1F6TA

Structure of the nucleoside diphosphate kinase/alpha-borano(rp)-tdp.mg complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for activation of alpha-boranophosphate nucleotide analogues targeting drug-resistant reverse transcriptase.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords PROTEIN (NUCLEOSIDE DIPHOSPHATE KINASE)
total genus 46
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2000-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1f6tA00
1WKLA 4F4AA 3PRVA 3FBEA 1S59A 4ANCA 1ZS6A 2VU5A 3BBBA 1KDNA 3VGTA 1BE4A 1LWXA 1NDKA 4UOGA 2AZ3A 3ZTOA 5CABA 1S57A 3DKDA 1U8WA 3Q86A 3VGUA 1HLWA 5CAAA 3VVUA 3MPDA 1NHKL 4W98A 3Q8VA 1NDLA 2CWKA 1MN7A 3ZTRA 5C7PA 1F6TA 3JS9A 1PKUA 1NSKL 3VVTA 1EHWA 1F3FA 1NDCA 3EICA 1HIYA 4DUTA 1UCNA 3EM1A 4O0NA 1W7WA 3BBCA 4KPCA 4ENOA 2B8QA 3ELHA 2DY9A 1B4SA 2B8PA 3FBFA 5BXIA 1NUEA 3PJ9A 4F36A 3ZTPA 3EMTA 1K44A 3BH7B 3GPAA 4ANEA 3WX8A 3FBBA 3NGSA 1JXVA 1WKJA 4FKXA 5IOLA 2HVEA 4CP5A 1BHNA 1BUXA 1NSQA 1NPKA 2HURA 2DXEA 3VGVA 3EVOA 4EK2A 1XQIA 3ENAA 2DXFA 1VYAA 3Q89A 4C6AA 1WKKA 3DDIA 3NGTA 1LEOA 2DXDA 4UOHA 3Q8YA 1NDPA 3NGRA 2DYAA 4UOFA 3B6BA 3B54A 3EVWA 1NLKL 3Q8UA 3BBFA 1MN9A 3EJMA 1HHQA 1XIQA 3GP9A 2ZUAA 3G2XA 4WBFA 2HVDA 1B99A 3VGSA 4ANDA 2BEFA 3ETMA 1NSPA 1PAEX 3FC9A 3ZTSA 4S0MA 4DZ6A 3ZTQA 3EE3A 4FKYA 3Q83A 1NB2A 3FCWA 3L7UA 2NCKL 2BX6A 1S5ZA 4DI6A 4HR2A 1NCLA 3NGUA 2AZ1A 3R9LA 3EVMA 3FKBA 3FCVA 3FBCA 3BH6B
chains in the Genus database with same CATH superfamily
5E3PA 1WKLA 4F4AA 4BWJA 4IDKA 5A76A 2H5EA 3UD5A 2AEFA 4KHPF 4LRDA 4JB8B 4K5RA 1CQNA 4KIAA 4WXOA 1UL3A 2GVDA 1KDNA 2DTJA 2RKIB 3BBBA 3VGTA 5L1LA 4F02A 2V50A 2VHGA 3M8ZA 2CXEA 3E01A 2R7UA 2BQ3A 4LR7A 1ZM3A 2B6AA 3BGLA 2H5IB 2E29A 3GR1A 2VG6A 4DG1A 5L46A 2HHHJ 1NHKL 5L39A 4PAAA 1H0HB 2M9KA 5D4PA 3QATA 4RNFA 1NBEB 4A8QA 1TMMA 2I5JA 1X4EA 3KLEB 3C3LA 2DITA 