHVA 5DMNA 4OU1A 2Y8VA 3G22A 3QZ6A 1E6NA 3EOOA 5CPLA 2PTYA 4FOJA 4S3EA 2OT1A 2X41A 2QCEA 1JDFA 5AYIA 1XLHA 1EIBA 4AY7A 3TFCA 1V03A 1ZJIA 3PY2A 4CU7A 1J01A 1SUXA 4L1XA 3SUTA 4F0SA 3WELA 3AS3A 1N8FA 3HQNA 4QDMA 3W22A 3BAWA 2VZOA 3CV1A 1MFUA 2UY5A 4URIA 1WZMA 4TTGA 1JUEA 1TV3A 3WNLA 2ACSA 2YCIX 3L68A 4DI9A 1H51A 2C1IA 4Z0JA 5BXRA 1O5QA 3ALGA 4PODA 3ZJ8A 2J7BA 2V3FA 2XYLA 1F4AA 3LI0A 1IF2A 4HCHA 2FVMA 3KS6A 3SN0A 5BOEA 1Z7AA 1OFAA 1AH4A 1V02A 3FYYA 1TVPA 3R12A 4WZHA 5I6SA 2WNQA 3IJ9A 1VPYA 3WL1A 5D2YA 3LSBA 1W5MA 2OQLA 2HBXA 2JKAA 2J7HA 2A21A 4LUTB 1UD8A 4NZ4A 3B04A 2QCGA 3RCYA 3TTQA 2E9BA 1YDNA 1HJVA 4ZO7A 5D2XA 1HKJA 5GJMA 4K36A 4NZ1A 4QG9A 1PB0A 5FF7A 4A3HA 4QEEA 1ML1A 4NNCA 1N8IA 4CQ8A 5IRPA 3DAQA 3H53A 1NWTA 1JG9A 3TC7A 2DH2A 4B5TA 5CC7A 1J18A 1ZBKA 3AIEA 3GQYA 3TZNA 1J2BA 3F4WA 4PN2A 2Z25A 1UOZA 1XLKA 4DO7A 3QPZA 2EJ1A 2V5KA 1K6AA 2J4GA 2G3MA 3ES8A 1JZ6A 2RKXA 2UZ9A 3V35A 3VKBA 4DBEA 3W82A 3DEQA 1E9LA 1FCVA 4OKDA 3LENA 4G2DA 2Y5EA 3TA6A 3BAYA 3U3HA 1KBJA 3M0KA 3W28A 3SUVA 1TR9A 2HPIA 3W1RA 1XI3A 3GUGA 3QR3A 3FOKA 2XPKA 3W4RA 3QGAC 1R5YA 2H90A 1FWAC 5FSEC 4D6IA 4GINA 2CESA 2Q8LA 2PGEA 1KLZA 4RNIA 6TIMA 1ONXA 3KTSA 2FLIA 3BCFA 1XDMA 1IYXA 3LCIA 4A2SA 2AGTA 4CD5A 5AZ1A 1A5MC 2VOMA 3EB2A 2A79A 1JXKA 1KRCC 1D8WA 1EH9A 2DSWA 4PH6A 3EOSA 1ZTVA 3W86A 3A4XA 1PZ2A 1FWCC 2WB5A 4PL1A 1HO1A 2IPGA 1XD0A 3THAA 3CH0A 3IRDA 3C5QA 3LN3A 1PZ1A 3VZYA 3GVWA 1OC6A 1RJQA 3I3EA 4J2PA 1W9PA 4YTRA 3L4YA 4JOMA 5DT5A 3UERA 4GVHA 3QHOA 2QNEA 3LD5A 4N6EA 2CLKA 3VOGA 4GVIA 1ZZMA 4H2CA 3O3RA 3A4JA 3P3BA 1HJQA 2O4MA 3V4BA 5C8BB 2ACQA 3FS2A 1E4NA 5CEWA 1SW3A 2C6QA 3VNKA 4IICA 3N29A 4J28A 1LP6A 1DL3A 2Q3RA 2Z6IA 3ES7A 3TROA 5LIXX 4EPKA 4LV4A 2VOTA 2IQ0A 1ZCCA 4G1NA 4KGJA 4K8HA 2NV2A 1JPHA 4ZQRA 3UJFA 5D2TA 1EDTA 2WZHA 1NY1A 4W7UA 1GHRA 1OCJA 4HU3A 1XCXA 3QR0A 5FEWA 3QFWA 4TIMA 2LLEA 4PUMA 1LRTA 5I3HA 1QBAA 5A6JA 3ABOA 3P7YA 4UQCA 3F4DA 4P8XA 2ABBA 4C6NA 5C9ZA 4DBUA 1BTMA 2ZZ5A 1U5HA 4H7CA 4E8DA 1ECEA 1KR1A 3SZ8A 3OG3A 1WYIA 3TQPA 3RXZA 4KEMA 2QEZA 2VD8A 1HKMA 2NV9A 3NTYA 1KFKA 1X39A 4NVTA 1TPH1 2ZX6A 4LUSB 1NFGA 1EGVA 4UFKA 5CPMA 3N3TA 4ICNA 1CGTA 3WLKX 4HVXA 1M65A 4XWUA 3TCSA 3QC0A 3AOFA 1E4MM 3ATYA 1OYCA 1TVNA 2Q09A 1F8MA 3LMYA 4MGGA 3URNA 1WDQA 5FF2A 1HQTA 2VRJA 1UKPA 4PCNA 1XLFA 4YTSA 4QTGA 3WMLA 4AD4A 2YGYA 1EJWC 4RUBA 2IQTA 3VOJA 2ATSA 2BHYA 2WSPA 3BW2A 2OU4A 3VFCA 3W25A 2XM1A 1UD2A 3STCA 3AIRA 2GPTA 1TFVA 4HK5A 1RY8A 2ZXQA 5LNSA 3U4AA 1A5OC 3ZWTA 1GEQA 3ALFA 1K7XA 1ME7A 2W61A 4DUVA 4PMOA 1R2SA 2JKEA 3IAPA 4NAFB 3CZGA 4J27A 3T09A 4XZWA 4JHMA 3FY1A 4B91A 3VE9A 2YDAA 3GG0A 4DO5A 1MNZA 1BQGA 1TJ2A 3FV9A 3RO8A 2JEQA 1HFBA 5HNNA 2GVGA 2ZZ4A 1ZJBA 1NDYA 2Y6ZA 2ATMA 5I3DA 5XINA 1Q6FA 1ZQ5A 2GQ8A 1R3TA 1E70M 3T4WA 1XIFA 3UPWA 3P67A 4BF5A 5I5RA 