1F6MA

Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
320
structure length
320
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSASATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 95
structure length 320
sequence length 320
chains with identical sequence B, E, F
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f6mA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f6mA02
1KF6A 2ZZ0A 3AE6A 1MXTA 1CJ3A 1TYTA 2E4GA 2YM2A 1VDCA 1CJ2A 2Z5XA 3FPZA 1H7WA 1NHSA 4USQA 1EL7A 1D4CA 2E5VA 2XYOA 1IUWA 1GTHA 4GDEA 1GPEA 1K4QA 2Y6QA 2YVFA 3PVCA 1F6MA 4I58A 2PYXA 2WPFA 2UZZA 1EL8A 2PHHA 4YXDA 3AYIA 4U2SA 2YG3A 4H4UA 4JNQA 2YLZA 3AD7B 1CHUA 2YLRA 3AE9A 2YR4A 3UKAA 1K0LA 4JDRA 3AEDA 2CDUA 3ALLA 2XVFA 2H89A 1BKWA 2C3DA 2YG5A 5JCLA 1K0JA 4U8PA 1NHRA 1E6EA 1LV0A 4FX9A 2B9XA 3CIRA 4C77A 5GSNA 1ZX9A 2BK3A 4IV9A 5EBKA 2JB3A 2C76A 4DGKA 3GDNA 2V5ZA 3AB1A 2BACA 2WS3A 3FIMB 1DOCA 1ELIA 2H88A 1YQZA 4EIPA 1B37A 1JNZA 1Q9IA 1JRXA 1SEZA 1ZDLA 2JK6A 4JY2A 1Y56A 2WBAA 4EQSA 2WHDA 1DOEA 4O5UA 2XVJA 3AE3A 4CCQA 1PJ5A 2GH5A 1FECA 3DA1A 4Z24A 1N4VA 2RABA 4ADWA 1FEAA 2AAQA 2O9ZA 4CCRA 3GWDA 1ZP0A 1TDFA 2A89A 2X50A 3QSMA 4Y4NA 5JCKA 1AOGA 4HA6A 2WPCA 2X99A 4Z43A 4K2XA 3DK9A 3BHKA 4EIQA 2Z5YA 4B63A 1NHPA 1GV4A 4PAAA 2C70A 2AR8A 2VVMA 3LOVA 3UOVA 3AEAA 3AE8A 3UKPA 1DNCA 3K7MX 2YG6A 3KA7A 3GDPA 4X9NA 4JY3A 1MOKA 3AEFA 2A87A 2XDOA 4NEWA 2WOIA 3GRTA 3LZWA 3NK1X 4AP1A 3NYEA 5KOWA 3IHGA 3UKQA 3UP4A 2XFUA 1TYPA 4N9XA 3KU9A 1D7YA 3ABVA 3ICTA 4H2RA 3L1RA 2X8CA 3KVEA 1PBBA 4NTEA 3COXA 2JBVA 4DSGA 4H7UA 5KVHA 5LV9A 2CVJA 2YLTA 4J36A 2X8GA 1Y0PA 3CPIG 4WX1A 5M0ZA 3DMEA 2XVEA 4NEVA 4A7AA 2XLRA 4GUVA 5U63A 3NYCA 5JCMA 1GXFA 1GRBA 2C64A 1L0VA 2AQJA 4KPRA 5J60A 3PS9A 3Q6JA 2WDRA 2XFNA 3H8IA 3K30A 2OAMA 2BS2A 1E1NA 2WOWA 4CRTA 1DJNA 4A79A 3HZLA 4B66A 2FBWA 1EL5A 1IUVA 2RGJA 4H2QA 1REOA 1UKVG 3P1WA 1DODA 3JSKA 3K7QX 1PXAA 5BRTA 4J57A 1DJQA 2EQ6A 4C74A 4BK1A 3LZXA 1IJHA 4OCGA 4YTPA 4ZN0A 1KNRA 1RP0A 3DJGX 4FDCB 1CL0A 2R4EA 1GREA 4C5OA 4WCTA 4JNAA 3UTGA 4K22A 4LIIA 5HXIA 2R0CA 4M52A 4Z44A 3H8LA 3M12A 4TM0A 5KVIA 1EL9A 3CGEA 1GOSA 2BYBA 3NK0X 4NTCA 3RP8A 4J33A 3KD9A 3F8PA 2GEWA 4IA6A 4H4TA 3EF6A 3ZYXA 4ZCCA 2WU2A 1IUXA 2FJEA 2GF3A 2WP6A 2BK5A 1TDOA 3FG2P 5U1OA 4YSYA 4Z25A 5IPYA 2IIDA 5ER0A 1X31B 1FEBA 4YSZA 3B6DA 1D7LA 3AE2A 4ECHA 4LA1A 2JB2A 1OJ9A 3BNMA 3KPFA 1E1MA 1OJCA 2GR3A 4Z26A 1BF3A 3CNTA 1IUSA 1LJ1A 1M6IA 2XFPA 3AECA 2YR6A 1GEUA 4B65A 4B64A 2VVLG 1XANA 2C65A 2V60A 5HHFA 4EQWA 3UTFA 3DJEA 2XVIA 3DK8A 2CULA 4Z2RA 2QA2A 1D4DA 4H4PA 2WETA 2BS4A 4GF7A 5J7XA 2NVKX 2GQWA 4IVOB 1B4VA 1FL2A 2WP5A 1S2QA 4YWOA 2X8HA 4Z2TA 3BNUA 3VQRA 3QVPA 1JEHA 5FMHA 2C75A 3Q9TA 2XFOA 1N1PA 4UP3A 1RSGA 4H4SA 4YKFA 1N4UA 3IWAA 3VR9A 1NHQA 3II4A 2Q6UA 2GR1A 4U8LA 4U8JA 1CC2A 3EAOA 1BWCA 4H4ZA 2RGOA 3IF9A 4USRA 5DBJA 3UOYA 2WOVA 3AE4A 3ICSA 2BXSA 3C96A 3GYIA 4U8NA 4CBQA 4CNJA 1CJ4A 1Z6LA 3VRAA 1D4EA 2RGHA 1W4XA 1GSNA 2R4JA 3LXDA 2QCUA 2F5ZA 2EQ8A 2R0PA 3UKKA 1E1LA 3BI5A 3UKLA 3GSIA 3F8DA 3AD9B 4AT2A 4REKA 2VQ7A 2ACZA 1COYA 1YQ3A 1QO8A 4OVIA 2C7GA 4XXGA 1CF3A 1JOAA 1GETA 1IUUA 1PBDA 2ZZCA 3I6DA 5KXJA 3NT6A 2YLXA 2YVGA 1BGJA 1KNPA 4H4YA 3CNSA 5BULA 4H2NA 4B69A 1H6VA 3NHOX 4J31A 4BURA 4HB9A 4A99A 1JNRA 1ZOVA 2YLWA 3SFDA 3ICRA 5TR3A 2X3NA 3DJDA 4B68A 4H4XA 2GRTA 2V6OA 1GT8A 4RSLA 4A5LA 4YSXA 3V3OA 4OPCA 4A6NB 3CN8A 2XLUA 2WQYA 1PS9A 1B5QA 4U8IA 1P2EA 3AEBA 4AT0A 4OPTA 3QFBA 1JRZA 3NN0X 1RYIA 1PJ7A 3DH9A 1TRBA 3IC9A 4KX6A 3NKSA 4H4QA 3KKJA 2WDQA 2V3AA 2YWLA 1PN0A 1F3PA 3AE5A 3CPJG 3D8XA 4OPGA 4U8OA 2EQ9A 5EB5A 5HYMA 1NG4A 4OPIA 2B7RA 2BK4A 2FJDA 2R46A 3ITJA 4A9WA 1PBFA 3CGCA 2XLPA 4J56A 2R45A 3R9UA 1F8WA 1KSUA 4ZCDA 5FS9A 2IVEA 3GRSA 1HYUA 5BVAA 2E1MA 5L46A 3VRBA 1FCDA 1OJTA 1YY5A 1KSSA 3NNEA 3ADAB 2BABA 3FBSA 4BJZA 3K7TA 1K0IA 4TM3A 4NZHA 2GR0A 3NYFA 4OPLA 1H82A 1VQWA 3I3LA 4NTDA 3SGLA 3NG7X 4APNA 4UDQA 3IHMA 3NRNA 2BC1A 1OJDA 1PXCA 2VRMA 1CC4A 3OZ2A 3P4RA 4D03A 4AP3A 3NTAA 2GR2A 3AYJA 3UTHA 2W0HA 4RG4A 3CTYA 2FJAA 1LTXR 1CJCA 4U8MA 1LQTA 1OJAA 3RP7A 4U2LA 4TLZA 1E7PA 2APGA 2XCGA 3ALMA 5FS7A 2WDVA 4H4RA 4Y4LA 3RNMA 1M64A 1Q1WA 4K7ZA 5EB4A 2J3NA 4GCMA 1PBCA 2CFYA 2XLTA 4EMWA 3DJJA 1O95A 1YKJA 1XDIA 2GB0A 3G5QA 1GNDA 2VRLA 1LQUA 4H50A 2IVDA 3M0OA 1CBOA 4EM3A 4YT0A 1FOHA 3PO7A 4BJYA 1GTEA 1D5TA 5BUKA 2C66A 3UKHA 4C3YA 3B3RA 4YTNA 1H7XA 3GD3A 2Q0LA 3BHFA 3UP5A 3C4NA 1O94A 2C3CA 4H4VA 4EM4A 1TDKA 1BZLA 3KLJA 1KFYA 1PBEA 3AE1A 4H2PA 4IA5A 4P9SA 4B1BA 2DKIA 3DGZA 5KRQA 3S61A 3LJPA 3REDA 1JU2A 1YQ4A 4EMIA 3O0HA 4TM4A 4D04A 3C4AA 4U2TA 1QJDA 4K5SA 5IQ4A 3CPHG 2GVCA 2VOUA 4A6NA 2C72A 4FK1A 4H4WA 1ONFA 1GRHA 2A8XA 4GR1A 3GD4A 3VRDB 2TPRA 3QFAA 2B9WA 2I0ZA 3BI4A 1KDGA 3ZDNA 1IUTA 3NK2X 3P9UA 4E0VA 3DK4A 4BK3A 4A65A 4AOSA 3ALJA 5KOXA 1PDHA 4Z2UA 2VQBA 1PJ6A 1DOBA 1XHCA 1DXLA 3SM8A 3QSEA 5M10A 4B67A 2V61A 3NH3X 4JQ9A 2BXRA 3NGCX 1NEKA 2JAEA 3SQPA 3GMBA 1ZMCA 3FMWA 3P4PA 3UOZA 2BC0A 4CNKA 4O5QA 3UTEA 1S2YA 4IVMB 2GAGB 1L9EA 1GRAA 3V76A 3GMCA 2BCGG 2C73A 3EPTA 1GRFA 5CKUA 1TDEA 2YM1A 1H86A 5IQ1A 4J34A 1VRQB 2BS3A 1GRTA 2JKCA 3EANA 3URHA 3VR8A 4U8KA 2B76A 2YVJA 3NIXA 4DNAA 4XWZA 1B8SA 1GESA 3CNDA 4AOXA 2Q0KA 2WP9A 2YQUA 4I59A 4PABA 5C3JA 4YTMA 3AEEA 2YG4A 3NTDA 2OLNA 4YKGA 2QA1A 4J2WA 4GDPA 1EBDA 2R0GA 1Q1RA 3NLCA 4XWRA 1L9CA 2V3BA 1N4WA 1TDNA 3CNJA 1ZOYA 2YG7A 3LB8A 1ZKQA 2JB1A 3QSSA 3NN6X 1ZMDA 2VVLA 3GWFA 2B9YA 3T37A 3UCLA 1QLBA 1ZK7A 4K8DA 2EQ7A 3AE7A 1E1KA 3RHAA 5KWFA 3WE0A 2OA1A 4X9MA 2XVHA 2YAUA 5GRTA 1NAAA 4LU6A 5EOWA 1H84A 3L8KA 4RG3A 5JCIA 1P2HA 5C2TA 2GAHB 3UOXA 1Y56B 2OLOA 4FK1C 1XPQA 2YR5A 4EQRA 3V3NA 3P4QA 2HQMA 2GMHA 1H81A 1F8RA 3P4SA 2Y6RA 4C3XA 2DKHA 3QJ4A 2BCPA 5U25A 4YSHA 5HY5A 4Y4MA 2QAEA 4DSHA 2VZ2A 1NDAA 3CGDA 5FS6A 4JN9A 3ATRA 1GERA 2NPXA 1JRYA 1V59A 1MO9A 1VG0A 3ATQA 3AYLA 2XLSA 4BV6A 3CNPA 4OPUA 4OPDA 2ZZBA 2GMJA 4EMJA 2R9ZA 3AEGA 3E1TA 1NG3A 2ZBWA 4TM1A 2TMDA 5CQFA 3AXBA 3S5WA 4TLXA 4CY8A 3DGHA 1LVLA 3AD8B 4ICYA 4K5RA 1GALA 2YLSA 2Q7VA 3H4KA 1NENA 3D1CA 3ISHA 3OC4A 3BI2A 2GQFA 3UKFA 1L9DA 1E39A 4BK2A 3CGBA 1GRGA 3GYJA 5JCNA 3QVRA 4EQXA 2WPEA 2FJBA 3G5SA 1PXBA 2B7SA 2GV8A 3F8RA 4MJWA 2WEUA 1BGNA 3G5RA 4X4JA 1S3BA 2BA9A 1VG9A 2WU5A 1LPFA 3RP6A 1ZY8A 4CY6A 2OALA 1CC6A 1H83A 4UDRA 1O5WA 1F8SA 3AWIA 2XFQA 5FS8A 1PHHA 4GRTA 2C67A 3M13A 1NPXA 3SFEA 2ARDA 4UDPA 1S3EA 2WESA 3LADA