4KFBA 5EWEA 1A9NB 1P9YA 2KG1A 1DY3A 1TL3A 3THTA 1FHTA 3ILOA 2BDPA 4X4VA 5KTQA 1H3DA 2Q43A 3TO8A 4C8KA 1H74A 4OYBA 3GCWP 3CD0A 3QZ8A 1HHTP 3NGKA 5GAGU 4ZCKA 2HWTA 3GJSB 1YTYA 2RIJA 3PKYA 2M8HA 2NSCA 5AJ3F 2XM3A 1RBOB 3N6MA 4WFBQ 2JSXA 2FPHX 4QWBA 3QYYA 4EO8A 3D28A 4USMA 3CPWR 4DL6A 1SKUB 2DNKA 3HFKA 5DDQC 3RAQA 4A47A 4DUZF 4MKYA 3K5MA 1UKUA 2KDOA 1WEZA 3A8EA 4CYUA 4LSNB 2IFXA 1FNXH 4OZ0A 3T5JA 3FGVA 1RJJA 5HMXA 4FP9A 1CC8A 1S6QA 1RAHB 2DHHA 3OV7A 4RW9A 2XO7A 3FSIA 2A6MA 2A2CA 3CCWA 3JTOA 2YNHB 2G2YA 3V5RA 4LF8F 1KHVA 4FKXA 4C7QA 5IOLA 2KJVA 6FDRA 2FB0A 3D3CJ 2DRBA 2YNFA 3TX8A 3KLFB 2PI4A 4F4WA 2VDIA 1P8GA 2ADBA 2HMIB 2V2ZA 3VALA 4OFZA 3H7HB 3PIOQ 3A8JA 2FHMA 4NXMJ 1ZH5A 3J7AN 1ZTWA 1RA6A 4N76A 1RWKB 2CIMA 4ED6A 1WKKA 4YP3A 2B9XA 4IR9A 3MZIA 2ROPA 1NEEA 4OZ3A 3FEZA 4J9PA 4CLLA 1KR4A 3CJRA 2PDAA 1KQKA 2NR0A 5K14B 1YHQS 1YDLA 3PG9A 1REGX 3SXLA 3PTWA 1N32F 4DUYJ 1PIEA 2F5GA 2ACMA 3F41A 3LANA 4RU2A 3D7SB 1GMWD 1M1GA 2LXFA 2KZMA 4HL9A 3VAFA 4QYZK 3KUEA 2PGCA 2ACYA 2YQ0A 4LJMA 3G2XA 2X7IA 1NK5A 3EXCX 3K59A 2E1AA 1KQGB 1AZSA 1CJUB 2NUUG 3DU6A 4BC9A 4B3RF 3M8YA 2ZDPA 4HTJA 1RK8A 2HGLA 3MAAA 3VAJA 3HFVA 1MWYA 2B5JA 2JLEA 3WIVA 1VLOA 4DZ6A 1HD0A 1ULRA 2QZ8A 3K8VA 3OQ2A 4WFYA 4QPTA 3MMBA 4ZVOB 4BCAA 4C3LA 1SUQB 3HKZD 5KFXA 2K7KA 3T1HJ 4DCPB 4IG3B 4JI1J 1JLGB 3FK4A 4LBHA 3AXMA 2DR6A 4FN5A 3WDOA 2HHTA 2NZ4A 5IWAJ 3CJ2A 3NGUA 3R7NB 2UVRA 4X66F 2XLJA 2GHPA 2V8GA 4CO1A 5KFNA 4J9RA 5LM7E 5IS2A 4C3KA 5J2NA 1RTDA 4NXNJ 3KJVA 3BQ2A 4MH8A 2M5YA 3PV8A 3E01B 1IKYA 3THPA 3MR3A 5L1JA 1R7IA 1S59A 2XNQA 1KQSR 1MROA 2EK6A 2GQ2A 2I1RA 2N4CA 1R3NA 4NMLA 2FVSA 1RT3A 2GMHA 1ZPVA 2H54B 1JJHA 3AAWB 3ZTOA 3S7RA 4UQTA 5K8OA 3PW2A 4WP3A 1LV5A 2J6SA 2VG7A 4KGKA 2J6TA 3QIPA 4J9OA 2IJFA 3HVRA 1R0BG 1AXQA 5D4NA 3KMSA 4ED8A 4IH5A 1U4BA 3JSMA 4GRSA 2UUBF 5IQ6A 2HVZA 3V6DB 4KV8A 1K1QA 2QRRA 5BYRA 3K5LA 