3RDKA 1C3FA 4BWLC 2VVNA 1DV7A 2CZ5A 5EA9A 1W5QA 3KX6A 1HVQA 1IE7C 3T7VA 2DP3A 4TX8A 2NWRA 1MEIA 2BSLA 2QYGA 2WNZA 1ZU8A 3W1QA 4HSHA 3W7HA 1QW9A 3AMCA 3ARUA 1MQPA 3DBPA 3IJ6A 2IKIA 1TJPA 3WH9A 3CAWA 2BG5A 3TQKA 4Q8VA 4WDUA 3W01A 3N12A 1X1NA 3KCJA 3TQVA 3UG3A 3CL6A 3HIJA 4B5WA 4W89A 1C90A 5T9BG 3AFBA 4XX6A 4ZTXA 3PUDA 2PDJA 4NJHA 3UZXA 2VWTA 1YDYA 1L2UA 4KERA 3RM8A 1PCWA 2ZCGA 2Y7EA 3DENA 1Y5VA 3NQ8A 4GQ0A 2CU0A 5AHIA 2D73A 4IQLA 3FSTA 4V1XA 5CJMA 3EWXA 1BYDA 4MB5A 1JF6A 2TRSA 3NZ1A 3UG8A 1AH0A 2PDMA 1V7YA 2QJHA 3N4FA 2PDKA 2YA2A 4Y2WA 9CGTA 7REQB 1MNSA 2AMGA 3GG1A 1EDQA 3EYPA 1QAPA 1OBAA 3MSYA 2AL1A 3QTGA 2C14A 2Z29A 3UYCA 2ZDRA 4AZBA 5BU9A 1DIDA 3K1GA 4AD5A 4H9ZA 4OFCA 1E73M 2PDCA 1Q6CA 2YDRA 3ARZA 1I4NA 4IGSA 4JIHA 1FTXA 3A64A 4JS3A 1JXJA 2JKPA 4O1AA 1K9DA 1GUVA 4S3GA 4S39A 2KX9A 3W1LA 4U4MA 1MSSA 3TTEA 3GKFA 5BWAA 2VR2A 3EWWA 3BO9A 1KM1A 4M1BA 3QJAA 1NARA 1ISVA 4MY9A 2F6UA 2G3FA 2I9EA 1LWHA 1KWGA 1IEQA 5FJJA 4DJDA 3MUCA 2CLHA 3LHYA 2FZ8A 3UXIA 5DCBA 3GE7A 5AHFA 3IJQA 2PB1A 4KKXA 4ZOBA 2ALRA 1KFBA 4XG1A 5LIKX 1YPIA 3AS1A 2WO5A 4FR1A 4ZB5A 5I3IA 3VGGA 4US5A 1UYQA 4QGCA 1PEZA 4YVVA 3L4WA 3GZAA 4ZE4A 1F4HA 2CEQA 1MZRA 1NELA 3EZ4A 4NNBA 3QSTA 3L67A 2DSUA 3PBUA 1XKJA 1VH7A 1WZLA 2V30A 3TOPA 3FHAA 1VYSX 3N15A 3W87A 1OCNA 4JTGA 1H5VA 3ZQ9A 1W37A 1XDLA 3ZLFA 2VQUA 4F8XA 5FF4A 3U5UA 3KDNA 4WUIA 1FH7A 1QPNA 2VFIA 6ENLA 7PTDA 4FOKA 2PUZA 3B0XA 3SRKA 1XFCA 4H2HA 4AEFA 3ABQA 5I03A 4F2TA 3LLFA 2PP0A 3LGDA 4NXSA 3LOTA 3JZUA 4MDPA 3C0LA 1FWRA 1EWEA 4AHOA 3FAWA 4UZUA 3CIXA 3T0BA 4R7OA 2VRQA 3OZYA 1NOFA 3ITYA 5FJPA 1MUMA 3NZQA 9RUBA 2YYTA 5BNKA 4LWWA 4FA3A 1Z3NA 4KCVA 4XTIA 3FNDA 3THUA 4GZ7A 3FN9A 2E0PA 5FOOA 5DO8A 2Y7DA 1G7VA 3DYOA 4HTYA 1TE6A 2P0OA 4CNSA 2A3HA 4HNCA 2ZX8A 1AQHA 1X97A 3BLEA 3C2YA 3H4XA 1MXGA 4XKMA 3T9PA 1BQCA 4WGHA 4Q3MA 5M1TA 3EDJA 1LF1A 1CT5A 4JIRA 3LX9A 3PZ9A 3QSRA 4IXXA 5HWNA 1UR9A 3RUBL 3ORWA 3SY5A 3E5PA 3WLNA 2AMXA 3WLRA 2FVKA 3Q2DA 3F4NA 3FA3A 2VEKA 5C2GA 5LXXA 3ZR6A 2Z7GA 1S39A 5CAKA 4U31A 2FYMA 4CCZA 5HK4A 3P14A 4V28A 3UR5A 2ICSA 3TQ0A 3LG3A 1GYNA 1WV2A 4RNJA 4PMDA 1YE6A 2G97A 3MTWA 3A3WA 4ZQCA 3CYJA 3M46A 3EWUA 3PJWA 1IEVA 2DUZA 3RF9A 1ADDA 2Z2AA 3DG3A 4JHZA 4B4FA 4PTDA 3BMWA 1Z42A 1MW2A 1HJSA 3MZNA 3S9ZA 4IZGA 2DV0A 2OSWA 1GOIA 1O1ZA 2QJGA 2Y4SA 3S46A 2FZDA 5BYWA 2C0AA 1GQNA 4E4UA 4XZMX 4IL0A 1DWHM 2BXZA 5IOBA 3TW6A 2FTPA 3BVJA 3WNMA 1D3HA 3WZ0E 1LORA 5EU9A 1JAKA 4GI8A 3RX2A 3ZMRA 5I23A 5G1TA 5ECVA 4RX0A 3LBCA 3VZZA 4J3XA 1A5NC 1PAMA 2E5BA 4UOJA 1LTDA 1E5NA 4JN7A 5G1MA 3TAKA 4FF7A 1I60A 3MS8A 1EHNA 3PF3A 1OABA 4CVWA 4GZEA 3M1ZA 1WXZA 4K3ZA 3CV6A 3R94A 1B3VA 1JPMA 3H21A 1MUCA 4CD8A 5H8UA 2X2GA 3T6CA 1DWGM 1WUFA 4NZ5A 2D0GA 3ZOAA 3GSMA 3WFZA 4LYRA 4RNHA 3UXDA 1JULA 4O16A 4CU8A 2AQWA 3K8KA 1QWGA 