chains in the Genus database with same CATH superfamily
1KF6A 2ZZ0A 3AE6A 1MXTA 1CJ3A 1TYTA 2E4GA 2YM2A 1VDCA 1CJ2A 2Z5XA 3FPZA 1H7WA 1NHSA 4USQA 1EL7A 3T2YA 1D4CA 2E5VA 2XYOA 3GYXA 1IUWA 1GTHA 4GDEA 1GPEA 1K4QA 2Y6QA 2YVFA 3PVCA 1F6MA 4G74A 4I58A 2PYXA 2WPFA 2UZZA 1EL8A 2PHHA 4YXDA 3AYIA 4U2SA 2YG3A 4H4UA 4JNQA 2YLZA 3AD7B 1CHUA 2YLRA 3AE9A 4GAPA 2YR4A 3UKAA 1K0LA 4JDRA 3AEDA 2CDUA 3ALLA 2XVFA 2H89A 1BKWA 2C3DA 2YG5A 5JCLA 1K0JA 4U8PA 1NHRA 1E6EA 1LV0A 4FX9A 2B9XA 3CIRA 4C77A 5GSNA 1ZX9A 2BK3A 4IV9A 5EBKA 2JB3A 2C76A 4DGKA 3GDNA 2V5ZA 3AB1A 2BACA 2WS3A 3FIMB 1DOCA 1ELIA 2H88A 1YQZA 4EIPA 1B37A 1JNZA 1Q9IA 1JRXA 1SEZA 1ZDLA 2JK6A 4JY2A 1Y56A 3SZWA 2WBAA 4EQSA 2WHDA 1DOEA 4O5UA 2XVJA 3AE3A 4CCQA 1PJ5A 2GH5A 1FECA 3DA1A 4Z24A 1N4VA 2RABA 4ADWA 1FEAA 2AAQA 2O9ZA 4CCRA 3GWDA 1ZP0A 1TDFA 2A89A 2X50A 3QSMA 4Y4NA 5JCKA 1AOGA 4HA6A 2WPCA 2X99A 4Z43A 4K2XA 3DK9A 3BHKA 4EIQA 2Z5YA 4B63A 1NHPA 1GV4A 4PAAA 2C4CA 2C70A 2AR8A 2VVMA 3LOVA 3UOVA 3AEAA 3AE8A 3UKPA 4G73A 1DNCA 3K7MX 2YG6A 3KA7A 3GDPA 4X9NA 4JY3A 1MOKA 3AEFA 2A87A 2XDOA 4NEWA 2WOIA 3GRTA 3LZWA 3NK1X 4AP1A 3NYEA 5KOWA 3IHGA 3UKQA 3UP4A 2XFUA 1TYPA 4N9XA 3KU9A 5KNLA 1D7YA 3ABVA 3ICTA 4H2RA 3L1RA 2X8CA 3KVEA 1PBBA 4NTEA 3COXA 2JBVA 4DSGA 4H7UA 5KVHA 5LV9A 2CVJA 2YLTA 4J36A 2X8GA 1Y0PA 3CPIG 4WX1A 5M0ZA 3DMEA 2XVEA 4NEVA 4A7AA 2XLRA 4GUVA 5U63A 3NYCA 5JCMA 1GXFA 1GRBA 2C64A 1L0VA 2AQJA 4KPRA 5J60A 3PS9A 3Q6JA 2WDRA 2XFNA 3H8IA 3K30A 2OAMA 2BS2A 1E1NA 2WOWA 4CRTA 1DJNA 4A79A 3HZLA 4B66A 2FBWA 1EL5A 1IUVA 2RGJA 4H2QA 1REOA 1UKVG 3P1WA 1DODA 3JSKA 3K7QX 1PXAA 5BRTA 4J57A 1DJQA 2EQ6A 4C74A 4BK1A 3LZXA 1IJHA 4OCGA 4YTPA 4ZN0A 1KNRA 1RP0A 3DJGX 4FDCB 3T14A 1CL0A 2R4EA 1GREA 4C5OA 4WCTA 4JNAA 3UTGA 4K22A 4LIIA 5HXIA 2R0CA 4M52A 4Z44A 3H8LA 3M12A 4TM0A 5KVIA 3T0KA 1EL9A 3CGEA 1GOSA 2BYBA 3NK0X 4NTCA 3RP8A 4J33A 3KD9A 3F8PA 4II3A 2GEWA 4IA6A 4H4TA 3EF6A 3ZYXA 4ZCCA 2WU2A 3SY4A 1IUXA 2FJEA 2GF3A 2WP6A 2BK5A 1TDOA 3FG2P 5U1OA 4YSYA 4Z25A 5IPYA 2IIDA 5ER0A 1X31B 1FEBA 4YSZA 3B6DA 1D7LA 3AE2A 4ECHA 4LA1A 2JB2A 1OJ9A 3BNMA 3KPFA 1E1MA 1OJCA 2GR3A 4Z26A 1BF3A 3CNTA 1IUSA 1LJ1A 1M6IA 2XFPA 3AECA 2YR6A 1GEUA 3T2KA 4B65A 4B64A 2VVLG 4G6HA 1XANA 2C65A 2V60A 5HHFA 4EQWA 3UTFA 4II2A 3DJEA 2XVIA 3DK8A 2CULA 4Z2RA 2QA2A 1D4DA 4H4PA 2WETA 2BS4A 4GF7A 5J7XA 2NVKX 2GQWA 4IVOB 1B4VA 1FL2A 2WP5A 1S2QA 4YWOA 2X8HA 4Z2TA 3BNUA 3VQRA 3QVPA 1JEHA 5FMHA 2C75A 3Q9TA 2XFOA 1N1PA 4UP3A 1RSGA 4H4SA 4YKFA 1N4UA 3IWAA 3VR9A 1NHQA 3II4A 2Q6UA 2GR1A 4U8LA 4U8JA 1CC2A 3EAOA 1BWCA 4H4ZA 2RGOA 3IF9A 4USRA 5DBJA 3UOYA 2WOVA 3AE4A 3ICSA 2BXSA 3C96A 3GYIA 4U8NA 4CBQA 4CNJA 1CJ4A 1Z6LA 3VRAA 1D4EA 2RGHA 1W4XA 1GSNA 2R4JA 3LXDA 2QCUA 2F5ZA 2EQ8A 2R0PA 3UKKA 1E1LA 3BI5A 3UKLA 3GSIA 3F8DA 3KPKA 3AD9B 4AT2A 4REKA 2VQ7A 2ACZA 1COYA 1YQ3A 1QO8A 4OVIA 2C7GA 4XXGA 1CF3A 1JOAA 1GETA 1IUUA 1PBDA 2ZZCA 3I6DA 3SXIA 5KXJA 3NT6A 2YLXA 2YVGA 1BGJA 1KNPA 4H4YA 3CNSA 5BULA 4H2NA 3SZCA 3T2ZA 4B69A 1H6VA 3NHOX 4J31A 4BURA 4HB9A 4A99A 1JNRA 1ZOVA 2YLWA 3SFDA 3ICRA 5TR3A 2X3NA 3DJDA 4B68A 4H4XA 2GRTA 2V6OA 1GT8A 4RSLA 4A5LA 4YSXA 3V3OA 4OPCA 4A6NB 3CN8A 2XLUA 2WQYA 1PS9A 1B5QA 4U8IA 1P2EA 3AEBA 4AT0A 4OPTA 3QFBA 1JRZA 3NN0X 1RYIA 1PJ7A 3DH9A 1TRBA 3IC9A 4KX6A 3NKSA 4H4QA 3KKJA 2WDQA 2V3AA 2YWLA 3CMMA 1PN0A 1F3PA 3AE5A 3CPJG 3D8XA 4OPGA 4U8OA 2EQ9A 5EB5A 3T31A 5HYMA 1NG4A 4OPIA 2B7RA 2BK4A 2FJDA 2R46A 3ITJA 4A9WA 4NWZA 1PBFA 3CGCA 2XLPA 4J56A 2R45A 3R9UA 1F8WA 1KSUA 4ZCDA 5FS9A 2IVEA 3GRSA 1HYUA 5BVAA 2E1MA 5L46A 3VRBA 1FCDA 1OJTA 1YY5A 1KSSA 3NNEA 3SX6A 3ADAB 2BABA 3FBSA 5KMRA 4BJZA 3K7TA 1K0IA 4TM3A 4NZHA 2GR0A 3NYFA 4OPLA 1H82A 1VQWA 3SZ0A 3I3LA 4NTDA 3SGLA 3NG7X 4APNA 4UDQA 3IHMA 3NRNA 2BC1A 1OJDA 1PXCA 2VRMA 1CC4A 3OZ2A 3P4RA 4D03A 4AP3A 3NTAA 2GR2A 3AYJA 3UTHA 2W0HA 4RG4A 3CTYA 2FJAA 1LTXR 1CJCA 4U8MA 1LQTA 1OJAA 3RP7A 4U2LA 4TLZA 1E7PA 2APGA 2XCGA 3ALMA 5FS7A 2WDVA 4H4RA 4Y4LA 3RNMA 1M64A 1Q1WA 4G6GA 4K7ZA 5EB4A 2J3NA 4GCMA 1PBCA 2CFYA 2XLTA 4EMWA 3DJJA 1O95A 1YKJA 1XDIA 2GB0A 3G5QA 1GNDA 2VRLA 1LQUA 4H50A 4NNJA 2IVDA 3M0OA 1CBOA 4EM3A 4YT0A 3HYXA 1FOHA 3PO7A 4BJYA 1GTEA 1D5TA 4GAVA 5BUKA 2C66A 3UKHA 4C3YA 3B3RA 4YTNA 1H7XA 3GD3A 2Q0LA 3BHFA 3UP5A 3C4NA 1O94A 2C3CA 4H4VA 4EM4A 1TDKA 1BZLA 3KLJA 1KFYA 1PBEA 3AE1A 4H2PA 4IA5A 4P9SA 4B1BA 2DKIA 3DGZA 5KRQA 3S61A 3LJPA 3REDA 1JU2A 1YQ4A 4EMIA 3O0HA 4TM4A 4D04A 3C4AA 4U2TA 1QJDA 4K5SA 5IQ4A 3CPHG 2GVCA 2VOUA 4A6NA 2C72A 4FK1A 4H4WA 1ONFA 1GRHA 2A8XA 4GR1A 3GD4A 3VRDB 2TPRA 3QFAA 2B9WA 2I0ZA 3BI4A 1KDGA 3ZDNA 1IUTA 3NK2X 3P9UA 4E0VA 3DK4A 4BK3A 4A65A 4AOSA 3ALJA 5KOXA 1PDHA 4Z2UA 2VQBA 1PJ6A 1DOBA 1XHCA 1DXLA 3SM8A 3QSEA 3SZFA 5M10A 4B67A 2V61A 3NH3X 4JQ9A 2BXRA 3NGCX 1NEKA 2JAEA 3SQPA 3GMBA 1ZMCA 3FMWA 3P4PA 3HYVA 2BC0A 3UOZA 4CNKA 4O5QA 3UTEA 1S2YA 4IVMB 4G9KA 2GAGB 1L9EA 3HYWA 1GRAA 3V76A 3GMCA 2BCGG 2C73A 3EPTA 1GRFA 5CKUA 1TDEA 2YM1A 1H86A 5IQ1A 4J34A 1VRQB 2BS3A 1GRTA 2JKCA 3EANA 3URHA 3VR8A 4U8KA 2B76A 2YVJA 3NIXA 4DNAA 4XWZA 1B8SA 1GESA 3CNDA 4AOXA 2Q0KA 2WP9A 2YQUA 4I59A 4PABA 5C3JA 4YTMA 3AEEA 2YG4A 3NTDA 2OLNA 4YKGA 2QA1A 4J2WA 4GDPA 1EBDA 2R0GA 1Q1RA 3NLCA 4XWRA 1L9CA 2V3BA 1N4WA 1TDNA 3CNJA 1ZOYA 2YG7A 3LB8A 1ZKQA 2JB1A 3QSSA 3NN6X 1ZMDA 2VVLA 3GWFA 2B9YA 3T37A 3UCLA 1QLBA 