1F6MA

Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
320
structure length
320
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSASATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
total genus 95
structure length 320
sequence length 320
chains with identical sequence B, E, F
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f6mA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f6mA02
1DNCA 4A79A 2BCGG 2WPFA 4KX6A 2B9YA 3URHA 3P4SA 1TDEA 3F8RA 2GR1A 3C4NA 1PJ5A 3GD3A 2CFYA 3ATQA 3NLCA 3RP6A 2C7GA 2OLOA 1PBBA 3QVPA 4OCGA 3DJEA 1BZLA 3EAOA 1BGNA 2RABA 1O5WA 1TYPA 2BK4A 2Z5YA 1BF3A 3M13A 1TDNA 1TDFA 4FDCB 3IF9A 1S3EA 2YG6A 2VVLG 2BK5A 3UKPA 2C72A 2CDUA 2YG7A 3AE8A 4U8JA 4EIQA 1OJDA 4A6NA 4UDQA 1PJ6A 3HZLA 3KKJA 4H4PA 2E1MA 3NGCX 2YG5A 3AEBA 4OVIA 5U63A 4CCQA 2R0PA 3CNPA 3QSEA 4NTDA 3G5QA 3DJDA 1HYUA 3KPFA 2WDVA 4Y4LA 1GRHA 1JNZA 2YLTA 2EQ6A 5KVHA 2WETA 5EB5A 1ZX9A 2C73A 2BA9A 2Z5XA 2VOUA 1IUTA 2TPRA 4YKFA 1ZY8A 2VRMA 4IVMB 1ELIA 2GEWA 5EBKA 1EL9A 3AE5A 2VZ2A 4LU6A 5KWFA 3AE7A 2PYXA 2BC1A 4ZN0A 1QLBA 3KLJA 1IUWA 5EOWA 2YG3A 3REDA 3ICSA 1DJQA 4U8LA 2A87A 2FBWA 3P9UA 1DXLA 3B6DA 3CNJA 1JOAA 1NHRA 3D8XA 1TDKA 2YVGA 1B37A 1IUUA 4FK1A 3QFAA 4Z2RA 3QSSA 3DJJA 2UZZA 2VQ7A 1K4QA 1NAAA 2FJBA 2O9ZA 3NHOX 5BUKA 4CNJA 4OPTA 1RP0A 2GMHA 3DA1A 3BI5A 3NT6A 2BS4A 4H50A 2FJAA 3P4PA 2XVFA 4EMJA 4BK3A 4U8IA 2IVDA 2BYBA 1K0JA 4YTMA 2EQ8A 3FIMB 5KXJA 1LVLA 1H81A 3BI4A 3GWFA 2WOWA 1L0VA 2ARDA 4X9MA 4EIPA 1E1NA 3ALMA 1GETA 2XFPA 4CRTA 1E39A 1OJ9A 1CC2A 3VRBA 4ICYA 1BKWA 3CGDA 2OA1A 4IA5A 4DSGA 2YQUA 4A9WA 1Q9IA 4O5UA 3M12A 4UDRA 2XVEA 4CY8A 1ZOVA 2F5ZA 4USQA 5LV9A 2BXRA 4AT2A 4U8KA 3RP7A 3SFEA 3NYCA 4GDPA 3D1CA 5FS6A 1H82A 3KD9A 5FS8A 4Z43A 1E1LA 3FBSA 4FK1C 3CN8A 5HHFA 4Y4MA 3UKQA 2WPCA 3NN0X 3H8IA 3JSKA 2RGOA 1LQUA 2WP9A 2YVJA 3FPZA 2C67A 3AEFA 1D7YA 3H4KA 2Q0LA 4FX9A 3UOZA 4DSHA 4J36A 4OPGA 2BXSA 2YAUA 2GR0A 1Y0PA 1FCDA 4K22A 4C3XA 1P2EA 3DH9A 4APNA 3AEAA 5IPYA 2YLZA 3RNMA 3FG2P 4BJYA 4JDRA 4BJZA 1PS9A 1F8RA 2BCPA 1LV0A 2GMJA 2X50A 3P4RA 2YWLA 3K7QX 3AYJA 4RG4A 2GQWA 1E7PA 4AP1A 1D7LA 3VR8A 4YT0A 2OLNA 3AE1A 3AECA 2R45A 2E4GA 2QA1A 2GR2A 1IUVA 3AE6A 3ABVA 3GRSA 3CGCA 4B64A 4U8PA 2WU5A 3NN6X 1H83A 1MXTA 3AYLA 1S2YA 4TLZA 3ICRA 3LXDA 1REOA 3L1RA 1YQ4A 5HXIA 3GDPA 3GYIA 4UP3A 4A6NB 4CY6A 2QAEA 4EM4A 3UCLA 1L9EA 2X8CA 1YQ3A 4GRTA 4NTEA 4U8NA 4CBQA 1KSSA 4TM1A 4WCTA 4D03A 4B69A 2V61A 4H4SA 1VG9A 4EMIA 2H89A 2GQFA 3I3LA 4PAAA 4BURA 1B5QA 1JNRA 2YLSA 3GDNA 5BULA 1D5TA 2C3DA 3IHMA 1DJNA 2GAHB 4H4YA 3AD9B 2AQJA 4XXGA 1E1MA 4YTPA 3R9UA 1QO8A 3QFBA 3UTGA 1GV4A 4GR1A 4BK1A 5M10A 1N4UA 1NG3A 1SEZA 4NZHA 1O94A 4J33A 3GWDA 3GSIA 2Q7VA 1PN0A 2R46A 2WEUA 4K2XA 3EF6A 3NTAA 3NRNA 3K7MX 1KSUA 2VVMA 2A8XA 3V3OA 4U2SA 4YSHA 3B3RA 2YR5A 4M52A 4N9XA 2XFUA 2XLUA 1ZMCA 3ADAB 2BACA 3G5RA 5ER0A 2NVKX 2YG4A 2V6OA 4H4WA 5M0ZA 4Z2UA 3GYJA 1N4WA 1YQZA 4JY3A 4D04A 2CULA 5FS9A 3NK0X 1M64A 4J56A 4H4XA 5GRTA 3COXA 4H4RA 4ZCCA 4C74A 2XYOA 4YSZA 2XFOA 3GMBA 4YWOA 3ICTA 2X99A 3AEGA 4Z44A 1JEHA 1NDAA 5TR3A 3BNUA 4BV6A 4ADWA 1YKJA 4AP3A 5GSNA 3BI2A 4U2LA 5DBJA 4IVOB 1KNRA 2BS3A 5FMHA 4C5OA 3LOVA 3FMWA 4YXDA 2JB1A 3UOXA 4GCMA 1IJHA 1F8WA 2FJEA 2GF3A 4GDEA 1OJCA 5HY5A 3QJ4A 1ZK7A 3UKHA 2HQMA 3ITJA 4YTNA 1NHPA 1XDIA 2JAEA 2WP5A 4A5LA 5EB4A 1S2QA 4P9SA 5J60A 3ISHA 2WDRA 4NEVA 3M0OA 3S5WA 2XLTA 3AE9A 2VRLA 3DJGX 1CF3A 1LPFA 3BHFA 1P2HA 2B9XA 4J34A 1GRBA 1GREA 3NTDA 3AE4A 4JNAA 3VRAA 3DK4A 5IQ4A 3DGZA 2WBAA 3IWAA 3UKKA 2XDOA 1JU2A 1VRQB 4DGKA 1EL7A 3CGBA 4REKA 4B68A 4YSYA 1ZKQA 4OPUA 2EQ7A 3EPTA 3UKAA 5BRTA 2V60A 1GRFA 2GH5A 1GEUA 3GRTA 1GRTA 3P1WA 1K0LA 1KFYA 1PBCA 3CTYA 3UOVA 1PJ7A 1H86A 2WHDA 3S61A 2X8HA 2GRTA 4C77A 3K30A 3LZXA 2YR6A 1GXFA 3NYEA 4TLXA 3OC4A 4YSXA 5U1OA 4A7AA 2B76A 1H7WA 2JB3A 3NG7X 2RGJA 3LB8A 1GERA 1N1PA 2C65A 1D4CA 1GTHA 1Z6LA 1ZP0A 2EQ9A 3PO7A 1EBDA 2A89A 2BK3A 2X3NA 3KU9A 1F8SA 4H7UA 3CIRA 2IVEA 3AWIA 2ZZ0A 5J7XA 1H84A 1ZDLA 2R0CA 3SGLA 1BWCA 4EMWA 5JCLA 3AEEA 3AE3A 3VRDB 1YY5A 4ZCDA 3DMEA 3NYFA 3LADA 3L8KA 4H2RA 3F8PA 1Y56B 4UDPA 4B65A 2GAGB 4X9NA 1GTEA 1L9CA 2VQBA 2GVCA 2E5VA 4OPCA 1LTXR 1O95A 4B67A 5KRQA 3UOYA 1F3PA 1GSNA 1GALA 3P4QA 4H2QA 3VR9A 1DOEA 2ZBWA 2X8GA 1PBEA 5FS7A 1ONFA 3ZYXA 2WDQA 2I0ZA 1GESA 2DKIA 2NPXA 4H4TA 4XWRA 4B63A 1CJ4A 2XLRA 3QSMA 1VDCA 1FOHA 1PBDA 2H88A 5C2TA 4Z2TA 4DNAA 5HYMA 1ZMDA 2DKHA 1GRGA 1CJ3A 2XFQA 4OPDA 1FECA 4CNKA 1D4DA 2WS3A 2WESA 4B66A 3IC9A 1ZOYA 5CKUA 2YR4A 1PBFA 2WOVA 4PABA 5JCNA 1OJAA 1W4XA 2YLWA 3DK9A 4H4QA 4J31A 4Y4NA 4B1BA 2WPEA 2JB2A 4EQRA 4JQ9A 1UKVG 1Y56A 1GPEA 1H6VA 3NK1X 3UTEA 3G5SA 1TRBA 1AOGA 3H8LA 1PXBA 4H4UA 4H2PA 3KVEA 4HB9A 1RYIA 4TM3A 3VQRA 4K5SA 3GMCA 2QCUA 4O5QA 5JCMA 4MJWA 1VG0A 3AE2A 4C3YA 2JK6A 1Q1RA 1GNDA 3AYIA 2YLRA 4HA6A 1FEAA 3NIXA 1MO9A 3AD7B 4A65A 2JKCA 2W0HA 4EQWA 2ZZBA 4Z25A 2YLXA 2C64A 3AEDA 3CNDA 2WQYA 2ZZCA 2XVIA 1TYTA 3CGEA 2QA2A 1NHQA 2AAQA 3WE0A 3CPJG 2YVFA 2B9WA 4GUVA 2V3AA 1NG4A 1PHHA 1NPXA 3EANA 1DOCA 2WP6A 1CHUA 1H7XA 4K8DA 1PXAA 2Q6UA 4J2WA 5KOXA 1KDGA 5BVAA 4U8MA 1KNPA 1X31B 3KA7A 3QVRA 4U2TA 4Z24A 2OAMA 1OJTA 3NK2X 4OPIA 2BC0A 3LZWA 1BGJA 2BS2A 2R9ZA 1E6EA 4U8OA 2XLSA 3E1TA 1NEKA 4AOSA 1XANA 1L9DA 2AR8A 1DODA 3LJPA 4GF7A 2GR3A 3UP4A 1JRYA 3AD8B 3I6DA 5JCKA 1MOKA 3UKFA 2PHHA 4H4ZA 1GRAA 2CVJA 1EL5A 3NNEA 1Q1WA 4LA1A 2C70A 2XCGA 3AXBA 1LJ1A 1CJ2A 4WX1A 4AOXA 2XFNA 5CQFA 4YKGA 1IUSA 2YM2A 2RGHA 3ZDNA 4BK2A 1CBOA 2FJDA 1IUXA 3C4AA 5IQ1A 3ALJA 4CCRA 1NHSA 1CJCA 3RHAA 1PXCA 4ECHA 4NEWA 4USRA 5L46A 2APGA 2C3CA 3RP8A 4Z26A 3DGHA 5KVIA 2Y6RA 4NTCA 3PS9A 3AB1A 1FEBA 3CPIG 4LIIA 1PDHA 3NKSA 3UP5A 2XLPA 3BHKA 4TM0A 2WOIA 2GB0A 4EM3A 4JN9A 5JCIA 1GT8A 2B7SA 4H2NA 5U25A 3SM8A 1E1KA 3UTFA 3V3NA 4EQSA 4IV9A 4KPRA 1XHCA 4RSLA 4I58A 2WU2A 2XVHA 3CNTA 4AT0A 4J57A 3CNSA 1XPQA 1S3BA 3SFDA 2C75A 1B8SA 2C76A 2OALA 2Q0KA 4IA6A 1V59A 4JY2A 4TM4A 2XVJA 4XWZA 4EQXA 1FL2A 2TMDA 2R0GA 3T37A 3K7TA 3Q9TA 4A99A 1JRZA 1TDOA 2J3NA 4RG3A 1GOSA 2VVLA 3GD4A 4H4VA 3ALLA 1VQWA 2Y6QA 1M6IA 1D4EA 4K5RA 1K0IA 2ACZA 1CC4A 1N4VA 1CC6A 4I59A 4JNQA 3F8DA 5KOWA 1NENA 2IIDA 4K7ZA 2YM1A 3OZ2A 1QJDA 4X4JA 2C66A 5C3JA 2R4EA 2V3BA 4OPLA 1EL8A 1DOBA 1F6MA 2V5ZA 2JBVA 1B4VA 3C96A 3II4A 3Q6JA 1LQTA 3CPHG 3BNMA 1COYA 3PVCA 1KF6A 3NH3X 1JRXA 2R4JA 3IHGA 2BABA 3O0HA 3SQPA 3UKLA 3DK8A 3ATRA 4E0VA 1CL0A 3V76A 1RSGA 3UTHA 2B7RA 2GV8A