1W1IE 3FHQA 3CWOX 3GH4A 1N82A 3E12A 1JDAA 3G1VA 4P8UA 2Y2WA 3RJYA 3RLHA 1JJKA 2PWFA 2QIIA 2BGSA 3RMJA 2TAAA 1R38A 4HNOA 4MAVA 1MW3A 2KAUC 4LVDA 2XFYA 2WQDA 3HG2A 3NPWA 1F9CA 3PWGA 3WQ6A 4Y8EA 3CXOA 3E0WA 3NO5A 4RV8A 4M1RA 4B2DD 4TVUA 3C2RA 3OHMB 3TZFA 1W9BM 2W5FA 1TV2A 5DX7A 6A3HA 3TJIA 3P62A 5XIAA 2DSKA 1R9XA 1J6OA 3NQVA 4EKJA 1FWWA 1CGVA 3SJ3A 5D9NA 5C5YA 4UNIA 1EA9C 1AW5A 5PTDA 5EMUA 2Q6ZA 1EBGA 3KBSA 4O8AA 3N1AA 1MO0A 1QHPA 2CBUA 2A0NA 4H8NA 4UOQA 3WFLA 1SSDA 3GXNA 3EXSA 3OLEA 5K3VA 3TYEA 3PTQA 3RRXA 2H3BA 2C79A 3AMLA 4M3PA 5HULA 5E93A 3UWEA 3NQ2A 2H8ZA 2VZSA 3R0UA 2BY1A 3IVUA 4PTWA 3VNYA 4WKHA 4JAWA 4AQLA 4ACZA 1OGGA 2EO7A 3SADA 1BSLA 1LOSA 5CLWA 4D6FA 2OLSA 2GQAA 1R85A 4LY4A 4A3UA 3PUEA 3GX9A 3LM7A 3LXCA 3WN6A 4P8WA 3MBFA 3B9AA 3A3XA 1HL2A 5G4WA 1HTIA 4H8HA 2QDGA 2CBVA 1AQMA 1H11A 4ZTYA 2YCJA 3P6LA 5D9PA 4E5TA 4AD3A 4YN5A 3AHVA 4HYWA 5AC4A 3HA1A 1POKA 2HTMA 3VIOA 4OT7A 3PBVA 5HMDA 1EGMA 5LHFA 1CPUA 3WH5A 3WCZA 1XIMA 1KFWA 3E2VA 3O07A 2DGAA 2WANA 2X7WA 1GKRA 3MU7A 1HGYA 1R6WA 1VBRA 2Z1WA 4RXGA 3W6LA 1E1CA 1TWWA 1MVYA 4ATDA 3U57A 3O0FA 3TIMA 3MI6A 3AIBA 1HIZA 3ZWSA 4LGXA 2YA1A 3TTOA 4JD4A 1I2NA 4C6OA 2I5QA 2WHLA 3TTYA 2W92A 3BK0A 3U2EA 4PZVA 4W7VA 1VZWA 3SCUA 1VRXA 1HJWA 3P80A 3KAOA 2ZUWA 4U33A 4JX5A 4MJ4A 3WF1A 4Y9PA 3F7JA 4PFMA 1JFHA 4R7JA 4AD0A 4B3ZA 3Q4DA 4O0KA 1OX4A 3VM7A 5CPSA 3VZXA 4ONVA 3EOUA 4JGDA 1AUSL 3ENLA 3N2MA 1TV7A 1E0XA 1V0NA 5D33A 2PWGA 3AICA 3D0CA 3VX1A 3W7LA 2PWDA 1DQUA 1BKHA 1NAL1 3COTA 1R3RA 1KC7A 1PHQA 1BAGA 2E28A 2VTFA 3WLPA 3MVTA 4JKKA 2J74A 3MMDA 3GNDA 1C8QA 2JGQA 6XIAA 3B9DA 3WBEA 4LT9A 4MB1A 3RCNA 3QF0A 1PDYA 2ZUVA 4GXWA 4GFSA 3WD3A 3OA5A 4O0QA 1CGUA 4OUEA 1IZCA 1G7UA 1DQXA 1QXLA 5I7GA 5A6SA 3CMGA 2JF7A 3KRSA 4K68A 1FWHC 3VKJA 4D6HA 3DDMA 5A8NA 1AJ2A 3DHFA 3AXKA 3BLOA 4KFNA 3VABA 1XBZA 1BWLA 2GJPA 3OYXA 3DCPA 1WZAA 1TTQA 5AC7A 3A23A 4HYRA 1WZKA 5REQB 1M7PA 5DN1A 1YPXA 1HO4A 2L5HA 1UWSA 3HGJA 1OJXA 2VX7A 2BP1A 1ZAHA 1K8XA 3I6RA 1TZZA 1S1PA 1NU5A 4GKTA 1IEIA 3EEGA 4L6HA 1QO5A 4REQA 3I68A 3N9KA 3WJXA 1OHLA 5CXPA 4WD0A 3UBPC 3C86A 3S2CA 2O4QA 3OB8A 2BOGX 3EWDA 4P7RA 1BKSA 5CBIA 4KCTA 1QHOA 3P74A 2EG8A 1ITXA 3GNXA 4XBKA 2JIWA 2ZC1A 5EMJA 3NPXA 3W7GA 2OYKA 4ORMA 2XHYA 3GHUA 1B3OA 4GBDA 3ARPA 4C1LA 3TXZA 4DBDA 4GX9A 2WMHA 3UA3A 4NIRA 3NZGA 2F6KA 2HMCA 4UFLA 3U0HA 1S1RA 3G0SA 5BXPA 3PPFA 3I3BA 1TPB1 3LSCA 3K5XA 1KR0A 1BXCA 4JNYA 1X8CA 3G8RA 4TMCA 1WQ5A 4UB9A 1CLXA 4LVBA 2FPTA 5I00A 2RGLA 1A5SA 4PUJA 3AO0A 3RAOA 1YXCA 1K8YA 3W6YA 4RW5A 1YNYA 1AD1A 5A6TC 3SUWA 1SM9A 2C16A 2CLEA 3AXXA 5LHEA 1W32A 2VGIA 4JCLA 4JTAA 3HU7A 5EFFA 3I10A 2WZIA 1JYXA 1LM1A 2W0UA 3PPCA 4GUFA 3WF0A 3H24A 5I79A 1UR8A 1WCGA 5D8ZA 5DRCA 3H2AA 4F3HA 1O1HA 4U5KA 3W84A 3TTSA 1KTBA 1QJWA 5D9MA 1IEWA 4O13A 3FGCB 3WLOA 