1ZK7A 4K8DA 2EQ7A 3AE7A 1E1KA 3RHAA 5KWFA 3WE0A 2OA1A 4X9MA 2XVHA 2YAUA 5GRTA 1NAAA 4LU6A 5EOWA 1H84A 3L8KA 4RG3A 5JCIA 1P2HA 5C2TA 5KMPA 2GAHB 3UOXA 1Y56B 2OLOA 4FK1C 1XPQA 2YR5A 4EQRA 3V3NA 3P4QA 2HQMA 2GMHA 1H81A 1F8RA 3P4SA 2Y6RA 4C3XA 2DKHA 3QJ4A 2BCPA 5U25A 4YSHA 5HY5A 4Y4MA 2QAEA 4DSHA 2VZ2A 1NDAA 3CGDA 5FS6A 4JN9A 3ATRA 1GERA 2NPXA 1JRYA 1V59A 1MO9A 1VG0A 3ATQA 3AYLA 2XLSA 4BV6A 3SYIA 3CNPA 4OPUA 4OPDA 2ZZBA 2GMJA 4EMJA 2R9ZA 3AEGA 3E1TA 1NG3A 2ZBWA 4TM1A 2TMDA 5KMQA 5CQFA 3AXBA 3S5WA 4TLXA 4CY8A 3DGHA 1LVLA 3AD8B 4ICYA 4K5RA 1GALA 2YLSA 2Q7VA 3H4KA 1NENA 3D1CA 3ISHA 3OC4A 5KMSA 3BI2A 2GQFA 3UKFA 1L9DA 1E39A 4BK2A 3CGBA 1GRGA 3GYJA 5JCNA 3QVRA 4EQXA 2WPEA 2FJBA 3G5SA 1PXBA 2B7SA 2GV8A 3F8RA 4MJWA 2WEUA 1BGNA 3G5RA 4X4JA 1S3BA 2BA9A 1VG9A 2WU5A 1LPFA 3RP6A 1ZY8A 4CY6A 2OALA 1CC6A 1H83A 4UDRA 1O5WA 1F8SA 3AWIA 2XFQA 5FS8A 1PHHA 4GRTA 2C67A 2BRYA 3M13A 1NPXA 3SFEA 2BRAA 2ARDA 4UDPA 1S3EA 2WESA 3LADA
chains in the Genus database with same CATH topology
1KF6A 2ZZ0A 3AE6A 1MXTA 1CJ3A 1TYTA 2E4GA 2YM2A 1VDCA 1CJ2A 2Z5XA 3FPZA 1H7WA 1NHSA 4USQA 1EL7A 3T2YA 1D4CA 2E5VA 2XYOA 3GYXA 1IUWA 1GTHA 4GDEA 1GPEA 1K4QA 2Y6QA 2YVFA 3PVCA 1F6MA 4G74A 4I58A 2PYXA 2WPFA 2UZZA 1EL8A 2PHHA 4YXDA 3AYIA 4U2SA 2YG3A 4H4UA 4JNQA 2YLZA 3AD7B 1CHUA 2YLRA 3AE9A 4GAPA 2YR4A 3UKAA 1K0LA 4JDRA 3AEDA 2CDUA 3ALLA 2XVFA 2H89A 1BKWA 2C3DA 2YG5A 5JCLA 1K0JA 4U8PA 1NHRA 1E6EA 1LV0A 4FX9A 2B9XA 3CIRA 4C77A 5GSNA 1ZX9A 2BK3A 4IV9A 5EBKA 2JB3A 2C76A 4DGKA 3GDNA 2V5ZA 3AB1A 2BACA 2WS3A 3FIMB 1DOCA 1ELIA 2H88A 1YQZA 4EIPA 1B37A 1JNZA 1Q9IA 1JRXA 1SEZA 1ZDLA 2JK6A 4JY2A 1Y56A 3SZWA 2WBAA 4EQSA 2WHDA 1DOEA 4O5UA 2XVJA 3AE3A 4CCQA 1PJ5A 2GH5A 1FECA 3DA1A 4Z24A 1N4VA 2RABA 4ADWA 1FEAA 2AAQA 2O9ZA 4CCRA 3GWDA 1ZP0A 1TDFA 2A89A 2X50A 3QSMA 4Y4NA 5JCKA 1AOGA 4HA6A 2WPCA 2X99A 4Z43A 4K2XA 3DK9A 3BHKA 4EIQA 2Z5YA 4B63A 1NHPA 1GV4A 4PAAA 2C4CA 2C70A 2AR8A 2VVMA 3LOVA 3UOVA 3AEAA 3AE8A 3UKPA 4G73A 1DNCA 3K7MX 2YG6A 3KA7A 3GDPA 4X9NA 4JY3A 1MOKA 3AEFA 2A87A 2XDOA 4NEWA 2WOIA 3GRTA 3LZWA 3NK1X 4AP1A 3NYEA 5KOWA 3IHGA 3UKQA 3UP4A 2XFUA 1TYPA 4N9XA 3KU9A 5KNLA 1D7YA 3ABVA 3ICTA 4H2RA 3L1RA 2X8CA 3KVEA 1PBBA 4NTEA 3COXA 2JBVA 4DSGA 4H7UA 5KVHA 5LV9A 2CVJA 2YLTA 4J36A 2X8GA 1Y0PA 3CPIG 4WX1A 5M0ZA 3DMEA 2XVEA 4NEVA 4A7AA 2XLRA 4GUVA 5U63A 3NYCA 5JCMA 1GXFA 1GRBA 2C64A 1L0VA 2AQJA 4KPRA 5J60A 3PS9A 3Q6JA 2WDRA 2XFNA 3H8IA 3K30A 2OAMA 2BS2A 1E1NA 2WOWA 4CRTA 1DJNA 4A79A 3HZLA 4B66A 2FBWA 1EL5A 1IUVA 2RGJA 4H2QA 1REOA 1UKVG 3P1WA 1DODA 3JSKA 3K7QX 1PXAA 5BRTA 4J57A 1DJQA 2EQ6A 4C74A 4BK1A 3LZXA 1IJHA 4OCGA 4YTPA 4ZN0A 1KNRA 1RP0A 3DJGX 4FDCB 3T14A 1CL0A 2R4EA 1GREA 4C5OA 4WCTA 4JNAA 3UTGA 4K22A 4LIIA 5HXIA 2R0CA 4M52A 4Z44A 3H8LA 3M12A 4TM0A 5KVIA 3T0KA 1EL9A 3CGEA 1GOSA 2BYBA 3NK0X 4NTCA 3RP8A 4J33A 3KD9A 3F8PA 4II3A 2GEWA 4IA6A 4H4TA 3EF6A 3ZYXA 4ZCCA 2WU2A 3SY4A 1IUXA 2FJEA 2GF3A 2WP6A 2BK5A 1TDOA 3FG2P 5U1OA 4YSYA 4Z25A 5IPYA 2IIDA 5ER0A 1X31B 1FEBA 4YSZA 3B6DA 1D7LA 3AE2A 4ECHA 4LA1A 2JB2A 1OJ9A 3BNMA 3KPFA 1E1MA 1OJCA 2GR3A 4Z26A 1BF3A 3CNTA 1IUSA 1LJ1A 1M6IA 2XFPA 3AECA 2YR6A 1GEUA 3T2KA 4B65A 4B64A 2VVLG 4G6HA 1XANA 2C65A 2V60A 5HHFA 4EQWA 3UTFA 4II2A 3DJEA 2XVIA 3DK8A 2CULA 4Z2RA 2QA2A 1D4DA 4H4PA 2WETA 2BS4A 4GF7A 5J7XA 2NVKX 2GQWA 4IVOB 1B4VA 1FL2A 2WP5A 1S2QA 4YWOA 2X8HA 4Z2TA 3BNUA 3VQRA 3QVPA 1JEHA 5FMHA 2C75A 3Q9TA 2XFOA 1N1PA 4UP3A 1RSGA 4H4SA 4YKFA 1N4UA 3IWAA 3VR9A 1NHQA 3II4A 2Q6UA 2GR1A 4U8LA 4U8JA 1CC2A 3EAOA 1BWCA 4H4ZA 2RGOA 3IF9A 4USRA 5DBJA 3UOYA 2WOVA 3AE4A 3ICSA 2BXSA 3C96A 3GYIA 4U8NA 4CBQA 4CNJA 1CJ4A 1Z6LA 3VRAA 1D4EA 2RGHA 1W4XA 1GSNA 2R4JA 3LXDA 2QCUA 2F5ZA 2EQ8A 2R0PA 3UKKA 1E1LA 3BI5A 3UKLA 3GSIA 3F8DA 3KPKA 3AD9B 4AT2A 4REKA 2VQ7A 2ACZA 1COYA 1YQ3A 1QO8A 4OVIA 2C7GA 4XXGA 1CF3A 1JOAA 1GETA 1IUUA 1PBDA 2ZZCA 3I6DA 3SXIA 5KXJA 3NT6A 2YLXA 2YVGA 1BGJA 1KNPA 4H4YA 3CNSA 5BULA 4H2NA 3SZCA 3T2ZA 4B69A 1H6VA 3NHOX 4J31A 4BURA 4HB9A 4A99A 1JNRA 1ZOVA 2YLWA 3SFDA 3ICRA 5TR3A 2X3NA 3DJDA 4B68A 4H4XA 2GRTA 2V6OA 1GT8A 4RSLA 4A5LA 4YSXA 3V3OA 4OPCA 4A6NB 3CN8A 2XLUA 2WQYA 1PS9A 1B5QA 4U8IA 1P2EA 3AEBA 4AT0A 4OPTA 3QFBA 1JRZA 3NN0X 1RYIA 1PJ7A 3DH9A 1TRBA 3IC9A 4KX6A 3NKSA 4H4QA 3KKJA 2WDQA 2V3AA 2YWLA 3CMMA 1PN0A 1F3PA 3AE5A 3CPJG 3D8XA 4OPGA 4U8OA 2EQ9A 5EB5A 3T31A 5HYMA 1NG4A 4OPIA 2B7RA 2BK4A 2FJDA 2R46A 3ITJA 4A9WA 4NWZA 1PBFA 3CGCA 2XLPA 4J56A 2R45A 3R9UA 1F8WA 1KSUA 4ZCDA 5FS9A 2IVEA 3GRSA 1HYUA 5BVAA 2E1MA 5L46A 3VRBA 1FCDA 1OJTA 1YY5A 1KSSA 3NNEA 3SX6A 3ADAB 2BABA 3FBSA 5KMRA 4BJZA 3K7TA 1K0IA 4TM3A 4NZHA 2GR0A 3NYFA 4OPLA 1H82A 1VQWA 3SZ0A 3I3LA 4NTDA 3SGLA 3NG7X 4APNA 4UDQA 3IHMA 3NRNA 2BC1A 1OJDA 1PXCA 2VRMA 1CC4A 3OZ2A 3P4RA 4D03A 4AP3A 3NTAA 2GR2A 3AYJA 3UTHA 2W0HA 4RG4A 3CTYA 2FJAA 1LTXR 1CJCA 4U8MA 1LQTA 1OJAA 3RP7A 4U2LA 4TLZA 1E7PA 2APGA 2XCGA 3ALMA 5FS7A 2WDVA 4H4RA 4Y4LA 3RNMA 1M64A 1Q1WA 4G6GA 4K7ZA 5EB4A 2J3NA 4GCMA 1PBCA 2CFYA 2XLTA 4EMWA 3DJJA 1O95A 1YKJA 1XDIA 2GB0A 3G5QA 1GNDA 2VRLA 1LQUA 4H50A 4NNJA 2IVDA 3M0OA 1CBOA 4EM3A 4YT0A 3HYXA 1FOHA 3PO7A 4BJYA 1GTEA 1D5TA 4GAVA 5BUKA 2C66A 3UKHA 4C3YA 3B3RA 4YTNA 1H7XA 3GD3A 2Q0LA 3BHFA 3UP5A 3C4NA 1O94A 2C3CA 4H4VA 4EM4A 1TDKA 1BZLA 3KLJA 1KFYA 1PBEA 3AE1A 4H2PA 4IA5A 4P9SA 4B1BA 2DKIA 3DGZA 5KRQA 3S61A 3LJPA 3REDA 1JU2A 1YQ4A 4EMIA 3O0HA 4TM4A 4D04A 3C4AA 4U2TA 1QJDA 4K5SA 5IQ4A 3CPHG 2GVCA 2VOUA 4A6NA 2C72A 4FK1A 4H4WA 1ONFA 1GRHA 2A8XA 4GR1A 3GD4A 3VRDB 2TPRA 3QFAA 2B9WA 2I0ZA 3BI4A 1KDGA 3ZDNA 1IUTA 3NK2X 3P9UA 4E0VA 3DK4A 4BK3A 4A65A 4AOSA 3ALJA 5KOXA 1PDHA 4Z2UA 2VQBA 1PJ6A 1DOBA 1XHCA 1DXLA 3SM8A 3QSEA 3SZFA 5M10A 4B67A 2V61A 3NH3X 4JQ9A 2BXRA 3NGCX 1NEKA 2JAEA 3SQPA 3GMBA 1ZMCA 3FMWA 3P4PA 3HYVA 2BC0A 3UOZA 4CNKA 4O5QA 3UTEA 1S2YA 4IVMB 4G9KA 2GAGB 1L9EA 3HYWA 1GRAA 