chains in the Genus database with same CATH superfamily
1DNCA 4A79A 2BCGG 2WPFA 4KX6A 4II3A 2B9YA 3URHA 3P4SA 1TDEA 3F8RA 2GR1A 3C4NA 1PJ5A 3GD3A 2CFYA 3ATQA 3NLCA 3RP6A 2C7GA 2OLOA 1PBBA 3QVPA 4OCGA 3DJEA 1BZLA 3EAOA 1BGNA 2RABA 1O5WA 1TYPA 2BK4A 2Z5YA 1BF3A 3M13A 1TDNA 1TDFA 4FDCB 3IF9A 1S3EA 2YG6A 2VVLG 2BK5A 3CMMA 3UKPA 2C72A 2CDUA 2YG7A 3AE8A 4U8JA 4EIQA 1OJDA 4A6NA 4UDQA 1PJ6A 3HZLA 3KKJA 4H4PA 2E1MA 3NGCX 2YG5A 3AEBA 4OVIA 5U63A 4CCQA 2R0PA 3CNPA 3QSEA 4NTDA 5KMRA 3G5QA 3DJDA 1HYUA 3KPFA 2WDVA 4Y4LA 1GRHA 1JNZA 2YLTA 2EQ6A 5KVHA 2WETA 5EB5A 1ZX9A 2C73A 2BA9A 2Z5XA 4G6HA 2VOUA 1IUTA 2TPRA 4YKFA 1ZY8A 2VRMA 4IVMB 1ELIA 2GEWA 5EBKA 1EL9A 3AE5A 2VZ2A 4LU6A 5KWFA 3AE7A 2PYXA 2BC1A 4ZN0A 1QLBA 3KLJA 1IUWA 5EOWA 2YG3A 3REDA 3ICSA 1DJQA 4U8LA 2A87A 2FBWA 3P9UA 1DXLA 3B6DA 3CNJA 1JOAA 1NHRA 3D8XA 1TDKA 2YVGA 1B37A 1IUUA 4FK1A 2C4CA 3QFAA 4Z2RA 3QSSA 3DJJA 2UZZA 2VQ7A 1K4QA 1NAAA 2FJBA 2O9ZA 3NHOX 5BUKA 4CNJA 4OPTA 1RP0A 2GMHA 3DA1A 3BI5A 3NT6A 4GAVA 2BS4A 4H50A 2FJAA 3P4PA 2XVFA 4EMJA 4BK3A 4U8IA 2IVDA 2BYBA 1K0JA 4YTMA 2EQ8A 3FIMB 5KXJA 1LVLA 1H81A 3BI4A 3GWFA 2WOWA 1L0VA 2ARDA 4X9MA 4EIPA 1E1NA 3ALMA 1GETA 2XFPA 4CRTA 1E39A 1OJ9A 1CC2A 3VRBA 4ICYA 1BKWA 3CGDA 2OA1A 4IA5A 4DSGA 2YQUA 4A9WA 1Q9IA 4O5UA 3M12A 4UDRA 2XVEA 4CY8A 1ZOVA 2F5ZA 4USQA 4NWZA 5LV9A 2BXRA 4AT2A 4U8KA 3T2KA 3RP7A 3SFEA 3NYCA 3SY4A 4GDPA 3D1CA 5FS6A 1H82A 3KD9A 5FS8A 4Z43A 1E1LA 3FBSA 4FK1C 3CN8A 5HHFA 4Y4MA 3UKQA 2WPCA 3NN0X 3H8IA 3JSKA 2RGOA 1LQUA 2WP9A 2YVJA 3FPZA 2C67A 3AEFA 1D7YA 3H4KA 2Q0LA 4FX9A 3UOZA 4DSHA 4J36A 4OPGA 2BXSA 2YAUA 2GR0A 1Y0PA 1FCDA 3T0KA 4K22A 4C3XA 1P2EA 3DH9A 4APNA 3AEAA 5IPYA 2YLZA 3RNMA 3FG2P 4BJYA 4JDRA 4BJZA 1PS9A 1F8RA 2BCPA 1LV0A 2GMJA 2X50A 3P4RA 2YWLA 3K7QX 3AYJA 4RG4A 2GQWA 1E7PA 4AP1A 1D7LA 3VR8A 4YT0A 2OLNA 3AE1A 3AECA 2R45A 2E4GA 2QA1A 2GR2A 1IUVA 3AE6A 3ABVA 3GRSA 3CGCA 4B64A 5JCIA 4U8PA 2WU5A 3NN6X 1H83A 1MXTA 3AYLA 1S2YA 4TLZA 3ICRA 3LXDA 1REOA 3L1RA 1YQ4A 3GYXA 5HXIA 3GDPA 3GYIA 4UP3A 4A6NB 4CY6A 5KMSA 2QAEA 4EM4A 3UCLA 1L9EA 2X8CA 1YQ3A 4GRTA 4NTEA 4U8NA 4CBQA 1KSSA 4TM1A 4WCTA 4D03A 4B69A 2V61A 4H4SA 1VG9A 4EMIA 2H89A 2GQFA 3I3LA 4PAAA 4BURA 1B5QA 1JNRA 2YLSA 3GDNA 5BULA 1D5TA 2C3DA 4NNJA 3IHMA 1DJNA 2GAHB 4H4YA 3AD9B 2AQJA 4XXGA 1E1MA 4YTPA 3R9UA 1QO8A 3QFBA 3UTGA 1GV4A 3T14A 4GR1A 4BK1A 5M10A 1N4UA 1NG3A 1SEZA 4NZHA 1O94A 4J33A 3GWDA 3GSIA 2Q7VA 1PN0A 2R46A 2WEUA 4K2XA 3EF6A 3NTAA 3NRNA 3K7MX 1KSUA 2VVMA 2A8XA 3V3OA 4U2SA 4YSHA 3B3RA 2YR5A 4M52A 4N9XA 2XFUA 2XLUA 1ZMCA 3ADAB 2BACA 3G5RA 5ER0A 2NVKX 2YG4A 2V6OA 4H4WA 5M0ZA 4Z2UA 3GYJA 1N4WA 1YQZA 4JY3A 4D04A 2CULA 5FS9A 3NK0X 1M64A 4J56A 4H4XA 3SZWA 5GRTA 3COXA 4H4RA 4ZCCA 4C74A 2XYOA 4YSZA 2XFOA 3GMBA 4YWOA 3ICTA 2X99A 3AEGA 4Z44A 1JEHA 1NDAA 5TR3A 3BNUA 3SZFA 4BV6A 4ADWA 1YKJA 4AP3A 5GSNA 3BI2A 5KMQA 4U2LA 5DBJA 4IVOB 1KNRA 2BS3A 5FMHA 4C5OA 3LOVA 3FMWA 4YXDA 2JB1A 3UOXA 4GCMA 1IJHA 1F8WA 2FJEA 2GF3A 4GDEA 1OJCA 5HY5A 3QJ4A 1ZK7A 3UKHA 2HQMA 3ITJA 4YTNA 1NHPA 1XDIA 2JAEA 2WP5A 4A5LA 5EB4A 4GAPA 1S2QA 4P9SA 5J60A 3ISHA 2WDRA 4NEVA 3M0OA 3S5WA 2XLTA 3AE9A 2VRLA 3DJGX 1CF3A 1LPFA 3BHFA 3T2ZA 1P2HA 2B9XA 4J34A 1GRBA 1GREA 3NTDA 3AE4A 4JNAA 3VRAA 3DK4A 5IQ4A 3DGZA 2WBAA 3IWAA 3UKKA 2XDOA 1JU2A 1VRQB 4DGKA 1EL7A 3CGBA 4REKA 4B68A 4YSYA 1ZKQA 4OPUA 2EQ7A 3EPTA 3UKAA 5BRTA 2V60A 1GRFA 2GH5A 1GEUA 3GRTA 1GRTA 3P1WA 1K0LA 1KFYA 1PBCA 3CTYA 3UOVA 1PJ7A 1H86A 2WHDA 3S61A 2X8HA 2GRTA 4C77A 3K30A 3LZXA 2YR6A 1GXFA 3NYEA 4II2A 4TLXA 3OC4A 4YSXA 5U1OA 4A7AA 2B76A 1H7WA 2JB3A 3NG7X 2RGJA 3HYXA 1GERA 1N1PA 3LB8A 2C65A 1D4CA 1GTHA 1Z6LA 1ZP0A 2EQ9A 3PO7A 1EBDA 2A89A 2BK3A 2X3NA 3KU9A 1F8SA 4H7UA 3CIRA 2IVEA 3AWIA 2ZZ0A 5J7XA 1H84A 1ZDLA 2R0CA 3SGLA 1BWCA 4EMWA 5JCLA 3AEEA 3AE3A 3VRDB 1YY5A 4ZCDA 3DMEA 4G73A 3NYFA 3LADA 3HYVA 3L8KA 4H2RA 3T2YA 3F8PA 1Y56B 4UDPA 4B65A 2GAGB 4X9NA 1GTEA 1L9CA 2VQBA 2GVCA 2E5VA 4OPCA 1LTXR 1O95A 4B67A 5KRQA 3UOYA 1F3PA 1GSNA 1GALA 3P4QA 4H2QA 3VR9A 1DOEA 3SX6A 2ZBWA 2X8GA 1PBEA 5FS7A 1ONFA 3ZYXA 2WDQA 2I0ZA 1GESA 2DKIA 2NPXA 4H4TA 4XWRA 4B63A 1CJ4A 2XLRA 3QSMA 1VDCA 1FOHA 1PBDA 2H88A 5C2TA 4Z2TA 4DNAA 5HYMA 1ZMDA 2DKHA 1GRGA 1CJ3A 2XFQA 4OPDA 1FECA 4CNKA 1D4DA 2WS3A 2WESA 4B66A 3IC9A 4G6GA 1ZOYA 5CKUA 2YR4A 1PBFA 2WOVA 4PABA 5JCNA 1OJAA 1W4XA 2YLWA 3DK9A 4H4QA 4J31A 3HYWA 4Y4NA 4B1BA 2WPEA 2JB2A 4EQRA 4JQ9A 1UKVG 1Y56A 1GPEA 1H6VA 3NK1X 3UTEA 3G5SA 1TRBA 1AOGA 3H8LA 1PXBA 4H4UA 4H2PA 3KVEA 4HB9A 1RYIA 4TM3A 3SXIA 3VQRA 4K5SA 3GMCA 2QCUA 4O5QA 5JCMA 4MJWA 1VG0A 3AE2A 3SZ0A 4C3YA 2JK6A 1Q1RA 1GNDA 3AYIA 2YLRA 4HA6A 1FEAA 3NIXA 1MO9A 2BRYA 3AD7B 4G74A 4A65A 2JKCA 2W0HA 4EQWA 2ZZBA 4Z25A 2YLXA 2C64A 3AEDA 3CNDA 2WQYA 2ZZCA 2XVIA 1TYTA 3CGEA 2QA2A 1NHQA 2AAQA 3WE0A 3CPJG 2YVFA 2B9WA 4GUVA 2V3AA 1NG4A 1PHHA 1NPXA 3EANA 3SZCA 4G9KA 1DOCA 2WP6A 1CHUA 1H7XA 4K8DA 1PXAA 2Q6UA 4J2WA 5KOXA 1KDGA 5BVAA 4U8MA 1KNPA 1X31B 3KA7A 3QVRA 4U2TA 4Z24A 2OAMA 1OJTA 3NK2X 4OPIA 2BC0A 3LZWA 1BGJA 2BS2A 2R9ZA 1E6EA 4U8OA 2XLSA 3E1TA 1NEKA 4AOSA 1XANA 5KMPA 1L9DA 2AR8A 1DODA 3LJPA 4GF7A 2GR3A 3UP4A 1JRYA 3AD8B 3I6DA 5JCKA 1MOKA 3UKFA 2PHHA 4H4ZA 1GRAA 2CVJA 5KNLA 1EL5A 3NNEA 1Q1WA 4LA1A 2C70A 2XCGA 3AXBA 1LJ1A 1CJ2A 4WX1A 4AOXA 2XFNA 3T31A 5CQFA 4YKGA 