2WVUA 3PZQA 5D4YA 3WQ4A 4ACZB 4GABA 1OX6A 4GWEA 1PIFA 3LCWA 4CUCA 1UWIA 4O1DA 1QI2A 1U1JA 1Q6OA 4RZBA 1OG6A 2XFRA 3BQ6A 3W7NA 3THQA 3HFTA 3CHCA 5HATA 2FHFA 3BLLA 3S0CA 2XISA 2VFEA 4ZMGA 4QNEA 5CZSA 4ATWA 2R14A 2E25A 3MKCA 1GKQA 3STFA 3L2IA 4LVFA 4QQ3A 1TE1A 3GDRA 6CGTA 3N25A 3BGJA 3SB0A 2CHRA 1OB0A 5HA7A 4Q8MA 4XO6A 4Q4PA 2QULA 4C6LA 1JUBA 4H6KA 3WJWA 2PWUA 3PTKA 1ELSA 1UASA 1QCWA 1X6UA 1OT2A 4AXNA 3VD9A 2IXVA 3DYPA 3VKKA 4H8VA 4TMBA 3QW4B 1YKWA 4PUNA 5C71A 3PNUA 4AZHA 2FTYA 4KFPA 4YCOA 3QH2A 3G3DA 5AY7A 4IMAA 1OYAA 3Q65A 4GUHA 1NF7A 1A4MA 3W75A 1CEOA 2FPYA 5EBAA 1TRIA 1DJNA 1VEOA 3EWYA 3PB2A 3AUOA 1HXJA 1M7JA 2BHUA 1DHKA 4Z1CA 1C7TA 4LBSA 5HPCA 1GQIA 3NQGA 4XO7A 3IIPA 3XIMA 3FDKA 3GC2A 3MSGA 4BWLA 4Q8OA 1Z8AA 4UNKA 4A3RA 5KZDA 4WK9A 4KW2A 1FP8A 1UD3A 1GOMA 1XXXA 3EWCA 1NP2A 1UUMA 2YYUA 1OK6A 4GO8A 4AIEA 4S3KA 1OX4B 3WQGA 4PMZA 4BF9A 4JNMA 2WK2A 2NX9A 1F07A 3M5XA 3CJPA 4R53A 2FFCA 1W3HA 1B57A 3LXBA 5E09A 3LEPA 4ZCWA 2XH4A 1E0UA 2VL4A 1NTHA 4LEFA 3EWZA 4FX8A 4MYXA 4O17A 1MMFA 3WMBA 3HPSA 3AI0A 3IGUA 1CCWB 3VDAA 3EX2A 3R8RA 4C6JA 4Q8PA 1EJRC 1VFHA 3LUTA 4JL1A 3PVFA 3AJ7A 1QOPA 1NSJA 2RFGA 3W1NA 3CWHA 2YLLA 5FJRA 1OF8A 2G3JA 2P88A 1FH8A 1CXHA 1W3TA 2Y70A 2V2DA 2NXIA 4QROA 4MPQA 5D30A 4IF2A 4GOAA 3GTHA 1TVLA 3VOHA 4MWAE 5IFPA 3UYIA 2POZA 4YVPA 3GHTA 4MZYA 4KCUA 1ITQA 1EP1A 1TX0A 1JZ4A 2CBIA 4YNGA 3QQ0A 2X1SA 5CSSA 1Y5WA 4MJMA 1P0BA 3M44A 3UD6A 3MUIA 1LBFA 5FSDC 1CIUA 2DZUA 3NPUA 1XSIA 1YDOA 1XRSA 3HJEA 4NZJA 4AVFA 5C0QA 1W2VA 1O95A 3TN6A 3NDZA 1OK4A 4DAIA 2D0FA 3GXFA 3TWBA 1OG0A 1XX1A 2XVLA 1TUFA 2Y88A 4N2YA 2YXXA 4UXDA 1M53A 5CBJA 1TV4A 2HK1A 1SJCA 2GJXB 4V33A 7ENLA 3O06A 4H01A 3LPOA 3GWQA 4DM2A 4E4FA 2J79A 2J78A 1A5UA 3VPLA 3CUJA 1AK5A 3IV8A 3SO7A 2J7EA 3QW3A 2ZZ2A 3SSJA 2CHNA 2HNEA 1VHNA 2BB0A 3E0IA 4MJ2A 2GGIA 3NSNA 5A69A 1QFEA 4JX6A 1V77A 3OW1A 5A6KA 1GONA 1IXOA 3CEPA 4DJFD 1HP5A 2ZUMA 1EJUC 3R25A 1E6SM 4KMQA 5J5RA 2B7PA 3U4FA 1UC4A 3G1YA 1A5KC 1KBLA 4HMCA 2PDBA 2JF6A 4AY8A 1TIWA 2OPJA 3W0KA 4QJ3B 1ISYA 1HX0A 2GUYA 3F2CA 4CNUA 4QS5A 1RD5A 1G01A 1DWJM 1LG2A 3CQJA 3H22A 3CZJA 4IX2A 4B5XA 2WW5A 4PA8A 1S5TA 4IIBA 4GA8A 2XGIA 3UY8A 1JD9A 3CM4A 3DGBA 1HW6A 3N9SA 3GFZA 1W31A 4HHMA 4LF2A 2PAJA 4EX4A 4KRTA 5AB3A 4R7WA 4HOXA 3OYZA 4GCAA 4HPHA 2Z2UA 2X0HA 2JE8A 1V3IA 3DHUA 2D22A 3APYA 5EY5A 5GQBA 4WHBA 4AB4A 4ROPA 4QAIA 3UJSA 2XWDA 4CD4A 4B5SA 4Z0SA 4RPQA 3NJ3A 2WMKA 4RE3A 1DE6A 3GBDA 1XUZA 3WEMA 1OFDA 3VU2A 3CNYA 3HMJG 1YHTA 3N2OA 4WX2A 4PYSA 2IKHA 1GNXA 3P0XA 3KBVA 4XSMA 2VZTA 4Q4QA 2HXTA 3EMCA 4L9XA 3W07A 1LRNA 1WUEA 3L65A 3FYOA 1KXVA 2XGZA 4MAZA 3WDJA 3VGDA 3I7RA 2A1YA 4AWSA 3GU9A 3EDKA 1ME9A 2QUNA 4NI8A 3GW3A 3NQ7A 1XIHA 3KRUA 4DJFC 1YNPA 1VBGA 1PXGA 3V7PA 4ZFCA 1ZY9A 5CZKA 4NJJA 1GVOA 1MFVA 3DFYA 4UTHA 2ZADA 3SQSA 