3V76A 3GMCA 2BCGG 2C73A 3EPTA 1GRFA 5CKUA 1TDEA 2YM1A 1H86A 5IQ1A 4J34A 1VRQB 2BS3A 1GRTA 2JKCA 3EANA 3URHA 3VR8A 4U8KA 2B76A 2YVJA 3NIXA 4DNAA 4XWZA 1B8SA 1GESA 3CNDA 4AOXA 2Q0KA 2WP9A 2YQUA 4I59A 4PABA 5C3JA 4YTMA 3AEEA 2YG4A 3NTDA 2OLNA 4YKGA 2QA1A 4J2WA 4GDPA 1EBDA 2R0GA 1Q1RA 3NLCA 4XWRA 1L9CA 2V3BA 1N4WA 1TDNA 3CNJA 1ZOYA 2YG7A 3LB8A 1ZKQA 2JB1A 3QSSA 3NN6X 1ZMDA 2VVLA 3GWFA 2B9YA 3T37A 3UCLA 1QLBA 1ZK7A 4K8DA 2EQ7A 3AE7A 1E1KA 3RHAA 5KWFA 3WE0A 2OA1A 4X9MA 2XVHA 2YAUA 5GRTA 1NAAA 4LU6A 5EOWA 1H84A 3L8KA 4RG3A 5JCIA 1P2HA 5C2TA 5KMPA 2GAHB 3UOXA 1Y56B 2OLOA 4FK1C 1XPQA 2YR5A 4EQRA 3V3NA 3P4QA 2HQMA 2GMHA 1H81A 1F8RA 3P4SA 2Y6RA 4C3XA 2DKHA 3QJ4A 2BCPA 5U25A 4YSHA 5HY5A 4Y4MA 2QAEA 4DSHA 2VZ2A 1NDAA 3CGDA 5FS6A 4JN9A 3ATRA 1GERA 2NPXA 1JRYA 1V59A 1MO9A 1VG0A 3ATQA 3AYLA 2XLSA 4BV6A 3SYIA 3CNPA 4OPUA 4OPDA 2ZZBA 2GMJA 4EMJA 2R9ZA 3AEGA 3E1TA 1NG3A 2ZBWA 4TM1A 2TMDA 5KMQA 5CQFA 3AXBA 3S5WA 4TLXA 4CY8A 3DGHA 1LVLA 3AD8B 4ICYA 4K5RA 1GALA 2YLSA 2Q7VA 3H4KA 1NENA 3D1CA 3ISHA 3OC4A 5KMSA 3BI2A 2GQFA 3UKFA 1L9DA 1E39A 4BK2A 3CGBA 1GRGA 3GYJA 5JCNA 3QVRA 4EQXA 2WPEA 2FJBA 3G5SA 1PXBA 2B7SA 2GV8A 3F8RA 4MJWA 2WEUA 1BGNA 3G5RA 4X4JA 1S3BA 2BA9A 1VG9A 2WU5A 1LPFA 3RP6A 1ZY8A 4CY6A 2OALA 1CC6A 1H83A 4UDRA 1O5WA 1F8SA 3AWIA 2XFQA 5FS8A 1PHHA 4GRTA 2C67A 2BRYA 3M13A 1NPXA 3SFEA 2BRAA 2ARDA 4UDPA 1S3EA 2WESA 3LADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KF6 A;  2ZZ0 A;  3AE6 A;  1MXT A;  1CJ3 A;  1TYT A;  2E4G A;  2YM2 A;  1VDC A;  1CJ2 A;  2Z5X A;  3FPZ A;  1H7W A;  1NHS A;  4USQ A;  1EL7 A;  1D4C A;  2E5V A;  2XYO A;  1IUW A;  1GTH A;  4GDE A;  1GPE A;  1K4Q A;  2Y6Q A;  2YVF A;  3PVC A;  1F6M A;  4I58 A;  2PYX A;  2WPF A;  2UZZ A;  1EL8 A;  2PHH A;  4YXD A;  3AYI A;  4U2S A;  2YG3 A;  4H4U A;  4JNQ A;  2YLZ A;  3AD7 B;  1CHU A;  2YLR A;  3AE9 A;  2YR4 A;  3UKA A;  1K0L A;  4JDR A;  3AED A;  2CDU A;  3ALL A;  2XVF A;  2H89 A;  1BKW A;  2C3D A;  2YG5 A;  5JCL A;  1K0J A;  4U8P A;  1NHR A;  1E6E A;  1LV0 A;  4FX9 A;  2B9X A;  3CIR A;  4C77 A;  5GSN A;  1ZX9 A;  2BK3 A;  4IV9 A;  5EBK A;  2JB3 A;  2C76 A;  4DGK A;  3GDN A;  2V5Z A;  3AB1 A;  2BAC A;  2WS3 A;  3FIM B;  1DOC A;  1ELI A;  2H88 A;  1YQZ A;  4EIP A;  1B37 A;  1JNZ A;  1Q9I A;  1JRX A;  1SEZ A;  1ZDL A;  2JK6 A;  4JY2 A;  1Y56 A;  2WBA A;  4EQS A;  2WHD A;  1DOE A;  4O5U A;  2XVJ A;  3AE3 A;  4CCQ A;  1PJ5 A;  2GH5 A;  1FEC A;  3DA1 A;  4Z24 A;  1N4V A;  2RAB A;  4ADW A;  1FEA A;  2AAQ A;  2O9Z A;  4CCR A;  3GWD A;  1ZP0 A;  1TDF A;  2A89 A;  2X50 A;  3QSM A;  4Y4N A;  5JCK A;  1AOG A;  4HA6 A;  2WPC A;  2X99 A;  4Z43 A;  4K2X A;  3DK9 A;  3BHK A;  4EIQ A;  2Z5Y A;  4B63 A;  1NHP A;  1GV4 A;  4PAA A;  2C70 A;  2AR8 A;  2VVM A;  3LOV A;  3UOV A;  3AEA A;  3AE8 A;  3UKP A;  1DNC A;  3K7M X;  2YG6 A;  3KA7 A;  3GDP A;  4X9N A;  4JY3 A;  1MOK A;  3AEF A;  2A87 A;  2XDO A;  4NEW A;  2WOI A;  3GRT A;  3LZW A;  3NK1 X;  4AP1 A;  3NYE A;  5KOW A;  3IHG A;  3UKQ A;  3UP4 A;  2XFU A;  1TYP A;  4N9X A;  3KU9 A;  1D7Y A;  3ABV A;  3ICT A;  4H2R A;  3L1R A;  2X8C A;  3KVE A;  1PBB A;  4NTE A;  3COX A;  2JBV A;  4DSG A;  4H7U A;  5KVH A;  5LV9 A;  2CVJ A;  2YLT A;  4J36 A;  2X8G A;  1Y0P A;  3CPI G;  4WX1 A;  5M0Z A;  3DME A;  2XVE A;  4NEV A;  4A7A A;  2XLR A;  4GUV A;  5U63 A;  3NYC A;  5JCM A;  1GXF A;  1GRB A;  2C64 A;  1L0V A;  2AQJ A;  4KPR A;  5J60 A;  3PS9 A;  3Q6J A;  2WDR A;  2XFN A;  3H8I A;  3K30 A;  2OAM A;  2BS2 A;  1E1N A;  2WOW A;  4CRT A;  1DJN A;  4A79 A;  3HZL A;  4B66 A;  2FBW A;  1EL5 A;  1IUV A;  2RGJ A;  4H2Q A;  1REO A;  1UKV G;  3P1W A;  1DOD A;  3JSK A;  3K7Q X;  1PXA A;  5BRT A;  4J57 A;  1DJQ A;  2EQ6 A;  4C74 A;  4BK1 A;  3LZX A;  1IJH A;  4OCG A;  4YTP A;  4ZN0 A;  1KNR A;  1RP0 A;  3DJG X;  4FDC B;  1CL0 A;  2R4E A;  1GRE A;  4C5O A;  4WCT A;  4JNA A;  3UTG A;  4K22 A;  4LII A;  5HXI A;  2R0C A;  4M52 A;  4Z44 A;  3H8L A;  3M12 A;  4TM0 A;  5KVI A;  1EL9 A;  3CGE A;  1GOS A;  2BYB A;  3NK0 X;  4NTC A;  3RP8 A;  4J33 A;  3KD9 A;  3F8P A;  2GEW A;  4IA6 A;  4H4T A;  3EF6 A;  3ZYX A;  4ZCC A;  2WU2 A;  1IUX A;  2FJE A;  2GF3 A;  2WP6 A;  2BK5 A;  1TDO A;  3FG2 P;  5U1O A;  4YSY A;  4Z25 A;  5IPY A;  2IID A;  5ER0 A;  1X31 B;  1FEB A;  4YSZ A;  3B6D A;  1D7L A;  3AE2 A;  4ECH A;  4LA1 A;  2JB2 A;  1OJ9 A;  3BNM A;  3KPF A;  1E1M A;  1OJC A;  2GR3 A;  4Z26 A;  1BF3 A;  3CNT A;  1IUS A;  1LJ1 A;  1M6I A;  2XFP A;  3AEC A;  2YR6 A;  1GEU A;  4B65 A;  4B64 A;  2VVL G;  1XAN A;  2C65 A;  2V60 A;  5HHF A;  4EQW A;  3UTF A;  3DJE A;  2XVI A;  3DK8 A;  2CUL A;  4Z2R A;  2QA2 A;  1D4D A;  4H4P A;  2WET A;  2BS4 A;  4GF7 A;  5J7X A;  2NVK X;  2GQW A;  4IVO B;  1B4V A;  1FL2 A;  2WP5 A;  1S2Q A;  4YWO A;  2X8H A;  4Z2T A;  3BNU A;  3VQR A;  3QVP A;  1JEH A;  5FMH A;  2C75 A;  3Q9T A;  2XFO A;  1N1P A;  4UP3 A;  1RSG A;  4H4S A;  4YKF A;  1N4U A;  3IWA A;  3VR9 A;  1NHQ A;  3II4 A;  2Q6U A;  2GR1 A;  4U8L A;  4U8J A;  1CC2 A;  3EAO A;  1BWC A;  4H4Z A;  2RGO A;  3IF9 A;  4USR A;  5DBJ A;  3UOY A;  2WOV A;  3AE4 A;  3ICS A;  2BXS A;  3C96 A;  3GYI A;  4U8N A;  4CBQ A;  4CNJ A;  1CJ4 A;  1Z6L A;  3VRA A;  1D4E A;  2RGH A;  1W4X A;  1GSN A;  2R4J A;  3LXD A;  2QCU A;  2F5Z A;  2EQ8 A;  2R0P A;  3UKK A;  1E1L A;  3BI5 A;  3UKL A;  3GSI A;  3F8D A;  3AD9 B;  4AT2 A;  4REK A;  2VQ7 A;  2ACZ A;  1COY A;  1YQ3 A;  1QO8 A;  4OVI A;  2C7G A;  4XXG A;  1CF3 A;  1JOA A;  1GET A;  1IUU A;  1PBD A;  2ZZC A;  3I6D A;  5KXJ A;  3NT6 A;  2YLX A;  2YVG A;  1BGJ A;  1KNP A;  4H4Y A;  3CNS A;  5BUL A;  4H2N A;  4B69 A;  1H6V A;  3NHO X;  4J31 A;  4BUR A;  4HB9 A;  4A99 A;  1JNR A;  1ZOV A;  2YLW A;  3SFD A;  3ICR A;  5TR3 A;  2X3N A;  3DJD A;  4B68 A;  4H4X A;  2GRT A;  2V6O