1IUSA 2YM2A 2RGHA 3ZDNA 4BK2A 1CBOA 2FJDA 1IUXA 3C4AA 5IQ1A 3ALJA 4CCRA 1NHSA 1CJCA 3RHAA 1PXCA 4ECHA 4NEWA 4USRA 5L46A 2APGA 2C3CA 3RP8A 4Z26A 3DGHA 5KVIA 2Y6RA 4NTCA 3PS9A 3AB1A 1FEBA 3CPIG 4LIIA 1PDHA 3NKSA 3UP5A 2XLPA 3BHKA 4TM0A 2WOIA 2GB0A 4EM3A 4JN9A 3KPKA 1GT8A 2B7SA 4H2NA 5U25A 3SM8A 1E1KA 3UTFA 3V3NA 4EQSA 4IV9A 4KPRA 1XHCA 4RSLA 4I58A 2WU2A 2XVHA 3CNTA 4AT0A 4J57A 3CNSA 1XPQA 1S3BA 3SFDA 2C75A 1B8SA 2C76A 2OALA 3SYIA 2Q0KA 4IA6A 1V59A 4JY2A 4TM4A 2XVJA 4XWZA 4EQXA 1FL2A 2TMDA 2R0GA 3T37A 3K7TA 3Q9TA 4A99A 1JRZA 1TDOA 2J3NA 4RG3A 1GOSA 2VVLA 3GD4A 4H4VA 3ALLA 1VQWA 2Y6QA 1M6IA 1D4EA 4K5RA 1K0IA 2ACZA 1CC4A 1N4VA 1CC6A 4I59A 4JNQA 3F8DA 5KOWA 1NENA 2IIDA 4K7ZA 2BRAA 2YM1A 3OZ2A 1QJDA 4X4JA 2C66A 5C3JA 2R4EA 2V3BA 4OPLA 1EL8A 1DOBA 1F6MA 2V5ZA 2JBVA 1B4VA 3C96A 3II4A 3Q6JA 1LQTA 3CPHG 3BNMA 1COYA 3PVCA 1KF6A 3NH3X 1JRXA 2R4JA 3IHGA 2BABA 3O0HA 3SQPA 3UKLA 3DK8A 3ATRA 4E0VA 1CL0A 3V76A 1RSGA 3UTHA 2B7RA 2GV8A
chains in the Genus database with same CATH topology
1DNCA 4A79A 2BCGG 2WPFA 4KX6A 4II3A 2B9YA 3URHA 3P4SA 1TDEA 3F8RA 2GR1A 3C4NA 1PJ5A 3GD3A 2CFYA 3ATQA 3NLCA 3RP6A 2C7GA 2OLOA 1PBBA 3QVPA 4OCGA 3DJEA 1BZLA 3EAOA 1BGNA 2RABA 1O5WA 1TYPA 2BK4A 2Z5YA 1BF3A 3M13A 1TDNA 1TDFA 4FDCB 3IF9A 1S3EA 2YG6A 2VVLG 2BK5A 3CMMA 3UKPA 2C72A 2CDUA 2YG7A 3AE8A 4U8JA 4EIQA 1OJDA 4A6NA 4UDQA 1PJ6A 3HZLA 3KKJA 4H4PA 2E1MA 3NGCX 2YG5A 3AEBA 4OVIA 5U63A 4CCQA 2R0PA 3CNPA 3QSEA 4NTDA 5KMRA 3G5QA 3DJDA 1HYUA 3KPFA 2WDVA 4Y4LA 1GRHA 1JNZA 2YLTA 2EQ6A 5KVHA 2WETA 5EB5A 1ZX9A 2C73A 2BA9A 2Z5XA 4G6HA 2VOUA 1IUTA 2TPRA 4YKFA 1ZY8A 2VRMA 4IVMB 1ELIA 2GEWA 5EBKA 1EL9A 3AE5A 2VZ2A 4LU6A 5KWFA 3AE7A 2PYXA 2BC1A 4ZN0A 1QLBA 3KLJA 1IUWA 5EOWA 2YG3A 3REDA 3ICSA 1DJQA 4U8LA 2A87A 2FBWA 3P9UA 1DXLA 3B6DA 3CNJA 1JOAA 1NHRA 3D8XA 1TDKA 2YVGA 1B37A 1IUUA 4FK1A 2C4CA 3QFAA 4Z2RA 3QSSA 3DJJA 2UZZA 2VQ7A 1K4QA 1NAAA 2FJBA 2O9ZA 3NHOX 5BUKA 4CNJA 4OPTA 1RP0A 2GMHA 3DA1A 3BI5A 3NT6A 4GAVA 2BS4A 4H50A 2FJAA 3P4PA 2XVFA 4EMJA 4BK3A 4U8IA 2IVDA 2BYBA 1K0JA 4YTMA 2EQ8A 3FIMB 5KXJA 1LVLA 1H81A 3BI4A 3GWFA 2WOWA 1L0VA 2ARDA 4X9MA 4EIPA 1E1NA 3ALMA 1GETA 2XFPA 4CRTA 1E39A 1OJ9A 1CC2A 3VRBA 4ICYA 1BKWA 3CGDA 2OA1A 4IA5A 4DSGA 2YQUA 4A9WA 1Q9IA 4O5UA 3M12A 4UDRA 2XVEA 4CY8A 1ZOVA 2F5ZA 4USQA 4NWZA 5LV9A 2BXRA 4AT2A 4U8KA 3T2KA 3RP7A 3SFEA 3NYCA 3SY4A 4GDPA 3D1CA 5FS6A 1H82A 3KD9A 5FS8A 4Z43A 1E1LA 3FBSA 4FK1C 3CN8A 5HHFA 4Y4MA 3UKQA 2WPCA 3NN0X 3H8IA 3JSKA 2RGOA 1LQUA 2WP9A 2YVJA 3FPZA 2C67A 3AEFA 1D7YA 3H4KA 2Q0LA 4FX9A 3UOZA 4DSHA 4J36A 4OPGA 2BXSA 2YAUA 2GR0A 1Y0PA 1FCDA 3T0KA 4K22A 4C3XA 1P2EA 3DH9A 4APNA 3AEAA 5IPYA 2YLZA 3RNMA 3FG2P 4BJYA 4JDRA 4BJZA 1PS9A 1F8RA 2BCPA 1LV0A 2GMJA 2X50A 3P4RA 2YWLA 3K7QX 3AYJA 4RG4A 2GQWA 1E7PA 4AP1A 1D7LA 3VR8A 4YT0A 2OLNA 3AE1A 3AECA 2R45A 2E4GA 2QA1A 2GR2A 1IUVA 3AE6A 3ABVA 3GRSA 3CGCA 4B64A 5JCIA 4U8PA 2WU5A 3NN6X 1H83A 1MXTA 3AYLA 1S2YA 4TLZA 3ICRA 3LXDA 1REOA 3L1RA 1YQ4A 3GYXA 5HXIA 3GDPA 3GYIA 4UP3A 4A6NB 4CY6A 5KMSA 2QAEA 4EM4A 3UCLA 1L9EA 2X8CA 1YQ3A 4GRTA 4NTEA 4U8NA 4CBQA 1KSSA 4TM1A 4WCTA 4D03A 4B69A 2V61A 4H4SA 1VG9A 4EMIA 2H89A 2GQFA 3I3LA 4PAAA 4BURA 1B5QA 1JNRA 2YLSA 3GDNA 5BULA 1D5TA 2C3DA 4NNJA 3IHMA 1DJNA 2GAHB 4H4YA 3AD9B 2AQJA 4XXGA 1E1MA 4YTPA 3R9UA 1QO8A 3QFBA 3UTGA 1GV4A 3T14A 4GR1A 4BK1A 5M10A 1N4UA 1NG3A 1SEZA 4NZHA 1O94A 4J33A 3GWDA 3GSIA 2Q7VA 1PN0A 2R46A 2WEUA 4K2XA 3EF6A 3NTAA 3NRNA 3K7MX 1KSUA 2VVMA 2A8XA 3V3OA 4U2SA 4YSHA 3B3RA 2YR5A 4M52A 4N9XA 2XFUA 2XLUA 1ZMCA 3ADAB 2BACA 3G5RA 5ER0A 2NVKX 2YG4A 2V6OA 4H4WA 5M0ZA 4Z2UA 3GYJA 1N4WA 1YQZA 4JY3A 4D04A 2CULA 5FS9A 3NK0X 1M64A 4J56A 4H4XA 3SZWA 5GRTA 3COXA 4H4RA 4ZCCA 4C74A 2XYOA 4YSZA 2XFOA 3GMBA 4YWOA 3ICTA 2X99A 3AEGA 4Z44A 1JEHA 1NDAA 5TR3A 3BNUA 3SZFA 4BV6A 4ADWA 1YKJA 4AP3A 5GSNA 3BI2A 5KMQA 4U2LA 5DBJA 4IVOB 1KNRA 2BS3A 5FMHA 4C5OA 3LOVA 3FMWA 4YXDA 2JB1A 3UOXA 4GCMA 1IJHA 1F8WA 2FJEA 2GF3A 4GDEA 1OJCA 5HY5A 3QJ4A 1ZK7A 3UKHA 2HQMA 3ITJA 4YTNA 1NHPA 1XDIA 2JAEA 2WP5A 4A5LA 5EB4A 4GAPA 1S2QA 4P9SA 5J60A 3ISHA 2WDRA 4NEVA 3M0OA 3S5WA 2XLTA 3AE9A 2VRLA 3DJGX 1CF3A 1LPFA 3BHFA 3T2ZA 1P2HA 2B9XA 4J34A 1GRBA 1GREA 3NTDA 3AE4A 4JNAA 3VRAA 3DK4A 5IQ4A 3DGZA 2WBAA 3IWAA 3UKKA 2XDOA 1JU2A 1VRQB 4DGKA 1EL7A 3CGBA 4REKA 4B68A 4YSYA 1ZKQA 4OPUA 2EQ7A 3EPTA 3UKAA 5BRTA 2V60A 1GRFA 2GH5A 1GEUA 3GRTA 1GRTA 3P1WA 1K0LA 1KFYA 1PBCA 3CTYA 3UOVA 1PJ7A 1H86A 2WHDA 3S61A 2X8HA 2GRTA 4C77A 3K30A 3LZXA 2YR6A 1GXFA 3NYEA 4II2A 4TLXA 3OC4A 4YSXA 5U1OA 4A7AA 2B76A 1H7WA 2JB3A 3NG7X 2RGJA 3HYXA 1GERA 1N1PA 3LB8A 2C65A 1D4CA 1GTHA 1Z6LA 1ZP0A 2EQ9A 3PO7A 1EBDA 2A89A 2BK3A 2X3NA 3KU9A 1F8SA 4H7UA 3CIRA 2IVEA 3AWIA 2ZZ0A 5J7XA 1H84A 1ZDLA 2R0CA 3SGLA 1BWCA 4EMWA 5JCLA 3AEEA 3AE3A 3VRDB 1YY5A 4ZCDA 3DMEA 4G73A 3NYFA 3LADA 3HYVA 3L8KA 4H2RA 3T2YA 3F8PA 1Y56B 4UDPA 4B65A 2GAGB 4X9NA 1GTEA 1L9CA 2VQBA 2GVCA 2E5VA 4OPCA 1LTXR 1O95A 4B67A 5KRQA 3UOYA 1F3PA 1GSNA 1GALA 3P4QA 4H2QA 3VR9A 1DOEA 3SX6A 2ZBWA 2X8GA 1PBEA 5FS7A 1ONFA 3ZYXA 2WDQA 2I0ZA 1GESA 2DKIA 2NPXA 4H4TA 4XWRA 4B63A 1CJ4A 2XLRA 3QSMA 1VDCA 1FOHA 1PBDA 2H88A 5C2TA 4Z2TA 4DNAA 5HYMA 1ZMDA 2DKHA 1GRGA 1CJ3A 2XFQA 4OPDA 1FECA 4CNKA 1D4DA 2WS3A 2WESA 4B66A 3IC9A 4G6GA 1ZOYA 5CKUA 2YR4A 1PBFA 2WOVA 4PABA 5JCNA 1OJAA 1W4XA 2YLWA 3DK9A 4H4QA 4J31A 3HYWA 4Y4NA 4B1BA 2WPEA 2JB2A 4EQRA 4JQ9A 1UKVG 1Y56A 1GPEA 1H6VA 3NK1X 3UTEA 3G5SA 1TRBA 1AOGA 3H8LA 1PXBA 4H4UA 4H2PA 3KVEA 4HB9A 1RYIA 4TM3A 3SXIA 3VQRA 4K5SA 3GMCA 2QCUA 4O5QA 5JCMA 4MJWA 1VG0A 3AE2A 3SZ0A 4C3YA 2JK6A 1Q1RA 1GNDA 3AYIA 2YLRA 4HA6A 1FEAA 3NIXA 1MO9A 2BRYA 3AD7B 4G74A 4A65A 2JKCA 2W0HA 4EQWA 2ZZBA 4Z25A 2YLXA 2C64A 3AEDA 3CNDA 2WQYA 2ZZCA 2XVIA 1TYTA 3CGEA 2QA2A 1NHQA 2AAQA 3WE0A 3CPJG 2YVFA 2B9WA 4GUVA 2V3AA 1NG4A 1PHHA 1NPXA 3EANA 3SZCA 4G9KA 1DOCA 