1EEPA 4JTHA 4Z1BA 4HQVA 1HKVA 3FVDA 4GISA 3MQTA 3ANVA 4CCEA 5DELA 3HJZA 4HCDA 1HL8A 1DJYA 1B4KA 1ODUA 4GIEA 3LZ3A 1H62A 1B90A 1GJWA 1BHGA 4U3CA 1IT0A 3RM4A 4KQNA 3CO4A 5EBUA 3KL5A 3BARA 4UFHA 2YDQA 3M0YA 4CQBA 4WRHA 2NSOA 2P3EA 4M80A 1WDWA 2QUVA 4BFAA 2FH8A 2GGJA 1PCKA 3UXLA 4Y7EA 1X1ZA 5HQEA 1UZ4A 1O5XA 3AWNA 4A4AA 1NH6A 2G41A 3NVDA 1XBYA 3ITTA 3CUZA 1V0KA 1XD1A 2VC7A 1L9WA 4UC5A 1QUMA 3RMEA 1O5KA 1GK8A 2V5JA 1KM3A 3FK4A 4XAZA 1XICA 4B92A 4WJ8A 4DJED 1POJA 4G7FA 2PD5A 1X7IA 3PULA 1U83A 2ZXAA 3RX4A 1FWIC 4HN8A 1E43A 3BAKA 2V63A 4S3DA 3E49A 3HGSA 3P5YA 2PI6A 2QDEA 2VCCA 3HGRA 2PZNA 1D9EA 2CNCA 1XBXA 3HG3A 3IWPA 3AHZA 3DFQA 4BI5A 4BJHA 1Z6KA 2BVTA 2Z00A 4XB3A 2WMFA 3QLDA 3BLDA 1F3EA 4QHRA 5DXXA 2J47A 4S3CA 3GS6A 3BGAA 1VBUA 3EGJA 1I45A 3KUMA 3JS3A 3MMWA 3UGVA 1I2PA 2G0WA 5U7SA 2YXGA 5FL0A 3FLUA 3OIHA 5FJUA 2D24A 2ZUUA 5AYZA 1OINA 5LSMA 4ZL1A 3C2FA 5C9XA 1GPFA 4X0NA 3O2LA 2QXWA 2UBPC 1PIIA 2NXGA 1BYAA 2IXUA 3GH7A 3FX4A 3KOXA 1RZMA 3KOWA 3CBWA 1EB3A 5H8PA 3SCNA 4LAOA 1PZ0A 1XIJA 5FJIA 4QLLA 3T8QA 1BF2A 4GQGA 4RPPA 5KSWA 2QCHA 1JGIA 1RV8A 3G1AA 4J3VA 5GNYA 1Q7MA 3TVAA 3QN3A 1YW1A 3UJ2A 2GFTA 3H4GA 5HAOA 7TAAA 1EHAA 4MF4A 2ANUA 2OSYA 4FX6M 4H9TA 4JTQA 4YVXA 1LLOA 1EYWA 4B90A 4DJEC 4Q4RA 1PKMA 1WX0A 4O52A 1BEUA 3VNMA 1TA3B 2ESCA 2GVJA 2VXNA 3APGA 1UUOA 1SW0A 4XAFA 3L4XA 4V2XA 3DHDA 3B9OA 5CGQA 1UOKA 2H9AA 5F4WA 1LDCA 2X1IA 4TVDA 4XZLX 4KIRA 1Q45A 4P7LA 4L4PA 4EPEC 3A47A 4GK8A 2R1MA 4Q7IA 3M6YA 3VO0A 2D2HA 4PBEA 5IHRA 4O15A 4TV6A 1N7KA 2HJPA 4B2DA 5J8LA 2ISWA 4Z08A 2Z1SA 3J7HA 2J6VA 3M0VA 4AW7A 1V6UA 5CZTA 3MKKA 4WDWA 3SUSA 3DFTA 3DH7A 1OFPA 3E2SA 3PG8A 2XSAA 4WEVX 4KPLA 2G96A 5G1YA 4OZOA 4DYEA 5LGZA 3TDFA 3LA4A 1RUSA 3NL2A 1M68A 5F2GA 3M0MA 2VDHA 4EANA 3LS9A 4HA0A 4JDBA 3V3WA 3ITXA 4RE4A 1ZJHA 1B0IA 3EAUA 3UT0A 2ZRYA 1CLKA 3GBEA 1B9ZA 3MMUA 2OVLA 1V5XA 3WFAA 5E1QA 2BS9A 5CZ0A 4ZE5A 1TQJA 2ZZ6A 2DFAA 4XVDA 5I3GA 3MY9A 2HVMA 3W3OA 1DKWA 5JVLA 5JIWA 4E3TA 2NUYA 5MKGA 3VDHA 2P50A 1WA3A 1VFFA 1GTHA 5AFDA 3I4EA 3CZLA 4HA3A 4GCXA 3QGVA 2CZDA 3WQ5A 2OR2A 3FW6A 5DMYA 2ZOXA 4MADA 1SMDA 3WLLA 3L23A 2DDXA 2O9OA 4YL2A 1G69A 1OGBA 1Y8BA 4AAJA 2AAMA 2A4AA 1A53A 3PZIA 2VZVA 3SRHA 1S5MA 4RDZA 4RDYA 1VB9A 4JX4A 3WLSA 1WKFA 2W67A 3UZZA 3Q45A 5D05A 1JRBA 3TN4A 2VFGA 3H26A 1WBHA 3AZRA 4ACYA 4DZAA 1GVQA 2XSXA 1GOWA 3SCWA 3NG3A 5M2FX 4AZIA 1XM3A 2ACRA 4C5YA 1DJQA 4LS2A 2TYSA 3R7MA 3WLTA 2WC7A 2QPXA 3VC6A 1HUVA 1UA3A 3W81A 3IIZA 4FMVA 4GY0A 1S3TC 3ITLA 4H3DA 2OYMA 1R2TA 4DVOA 1E5JA 4WOZA 2R8WA 2ISSA 4I9MA 5JIPA 1ITUA 5E9XA 3WBXA 4Z17A 3W27A 1NDWA 3AXMA 3QVQA 1FWGC 1FHDA 4J7RA 2VYOA 4IT1A 1O94A 3BC9A 1JDCA 3N18A 3PR2A 4P2VA 3PJXA 4D1IA 4FPSA 2PD9A 1EZ2A 4DPPA 3S42A 4LW7A 2WHMA 3LV6A 4C5ZA 1E6PA 4JFSA 3EPOA 3MSRA 3HPAA 1P0EA 1C93A 3GLCA 