A;  1GT8 A;  4RSL A;  4A5L A;  4YSX A;  3V3O A;  4OPC A;  4A6N B;  3CN8 A;  2XLU A;  2WQY A;  1PS9 A;  1B5Q A;  4U8I A;  1P2E A;  3AEB A;  4AT0 A;  4OPT A;  3QFB A;  1JRZ A;  3NN0 X;  1RYI A;  1PJ7 A;  3DH9 A;  1TRB A;  3IC9 A;  4KX6 A;  3NKS A;  4H4Q A;  3KKJ A;  2WDQ A;  2V3A A;  2YWL A;  1PN0 A;  1F3P A;  3AE5 A;  3CPJ G;  3D8X A;  4OPG A;  4U8O A;  2EQ9 A;  5EB5 A;  5HYM A;  1NG4 A;  4OPI A;  2B7R A;  2BK4 A;  2FJD A;  2R46 A;  3ITJ A;  4A9W A;  1PBF A;  3CGC A;  2XLP A;  4J56 A;  2R45 A;  3R9U A;  1F8W A;  1KSU A;  4ZCD A;  5FS9 A;  2IVE A;  3GRS A;  1HYU A;  5BVA A;  2E1M A;  5L46 A;  3VRB A;  1FCD A;  1OJT A;  1YY5 A;  1KSS A;  3NNE A;  3ADA B;  2BAB A;  3FBS A;  4BJZ A;  3K7T A;  1K0I A;  4TM3 A;  4NZH A;  2GR0 A;  3NYF A;  4OPL A;  1H82 A;  1VQW A;  3I3L A;  4NTD A;  3SGL A;  3NG7 X;  4APN A;  4UDQ A;  3IHM A;  3NRN A;  2BC1 A;  1OJD A;  1PXC A;  2VRM A;  1CC4 A;  3OZ2 A;  3P4R A;  4D03 A;  4AP3 A;  3NTA A;  2GR2 A;  3AYJ A;  3UTH A;  2W0H A;  4RG4 A;  3CTY A;  2FJA A;  1LTX R;  1CJC A;  4U8M A;  1LQT A;  1OJA A;  3RP7 A;  4U2L A;  4TLZ A;  1E7P A;  2APG A;  2XCG A;  3ALM A;  5FS7 A;  2WDV A;  4H4R A;  4Y4L A;  3RNM A;  1M64 A;  1Q1W A;  4K7Z A;  5EB4 A;  2J3N A;  4GCM A;  1PBC A;  2CFY A;  2XLT A;  4EMW A;  3DJJ A;  1O95 A;  1YKJ A;  1XDI A;  2GB0 A;  3G5Q A;  1GND A;  2VRL A;  1LQU A;  4H50 A;  2IVD A;  3M0O A;  1CBO A;  4EM3 A;  4YT0 A;  1FOH A;  3PO7 A;  4BJY A;  1GTE A;  1D5T A;  5BUK A;  2C66 A;  3UKH A;  4C3Y A;  3B3R A;  4YTN A;  1H7X A;  3GD3 A;  2Q0L A;  3BHF A;  3UP5 A;  3C4N A;  1O94 A;  2C3C A;  4H4V A;  4EM4 A;  1TDK A;  1BZL A;  3KLJ A;  1KFY A;  1PBE A;  3AE1 A;  4H2P A;  4IA5 A;  4P9S A;  4B1B A;  2DKI A;  3DGZ A;  5KRQ A;  3S61 A;  3LJP A;  3RED A;  1JU2 A;  1YQ4 A;  4EMI A;  3O0H A;  4TM4 A;  4D04 A;  3C4A A;  4U2T A;  1QJD A;  4K5S A;  5IQ4 A;  3CPH G;  2GVC A;  2VOU A;  4A6N A;  2C72 A;  4FK1 A;  4H4W A;  1ONF A;  1GRH A;  2A8X A;  4GR1 A;  3GD4 A;  3VRD B;  2TPR A;  3QFA A;  2B9W A;  2I0Z A;  3BI4 A;  1KDG A;  3ZDN A;  1IUT A;  3NK2 X;  3P9U A;  4E0V A;  3DK4 A;  4BK3 A;  4A65 A;  4AOS A;  3ALJ A;  5KOX A;  1PDH A;  4Z2U A;  2VQB A;  1PJ6 A;  1DOB A;  1XHC A;  1DXL A;  3SM8 A;  3QSE A;  5M10 A;  4B67 A;  2V61 A;  3NH3 X;  4JQ9 A;  2BXR A;  3NGC X;  1NEK A;  2JAE A;  3SQP A;  3GMB A;  1ZMC A;  3FMW A;  3P4P A;  3UOZ A;  2BC0 A;  4CNK A;  4O5Q A;  3UTE A;  1S2Y A;  4IVM B;  2GAG B;  1L9E A;  1GRA A;  3V76 A;  3GMC A;  2BCG G;  2C73 A;  3EPT A;  1GRF A;  5CKU A;  1TDE A;  2YM1 A;  1H86 A;  5IQ1 A;  4J34 A;  1VRQ B;  2BS3 A;  1GRT A;  2JKC A;  3EAN A;  3URH A;  3VR8 A;  4U8K A;  2B76 A;  2YVJ A;  3NIX A;  4DNA A;  4XWZ A;  1B8S A;  1GES A;  3CND A;  4AOX A;  2Q0K A;  2WP9 A;  2YQU A;  4I59 A;  4PAB A;  5C3J A;  4YTM A;  3AEE A;  2YG4 A;  3NTD A;  2OLN A;  4YKG A;  2QA1 A;  4J2W A;  4GDP A;  1EBD A;  2R0G A;  1Q1R A;  3NLC A;  4XWR A;  1L9C A;  2V3B A;  1N4W A;  1TDN A;  3CNJ A;  1ZOY A;  2YG7 A;  3LB8 A;  1ZKQ A;  2JB1 A;  3QSS A;  3NN6 X;  1ZMD A;  2VVL A;  3GWF A;  2B9Y A;  3T37 A;  3UCL A;  1QLB A;  1ZK7 A;  4K8D A;  2EQ7 A;  3AE7 A;  1E1K A;  3RHA A;  5KWF A;  3WE0 A;  2OA1 A;  4X9M A;  2XVH A;  2YAU A;  5GRT A;  1NAA A;  4LU6 A;  5EOW A;  1H84 A;  3L8K A;  4RG3 A;  5JCI A;  1P2H A;  5C2T A;  2GAH B;  3UOX A;  1Y56 B;  2OLO A;  4FK1 C;  1XPQ A;  2YR5 A;  4EQR A;  3V3N A;  3P4Q A;  2HQM A;  2GMH A;  1H81 A;  1F8R A;  3P4S A;  2Y6R A;  4C3X A;  2DKH A;  3QJ4 A;  2BCP A;  5U25 A;  4YSH A;  5HY5 A;  4Y4M A;  2QAE A;  4DSH A;  2VZ2 A;  1NDA A;  3CGD A;  5FS6 A;  4JN9 A;  3ATR A;  1GER A;  2NPX A;  1JRY A;  1V59 A;  1MO9 A;  1VG0 A;  3ATQ A;  3AYL A;  2XLS A;  4BV6 A;  3CNP A;  4OPU A;  4OPD A;  2ZZB A;  2GMJ A;  4EMJ A;  2R9Z A;  3AEG A;  3E1T A;  1NG3 A;  2ZBW A;  4TM1 A;  2TMD A;  5CQF A;  3AXB A;  3S5W A;  4TLX A;  4CY8 A;  3DGH A;  1LVL A;  3AD8 B;  4ICY A;  4K5R A;  1GAL A;  2YLS A;  2Q7V A;  3H4K A;  1NEN A;  3D1C A;  3ISH A;  3OC4 A;  3BI2 A;  2GQF A;  3UKF A;  1L9D A;  1E39 A;  4BK2 A;  3CGB A;  1GRG A;  3GYJ A;  5JCN A;  3QVR A;  4EQX A;  2WPE A;  2FJB A;  3G5S A;  1PXB A;  2B7S A;  2GV8 A;  3F8R A;  4MJW A;  2WEU A;  1BGN A;  3G5R A;  4X4J A;  1S3B A;  2BA9 A;  1VG9 A;  2WU5 A;  1LPF A;  3RP6 A;  1ZY8 A;  4CY6 A;  2OAL A;  1CC6 A;  1H83 A;  4UDR A;  1O5W A;  1F8S A;  3AWI A;  2XFQ A;  5FS8 A;  1PHH A;  4GRT A;  2C67 A;  3M13 A;  1NPX A;  3SFE A;  2ARD A;  4UDP A;  1S3E A;  2WES A;  3LAD A; 
#chains in the Genus database with same CATH topology
 1KF6 A;  2ZZ0 A;  3AE6 A;  1MXT A;  1CJ3 A;  1TYT A;  2E4G A;  2YM2 A;  1VDC A;  1CJ2 A;  2Z5X A;  3FPZ A;  1H7W A;  1NHS A;  4USQ A;  1EL7 A;  3T2Y A;  1D4C A;  2E5V A;  2XYO A;  3GYX A;  1IUW A;  1GTH A;  4GDE A;  1GPE A;  1K4Q A;  2Y6Q A;  2YVF A;  3PVC A;  1F6M A;  4G74 A;  4I58 A;  2PYX A;  2WPF A;  2UZZ A;  1EL8 A;  2PHH A;  4YXD A;  3AYI A;  4U2S A;  2YG3 A;  4H4U A;  4JNQ A;  2YLZ A;  3AD7 B;  1CHU A;  2YLR A;  3AE9 A;  4GAP A;  2YR4 A;  3UKA A;  1K0L A;  4JDR A;  3AED A;  2CDU A;  3ALL A;  2XVF A;  2H89 A;  1BKW A;  2C3D A;  2YG5 A;  5JCL A;  1K0J A;  4U8P A;  1NHR A;  1E6E A;  1LV0 A;  4FX9 A;  2B9X A;  3CIR A;  4C77 A;  5GSN A;  1ZX9 A;  2BK3 A;  4IV9 A;  5EBK A;  2JB3 A;  2C76 A;  4DGK A;  3GDN A;  2V5Z A;  3AB1 A;  2BAC A;  2WS3 A;  3FIM B;  1DOC A;  1ELI A;  2H88 A;  1YQZ A;  4EIP A;  1B37 A;  1JNZ A;  1Q9I A;  1JRX A;  1SEZ A;  1ZDL A;  2JK6 A;  4JY2 A;  1Y56 A;  3SZW A;  2WBA A;  4EQS A;  2WHD A;  1DOE A;  4O5U A;  2XVJ A;  3AE3 A;  4CCQ A;  1PJ5 A;  2GH5 A;  1FEC A;  3DA1 A;  4Z24 A;  1N4V A;  2RAB A;  4ADW A;  1FEA A;  2AAQ A;  2O9Z A;  4CCR A;  3GWD A;  1ZP0 A;  1TDF A;  2A89 A;  2X50 A;  3QSM A;  4Y4N A;  5JCK A;  1AOG