2WP6A 1CHUA 1H7XA 4K8DA 1PXAA 2Q6UA 4J2WA 5KOXA 1KDGA 5BVAA 4U8MA 1KNPA 1X31B 3KA7A 3QVRA 4U2TA 4Z24A 2OAMA 1OJTA 3NK2X 4OPIA 2BC0A 3LZWA 1BGJA 2BS2A 2R9ZA 1E6EA 4U8OA 2XLSA 3E1TA 1NEKA 4AOSA 1XANA 5KMPA 1L9DA 2AR8A 1DODA 3LJPA 4GF7A 2GR3A 3UP4A 1JRYA 3AD8B 3I6DA 5JCKA 1MOKA 3UKFA 2PHHA 4H4ZA 1GRAA 2CVJA 5KNLA 1EL5A 3NNEA 1Q1WA 4LA1A 2C70A 2XCGA 3AXBA 1LJ1A 1CJ2A 4WX1A 4AOXA 2XFNA 3T31A 5CQFA 4YKGA 1IUSA 2YM2A 2RGHA 3ZDNA 4BK2A 1CBOA 2FJDA 1IUXA 3C4AA 5IQ1A 3ALJA 4CCRA 1NHSA 1CJCA 3RHAA 1PXCA 4ECHA 4NEWA 4USRA 5L46A 2APGA 2C3CA 3RP8A 4Z26A 3DGHA 5KVIA 2Y6RA 4NTCA 3PS9A 3AB1A 1FEBA 3CPIG 4LIIA 1PDHA 3NKSA 3UP5A 2XLPA 3BHKA 4TM0A 2WOIA 2GB0A 4EM3A 4JN9A 3KPKA 1GT8A 2B7SA 4H2NA 5U25A 3SM8A 1E1KA 3UTFA 3V3NA 4EQSA 4IV9A 4KPRA 1XHCA 4RSLA 4I58A 2WU2A 2XVHA 3CNTA 4AT0A 4J57A 3CNSA 1XPQA 1S3BA 3SFDA 2C75A 1B8SA 2C76A 2OALA 3SYIA 2Q0KA 4IA6A 1V59A 4JY2A 4TM4A 2XVJA 4XWZA 4EQXA 1FL2A 2TMDA 2R0GA 3T37A 3K7TA 3Q9TA 4A99A 1JRZA 1TDOA 2J3NA 4RG3A 1GOSA 2VVLA 3GD4A 4H4VA 3ALLA 1VQWA 2Y6QA 1M6IA 1D4EA 4K5RA 1K0IA 2ACZA 1CC4A 1N4VA 1CC6A 4I59A 4JNQA 3F8DA 5KOWA 1NENA 2IIDA 4K7ZA 2BRAA 2YM1A 3OZ2A 1QJDA 4X4JA 2C66A 5C3JA 2R4EA 2V3BA 4OPLA 1EL8A 1DOBA 1F6MA 2V5ZA 2JBVA 1B4VA 3C96A 3II4A 3Q6JA 1LQTA 3CPHG 3BNMA 1COYA 3PVCA 1KF6A 3NH3X 1JRXA 2R4JA 3IHGA 2BABA 3O0HA 3SQPA 3UKLA 3DK8A 3ATRA 4E0VA 1CL0A 3V76A 1RSGA 3UTHA 2B7RA 2GV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DNC A;  4A79 A;  2BCG G;  2WPF A;  4KX6 A;  2B9Y A;  3URH A;  3P4S A;  1TDE A;  3F8R A;  2GR1 A;  3C4N A;  1PJ5 A;  3GD3 A;  2CFY A;  3ATQ A;  3NLC A;  3RP6 A;  2C7G A;  2OLO A;  1PBB A;  3QVP A;  4OCG A;  3DJE A;  1BZL A;  3EAO A;  1BGN A;  2RAB A;  1O5W A;  1TYP A;  2BK4 A;  2Z5Y A;  1BF3 A;  3M13 A;  1TDN A;  1TDF A;  4FDC B;  3IF9 A;  1S3E A;  2YG6 A;  2VVL G;  2BK5 A;  3UKP A;  2C72 A;  2CDU A;  2YG7 A;  3AE8 A;  4U8J A;  4EIQ A;  1OJD A;  4A6N A;  4UDQ A;  1PJ6 A;  3HZL A;  3KKJ A;  4H4P A;  2E1M A;  3NGC X;  2YG5 A;  3AEB A;  4OVI A;  5U63 A;  4CCQ A;  2R0P A;  3CNP A;  3QSE A;  4NTD A;  3G5Q A;  3DJD A;  1HYU A;  3KPF A;  2WDV A;  4Y4L A;  1GRH A;  1JNZ A;  2YLT A;  2EQ6 A;  5KVH A;  2WET A;  5EB5 A;  1ZX9 A;  2C73 A;  2BA9 A;  2Z5X A;  2VOU A;  1IUT A;  2TPR A;  4YKF A;  1ZY8 A;  2VRM A;  4IVM B;  1ELI A;  2GEW A;  5EBK A;  1EL9 A;  3AE5 A;  2VZ2 A;  4LU6 A;  5KWF A;  3AE7 A;  2PYX A;  2BC1 A;  4ZN0 A;  1QLB A;  3KLJ A;  1IUW A;  5EOW A;  2YG3 A;  3RED A;  3ICS A;  1DJQ A;  4U8L A;  2A87 A;  2FBW A;  3P9U A;  1DXL A;  3B6D A;  3CNJ A;  1JOA A;  1NHR A;  3D8X A;  1TDK A;  2YVG A;  1B37 A;  1IUU A;  4FK1 A;  3QFA A;  4Z2R A;  3QSS A;  3DJJ A;  2UZZ A;  2VQ7 A;  1K4Q A;  1NAA A;  2FJB A;  2O9Z A;  3NHO X;  5BUK A;  4CNJ A;  4OPT A;  1RP0 A;  2GMH A;  3DA1 A;  3BI5 A;  3NT6 A;  2BS4 A;  4H50 A;  2FJA A;  3P4P A;  2XVF A;  4EMJ A;  4BK3 A;  4U8I A;  2IVD A;  2BYB A;  1K0J A;  4YTM A;  2EQ8 A;  3FIM B;  5KXJ A;  1LVL A;  1H81 A;  3BI4 A;  3GWF A;  2WOW A;  1L0V A;  2ARD A;  4X9M A;  4EIP A;  1E1N A;  3ALM A;  1GET A;  2XFP A;  4CRT A;  1E39 A;  1OJ9 A;  1CC2 A;  3VRB A;  4ICY A;  1BKW A;  3CGD A;  2OA1 A;  4IA5 A;  4DSG A;  2YQU A;  4A9W A;  1Q9I A;  4O5U A;  3M12 A;  4UDR A;  2XVE A;  4CY8 A;  1ZOV A;  2F5Z A;  4USQ A;  5LV9 A;  2BXR A;  4AT2 A;  4U8K A;  3RP7 A;  3SFE A;  3NYC A;  4GDP A;  3D1C A;  5FS6 A;  1H82 A;  3KD9 A;  5FS8 A;  4Z43 A;  1E1L A;  3FBS A;  4FK1 C;  3CN8 A;  5HHF A;  4Y4M A;  3UKQ A;  2WPC A;  3NN0 X;  3H8I A;  3JSK A;  2RGO A;  1LQU A;  2WP9 A;  2YVJ A;  3FPZ A;  2C67 A;  3AEF A;  1D7Y A;  3H4K A;  2Q0L A;  4FX9 A;  3UOZ A;  4DSH A;  4J36 A;  4OPG A;  2BXS A;  2YAU A;  2GR0 A;  1Y0P A;  1FCD A;  4K22 A;  4C3X A;  1P2E A;  3DH9 A;  4APN A;  3AEA A;  5IPY A;  2YLZ A;  3RNM A;  3FG2 P;  4BJY A;  4JDR A;  4BJZ A;  1PS9 A;  1F8R A;  2BCP A;  1LV0 A;  2GMJ A;  2X50 A;  3P4R A;  2YWL A;  3K7Q X;  3AYJ A;  4RG4 A;  2GQW A;  1E7P A;  4AP1 A;  1D7L A;  3VR8 A;  4YT0 A;  2OLN A;  3AE1 A;  3AEC A;  2R45 A;  2E4G A;  2QA1 A;  2GR2 A;  1IUV A;  3AE6 A;  3ABV A;  3GRS A;  3CGC A;  4B64 A;  4U8P A;  2WU5 A;  3NN6 X;  1H83 A;  1MXT A;  3AYL A;  1S2Y A;  4TLZ A;  3ICR A;  3LXD A;  1REO A;  3L1R A;  1YQ4 A;  5HXI A;  3GDP A;  3GYI A;  4UP3 A;  4A6N B;  4CY6 A;  2QAE A;  4EM4 A;  3UCL A;  1L9E A;  2X8C A;  1YQ3 A;  4GRT A;  4NTE A;  4U8N A;  4CBQ A;  1KSS A;  4TM1 A;  4WCT A;  4D03 A;  4B69 A;  2V61 A;  4H4S A;  1VG9 A;  4EMI A;  2H89 A;  2GQF A;  3I3L A;  4PAA A;  4BUR A;  1B5Q A;  1JNR A;  2YLS A;  3GDN A;  5BUL A;  1D5T A;  2C3D A;  3IHM A;  1DJN A;  2GAH B;  4H4Y A;  3AD9 B;  2AQJ A;  4XXG A;  1E1M A;  4YTP A;  3R9U A;  1QO8 A;  3QFB A;  3UTG A;  1GV4 A;  4GR1 A;  4BK1 A;  5M10 A;  1N4U A;  1NG3 A;  1SEZ A;  4NZH A;  1O94 A;  4J33 A;  3GWD A;  3GSI A;  2Q7V A;  1PN0 A;  2R46 A;  2WEU A;  4K2X A;  3EF6 A;  3NTA A;  3NRN A;  3K7M X;  1KSU A;  2VVM A;  2A8X A;  3V3O A;  4U2S A;  4YSH A;  3B3R A;  2YR5 A;  4M52 A;  4N9X A;  2XFU A;  2XLU A;  1ZMC A;  3ADA B;  2BAC A;  3G5R A;  5ER0 A;  2NVK X;  2YG4 A;  2V6O A;  4H4W A;  5M0Z A;  4Z2U A;  3GYJ A;  1N4W A;  1YQZ A;  4JY3 A;  4D04 A;  2CUL A;  5FS9 A;  3NK0 X;  1M64 A;  4J56 A;  4H4X A;  5GRT A;  3COX A;  4H4R A;  4ZCC A;  4C74 A;  2XYO A;  4YSZ A;  2XFO A;  3GMB A;  4YWO A;  3ICT A;  2X99 A;  3AEG A;  4Z44 A;  1JEH A;  1NDA A;  5TR3 A;  3BNU A;  4BV6 A;  4ADW A;  1YKJ A;  4AP3 A;  5GSN A;  3BI2 A;  4U2L A;  5DBJ A;  4IVO B;  1KNR A;  2BS3 A;  5FMH A;  4C5O A;  3LOV A;  3FMW A;  4YXD A;  2JB1 A;  3UOX A;  4GCM A;  1IJH A;  1F8W A;  2FJE A;  2GF3 A;  4GDE A;  1OJC A;  5HY5 A;  3QJ4 A;  1ZK7 A;  3UKH A;  2HQM A;  3ITJ A;  4YTN A;  1NHP A;  1XDI A;  2JAE A;  2WP5 A;  4A5L A;  5EB4 A;  1S2Q A;  4P9S A;  5J60 A;  