3W6MA 3KVJA 3VDGA 2WKGA 2FH6A 1VPXA 4HB7A 4TUFA 1JYVA 5AC6A 3WF4A 4PUKA 5LZLA 3GTNA 3V0SA 2CLIA 1UD6A 4CCDA 1JQVA 4O19A 4IGNA 3AMGA 2OX4A 1L6SA 1JZ8A 4GMEA 3VNJA 2E09A 5LKYA 4V15A 5EMKA 2NQ5A 4QITA 3FXGA 2YOCA 3VINA 1J4EA 5L9FA 3KZPA 4PFHA 2H8XA 3ZT6A 4P7QA 1UR3M 1OQFA 3LRMA 3VC5A 8RUCA 3DBNA 3DECA 4Q8UA 1CXFA 2VM8A 2Z24A 3DC0A 1H1NA 4LAUA 3M9YA 3WNPA 3R1ZA 1MQQA 4X61A 4HOZA 1P48A 2GL5A 1DJGA 1XCWA 2YSWA 1VFOA 4O1CA 3WLHA 4RE2A 4YTTA 3M0JA 3EA2A 3JUGA 1G4SA 2V69A 1JZ2A 3R8GA 3S2MA 3Q58A 2DVTA 4BQ5A 2VKZG 3T08A 1WDRA 3SIZA 4FSAA 2BNJA 2XM2A 5EKYA 2JEPA 1IGSA 3HPFA 5EMMA 1WKDA 1OF6A 1FCBA 1OT1A 4K1WA 4LTSA 4UNLA 5JUVA 1EP2A 4ZA0A 4NJGA 4R88A 3GDKA 2G8ZA 1WAWA 2NQ9A 2YW4A 1W1YA 3F4VA 1UD4A 2QPSA 1L6FA 2G5WA 5DRIA 3S6OA 4G8TA 4NP7A 2P8CA 4X3ZA 2ZQ0A 1V02E 1CENA 2D3NA 5I77A 3VCRA 4ZVJA 3B4UA 4QJ4B 2R24A 5B7ZA 1KD0A 1K6WA 4CU6A 1OEPA 5FAJA 3VDCA 1K4GA 5A2AA 1VS1A 2OGYA 5I02A 1FXQA 2CZVA 1UKOA 1C91A 1TMHA 4A05A 3E2QA 2H9AB 1IXPA 2Y1HA 3W7KA 3G1RA 4PULA 3H55A 4KWUA 3GAKA 2QCDA 5HJXA 1A0CA 4O54A 4XZBA 1JQXA 3DHPA 1EOKA 3SSZA 4A8NA 1BG9A 1UP2A 3V75A 5JXQA 4ATLA 1I2RA 1TZ7A 4NAEB 5A6LA 3AISA 3OLIA 2WWDA 3KTXA 4LEQA 1TMQA 1EJ7L 3D47A 3H70A 3SQLA 1UQYA 1Y0EA 3C2OA 1PJ9A 3FCPA 2W27A 3UNDA 1LUCA 2R1PA 2NSXA 2E7FA 5ABTA 1SO3A 4EWJA 4H6EA 1TWIA 4EACA 3AYSA 1UP3A 1EL3A 5DCEA 1F76A 3CIWA 1GW9A 1MW0A 4R9OA 4DWDA 4HZ6A 3H2NA 4LYQA 1EO7A 1C92A 4F2UA 3KP1A 1GOKA 3FIGA 1B4EA 5DEZA 3S1VA 4L56A 5IDIA 3OVPA 5I0DA 1P6CA 1Q7QA 2J9YA 2YR1A 2PDHA 4O28A 1U2YA 2BMBA 3UWUA 1RJRA 4NX5A 1PYMA 4M51A 3EKZA 1GW1A 3GXMA 2EJAA 4WSJA 3F5KA 3O6YX 2NVAA 1Q5MA 1KFJA 5C2XA 4PMXA 2PTXA 4DYJA 4D8AA 2IUZA 4FR6A 5K4ZA 3CUFA 3EDEA 4YXGA 1FRBA 3IPWA 2IQDA 4O18A 3L4VA 4FLSA 2NT0A 1W5OA 4YHGA 3PNZA 3QYSA 4DN1A 2GDVA 4JFWA 4DF0A 3O05A 4PR4A 3VOIA 1GCYA 2D23A 1IR2A 2Q8XA 3GY1A 3P82A 1WDDA 3A4AA 3NM3A 1Q7ZA 4BF7A 1K4HA 4C6BA 3E74A 2PEVA 3LLXA 2WVSA 3T4CA 3GIPA 4MZ8A 3H23A 1BXNA 1TTJA 4GH1A 3WMSA 1KCXA 4ZBCA 4HHPA 1KM0A 2V6AA 2QMKA 2WZMA 4PCFA 3EWBX 4F9DA 3P2VA 1FWTA 4S38A 3S2NA 2SFPA 3TKFA 3Q37A 3A6OA 1B2YA 3H12A 1WOBA 3BURA 1KCLA 3NZRA 1W5NA 1LLZA 3S2JA 2WC4A 1PIGA 3H2EA 4NU7A 4W93A 4DQWA 1VFMA 2FPVA 4C7GA 2DJLA 1RCOB 1E71M 5F1UA 2NLIA 2VFHA 3NDYA 5JH2A 1SFSA 3FAXA 4H9MA 4DAFA 1HT6A 3B8DA 1BWKA 3WUEA 5CPOA 3R79A 2ZICA 4YLWA 4H04A 4UWMA 4PTXA 3NQMA 3PSVA 5JBFA 3N9RA 2XTKA 2B7QA 3HOJA 2UWFA 1V6VA 3D6NA 3WNOA 1Q2SA 3L7RA 5T91A 3KHJA 2GQ9A 3C4UA 1FBAA 5LA1A 1YNQA 3UZWA 3GNPA 1W5PA 2XVPA 4JCMA 2GYIA 3B05A 3AIQA 2CXGA 3CZKA 3MP3A 2AKMA 2ZE0A 3PAOA 3TMQA 4AZ6A 4JTRA 1GVRA 4XAYA 3GTIA 4I8DA 1LWJA 4A22A 1C8XA 1W9UA 2ZDSA 4ZQMA 4R5EA 4XSLA 3POCA 5CBBA 2FFIA 2ZA3A 3WDIA 3MI3A 2O9PA 3RN6A 1XPGA 3MBDA 4I9AA 5CCZA 4JFVA 1K70A 5JU6A 2EPHA 6ALDA 3BJSA 1ZRQA 5K9DA 2XFWA 4O10A 