A;  4HA6 A;  2WPC A;  2X99 A;  4Z43 A;  4K2X A;  3DK9 A;  3BHK A;  4EIQ A;  2Z5Y A;  4B63 A;  1NHP A;  1GV4 A;  4PAA A;  2C4C A;  2C70 A;  2AR8 A;  2VVM A;  3LOV A;  3UOV A;  3AEA A;  3AE8 A;  3UKP A;  4G73 A;  1DNC A;  3K7M X;  2YG6 A;  3KA7 A;  3GDP A;  4X9N A;  4JY3 A;  1MOK A;  3AEF A;  2A87 A;  2XDO A;  4NEW A;  2WOI A;  3GRT A;  3LZW A;  3NK1 X;  4AP1 A;  3NYE A;  5KOW A;  3IHG A;  3UKQ A;  3UP4 A;  2XFU A;  1TYP A;  4N9X A;  3KU9 A;  5KNL A;  1D7Y A;  3ABV A;  3ICT A;  4H2R A;  3L1R A;  2X8C A;  3KVE A;  1PBB A;  4NTE A;  3COX A;  2JBV A;  4DSG A;  4H7U A;  5KVH A;  5LV9 A;  2CVJ A;  2YLT A;  4J36 A;  2X8G A;  1Y0P A;  3CPI G;  4WX1 A;  5M0Z A;  3DME A;  2XVE A;  4NEV A;  4A7A A;  2XLR A;  4GUV A;  5U63 A;  3NYC A;  5JCM A;  1GXF A;  1GRB A;  2C64 A;  1L0V A;  2AQJ A;  4KPR A;  5J60 A;  3PS9 A;  3Q6J A;  2WDR A;  2XFN A;  3H8I A;  3K30 A;  2OAM A;  2BS2 A;  1E1N A;  2WOW A;  4CRT A;  1DJN A;  4A79 A;  3HZL A;  4B66 A;  2FBW A;  1EL5 A;  1IUV A;  2RGJ A;  4H2Q A;  1REO A;  1UKV G;  3P1W A;  1DOD A;  3JSK A;  3K7Q X;  1PXA A;  5BRT A;  4J57 A;  1DJQ A;  2EQ6 A;  4C74 A;  4BK1 A;  3LZX A;  1IJH A;  4OCG A;  4YTP A;  4ZN0 A;  1KNR A;  1RP0 A;  3DJG X;  4FDC B;  3T14 A;  1CL0 A;  2R4E A;  1GRE A;  4C5O A;  4WCT A;  4JNA A;  3UTG A;  4K22 A;  4LII A;  5HXI A;  2R0C A;  4M52 A;  4Z44 A;  3H8L A;  3M12 A;  4TM0 A;  5KVI A;  3T0K A;  1EL9 A;  3CGE A;  1GOS A;  2BYB A;  3NK0 X;  4NTC A;  3RP8 A;  4J33 A;  3KD9 A;  3F8P A;  4II3 A;  2GEW A;  4IA6 A;  4H4T A;  3EF6 A;  3ZYX A;  4ZCC A;  2WU2 A;  3SY4 A;  1IUX A;  2FJE A;  2GF3 A;  2WP6 A;  2BK5 A;  1TDO A;  3FG2 P;  5U1O A;  4YSY A;  4Z25 A;  5IPY A;  2IID A;  5ER0 A;  1X31 B;  1FEB A;  4YSZ A;  3B6D A;  1D7L A;  3AE2 A;  4ECH A;  4LA1 A;  2JB2 A;  1OJ9 A;  3BNM A;  3KPF A;  1E1M A;  1OJC A;  2GR3 A;  4Z26 A;  1BF3 A;  3CNT A;  1IUS A;  1LJ1 A;  1M6I A;  2XFP A;  3AEC A;  2YR6 A;  1GEU A;  3T2K A;  4B65 A;  4B64 A;  2VVL G;  4G6H A;  1XAN A;  2C65 A;  2V60 A;  5HHF A;  4EQW A;  3UTF A;  4II2 A;  3DJE A;  2XVI A;  3DK8 A;  2CUL A;  4Z2R A;  2QA2 A;  1D4D A;  4H4P A;  2WET A;  2BS4 A;  4GF7 A;  5J7X A;  2NVK X;  2GQW A;  4IVO B;  1B4V A;  1FL2 A;  2WP5 A;  1S2Q A;  4YWO A;  2X8H A;  4Z2T A;  3BNU A;  3VQR A;  3QVP A;  1JEH A;  5FMH A;  2C75 A;  3Q9T A;  2XFO A;  1N1P A;  4UP3 A;  1RSG A;  4H4S A;  4YKF A;  1N4U A;  3IWA A;  3VR9 A;  1NHQ A;  3II4 A;  2Q6U A;  2GR1 A;  4U8L A;  4U8J A;  1CC2 A;  3EAO A;  1BWC A;  4H4Z A;  2RGO A;  3IF9 A;  4USR A;  5DBJ A;  3UOY A;  2WOV A;  3AE4 A;  3ICS A;  2BXS A;  3C96 A;  3GYI A;  4U8N A;  4CBQ A;  4CNJ A;  1CJ4 A;  1Z6L A;  3VRA A;  1D4E A;  2RGH A;  1W4X A;  1GSN A;  2R4J A;  3LXD A;  2QCU A;  2F5Z A;  2EQ8 A;  2R0P A;  3UKK A;  1E1L A;  3BI5 A;  3UKL A;  3GSI A;  3F8D A;  3KPK A;  3AD9 B;  4AT2 A;  4REK A;  2VQ7 A;  2ACZ A;  1COY A;  1YQ3 A;  1QO8 A;  4OVI A;  2C7G A;  4XXG A;  1CF3 A;  1JOA A;  1GET A;  1IUU A;  1PBD A;  2ZZC A;  3I6D A;  3SXI A;  5KXJ A;  3NT6 A;  2YLX A;  2YVG A;  1BGJ A;  1KNP A;  4H4Y A;  3CNS A;  5BUL A;  4H2N A;  3SZC A;  3T2Z A;  4B69 A;  1H6V A;  3NHO X;  4J31 A;  4BUR A;  4HB9 A;  4A99 A;  1JNR A;  1ZOV A;  2YLW A;  3SFD A;  3ICR A;  5TR3 A;  2X3N A;  3DJD A;  4B68 A;  4H4X A;  2GRT A;  2V6O A;  1GT8 A;  4RSL A;  4A5L A;  4YSX A;  3V3O A;  4OPC A;  4A6N B;  3CN8 A;  2XLU A;  2WQY A;  1PS9 A;  1B5Q A;  4U8I A;  1P2E A;  3AEB A;  4AT0 A;  4OPT A;  3QFB A;  1JRZ A;  3NN0 X;  1RYI A;  1PJ7 A;  3DH9 A;  1TRB A;  3IC9 A;  4KX6 A;  3NKS A;  4H4Q A;  3KKJ A;  2WDQ A;  2V3A A;  2YWL A;  3CMM A;  1PN0 A;  1F3P A;  3AE5 A;  3CPJ G;  3D8X A;  4OPG A;  4U8O A;  2EQ9 A;  5EB5 A;  3T31 A;  5HYM A;  1NG4 A;  4OPI A;  2B7R A;  2BK4 A;  2FJD A;  2R46 A;  3ITJ A;  4A9W A;  4NWZ A;  1PBF A;  3CGC A;  2XLP A;  4J56 A;  2R45 A;  3R9U A;  1F8W A;  1KSU A;  4ZCD A;  5FS9 A;  2IVE A;  3GRS A;  1HYU A;  5BVA A;  2E1M A;  5L46 A;  3VRB A;  1FCD A;  1OJT A;  1YY5 A;  1KSS A;  3NNE A;  3SX6 A;  3ADA B;  2BAB A;  3FBS A;  5KMR A;  4BJZ A;  3K7T A;  1K0I A;  4TM3 A;  4NZH A;  2GR0 A;  3NYF A;  4OPL A;  1H82 A;  1VQW A;  3SZ0 A;  3I3L A;  4NTD A;  3SGL A;  3NG7 X;  4APN A;  4UDQ A;  3IHM A;  3NRN A;  2BC1 A;  1OJD A;  1PXC A;  2VRM A;  1CC4 A;  3OZ2 A;  3P4R A;  4D03 A;  4AP3 A;  3NTA A;  2GR2 A;  3AYJ A;  3UTH A;  2W0H A;  4RG4 A;  3CTY A;  2FJA A;  1LTX R;  1CJC A;  4U8M A;  1LQT A;  1OJA A;  3RP7 A;  4U2L A;  4TLZ A;  1E7P A;  2APG A;  2XCG A;  3ALM A;  5FS7 A;  2WDV A;  4H4R A;  4Y4L A;  3RNM A;  1M64 A;  1Q1W A;  4G6G A;  4K7Z A;  5EB4 A;  2J3N A;  4GCM A;  1PBC A;  2CFY A;  2XLT A;  4EMW A;  3DJJ A;  1O95 A;  1YKJ A;  1XDI A;  2GB0 A;  3G5Q A;  1GND A;  2VRL A;  1LQU A;  4H50 A;  4NNJ A;  2IVD A;  3M0O A;  1CBO A;  4EM3 A;  4YT0 A;  3HYX A;  1FOH A;  3PO7 A;  4BJY A;  1GTE A;  1D5T A;  4GAV A;  5BUK A;  2C66 A;  3UKH A;  4C3Y A;  3B3R A;  4YTN A;  1H7X A;  3GD3 A;  2Q0L A;  3BHF A;  3UP5 A;  3C4N A;  1O94 A;  2C3C A;  4H4V A;  4EM4 A;  1TDK A;  1BZL A;  3KLJ A;  1KFY A;  1PBE A;  3AE1 A;  4H2P A;  4IA5 A;  4P9S A;  4B1B A;  2DKI A;  3DGZ A;  5KRQ A;  3S61 A;  3LJP A;  3RED A;  1JU2 A;  1YQ4 A;  4EMI A;  3O0H A;  4TM4 A;  4D04 A;  3C4A A;  4U2T A;  1QJD A;  4K5S A;  5IQ4 A;  3CPH G;  2GVC A;  2VOU A;  4A6N A;  2C72 A;  4FK1 A;  4H4W A;  1ONF A;  1GRH A;  2A8X A;  4GR1 A;  3GD4 A;  3VRD B;  2TPR A;  3QFA A;  2B9W A;  2I0Z A;  3BI4 A;  1KDG A;  3ZDN A;  1IUT A;  3NK2 X;  3P9U A;  4E0V A;  3DK4 A;  4BK3 A;  4A65 A;  4AOS A;  3ALJ A;  5KOX A;  1PDH A;  4Z2U A;  2VQB A;  1PJ6 A;  1DOB A;  1XHC A;  1DXL A;  3SM8 A;  3QSE A;  3SZF A;  5M10 A;  4B67 A;  2V61 A;  3NH3 X;  4JQ9 A;  2BXR A;  3NGC X;  1NEK A;  2JAE A;  3SQP A;  3GMB A;  1ZMC