3ISH A;  2WDR A;  4NEV A;  3M0O A;  3S5W A;  2XLT A;  3AE9 A;  2VRL A;  3DJG X;  1CF3 A;  1LPF A;  3BHF A;  1P2H A;  2B9X A;  4J34 A;  1GRB A;  1GRE A;  3NTD A;  3AE4 A;  4JNA A;  3VRA A;  3DK4 A;  5IQ4 A;  3DGZ A;  2WBA A;  3IWA A;  3UKK A;  2XDO A;  1JU2 A;  1VRQ B;  4DGK A;  1EL7 A;  3CGB A;  4REK A;  4B68 A;  4YSY A;  1ZKQ A;  4OPU A;  2EQ7 A;  3EPT A;  3UKA A;  5BRT A;  2V60 A;  1GRF A;  2GH5 A;  1GEU A;  3GRT A;  1GRT A;  3P1W A;  1K0L A;  1KFY A;  1PBC A;  3CTY A;  3UOV A;  1PJ7 A;  1H86 A;  2WHD A;  3S61 A;  2X8H A;  2GRT A;  4C77 A;  3K30 A;  3LZX A;  2YR6 A;  1GXF A;  3NYE A;  4TLX A;  3OC4 A;  4YSX A;  5U1O A;  4A7A A;  2B76 A;  1H7W A;  2JB3 A;  3NG7 X;  2RGJ A;  3LB8 A;  1GER A;  1N1P A;  2C65 A;  1D4C A;  1GTH A;  1Z6L A;  1ZP0 A;  2EQ9 A;  3PO7 A;  1EBD A;  2A89 A;  2BK3 A;  2X3N A;  3KU9 A;  1F8S A;  4H7U A;  3CIR A;  2IVE A;  3AWI A;  2ZZ0 A;  5J7X A;  1H84 A;  1ZDL A;  2R0C A;  3SGL A;  1BWC A;  4EMW A;  5JCL A;  3AEE A;  3AE3 A;  3VRD B;  1YY5 A;  4ZCD A;  3DME A;  3NYF A;  3LAD A;  3L8K A;  4H2R A;  3F8P A;  1Y56 B;  4UDP A;  4B65 A;  2GAG B;  4X9N A;  1GTE A;  1L9C A;  2VQB A;  2GVC A;  2E5V A;  4OPC A;  1LTX R;  1O95 A;  4B67 A;  5KRQ A;  3UOY A;  1F3P A;  1GSN A;  1GAL A;  3P4Q A;  4H2Q A;  3VR9 A;  1DOE A;  2ZBW A;  2X8G A;  1PBE A;  5FS7 A;  1ONF A;  3ZYX A;  2WDQ A;  2I0Z A;  1GES A;  2DKI A;  2NPX A;  4H4T A;  4XWR A;  4B63 A;  1CJ4 A;  2XLR A;  3QSM A;  1VDC A;  1FOH A;  1PBD A;  2H88 A;  5C2T A;  4Z2T A;  4DNA A;  5HYM A;  1ZMD A;  2DKH A;  1GRG A;  1CJ3 A;  2XFQ A;  4OPD A;  1FEC A;  4CNK A;  1D4D A;  2WS3 A;  2WES A;  4B66 A;  3IC9 A;  1ZOY A;  5CKU A;  2YR4 A;  1PBF A;  2WOV A;  4PAB A;  5JCN A;  1OJA A;  1W4X A;  2YLW A;  3DK9 A;  4H4Q A;  4J31 A;  4Y4N A;  4B1B A;  2WPE A;  2JB2 A;  4EQR A;  4JQ9 A;  1UKV G;  1Y56 A;  1GPE A;  1H6V A;  3NK1 X;  3UTE A;  3G5S A;  1TRB A;  1AOG A;  3H8L A;  1PXB A;  4H4U A;  4H2P A;  3KVE A;  4HB9 A;  1RYI A;  4TM3 A;  3VQR A;  4K5S A;  3GMC A;  2QCU A;  4O5Q A;  5JCM A;  4MJW A;  1VG0 A;  3AE2 A;  4C3Y A;  2JK6 A;  1Q1R A;  1GND A;  3AYI A;  2YLR A;  4HA6 A;  1FEA A;  3NIX A;  1MO9 A;  3AD7 B;  4A65 A;  2JKC A;  2W0H A;  4EQW A;  2ZZB A;  4Z25 A;  2YLX A;  2C64 A;  3AED A;  3CND A;  2WQY A;  2ZZC A;  2XVI A;  1TYT A;  3CGE A;  2QA2 A;  1NHQ A;  2AAQ A;  3WE0 A;  3CPJ G;  2YVF A;  2B9W A;  4GUV A;  2V3A A;  1NG4 A;  1PHH A;  1NPX A;  3EAN A;  1DOC A;  2WP6 A;  1CHU A;  1H7X A;  4K8D A;  1PXA A;  2Q6U A;  4J2W A;  5KOX A;  1KDG A;  5BVA A;  4U8M A;  1KNP A;  1X31 B;  3KA7 A;  3QVR A;  4U2T A;  4Z24 A;  2OAM A;  1OJT A;  3NK2 X;  4OPI A;  2BC0 A;  3LZW A;  1BGJ A;  2BS2 A;  2R9Z A;  1E6E A;  4U8O A;  2XLS A;  3E1T A;  1NEK A;  4AOS A;  1XAN A;  1L9D A;  2AR8 A;  1DOD A;  3LJP A;  4GF7 A;  2GR3 A;  3UP4 A;  1JRY A;  3AD8 B;  3I6D A;  5JCK A;  1MOK A;  3UKF A;  2PHH A;  4H4Z A;  1GRA A;  2CVJ A;  1EL5 A;  3NNE A;  1Q1W A;  4LA1 A;  2C70 A;  2XCG A;  3AXB A;  1LJ1 A;  1CJ2 A;  4WX1 A;  4AOX A;  2XFN A;  5CQF A;  4YKG A;  1IUS A;  2YM2 A;  2RGH A;  3ZDN A;  4BK2 A;  1CBO A;  2FJD A;  1IUX A;  3C4A A;  5IQ1 A;  3ALJ A;  4CCR A;  1NHS A;  1CJC A;  3RHA A;  1PXC A;  4ECH A;  4NEW A;  4USR A;  5L46 A;  2APG A;  2C3C A;  3RP8 A;  4Z26 A;  3DGH A;  5KVI A;  2Y6R A;  4NTC A;  3PS9 A;  3AB1 A;  1FEB A;  3CPI G;  4LII A;  1PDH A;  3NKS A;  3UP5 A;  2XLP A;  3BHK A;  4TM0 A;  2WOI A;  2GB0 A;  4EM3 A;  4JN9 A;  5JCI A;  1GT8 A;  2B7S A;  4H2N A;  5U25 A;  3SM8 A;  1E1K A;  3UTF A;  3V3N A;  4EQS A;  4IV9 A;  4KPR A;  1XHC A;  4RSL A;  4I58 A;  2WU2 A;  2XVH A;  3CNT A;  4AT0 A;  4J57 A;  3CNS A;  1XPQ A;  1S3B A;  3SFD A;  2C75 A;  1B8S A;  2C76 A;  2OAL A;  2Q0K A;  4IA6 A;  1V59 A;  4JY2 A;  4TM4 A;  2XVJ A;  4XWZ A;  4EQX A;  1FL2 A;  2TMD A;  2R0G A;  3T37 A;  3K7T A;  3Q9T A;  4A99 A;  1JRZ A;  1TDO A;  2J3N A;  4RG3 A;  1GOS A;  2VVL A;  3GD4 A;  4H4V A;  3ALL A;  1VQW A;  2Y6Q A;  1M6I A;  1D4E A;  4K5R A;  1K0I A;  2ACZ A;  1CC4 A;  1N4V A;  1CC6 A;  4I59 A;  4JNQ A;  3F8D A;  5KOW A;  1NEN A;  2IID A;  4K7Z A;  2YM1 A;  3OZ2 A;  1QJD A;  4X4J A;  2C66 A;  5C3J A;  2R4E A;  2V3B A;  4OPL A;  1EL8 A;  1DOB A;  1F6M A;  2V5Z A;  2JBV A;  1B4V A;  3C96 A;  3II4 A;  3Q6J A;  1LQT A;  3CPH G;  3BNM A;  1COY A;  3PVC A;  1KF6 A;  3NH3 X;  1JRX A;  2R4J A;  3IHG A;  2BAB A;  3O0H A;  3SQP A;  3UKL A;  3DK8 A;  3ATR A;  4E0V A;  1CL0 A;  3V76 A;  1RSG A;  3UTH A;  2B7R A;  2GV8 A; 
#chains in the Genus database with same CATH topology
 1DNC A;  4A79 A;  2BCG G;  2WPF A;  4KX6 A;  4II3 A;  2B9Y A;  3URH A;  3P4S A;  1TDE A;  3F8R A;  2GR1 A;  3C4N A;  1PJ5 A;  3GD3 A;  2CFY A;  3ATQ A;  3NLC A;  3RP6 A;  2C7G A;  2OLO A;  1PBB A;  3QVP A;  4OCG A;  3DJE A;  1BZL A;  3EAO A;  1BGN A;  2RAB A;  1O5W A;  1TYP A;  2BK4 A;  2Z5Y A;  1BF3 A;  3M13 A;  1TDN A;  1TDF A;  4FDC B;  3IF9 A;  1S3E A;  2YG6 A;  2VVL G;  2BK5 A;  3CMM A;  3UKP A;  2C72 A;  2CDU A;  2YG7 A;  3AE8 A;  4U8J A;  4EIQ A;  1OJD A;  4A6N A;  4UDQ A;  1PJ6 A;  3HZL A;  3KKJ A;  4H4P A;  2E1M A;  3NGC X;  2YG5 A;  3AEB A;  4OVI A;  5U63 A;  4CCQ A;  2R0P A;  3CNP A;  3QSE A;  4NTD A;  5KMR A;  3G5Q A;  3DJD A;  1HYU A;  3KPF A;  2WDV A;  4Y4L A;  1GRH A;  1JNZ A;  2YLT A;  2EQ6 A;  5KVH A;  2WET A;  5EB5 A;  1ZX9 A;  2C73 A;  2BA9 A;  2Z5X A;  4G6H A;  2VOU A;  1IUT A;  2TPR A;  4YKF A;  1ZY8 A;  2VRM A;  4IVM B;  1ELI A;  2GEW A;  5EBK A;  1EL9 A;  3AE5 A;  2VZ2 A;  4LU6 A;  5KWF A;  3AE7 A;  2PYX A;  2BC1 A;  4ZN0 A;  1QLB A;  3KLJ A;  1IUW A;  5EOW A;  2YG3 A;  3RED A;  3ICS A;  1DJQ A;  4U8L A;  2A87 A;  2FBW A;  3P9U A;  1DXL A;  3B6D A;  3CNJ A;  1JOA A;  1NHR A;  3D8X A;  1TDK A;  2YVG A;  1B37 A;  