2DVXA 4QCFA 3C2VA 5FL1A 3HM7A 3C2EA 4FNPA 4HYVA 2ASHA 4WY0B 3CPGA 2WNWA 4RE0A 3SN4A 3HTWA 4YIWA 1JZ7A 3PK7A 1UZ1A 3CUIA 1H50A 3KM8A 3UXKA 3LGGA 1EF3A 4IM4A 3WD2A 1PS9A 4LBRA 1SO4A 4W7WA 4JDYA 1DWIM 4GUJA 1HVXA 2VGFA 3PZOA 2E9LA 3G6MA 4ZQOA 4AMAA 4LYKA 1VQTA 4UFJA 4AG0A 4CQ9A 4KRZA 3O8AA 3CQKA 1VEPA 1LOQA 3VKDA 1ISWA 2J8FA 1SJAA 1XFBA 5CSRA 1Q8AA 2FZ9A 4LS0A 5DANA 5A6MA 1VFTA 3G18A 1VPQA 4JQ4A 1K8ZA 4KBXA 1E6RA 1VBJA 2WZTA 1XGEA 4N9CA 3TONA 2YFNA 2VRKA 3FVMA 1SZEA 2I17A 3E38A 3CZEA 4QJ5B 1XQKA 3IGSA 2YDSA 4CEUC 2VO5A 4AMCA 2GVEA 5EMLA 3IEBA 3LTSA 4C6IA 1TPEA 3L9CA 3SQMA 5A94A 4HSOA 1D8CA 2QJJA 4DJFA 2X09A 4EAYA 1PTAA 4LANA 2C3ZA 3AHXA 5BRQA 3NWRA 2DPEA 3ECQA 4EE9A 4S3FA 8XIMA 5T9CE 3UCDA 3AS2A 3BUVA 1EQCA 1PKLA 3BLIA 1LUCB 5BOFA 3T07A 1UZDA 4PBFA 1UR2A 4ZQNA 4NSBA 5H2ZA 4JKLA 2XWEA 2CFFA 4PMQA 1ZAIA 1DXIA 3WLIA 1W1VA 2PP1A 4FNQA 3V0TA 5BROA 3B0VC 3TH6A 4AZGA 2D1ZA 1BSIA 3VIJA 1UB3A 1AW1A 4IPNB 4Q8TA 4GBUA 1EYEA 3CPUA 5LIUX 1XRTA 1QNQA 3OGSA 3QOMA 3CS2A 3NNTA 1TB3A 3SDOA 5IXEA 4XD5A 2Z28A 1J0YA 2W9MA 2DEPA 5DT7A 5I78A 1NVMA 2Z6JA 4QIUA 2J7CA 2VC6A 4C6DA 5BXSA 3AS0A 4TX9A 2R82A 1L6YA 9XIAA 2A85A 3NR0A 3TP4A 4ADUA 1YPFA 3PBGA 4NRRA 4C1NA 1HKIA 4HNTA 2OEJA 1Z89A 5C55A 1S2TA 1Q6DA 5HBFA 1E3XA 3CB3A 3P93A 4Q7BA 2VEMA 2OZTA 4PUWA 2J13A 4FK9A 3B8WA 1PPIA 3ICJA 1UPPA 1JCLA 1PKNA 3RIKA 4R34A 2E8ZA 1W3IA 2DQWA 1UG6A 4FXSA 4IHCA 1V08A 2UY4A 1OZQA 1YIXA 1KQZA 1XRFA 3E9AA 3MCNA 4LUSA 3RU8X 3N6JA 2J8GA 1YDVA 3VFLA 3POHA 3UWZA 1E56A 4CQDA 3W85A 1KTCA 3D3AA 3II1A 2HS6A 4PUEA 4FALA 3VNLA 1CB7B 4Y9AA 1W91A 1U5JA 4QNWA 3ISIX 1JDDA 4P5UA 3VM5A 3WH6A 1KXTA 3MCOA 3OP2A 1G1YA 3SY1A 1JPDX 2ZRVA 1DVJA 3EX1A 3OG2A 3NCOA 4H9UA 5EMYA 2RH9A 1BGGA 3AAMA 1KFCA 4C90A 1LQ2A 2Y5JA 1W1A1 3DI0A 4IOTA 4LH8A 2Y7GA 4MIMA 5I3JA 3JZEA 2DZVA 1Q65A 4NAFA 4Q8NA 5M5DA 1TPDA 4Y96A 4XD3A 3NSXA 5LA0A 1SR0A 3BJFA 9XIMA 1FWFC 4AHQA 3CL7A 1W1ZA 1M7XA 1KGXA 1XH1A 2V3GA 4JQ2A 4FF5A 4JTLA 3IUDA 5A1AA 4UBPC 3M16A 5D03A 1G4EA 3MKVA 5IM51 3B0YA 2IPFA 4ZOAA 2ZXBA 1ONRA 5F2IA 2EPLX 3OODA 1GGOA 1OCQA 2QUTA 2PRLA 2QLYA 2W4XA 2J75A 2WQPA 4X2RA 3V16A 4DJEA 2V5DA 1PX3A 3VD3A 2PGRA 4BCEA 4XD6A 1GOXA 5E70A 3W7RA 1S2CA 4I5XA 2HCVA 2DVUA 1T8QA 1A3WA 3G6LA 4KEUA 4BHYA 1ZCOA 5B7YA 2GOKA 3UESA 2F2KA 2WMGA 4Z1AA 4FXRA 4LS1A 4DWSD 2OKTA 1XLDA 1DYSA 3K30A 4B4HA 1QPOA 1MRQA 1CTNA 4CQCA 3WF2A 1PWLA 5M3WA 1EJSC 4MB4A 2CZEA 3QXBA 4AC1X 2E6FA 5H6HA 2Z26A 4F0LA 1TSIA 4YYCA 3DERA 2OZ3A 2A6LA 3SCQA 2NUXA 2CKSA 3N2TA 3E6EA 4MY1A 2E5DA 4PB5A 1UR4A 4JTIA 4IJCA 5K4XA 3W2LA 3L4ZA 4ZSUA 1VFSA 5CJNA 2PLMA 2W6RA 4QR6A 4QE5A 4ZOEA 2PZ0A 4WIWA 1UPMB 3IARA 4LCSA 3GIYA 1BF6A 4UTMA 3QZAA 4ERAA 4QLJA 2C0HA 3F03K 2F6XA 3H7RA 2HE5A 1W56A 7REQA 2IMRA 3VK5A 5HANA 1OCBA 2D3LA 4ML4A 4MTVA 3OVRA 4WGXA 3KS5A 1IT8A 