2FVRA 1T7PA 1EHWA 3BEGB 1FRXA 1QM9A 4DF8A 3EX7B 4KQZA 1G3OA 4YOEA 3LW5C 4JI4F 4G1QB 4M8LA 2LQ5A 1F5AA 4KKOA 1IKVA 5ETNA 2G4BA 2Q66A 4RNMA 4DEZA 5HJYA 1TTHB 3RYLA 4B9UA 3H5SA 2QYGA 3L4BC 5DDRC 1VQNS 1U2RA 4FS2A 2DGSA 4XK8C 3GMGA 1BD6A 1JMTA 2R7OA 3PYFA 2KT2A 2VD3A 2O66A 3QAEA 4LT6A 4LF6J 1KEKA 3N6NA 1YJNS 3CDBA 5HP1A 4WYWA 2E9ZA 4ZOSA 3Q2TC 1WSVA 3D6HB 3A3PB 3I9V9 5EGYA 2K1RB 4XPEA 2IVYA 4P7TA 4URSA 3D0HE 4CLSA 5KFRA 2QX0A 2KJWA 1VC5A 4JI2J 3SDEA 4J9SA 3H25A 1ZA1B 1UVJA 2MHEA 3T1YF 1H6KX 4YN3B 4DR1J 1Q7YT 4WZMA 1GXLA 4LF5F 1IJEB 4ZVHA 1F0XA 2B9WA 1FRIA 2UUCJ 4CNZA 1EKSA 2AU0A 2UUAJ 4BC7A 1X0PA 3MXHP 1XNQF 3KOAA 3OUYA 3CE8A 4C11B 2CKWA 2DXFA 2EKYA 2IA0A 2IDLA 2V34A 2AYBA 4ZVTB 4ICLB 4NMXA 4CIOA 1C1BA 3MEDB 3ZFVA 3CCLS 4ZN3A 1MMNA 3D1HA 3HI9A 1Y3JA 1KKHA 2E7VA 3OSNA 2JDJA 1LNQA 4Z7YA 1VQ7S 4L3KA 4OZNA 1IBKF 3B6BA 4KHMA 4OIXA 1UETA 3J81U 3Q8UA 2AJFE 3DI6B 2XMJA 2IHR1 1IWGA 1WC0A 2YNHA 3DGPA 1WG5A 4OX9J 3CJKA 4Y2MA 2XLIA 1TAUA 1KTVA 1NK6A 3G82A 2QE5A 2HIYA 4PXDA 2EC0A 2PFFB 2HVDA 4CRJA 5T7LA 5BJRA 3HP6A 4GMKA 3GWCA 2VA3A 2BQRA 2MKIA 2A3JA 4LFBF 2ZH7A 2L41A 4XTTA 2CQ0A 1J5OA 4I1TA 4OL8A 5C25B 2ZITA 4A8WA 3Q8QB 2DH8A 1RT4B 1TELA 2HGMA 3AQPA 1RTJB 5LXRA 1DQAA 2D41A 2YH0A 3CJ3A 3W5XA 5KT6A 2CJQA 2FTRA 2HNZA 1FKPA 3Q83A 4PCQA 3TEGA 2ZH9A 3G9CA 4MK8A 5HLFA 2AT1B 1SCJB 3G71S 4F4XA 1TP7A 1N5YA 3W1YC 5GADU 2HBQB 3FJ2A 3G86A 2YPYA 2G1DA 1SL2A 4O3RA 2DCUB 3AD7C 1CS4A 2QL7B 5ETOA 1SKSA 1G7CB 4OV6A 2R7XA 2LEPA 2DGWA 1RTHB 3FCVA 1RT1A 3NWGA 4Y2CA 2ZZTA 2BJ3A 2RVJA 4FYVB 4UOCA 2JEGA 2YX4A 2ZFHA 3R5JB 1YWXA 1YQHA 3C6TA 1RGVA 1T9YA 1UFKA 4IO1A 1EARA 4ZPWR 2XHWA 4C4WA 2RUSA 3RBEA 2JLGA 2MDAA 1MWQA 3ZZOA 3LH2S 3DOLA 4G1PA 2CQHA 4PQAA 1BGXT 4TYAA 3TX0A 4WFNQ 1K47A 3CDUA 1WG4A 5DG9A 3EPIA 2BJEA 2FJBB 3E8OA 4ZVSB 3KLGA 2GIRA 3L9ZA 3MPYA 2CWXA 3B82A 3CCZA 1U1RA 1PJ6A 3OLAA 3W9HA 4GO5X 4DV0F 