1IUU A;  4FK1 A;  2C4C A;  3QFA A;  4Z2R A;  3QSS A;  3DJJ A;  2UZZ A;  2VQ7 A;  1K4Q A;  1NAA A;  2FJB A;  2O9Z A;  3NHO X;  5BUK A;  4CNJ A;  4OPT A;  1RP0 A;  2GMH A;  3DA1 A;  3BI5 A;  3NT6 A;  4GAV A;  2BS4 A;  4H50 A;  2FJA A;  3P4P A;  2XVF A;  4EMJ A;  4BK3 A;  4U8I A;  2IVD A;  2BYB A;  1K0J A;  4YTM A;  2EQ8 A;  3FIM B;  5KXJ A;  1LVL A;  1H81 A;  3BI4 A;  3GWF A;  2WOW A;  1L0V A;  2ARD A;  4X9M A;  4EIP A;  1E1N A;  3ALM A;  1GET A;  2XFP A;  4CRT A;  1E39 A;  1OJ9 A;  1CC2 A;  3VRB A;  4ICY A;  1BKW A;  3CGD A;  2OA1 A;  4IA5 A;  4DSG A;  2YQU A;  4A9W A;  1Q9I A;  4O5U A;  3M12 A;  4UDR A;  2XVE A;  4CY8 A;  1ZOV A;  2F5Z A;  4USQ A;  4NWZ A;  5LV9 A;  2BXR A;  4AT2 A;  4U8K A;  3T2K A;  3RP7 A;  3SFE A;  3NYC A;  3SY4 A;  4GDP A;  3D1C A;  5FS6 A;  1H82 A;  3KD9 A;  5FS8 A;  4Z43 A;  1E1L A;  3FBS A;  4FK1 C;  3CN8 A;  5HHF A;  4Y4M A;  3UKQ A;  2WPC A;  3NN0 X;  3H8I A;  3JSK A;  2RGO A;  1LQU A;  2WP9 A;  2YVJ A;  3FPZ A;  2C67 A;  3AEF A;  1D7Y A;  3H4K A;  2Q0L A;  4FX9 A;  3UOZ A;  4DSH A;  4J36 A;  4OPG A;  2BXS A;  2YAU A;  2GR0 A;  1Y0P A;  1FCD A;  3T0K A;  4K22 A;  4C3X A;  1P2E A;  3DH9 A;  4APN A;  3AEA A;  5IPY A;  2YLZ A;  3RNM A;  3FG2 P;  4BJY A;  4JDR A;  4BJZ A;  1PS9 A;  1F8R A;  2BCP A;  1LV0 A;  2GMJ A;  2X50 A;  3P4R A;  2YWL A;  3K7Q X;  3AYJ A;  4RG4 A;  2GQW A;  1E7P A;  4AP1 A;  1D7L A;  3VR8 A;  4YT0 A;  2OLN A;  3AE1 A;  3AEC A;  2R45 A;  2E4G A;  2QA1 A;  2GR2 A;  1IUV A;  3AE6 A;  3ABV A;  3GRS A;  3CGC A;  4B64 A;  5JCI A;  4U8P A;  2WU5 A;  3NN6 X;  1H83 A;  1MXT A;  3AYL A;  1S2Y A;  4TLZ A;  3ICR A;  3LXD A;  1REO A;  3L1R A;  1YQ4 A;  3GYX A;  5HXI A;  3GDP A;  3GYI A;  4UP3 A;  4A6N B;  4CY6 A;  5KMS A;  2QAE A;  4EM4 A;  3UCL A;  1L9E A;  2X8C A;  1YQ3 A;  4GRT A;  4NTE A;  4U8N A;  4CBQ A;  1KSS A;  4TM1 A;  4WCT A;  4D03 A;  4B69 A;  2V61 A;  4H4S A;  1VG9 A;  4EMI A;  2H89 A;  2GQF A;  3I3L A;  4PAA A;  4BUR A;  1B5Q A;  1JNR A;  2YLS A;  3GDN A;  5BUL A;  1D5T A;  2C3D A;  4NNJ A;  3IHM A;  1DJN A;  2GAH B;  4H4Y A;  3AD9 B;  2AQJ A;  4XXG A;  1E1M A;  4YTP A;  3R9U A;  1QO8 A;  3QFB A;  3UTG A;  1GV4 A;  3T14 A;  4GR1 A;  4BK1 A;  5M10 A;  1N4U A;  1NG3 A;  1SEZ A;  4NZH A;  1O94 A;  4J33 A;  3GWD A;  3GSI A;  2Q7V A;  1PN0 A;  2R46 A;  2WEU A;  4K2X A;  3EF6 A;  3NTA A;  3NRN A;  3K7M X;  1KSU A;  2VVM A;  2A8X A;  3V3O A;  4U2S A;  4YSH A;  3B3R A;  2YR5 A;  4M52 A;  4N9X A;  2XFU A;  2XLU A;  1ZMC A;  3ADA B;  2BAC A;  3G5R A;  5ER0 A;  2NVK X;  2YG4 A;  2V6O A;  4H4W A;  5M0Z A;  4Z2U A;  3GYJ A;  1N4W A;  1YQZ A;  4JY3 A;  4D04 A;  2CUL A;  5FS9 A;  3NK0 X;  1M64 A;  4J56 A;  4H4X A;  3SZW A;  5GRT A;  3COX A;  4H4R A;  4ZCC A;  4C74 A;  2XYO A;  4YSZ A;  2XFO A;  3GMB A;  4YWO A;  3ICT A;  2X99 A;  3AEG A;  4Z44 A;  1JEH A;  1NDA A;  5TR3 A;  3BNU A;  3SZF A;  4BV6 A;  4ADW A;  1YKJ A;  4AP3 A;  5GSN A;  3BI2 A;  5KMQ A;  4U2L A;  5DBJ A;  4IVO B;  1KNR A;  2BS3 A;  5FMH A;  4C5O A;  3LOV A;  3FMW A;  4YXD A;  2JB1 A;  3UOX A;  4GCM A;  1IJH A;  1F8W A;  2FJE A;  2GF3 A;  4GDE A;  1OJC A;  5HY5 A;  3QJ4 A;  1ZK7 A;  3UKH A;  2HQM A;  3ITJ A;  4YTN A;  1NHP A;  1XDI A;  2JAE A;  2WP5 A;  4A5L A;  5EB4 A;  4GAP A;  1S2Q A;  4P9S A;  5J60 A;  3ISH A;  2WDR A;  4NEV A;  3M0O A;  3S5W A;  2XLT A;  3AE9 A;  2VRL A;  3DJG X;  1CF3 A;  1LPF A;  3BHF A;  3T2Z A;  1P2H A;  2B9X A;  4J34 A;  1GRB A;  1GRE A;  3NTD A;  3AE4 A;  4JNA A;  3VRA A;  3DK4 A;  5IQ4 A;  3DGZ A;  2WBA A;  3IWA A;  3UKK A;  2XDO A;  1JU2 A;  1VRQ B;  4DGK A;  1EL7 A;  3CGB A;  4REK A;  4B68 A;  4YSY A;  1ZKQ A;  4OPU A;  2EQ7 A;  3EPT A;  3UKA A;  5BRT A;  2V60 A;  1GRF A;  2GH5 A;  1GEU A;  3GRT A;  1GRT A;  3P1W A;  1K0L A;  1KFY A;  1PBC A;  3CTY A;  3UOV A;  1PJ7 A;  1H86 A;  2WHD A;  3S61 A;  2X8H A;  2GRT A;  4C77 A;  3K30 A;  3LZX A;  2YR6 A;  1GXF A;  3NYE A;  4II2 A;  4TLX A;  3OC4 A;  4YSX A;  5U1O A;  4A7A A;  2B76 A;  1H7W A;  2JB3 A;  3NG7 X;  2RGJ A;  3HYX A;  1GER A;  1N1P A;  3LB8 A;  2C65 A;  1D4C A;  1GTH A;  1Z6L A;  1ZP0 A;  2EQ9 A;  3PO7 A;  1EBD A;  2A89 A;  2BK3 A;  2X3N A;  3KU9 A;  1F8S A;  4H7U A;  3CIR A;  2IVE A;  3AWI A;  2ZZ0 A;  5J7X A;  1H84 A;  1ZDL A;  2R0C A;  3SGL A;  1BWC A;  4EMW A;  5JCL A;  3AEE A;  3AE3 A;  3VRD B;  1YY5 A;  4ZCD A;  3DME A;  4G73 A;  3NYF A;  3LAD A;  3HYV A;  3L8K A;  4H2R A;  3T2Y A;  3F8P A;  1Y56 B;  4UDP A;  4B65 A;  2GAG B;  4X9N A;  1GTE A;  1L9C A;  2VQB A;  2GVC A;  2E5V A;  4OPC A;  1LTX R;  1O95 A;  4B67 A;  5KRQ A;  3UOY A;  1F3P A;  1GSN A;  1GAL A;  3P4Q A;  4H2Q A;  3VR9 A;  1DOE A;  3SX6 A;  2ZBW A;  2X8G A;  1PBE A;  5FS7 A;  1ONF A;  3ZYX A;  2WDQ A;  2I0Z A;  1GES A;  2DKI A;  2NPX A;  4H4T A;  4XWR A;  4B63 A;  1CJ4 A;  2XLR A;  3QSM A;  1VDC A;  1FOH A;  1PBD A;  2H88 A;  5C2T A;  4Z2T A;  4DNA A;  5HYM A;  1ZMD A;  2DKH A;  1GRG A;  1CJ3 A;  2XFQ A;  4OPD A;  1FEC A;  4CNK A;  1D4D A;  2WS3 A;  2WES A;  4B66 A;  3IC9 A;  4G6G A;  1ZOY A;  5CKU A;  2YR4 A;  1PBF A;  2WOV A;  4PAB A;  5JCN A;  1OJA A;  1W4X A;  2YLW A;  3DK9 A;  4H4Q A;  4J31 A;  3HYW A;  4Y4N A;  4B1B A;  2WPE A;  2JB2 A;  4EQR A;  4JQ9 A;  1UKV G;  1Y56 A;  1GPE A;  1H6V A;  3NK1 X;  3UTE A;  3G5S A;  1TRB A;  1AOG A;  3H8L A;  1PXB A;  4H4U A;  4H2P A;  3KVE A;  4HB9 A;  1RYI A;  4TM3 A;  3SXI A;  3VQR A;  4K5S A;  3GMC A;  2QCU A;  4O5Q A;  5JCM A;  4MJW A;  1VG0 A;  3AE2 A;  3SZ0 A;  4C3Y A;  2JK6 A;  1Q1R A;  1GND A;  3AYI A;  2YLR A;  4HA6 A;  1FEA A;  3NIX A;  1MO9 A;  2BRY A;  3AD7 B;  4G74 A;  4A65 A;  2JKC A;  2W0H A;  4EQW A;  2ZZB A;  4Z25 A;  2YLX A;  2C64 A;  3AED A;  3CND A;  2WQY A;  2ZZC A;  2XVI A;  1TYT A;  3CGE A;  2QA2 A;  