2QDDA 3AALA 2YL6A 5U4NA 5D8WA 3UWVA 2G3IA 4QDWA 1XGZA 4NYYA 2YBVA 4K7YA 1SVDA 2VR5A 3LM3A 4I3GA 4LVAA 1OWQA 1SQ7A 1KBBA 2PA6A 2Y63A 3GUWA 6PTDA 4G7EA 3PZGA 4UTTA 4HNVA 4ZGYA 3RHGA 1RXOB 4D6EA 1Q66A 1BD0A 1QI4A 2FJUB 1K9FA 2OB3A 3SRFA 3JR2A 4K38A 4ML9A 4WXYA 1M5WA 2DY3A 1OFBA 3W7IA 1RD6A 3ZSSA 3OOQA 1Q6GA 5CG0A 1VHCA 1WKYA 4WKFA 4DWSC 3NQCA 4S23A 3UWWA 2V2CA 4GPNA 3W74A 4IMCA 3NQDA 2VMFA 3TOYA 3WD0A 1P0DA 3QV6A 4H00A 4PB4A 3R58A 3WF3A 3AC0A 2NQZA 1R3QA 4UIOA 3SCTA 3TV8A 1TJ0A 3W53A 4CNTA 1RVKA 4A2RA 4F0RA 2C13A 5DBTA 4P61A 5EGRA 2QMJA 2PU0A 3ABXA 2YL9A 4JYEA 5BCAA 3I7SA 1R9YA 3GH5A 5F2MA 1HKWA 4CLMA 3NM1A 5CLTA 3UA4A 3T42A 4F79A 6XIMA 2NWSA 4XV0A 2FHBA 1US0A 4O12A 1UIOA 1XINA 2OG9A 4C1NB 3IK4A 3R0DA 5HMSA 1RCQA 1HF6A 3N34A 4MM1A 1UR0A 2CLPA 3H8AA 3P61A 2CWXA 3CH9A 3M0ZA 1GQLA 4GUIA 2YPIA 3ZVHB 5AYXA 1E55A 3QOKA 3OTRA 4L65A 4PEKA 1EZWA 2J6XA 3CHEA 4B5NA 5C9WA 1GHSA 3OVGA 4PCPA 3ME3A 8XIAA 1KCZA 1RK6A 4P7OA 3C56A 2J25A 3N13A 1Q6QA 1P0NA 4FP1A 4F48A 4OUIA 2A3LA 3QQWA 1MXSA 3SCPA 1KM4A 1UIPA 1E15A 1V93A 1P0KA 2Q3OA 3IJDA 3B8UA 1XYMA 4WSHA 1K03A 2YJQA 4Q32A 4D72A 4O57A 3WIJA 3PZUA 4O1FA 3VIMA 1A5CA 1XJBA 3EA3A 3QRHA 4KWVA 2QHAA 2V82A 3OJGA 4GQBA 2HPMA 3UEQA 3WK0A 1F7BA 3KXQA 1AZ1A 5HPOA 3W1UA 4HPNA 5A8PA 1UQZA 5AZ0A 3NQEA 1W17A 4LALA 3MYPA 3VE7A 1A80A 2V8ZA 2O56A 1XIGA 5HWJA 2R6OA 3RO6A 1UH3A 1X98A 1QHZA 1VFUA 1LROA 1WXJA 1LT8A 1H09A 4KGLA 5CPQA 1UC5A 4AF0B 1Z48A 3B8VA 3LB0A 2WJEA 2QS8A 1DWFM 4YHEA 4O11A 4QXIA 2ZWYA 3WJSA 2F84A 5FEPA 4QP0A 1AL7A 2B81A 2A7NA 1A5LC 5FAGA 4QE4A 5AYBA 3W24A 4BQ4A 1V8EA 1UBPC 2H3DA 3VKAA 3W88A 1RR2A 2PFHA 4JXCA 3WMCA 1TELA 4P7NA 1ZGDA 3BW3A 5GNZA 3BGGA 3ONCA 3I3DA 1C29A 2TPSA 2FTWA 4ZFMA 3S9IA 3WENA 3GIQA 3PBMA 1W3JA 1MRAA 4IQEA 4EAMA 1NJJA 3LYEA 1X8FA 5CC3A 2ZIDA 3BPWA 3MUAA 4Q7NA 4FNTA 3SW6A 5F4SA 4JTFA 3I6EA 4RL3A 2WSQA 4LUIA 3IIXA 3CMFA 4B5UA 4HOWA 2PDXA 2TODA 4MOZA 3ZXWA 2PU1A 1WPCA 3ITGA 2NX1A 1ODZA 3BZJA 4ZEPA 4OVXA 5BOOA 3A13A 4FEZA 4LUJA 2E68A 1QK2A 1VC4A 4JN8A 5K2ZA 1FFRA 3LMZA 3TYBA 1DP0A 3KLLA 1PDZA 4IP7A 4N6FA 1DWAM 1N2VA 4PRRA 2J7DA 3PN8A 3L5AA 1REQB 4KT2A 1LL4A 4I7WA 3WQDA 1JCTA 1EEXA 1IQ8A 4AWTA 4C6PA 1MUWA 1UMYA 3PFMA 1HJXA 2EXOA 5FIPA 2IW0A 5E0CA 5AVNA 1J6PA 2DZWA 4X9YA 2NT1A 3T05A 1RH9A 3SCRA 4GKLA 2XZ9A 3IV3A 5F4XA 2MUCA 2E67A 3GTXA 1VYPX 1BYCA 2Y61A 4JEJA 4G7EB 1AQFA 1EWDA 1VEMA 3DX5A 3MO7A 3YPIA 1QNSA 3UJRA 3BSMA 1GVSA 1EGZA 1JD7A 1NFPA 2VENA 5LA2A 1VJSA 4LBUA 4L7ZA 1FHUA 2EF9A 4JYFA 4HT3A 2QF7A 5GJNA 4B15A 2WSYA 3ITOA 2HROA 4GJJA 3H2OA 5CGMA 5FF0A 1VENA 2GQ3A 2ZC8A 3ZIZA 1FDYA 3JRKA 3N2CA 2Y8UA 1AMYA 1RP9A 4DJDD 3R10A 2OWWA 2W63A 5AHLA 3LLDA 3EOEA 3CMJA 5DF0A 3R11A 2FIQA 3EX4A 3LBMA 4MUPA 3PWIA 4S2CA 1O4UA 4W8BA 2WWCA 3UG4A 2PDFA 2XG9A 2JGYA 2ZRWA 1NIUA 4JTEA