A;  3FMW A;  3P4P A;  3HYV A;  2BC0 A;  3UOZ A;  4CNK A;  4O5Q A;  3UTE A;  1S2Y A;  4IVM B;  4G9K A;  2GAG B;  1L9E A;  3HYW A;  1GRA A;  3V76 A;  3GMC A;  2BCG G;  2C73 A;  3EPT A;  1GRF A;  5CKU A;  1TDE A;  2YM1 A;  1H86 A;  5IQ1 A;  4J34 A;  1VRQ B;  2BS3 A;  1GRT A;  2JKC A;  3EAN A;  3URH A;  3VR8 A;  4U8K A;  2B76 A;  2YVJ A;  3NIX A;  4DNA A;  4XWZ A;  1B8S A;  1GES A;  3CND A;  4AOX A;  2Q0K A;  2WP9 A;  2YQU A;  4I59 A;  4PAB A;  5C3J A;  4YTM A;  3AEE A;  2YG4 A;  3NTD A;  2OLN A;  4YKG A;  2QA1 A;  4J2W A;  4GDP A;  1EBD A;  2R0G A;  1Q1R A;  3NLC A;  4XWR A;  1L9C A;  2V3B A;  1N4W A;  1TDN A;  3CNJ A;  1ZOY A;  2YG7 A;  3LB8 A;  1ZKQ A;  2JB1 A;  3QSS A;  3NN6 X;  1ZMD A;  2VVL A;  3GWF A;  2B9Y A;  3T37 A;  3UCL A;  1QLB A;  1ZK7 A;  4K8D A;  2EQ7 A;  3AE7 A;  1E1K A;  3RHA A;  5KWF A;  3WE0 A;  2OA1 A;  4X9M A;  2XVH A;  2YAU A;  5GRT A;  1NAA A;  4LU6 A;  5EOW A;  1H84 A;  3L8K A;  4RG3 A;  5JCI A;  1P2H A;  5C2T A;  5KMP A;  2GAH B;  3UOX A;  1Y56 B;  2OLO A;  4FK1 C;  1XPQ A;  2YR5 A;  4EQR A;  3V3N A;  3P4Q A;  2HQM A;  2GMH A;  1H81 A;  1F8R A;  3P4S A;  2Y6R A;  4C3X A;  2DKH A;  3QJ4 A;  2BCP A;  5U25 A;  4YSH A;  5HY5 A;  4Y4M A;  2QAE A;  4DSH A;  2VZ2 A;  1NDA A;  3CGD A;  5FS6 A;  4JN9 A;  3ATR A;  1GER A;  2NPX A;  1JRY A;  1V59 A;  1MO9 A;  1VG0 A;  3ATQ A;  3AYL A;  2XLS A;  4BV6 A;  3SYI A;  3CNP A;  4OPU A;  4OPD A;  2ZZB A;  2GMJ A;  4EMJ A;  2R9Z A;  3AEG A;  3E1T A;  1NG3 A;  2ZBW A;  4TM1 A;  2TMD A;  5KMQ A;  5CQF A;  3AXB A;  3S5W A;  4TLX A;  4CY8 A;  3DGH A;  1LVL A;  3AD8 B;  4ICY A;  4K5R A;  1GAL A;  2YLS A;  2Q7V A;  3H4K A;  1NEN A;  3D1C A;  3ISH A;  3OC4 A;  5KMS A;  3BI2 A;  2GQF A;  3UKF A;  1L9D A;  1E39 A;  4BK2 A;  3CGB A;  1GRG A;  3GYJ A;  5JCN A;  3QVR A;  4EQX A;  2WPE A;  2FJB A;  3G5S A;  1PXB A;  2B7S A;  2GV8 A;  3F8R A;  4MJW A;  2WEU A;  1BGN A;  3G5R A;  4X4J A;  1S3B A;  2BA9 A;  1VG9 A;  2WU5 A;  1LPF A;  3RP6 A;  1ZY8 A;  4CY6 A;  2OAL A;  1CC6 A;  1H83 A;  4UDR A;  1O5W A;  1F8S A;  3AWI A;  2XFQ A;  5FS8 A;  1PHH A;  4GRT A;  2C67 A;  2BRY A;  3M13 A;  1NPX A;  3SFE A;  2BRA A;  2ARD A;  4UDP A;  1S3E A;  2WES A;  3LAD A; 
#chains in the Genus database with same CATH homology
 1KF6 A;  2ZZ0 A;  3AE6 A;  1MXT A;  1CJ3 A;  1TYT A;  2E4G A;  2YM2 A;  1VDC A;  1CJ2 A;  2Z5X A;  3FPZ A;  1H7W A;  1NHS A;  4USQ A;  1EL7 A;  3T2Y A;  1D4C A;  2E5V A;  2XYO A;  3GYX A;  1IUW A;  1GTH A;  4GDE A;  1GPE A;  1K4Q A;  2Y6Q A;  2YVF A;  3PVC A;  1F6M A;  4G74 A;  4I58 A;  2PYX A;  2WPF A;  2UZZ A;  1EL8 A;  2PHH A;  4YXD A;  3AYI A;  4U2S A;  2YG3 A;  4H4U A;  4JNQ A;  2YLZ A;  3AD7 B;  1CHU A;  2YLR A;  3AE9 A;  4GAP A;  2YR4 A;  3UKA A;  1K0L A;  4JDR A;  3AED A;  2CDU A;  3ALL A;  2XVF A;  2H89 A;  1BKW A;  2C3D A;  2YG5 A;  5JCL A;  1K0J A;  4U8P A;  1NHR A;  1E6E A;  1LV0 A;  4FX9 A;  2B9X A;  3CIR A;  4C77 A;  5GSN A;  1ZX9 A;  2BK3 A;  4IV9 A;  5EBK A;  2JB3 A;  2C76 A;  4DGK A;  3GDN A;  2V5Z A;  3AB1 A;  2BAC A;  2WS3 A;  3FIM B;  1DOC A;  1ELI A;  2H88 A;  1YQZ A;  4EIP A;  1B37 A;  1JNZ A;  1Q9I A;  1JRX A;  1SEZ A;  1ZDL A;  2JK6 A;  4JY2 A;  1Y56 A;  3SZW A;  2WBA A;  4EQS A;  2WHD A;  1DOE A;  4O5U A;  2XVJ A;  3AE3 A;  4CCQ A;  1PJ5 A;  2GH5 A;  1FEC A;  3DA1 A;  4Z24 A;  1N4V A;  2RAB A;  4ADW A;  1FEA A;  2AAQ A;  2O9Z A;  4CCR A;  3GWD A;  1ZP0 A;  1TDF A;  2A89 A;  2X50 A;  3QSM A;  4Y4N A;  5JCK A;  1AOG A;  4HA6 A;  2WPC A;  2X99 A;  4Z43 A;  4K2X A;  3DK9 A;  3BHK A;  4EIQ A;  2Z5Y A;  4B63 A;  1NHP A;  1GV4 A;  4PAA A;  2C4C A;  2C70 A;  2AR8 A;  2VVM A;  3LOV A;  3UOV A;  3AEA A;  3AE8 A;  3UKP A;  4G73 A;  1DNC A;  3K7M X;  2YG6 A;  3KA7 A;  3GDP A;  4X9N A;  4JY3 A;  1MOK A;  3AEF A;  2A87 A;  2XDO A;  4NEW A;  2WOI A;  3GRT A;  3LZW A;  3NK1 X;  4AP1 A;  3NYE A;  5KOW A;  3IHG A;  3UKQ A;  3UP4 A;  2XFU A;  1TYP A;  4N9X A;  3KU9 A;  5KNL A;  1D7Y A;  3ABV A;  3ICT A;  4H2R A;  3L1R A;  2X8C A;  3KVE A;  1PBB A;  4NTE A;  3COX A;  2JBV A;  4DSG A;  4H7U A;  5KVH A;  5LV9 A;  2CVJ A;  2YLT A;  4J36 A;  2X8G A;  1Y0P A;  3CPI G;  4WX1 A;  5M0Z A;  3DME A;  2XVE A;  4NEV A;  4A7A A;  2XLR A;  4GUV A;  5U63 A;  3NYC A;  5JCM A;  1GXF A;  1GRB A;  2C64 A;  1L0V A;  2AQJ A;  4KPR A;  5J60 A;  3PS9 A;  3Q6J A;  2WDR A;  2XFN A;  3H8I A;  3K30 A;  2OAM A;  2BS2 A;  1E1N A;  2WOW A;  4CRT A;  1DJN A;  4A79 A;  3HZL A;  4B66 A;  2FBW A;  1EL5 A;  1IUV A;  2RGJ A;  4H2Q A;  1REO A;  1UKV G;  3P1W A;  1DOD A;  3JSK A;  3K7Q X;  1PXA A;  5BRT A;  4J57 A;  1DJQ A;  2EQ6 A;  4C74 A;  4BK1 A;  3LZX A;  1IJH A;  4OCG A;  4YTP A;  4ZN0 A;  1KNR A;  1RP0 A;  3DJG X;  4FDC B;  3T14 A;  1CL0 A;  2R4E A;  1GRE A;  4C5O A;  4WCT A;  4JNA A;  3UTG A;  4K22 A;  4LII A;  5HXI A;  2R0C A;  4M52 A;  4Z44 A;  3H8L A;  3M12 A;  4TM0 A;  5KVI A;  3T0K A;  1EL9 A;  3CGE A;  1GOS A;  2BYB A;  3NK0 X;  4NTC A;  3RP8 A;  4J33 A;  3KD9 A;  3F8P A;  4II3 A;  2GEW A;  4IA6 A;  4H4T A;  3EF6 A;  3ZYX A;  4ZCC A;  2WU2 A;  3SY4 A;  1IUX A;  2FJE A;  2GF3 A;  2WP6 A;  2BK5 A;  1TDO A;  3FG2 P;  5U1O A;  4YSY A;  4Z25 A;  5IPY A;  2IID A;  5ER0 A;  1X31 B;  1FEB A;  4YSZ A;  3B6D A;  1D7L A;  3AE2 A;  4ECH A;  4LA1 A;  2JB2 A;  1OJ9 A;  3BNM A;  3KPF A;  1E1M A;  1OJC A;  2GR3 A;  4Z26 A;  1BF3 A;  3CNT A;  1IUS A;  1LJ1 A;  1M6I A;  2XFP A;  3AEC A;  2YR6 A;  1GEU A;  3T2K A;  4B65 A;  4B64 A;  2VVL G;  4G6H A;  1XAN A;  2C65 A;  2V60 A;  5HHF A;  4EQW A;  3UTF A;  4II2 A;  3DJE A;  2XVI A;  3DK8 A;  2CUL A;  4Z2R A;  2QA2 A;  1D4D A;  4H4P A;  2WET A;  2BS4 A;  4GF7 A;  5J7X A;  2NVK X;  2GQW A;  4IVO B;  1B4V A;  1FL2 A;  2WP5 A;  1S2Q A;  4YWO A;  2X8H A;  4Z2T A;  3BNU