1NHQ A;  2AAQ A;  3WE0 A;  3CPJ G;  2YVF A;  2B9W A;  4GUV A;  2V3A A;  1NG4 A;  1PHH A;  1NPX A;  3EAN A;  3SZC A;  4G9K A;  1DOC A;  2WP6 A;  1CHU A;  1H7X A;  4K8D A;  1PXA A;  2Q6U A;  4J2W A;  5KOX A;  1KDG A;  5BVA A;  4U8M A;  1KNP A;  1X31 B;  3KA7 A;  3QVR A;  4U2T A;  4Z24 A;  2OAM A;  1OJT A;  3NK2 X;  4OPI A;  2BC0 A;  3LZW A;  1BGJ A;  2BS2 A;  2R9Z A;  1E6E A;  4U8O A;  2XLS A;  3E1T A;  1NEK A;  4AOS A;  1XAN A;  5KMP A;  1L9D A;  2AR8 A;  1DOD A;  3LJP A;  4GF7 A;  2GR3 A;  3UP4 A;  1JRY A;  3AD8 B;  3I6D A;  5JCK A;  1MOK A;  3UKF A;  2PHH A;  4H4Z A;  1GRA A;  2CVJ A;  5KNL A;  1EL5 A;  3NNE A;  1Q1W A;  4LA1 A;  2C70 A;  2XCG A;  3AXB A;  1LJ1 A;  1CJ2 A;  4WX1 A;  4AOX A;  2XFN A;  3T31 A;  5CQF A;  4YKG A;  1IUS A;  2YM2 A;  2RGH A;  3ZDN A;  4BK2 A;  1CBO A;  2FJD A;  1IUX A;  3C4A A;  5IQ1 A;  3ALJ A;  4CCR A;  1NHS A;  1CJC A;  3RHA A;  1PXC A;  4ECH A;  4NEW A;  4USR A;  5L46 A;  2APG A;  2C3C A;  3RP8 A;  4Z26 A;  3DGH A;  5KVI A;  2Y6R A;  4NTC A;  3PS9 A;  3AB1 A;  1FEB A;  3CPI G;  4LII A;  1PDH A;  3NKS A;  3UP5 A;  2XLP A;  3BHK A;  4TM0 A;  2WOI A;  2GB0 A;  4EM3 A;  4JN9 A;  3KPK A;  1GT8 A;  2B7S A;  4H2N A;  5U25 A;  3SM8 A;  1E1K A;  3UTF A;  3V3N A;  4EQS A;  4IV9 A;  4KPR A;  1XHC A;  4RSL A;  4I58 A;  2WU2 A;  2XVH A;  3CNT A;  4AT0 A;  4J57 A;  3CNS A;  1XPQ A;  1S3B A;  3SFD A;  2C75 A;  1B8S A;  2C76 A;  2OAL A;  3SYI A;  2Q0K A;  4IA6 A;  1V59 A;  4JY2 A;  4TM4 A;  2XVJ A;  4XWZ A;  4EQX A;  1FL2 A;  2TMD A;  2R0G A;  3T37 A;  3K7T A;  3Q9T A;  4A99 A;  1JRZ A;  1TDO A;  2J3N A;  4RG3 A;  1GOS A;  2VVL A;  3GD4 A;  4H4V A;  3ALL A;  1VQW A;  2Y6Q A;  1M6I A;  1D4E A;  4K5R A;  1K0I A;  2ACZ A;  1CC4 A;  1N4V A;  1CC6 A;  4I59 A;  4JNQ A;  3F8D A;  5KOW A;  1NEN A;  2IID A;  4K7Z A;  2BRA A;  2YM1 A;  3OZ2 A;  1QJD A;  4X4J A;  2C66 A;  5C3J A;  2R4E A;  2V3B A;  4OPL A;  1EL8 A;  1DOB A;  1F6M A;  2V5Z A;  2JBV A;  1B4V A;  3C96 A;  3II4 A;  3Q6J A;  1LQT A;  3CPH G;  3BNM A;  1COY A;  3PVC A;  1KF6 A;  3NH3 X;  1JRX A;  2R4J A;  3IHG A;  2BAB A;  3O0H A;  3SQP A;  3UKL A;  3DK8 A;  3ATR A;  4E0V A;  1CL0 A;  3V76 A;  1RSG A;  3UTH A;  2B7R A;  2GV8 A; 
#chains in the Genus database with same CATH homology
 1DNC A;  4A79 A;  2BCG G;  2WPF A;  4KX6 A;  4II3 A;  2B9Y A;  3URH A;  3P4S A;  1TDE A;  3F8R A;  2GR1 A;  3C4N A;  1PJ5 A;  3GD3 A;  2CFY A;  3ATQ A;  3NLC A;  3RP6 A;  2C7G A;  2OLO A;  1PBB A;  3QVP A;  4OCG A;  3DJE A;  1BZL A;  3EAO A;  1BGN A;  2RAB A;  1O5W A;  1TYP A;  2BK4 A;  2Z5Y A;  1BF3 A;  3M13 A;  1TDN A;  1TDF A;  4FDC B;  3IF9 A;  1S3E A;  2YG6 A;  2VVL G;  2BK5 A;  3CMM A;  3UKP A;  2C72 A;  2CDU A;  2YG7 A;  3AE8 A;  4U8J A;  4EIQ A;  1OJD A;  4A6N A;  4UDQ A;  1PJ6 A;  3HZL A;  3KKJ A;  4H4P A;  2E1M A;  3NGC X;  2YG5 A;  3AEB A;  4OVI A;  5U63 A;  4CCQ A;  2R0P A;  3CNP A;  3QSE A;  4NTD A;  5KMR A;  3G5Q A;  3DJD A;  1HYU A;  3KPF A;  2WDV A;  4Y4L A;  1GRH A;  1JNZ A;  2YLT A;  2EQ6 A;  5KVH A;  2WET A;  5EB5 A;  1ZX9 A;  2C73 A;  2BA9 A;  2Z5X A;  4G6H A;  2VOU A;  1IUT A;  2TPR A;  4YKF A;  1ZY8 A;  2VRM A;  4IVM B;  1ELI A;  2GEW A;  5EBK A;  1EL9 A;  3AE5 A;  2VZ2 A;  4LU6 A;  5KWF A;  3AE7 A;  2PYX A;  2BC1 A;  4ZN0 A;  1QLB A;  3KLJ A;  1IUW A;  5EOW A;  2YG3 A;  3RED A;  3ICS A;  1DJQ A;  4U8L A;  2A87 A;  2FBW A;  3P9U A;  1DXL A;  3B6D A;  3CNJ A;  1JOA A;  1NHR A;  3D8X A;  1TDK A;  2YVG A;  1B37 A;  1IUU A;  4FK1 A;  2C4C A;  3QFA A;  4Z2R A;  3QSS A;  3DJJ A;  2UZZ A;  2VQ7 A;  1K4Q A;  1NAA A;  2FJB A;  2O9Z A;  3NHO X;  5BUK A;  4CNJ A;  4OPT A;  1RP0 A;  2GMH A;  3DA1 A;  3BI5 A;  3NT6 A;  4GAV A;  2BS4 A;  4H50 A;  2FJA A;  3P4P A;  2XVF A;  4EMJ A;  4BK3 A;  4U8I A;  2IVD A;  2BYB A;  1K0J A;  4YTM A;  2EQ8 A;  3FIM B;  5KXJ A;  1LVL A;  1H81 A;  3BI4 A;  3GWF A;  2WOW A;  1L0V A;  2ARD A;  4X9M A;  4EIP A;  1E1N A;  3ALM A;  1GET A;  2XFP A;  4CRT A;  1E39 A;  1OJ9 A;  1CC2 A;  3VRB A;  4ICY A;  1BKW A;  3CGD A;  2OA1 A;  4IA5 A;  4DSG A;  2YQU A;  4A9W A;  1Q9I A;  4O5U A;  3M12 A;  4UDR A;  2XVE A;  4CY8 A;  1ZOV A;  2F5Z A;  4USQ A;  4NWZ A;  5LV9 A;  2BXR A;  4AT2 A;  4U8K A;  3T2K A;  3RP7 A;  3SFE A;  3NYC A;  3SY4 A;  4GDP A;  3D1C A;  5FS6 A;  1H82 A;  3KD9 A;  5FS8 A;  4Z43 A;  1E1L A;  3FBS A;  4FK1 C;  3CN8 A;  5HHF A;  4Y4M A;  3UKQ A;  2WPC A;  3NN0 X;  3H8I A;  3JSK A;  2RGO A;  1LQU A;  2WP9 A;  2YVJ A;  3FPZ A;  2C67 A;  3AEF A;  1D7Y A;  3H4K A;  2Q0L A;  4FX9 A;  3UOZ A;  4DSH A;  4J36 A;  4OPG A;  2BXS A;  2YAU A;  2GR0 A;  1Y0P A;  1FCD A;  3T0K A;  4K22 A;  4C3X A;  1P2E A;  3DH9 A;  4APN A;  3AEA A;  5IPY A;  2YLZ A;  3RNM A;  3FG2 P;  4BJY A;  4JDR A;  4BJZ A;  1PS9 A;  1F8R A;  2BCP A;  1LV0 A;  2GMJ A;  2X50 A;  3P4R A;  2YWL A;  3K7Q X;  3AYJ A;  4RG4 A;  2GQW A;  1E7P A;  4AP1 A;  1D7L A;  3VR8 A;  4YT0 A;  2OLN A;  3AE1 A;  3AEC A;  2R45 A;  2E4G A;  2QA1 A;  2GR2 A;  1IUV A;  3AE6 A;  3ABV A;  3GRS A;  3CGC A;  4B64 A;  5JCI A;  4U8P A;  2WU5 A;  3NN6 X;  1H83 A;  1MXT A;  3AYL A;  1S2Y A;  4TLZ A;  3ICR A;  3LXD A;  1REO A;  3L1R A;  1YQ4 A;  3GYX A;  5HXI A;  3GDP A;  3GYI A;  4UP3 A;  4A6N B;  4CY6 A;  5KMS A;  2QAE A;  4EM4 A;  3UCL A;  1L9E A;  2X8C A;  1YQ3 A;  4GRT A;  4NTE A;  4U8N A;  4CBQ A;  1KSS A;  4TM1 A;  4WCT A;  4D03 A;  4B69 A;  2V61 A;  4H4S A;  1VG9 A;  4EMI A;  2H89 A;  2GQF A;  3I3L A;  4PAA A;  4BUR A;  1B5Q A;  1JNR A;  2YLS A;  3GDN A;  5BUL A;  1D5T A;  2C3D A;  4NNJ A;  3IHM A;  1DJN A;  2GAH B;  4H4Y A;  3AD9 B;  2AQJ A;  4XXG A;  1E1M A;  4YTP A;  3R9U A;  1QO8 A;  3QFB A;  3UTG A;  1GV4 A;  3T14 A;  4GR1 A;  4BK1 A;  5M10 A;  1N4U A;  1NG3 A;  1SEZ A;  4NZH A;  1O94 A;  4J33 