A;  3VQR A;  3QVP A;  1JEH A;  5FMH A;  2C75 A;  3Q9T A;  2XFO A;  1N1P A;  4UP3 A;  1RSG A;  4H4S A;  4YKF A;  1N4U A;  3IWA A;  3VR9 A;  1NHQ A;  3II4 A;  2Q6U A;  2GR1 A;  4U8L A;  4U8J A;  1CC2 A;  3EAO A;  1BWC A;  4H4Z A;  2RGO A;  3IF9 A;  4USR A;  5DBJ A;  3UOY A;  2WOV A;  3AE4 A;  3ICS A;  2BXS A;  3C96 A;  3GYI A;  4U8N A;  4CBQ A;  4CNJ A;  1CJ4 A;  1Z6L A;  3VRA A;  1D4E A;  2RGH A;  1W4X A;  1GSN A;  2R4J A;  3LXD A;  2QCU A;  2F5Z A;  2EQ8 A;  2R0P A;  3UKK A;  1E1L A;  3BI5 A;  3UKL A;  3GSI A;  3F8D A;  3KPK A;  3AD9 B;  4AT2 A;  4REK A;  2VQ7 A;  2ACZ A;  1COY A;  1YQ3 A;  1QO8 A;  4OVI A;  2C7G A;  4XXG A;  1CF3 A;  1JOA A;  1GET A;  1IUU A;  1PBD A;  2ZZC A;  3I6D A;  3SXI A;  5KXJ A;  3NT6 A;  2YLX A;  2YVG A;  1BGJ A;  1KNP A;  4H4Y A;  3CNS A;  5BUL A;  4H2N A;  3SZC A;  3T2Z A;  4B69 A;  1H6V A;  3NHO X;  4J31 A;  4BUR A;  4HB9 A;  4A99 A;  1JNR A;  1ZOV A;  2YLW A;  3SFD A;  3ICR A;  5TR3 A;  2X3N A;  3DJD A;  4B68 A;  4H4X A;  2GRT A;  2V6O A;  1GT8 A;  4RSL A;  4A5L A;  4YSX A;  3V3O A;  4OPC A;  4A6N B;  3CN8 A;  2XLU A;  2WQY A;  1PS9 A;  1B5Q A;  4U8I A;  1P2E A;  3AEB A;  4AT0 A;  4OPT A;  3QFB A;  1JRZ A;  3NN0 X;  1RYI A;  1PJ7 A;  3DH9 A;  1TRB A;  3IC9 A;  4KX6 A;  3NKS A;  4H4Q A;  3KKJ A;  2WDQ A;  2V3A A;  2YWL A;  3CMM A;  1PN0 A;  1F3P A;  3AE5 A;  3CPJ G;  3D8X A;  4OPG A;  4U8O A;  2EQ9 A;  5EB5 A;  3T31 A;  5HYM A;  1NG4 A;  4OPI A;  2B7R A;  2BK4 A;  2FJD A;  2R46 A;  3ITJ A;  4A9W A;  4NWZ A;  1PBF A;  3CGC A;  2XLP A;  4J56 A;  2R45 A;  3R9U A;  1F8W A;  1KSU A;  4ZCD A;  5FS9 A;  2IVE A;  3GRS A;  1HYU A;  5BVA A;  2E1M A;  5L46 A;  3VRB A;  1FCD A;  1OJT A;  1YY5 A;  1KSS A;  3NNE A;  3SX6 A;  3ADA B;  2BAB A;  3FBS A;  5KMR A;  4BJZ A;  3K7T A;  1K0I A;  4TM3 A;  4NZH A;  2GR0 A;  3NYF A;  4OPL A;  1H82 A;  1VQW A;  3SZ0 A;  3I3L A;  4NTD A;  3SGL A;  3NG7 X;  4APN A;  4UDQ A;  3IHM A;  3NRN A;  2BC1 A;  1OJD A;  1PXC A;  2VRM A;  1CC4 A;  3OZ2 A;  3P4R A;  4D03 A;  4AP3 A;  3NTA A;  2GR2 A;  3AYJ A;  3UTH A;  2W0H A;  4RG4 A;  3CTY A;  2FJA A;  1LTX R;  1CJC A;  4U8M A;  1LQT A;  1OJA A;  3RP7 A;  4U2L A;  4TLZ A;  1E7P A;  2APG A;  2XCG A;  3ALM A;  5FS7 A;  2WDV A;  4H4R A;  4Y4L A;  3RNM A;  1M64 A;  1Q1W A;  4G6G A;  4K7Z A;  5EB4 A;  2J3N A;  4GCM A;  1PBC A;  2CFY A;  2XLT A;  4EMW A;  3DJJ A;  1O95 A;  1YKJ A;  1XDI A;  2GB0 A;  3G5Q A;  1GND A;  2VRL A;  1LQU A;  4H50 A;  4NNJ A;  2IVD A;  3M0O A;  1CBO A;  4EM3 A;  4YT0 A;  3HYX A;  1FOH A;  3PO7 A;  4BJY A;  1GTE A;  1D5T A;  4GAV A;  5BUK A;  2C66 A;  3UKH A;  4C3Y A;  3B3R A;  4YTN A;  1H7X A;  3GD3 A;  2Q0L A;  3BHF A;  3UP5 A;  3C4N A;  1O94 A;  2C3C A;  4H4V A;  4EM4 A;  1TDK A;  1BZL A;  3KLJ A;  1KFY A;  1PBE A;  3AE1 A;  4H2P A;  4IA5 A;  4P9S A;  4B1B A;  2DKI A;  3DGZ A;  5KRQ A;  3S61 A;  3LJP A;  3RED A;  1JU2 A;  1YQ4 A;  4EMI A;  3O0H A;  4TM4 A;  4D04 A;  3C4A A;  4U2T A;  1QJD A;  4K5S A;  5IQ4 A;  3CPH G;  2GVC A;  2VOU A;  4A6N A;  2C72 A;  4FK1 A;  4H4W A;  1ONF A;  1GRH A;  2A8X A;  4GR1 A;  3GD4 A;  3VRD B;  2TPR A;  3QFA A;  2B9W A;  2I0Z A;  3BI4 A;  1KDG A;  3ZDN A;  1IUT A;  3NK2 X;  3P9U A;  4E0V A;  3DK4 A;  4BK3 A;  4A65 A;  4AOS A;  3ALJ A;  5KOX A;  1PDH A;  4Z2U A;  2VQB A;  1PJ6 A;  1DOB A;  1XHC A;  1DXL A;  3SM8 A;  3QSE A;  3SZF A;  5M10 A;  4B67 A;  2V61 A;  3NH3 X;  4JQ9 A;  2BXR A;  3NGC X;  1NEK A;  2JAE A;  3SQP A;  3GMB A;  1ZMC A;  3FMW A;  3P4P A;  3HYV A;  2BC0 A;  3UOZ A;  4CNK A;  4O5Q A;  3UTE A;  1S2Y A;  4IVM B;  4G9K A;  2GAG B;  1L9E A;  3HYW A;  1GRA A;  3V76 A;  3GMC A;  2BCG G;  2C73 A;  3EPT A;  1GRF A;  5CKU A;  1TDE A;  2YM1 A;  1H86 A;  5IQ1 A;  4J34 A;  1VRQ B;  2BS3 A;  1GRT A;  2JKC A;  3EAN A;  3URH A;  3VR8 A;  4U8K A;  2B76 A;  2YVJ A;  3NIX A;  4DNA A;  4XWZ A;  1B8S A;  1GES A;  3CND A;  4AOX A;  2Q0K A;  2WP9 A;  2YQU A;  4I59 A;  4PAB A;  5C3J A;  4YTM A;  3AEE A;  2YG4 A;  3NTD A;  2OLN A;  4YKG A;  2QA1 A;  4J2W A;  4GDP A;  1EBD A;  2R0G A;  1Q1R A;  3NLC A;  4XWR A;  1L9C A;  2V3B A;  1N4W A;  1TDN A;  3CNJ A;  1ZOY A;  2YG7 A;  3LB8 A;  1ZKQ A;  2JB1 A;  3QSS A;  3NN6 X;  1ZMD A;  2VVL A;  3GWF A;  2B9Y A;  3T37 A;  3UCL A;  1QLB A;  1ZK7 A;  4K8D A;  2EQ7 A;  3AE7 A;  1E1K A;  3RHA A;  5KWF A;  3WE0 A;  2OA1 A;  4X9M A;  2XVH A;  2YAU A;  5GRT A;  1NAA A;  4LU6 A;  5EOW A;  1H84 A;  3L8K A;  4RG3 A;  5JCI A;  1P2H A;  5C2T A;  5KMP A;  2GAH B;  3UOX A;  1Y56 B;  2OLO A;  4FK1 C;  1XPQ A;  2YR5 A;  4EQR A;  3V3N A;  3P4Q A;  2HQM A;  2GMH A;  1H81 A;  1F8R A;  3P4S A;  2Y6R A;  4C3X A;  2DKH A;  3QJ4 A;  2BCP A;  5U25 A;  4YSH A;  5HY5 A;  4Y4M A;  2QAE A;  4DSH A;  2VZ2 A;  1NDA A;  3CGD A;  5FS6 A;  4JN9 A;  3ATR A;  1GER A;  2NPX A;  1JRY A;  1V59 A;  1MO9 A;  1VG0 A;  3ATQ A;  3AYL A;  2XLS A;  4BV6 A;  3SYI A;  3CNP A;  4OPU A;  4OPD A;  2ZZB A;  2GMJ A;  4EMJ A;  2R9Z A;  3AEG A;  3E1T A;  1NG3 A;  2ZBW A;  4TM1 A;  2TMD A;  5KMQ A;  5CQF A;  3AXB A;  3S5W A;  4TLX A;  4CY8 A;  3DGH A;  1LVL A;  3AD8 B;  4ICY A;  4K5R A;  1GAL A;  2YLS A;  2Q7V A;  3H4K A;  1NEN A;  3D1C A;  3ISH A;  3OC4 A;  5KMS A;  3BI2 A;  2GQF A;  3UKF A;  1L9D A;  1E39 A;  4BK2 A;  3CGB A;  1GRG A;  3GYJ A;  5JCN A;  3QVR A;  4EQX A;  2WPE A;  2FJB A;  3G5S A;  1PXB A;  2B7S A;  2GV8 A;  3F8R A;  4MJW A;  2WEU A;  1BGN A;  3G5R A;  4X4J A;  1S3B A;  2BA9 A;  1VG9 A;  2WU5 A;  1LPF A;  3RP6 A;  1ZY8 A;  4CY6 A;  2OAL A;  1CC6 A;  1H83 A;  4UDR A;  1O5W A;  1F8S A;  3AWI A;  2XFQ A;  5FS8 A;  1PHH A;  4GRT A;  2C67 A;  2BRY A;  3M13 A;  1NPX A;  3SFE A;  2BRA A;  2ARD A;  4UDP A;  1S3E A;  2WES A;  3LAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...