A;  3GWD A;  3GSI A;  2Q7V A;  1PN0 A;  2R46 A;  2WEU A;  4K2X A;  3EF6 A;  3NTA A;  3NRN A;  3K7M X;  1KSU A;  2VVM A;  2A8X A;  3V3O A;  4U2S A;  4YSH A;  3B3R A;  2YR5 A;  4M52 A;  4N9X A;  2XFU A;  2XLU A;  1ZMC A;  3ADA B;  2BAC A;  3G5R A;  5ER0 A;  2NVK X;  2YG4 A;  2V6O A;  4H4W A;  5M0Z A;  4Z2U A;  3GYJ A;  1N4W A;  1YQZ A;  4JY3 A;  4D04 A;  2CUL A;  5FS9 A;  3NK0 X;  1M64 A;  4J56 A;  4H4X A;  3SZW A;  5GRT A;  3COX A;  4H4R A;  4ZCC A;  4C74 A;  2XYO A;  4YSZ A;  2XFO A;  3GMB A;  4YWO A;  3ICT A;  2X99 A;  3AEG A;  4Z44 A;  1JEH A;  1NDA A;  5TR3 A;  3BNU A;  3SZF A;  4BV6 A;  4ADW A;  1YKJ A;  4AP3 A;  5GSN A;  3BI2 A;  5KMQ A;  4U2L A;  5DBJ A;  4IVO B;  1KNR A;  2BS3 A;  5FMH A;  4C5O A;  3LOV A;  3FMW A;  4YXD A;  2JB1 A;  3UOX A;  4GCM A;  1IJH A;  1F8W A;  2FJE A;  2GF3 A;  4GDE A;  1OJC A;  5HY5 A;  3QJ4 A;  1ZK7 A;  3UKH A;  2HQM A;  3ITJ A;  4YTN A;  1NHP A;  1XDI A;  2JAE A;  2WP5 A;  4A5L A;  5EB4 A;  4GAP A;  1S2Q A;  4P9S A;  5J60 A;  3ISH A;  2WDR A;  4NEV A;  3M0O A;  3S5W A;  2XLT A;  3AE9 A;  2VRL A;  3DJG X;  1CF3 A;  1LPF A;  3BHF A;  3T2Z A;  1P2H A;  2B9X A;  4J34 A;  1GRB A;  1GRE A;  3NTD A;  3AE4 A;  4JNA A;  3VRA A;  3DK4 A;  5IQ4 A;  3DGZ A;  2WBA A;  3IWA A;  3UKK A;  2XDO A;  1JU2 A;  1VRQ B;  4DGK A;  1EL7 A;  3CGB A;  4REK A;  4B68 A;  4YSY A;  1ZKQ A;  4OPU A;  2EQ7 A;  3EPT A;  3UKA A;  5BRT A;  2V60 A;  1GRF A;  2GH5 A;  1GEU A;  3GRT A;  1GRT A;  3P1W A;  1K0L A;  1KFY A;  1PBC A;  3CTY A;  3UOV A;  1PJ7 A;  1H86 A;  2WHD A;  3S61 A;  2X8H A;  2GRT A;  4C77 A;  3K30 A;  3LZX A;  2YR6 A;  1GXF A;  3NYE A;  4II2 A;  4TLX A;  3OC4 A;  4YSX A;  5U1O A;  4A7A A;  2B76 A;  1H7W A;  2JB3 A;  3NG7 X;  2RGJ A;  3HYX A;  1GER A;  1N1P A;  3LB8 A;  2C65 A;  1D4C A;  1GTH A;  1Z6L A;  1ZP0 A;  2EQ9 A;  3PO7 A;  1EBD A;  2A89 A;  2BK3 A;  2X3N A;  3KU9 A;  1F8S A;  4H7U A;  3CIR A;  2IVE A;  3AWI A;  2ZZ0 A;  5J7X A;  1H84 A;  1ZDL A;  2R0C A;  3SGL A;  1BWC A;  4EMW A;  5JCL A;  3AEE A;  3AE3 A;  3VRD B;  1YY5 A;  4ZCD A;  3DME A;  4G73 A;  3NYF A;  3LAD A;  3HYV A;  3L8K A;  4H2R A;  3T2Y A;  3F8P A;  1Y56 B;  4UDP A;  4B65 A;  2GAG B;  4X9N A;  1GTE A;  1L9C A;  2VQB A;  2GVC A;  2E5V A;  4OPC A;  1LTX R;  1O95 A;  4B67 A;  5KRQ A;  3UOY A;  1F3P A;  1GSN A;  1GAL A;  3P4Q A;  4H2Q A;  3VR9 A;  1DOE A;  3SX6 A;  2ZBW A;  2X8G A;  1PBE A;  5FS7 A;  1ONF A;  3ZYX A;  2WDQ A;  2I0Z A;  1GES A;  2DKI A;  2NPX A;  4H4T A;  4XWR A;  4B63 A;  1CJ4 A;  2XLR A;  3QSM A;  1VDC A;  1FOH A;  1PBD A;  2H88 A;  5C2T A;  4Z2T A;  4DNA A;  5HYM A;  1ZMD A;  2DKH A;  1GRG A;  1CJ3 A;  2XFQ A;  4OPD A;  1FEC A;  4CNK A;  1D4D A;  2WS3 A;  2WES A;  4B66 A;  3IC9 A;  4G6G A;  1ZOY A;  5CKU A;  2YR4 A;  1PBF A;  2WOV A;  4PAB A;  5JCN A;  1OJA A;  1W4X A;  2YLW A;  3DK9 A;  4H4Q A;  4J31 A;  3HYW A;  4Y4N A;  4B1B A;  2WPE A;  2JB2 A;  4EQR A;  4JQ9 A;  1UKV G;  1Y56 A;  1GPE A;  1H6V A;  3NK1 X;  3UTE A;  3G5S A;  1TRB A;  1AOG A;  3H8L A;  1PXB A;  4H4U A;  4H2P A;  3KVE A;  4HB9 A;  1RYI A;  4TM3 A;  3SXI A;  3VQR A;  4K5S A;  3GMC A;  2QCU A;  4O5Q A;  5JCM A;  4MJW A;  1VG0 A;  3AE2 A;  3SZ0 A;  4C3Y A;  2JK6 A;  1Q1R A;  1GND A;  3AYI A;  2YLR A;  4HA6 A;  1FEA A;  3NIX A;  1MO9 A;  2BRY A;  3AD7 B;  4G74 A;  4A65 A;  2JKC A;  2W0H A;  4EQW A;  2ZZB A;  4Z25 A;  2YLX A;  2C64 A;  3AED A;  3CND A;  2WQY A;  2ZZC A;  2XVI A;  1TYT A;  3CGE A;  2QA2 A;  1NHQ A;  2AAQ A;  3WE0 A;  3CPJ G;  2YVF A;  2B9W A;  4GUV A;  2V3A A;  1NG4 A;  1PHH A;  1NPX A;  3EAN A;  3SZC A;  4G9K A;  1DOC A;  2WP6 A;  1CHU A;  1H7X A;  4K8D A;  1PXA A;  2Q6U A;  4J2W A;  5KOX A;  1KDG A;  5BVA A;  4U8M A;  1KNP A;  1X31 B;  3KA7 A;  3QVR A;  4U2T A;  4Z24 A;  2OAM A;  1OJT A;  3NK2 X;  4OPI A;  2BC0 A;  3LZW A;  1BGJ A;  2BS2 A;  2R9Z A;  1E6E A;  4U8O A;  2XLS A;  3E1T A;  1NEK A;  4AOS A;  1XAN A;  5KMP A;  1L9D A;  2AR8 A;  1DOD A;  3LJP A;  4GF7 A;  2GR3 A;  3UP4 A;  1JRY A;  3AD8 B;  3I6D A;  5JCK A;  1MOK A;  3UKF A;  2PHH A;  4H4Z A;  1GRA A;  2CVJ A;  5KNL A;  1EL5 A;  3NNE A;  1Q1W A;  4LA1 A;  2C70 A;  2XCG A;  3AXB A;  1LJ1 A;  1CJ2 A;  4WX1 A;  4AOX A;  2XFN A;  3T31 A;  5CQF A;  4YKG A;  1IUS A;  2YM2 A;  2RGH A;  3ZDN A;  4BK2 A;  1CBO A;  2FJD A;  1IUX A;  3C4A A;  5IQ1 A;  3ALJ A;  4CCR A;  1NHS A;  1CJC A;  3RHA A;  1PXC A;  4ECH A;  4NEW A;  4USR A;  5L46 A;  2APG A;  2C3C A;  3RP8 A;  4Z26 A;  3DGH A;  5KVI A;  2Y6R A;  4NTC A;  3PS9 A;  3AB1 A;  1FEB A;  3CPI G;  4LII A;  1PDH A;  3NKS A;  3UP5 A;  2XLP A;  3BHK A;  4TM0 A;  2WOI A;  2GB0 A;  4EM3 A;  4JN9 A;  3KPK A;  1GT8 A;  2B7S A;  4H2N A;  5U25 A;  3SM8 A;  1E1K A;  3UTF A;  3V3N A;  4EQS A;  4IV9 A;  4KPR A;  1XHC A;  4RSL A;  4I58 A;  2WU2 A;  2XVH A;  3CNT A;  4AT0 A;  4J57 A;  3CNS A;  1XPQ A;  1S3B A;  3SFD A;  2C75 A;  1B8S A;  2C76 A;  2OAL A;  3SYI A;  2Q0K A;  4IA6 A;  1V59 A;  4JY2 A;  4TM4 A;  2XVJ A;  4XWZ A;  4EQX A;  1FL2 A;  2TMD A;  2R0G A;  3T37 A;  3K7T A;  3Q9T A;  4A99 A;  1JRZ A;  1TDO A;  2J3N A;  4RG3 A;  1GOS A;  2VVL A;  3GD4 A;  4H4V A;  3ALL A;  1VQW A;  2Y6Q A;  1M6I A;  1D4E A;  4K5R A;  1K0I A;  2ACZ A;  1CC4 A;  1N4V A;  1CC6 A;  4I59 A;  4JNQ A;  3F8D A;  5KOW A;  1NEN A;  2IID A;  4K7Z A;  2BRA A;  2YM1 A;  3OZ2 A;  1QJD A;  4X4J A;  2C66 A;  5C3J A;  2R4E A;  2V3B A;  4OPL A;  1EL8 A;  1DOB A;  1F6M A;  2V5Z A;  2JBV A;  1B4V A;  3C96 A;  3II4 A;  3Q6J A;  1LQT A;  3CPH G;  3BNM A;  1COY A;  3PVC A;  1KF6 A;  3NH3 X;  1JRX A;  2R4J A;  3IHG A;  2BAB A;  3O0H A;  3SQP A;  3UKL A;  3DK8 A;  3ATR A;  4E0V A;  1CL0 A;  3V76 A;  1RSG A;  3UTH A;  2B7R A;  2GV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...