2ADCA 2OAUA 2R8HA 3KJQB 3KK1B 3HZEA 1D3WA 3JS9A 1XK8A 1MU2A 3SSRA 1PO6A 4Y2IA 1FK9A 1JLQA 4RX6A 2XMWA 2OJ3A 3ITHA 1IM4A 2DEJA 1UFWA 3CSKA 2XO6A 4NLDA 2R9LA 2QYCA 2AX1A 2CPFA 2V63A 1VHIA 2YX1A 3HCXA 2HQ3A 5D77A 2XYHB 3AD9C 1CC7A 3EM1A 3FQLA 3QIDA 3RBZA 2KXNB 1S97A 4BBYA 4DX8H 3WQPA 3EYZA 4DFJA 1LQ9A 3ELHA 3M8PB 3W5ZA 2ZH5A 2ZD1A 2QV6A 3RRKA 4DV2F 1KC8T 3D6TB 1YRXA 1Q0NA 3EMTA 2XWYA 2QFJA 1X4CA 2V9WA 3GFZA 3DOLB 2RD5C 4IG3A 1K44A 1PCAA 3R5DA 3CJ8A 3S01A 4ANEA 4J9MA 3M6WA 3E51A 3FBBA 3QZ7A 3H40A 3U27A 2J6UA 3CO9A 3WHIA 1C1CA 1UA1A 1V3ZA 2HFSA 2HNDA 1HNZJ 2R7VA 2FJAB 1FDBA 3IGNA 2HRYA 2ROGA 1I3OB 3BKFA 1BQMA 2HHHF 1U1OA 3G87A 4CP5A 4TY8B 1BUXA 1CLFA 4JV5F 1WDTA 2N7YA 2QFIA 2KFYA 4U95A 4WE1A 3NG8A 2W2NP 3BYRA 3HFZB 2C2ZB 2JJ4D 4KBIA 4KC5A 4QW8A 2ASJA 3PRDA 5F9LA 4LF8J 2DGXA 4C6AA 1J2VA 5L38A 4BLGA 4QZVB 4YHHJ 3PW5A 3SCKE 2UP1A 2WB4A 3I6PA 4O4GB 2HQIA 2LXUA 3JSRA 2UXDF 1PJ5A 3UCGA 3PXGa 3LGMA 4HVZA 4M5JA 2WSEC 3QMQA 3GU0A 3IM9A 2C3PA 2ZHAA 2LDYA 1FCAA 5T7LB 1X4DA 3SFGA 4A8XA 3CC2S 2DH7A 2MQPA 2QSFA 3K8WA 5L9NA 1VC6A 5J2QA 1RU2A 2HQFA 2QMWA 1TL1B 4P6QA 2EFPA 2ATLA 4H4MA 1YRUA 3LF0A 4IFYA 4K2XA 1J5EF 1CSJA 2AMCB 4DQQA 2UV8A 4XO0A 4WTYA 5CYMB 1VMBA 3UNYA 4YFUA 2HGNA 2PA3A 4CM2A 4EGLA 1HFEL 2OTJS 2JC0A 2HRTA 2ZNZA 2OSRA 3I96A 3ISZA 4JI6F 3MTJA 4Y2AA 2MQOA 3M2VB 1NHVA 2DR9A 2G9OA 3PFEA 2H4WB 3HVTB 5KFAA 1NB2A 2R8IA 1SJQA 2F8EX 2OEMA 3MUMP 1VQLS 5IV4A 4DV5J 3H5UA 4HR2A 2GIFA 4F3QA 1H7WA 1CJVB 1XJWB 3RBXA 2AD9A 4DPUA 1Q78A 2R7QA 3PW7A 3RZAA 4ZJQA 2UVWA 3FKBA 2EG1A 1H7XA 1Z4UA 4YMEA 4DZDA 3G6VA 5EN1A 1RTIA 4CQ1A 3KLFA 4A8OA 3GYNA 5EWFA 2YKPA 4YB7A 3F0NA 3DLBA 4A46A 1Z2LA 2JHEA 3MM8A 4MIWA 2F3JA 3U1NA 3EPGA 3MEEB 5F3TA 3O5TB 3G6YA 5EUHA 4C0OC 4DPWA 3TVZA 4R5PB 4HYKA 5B0FA 2J7KA 4LF4J 2HFUA 1S1TB 3C8YA 5AXNA 1S1WB 4DV4J 2GHVC 2B7CB 4LSNA 3QT6A 2DIUA 4QIFA 3W2WA 1RCXB 4C0BA 3B8HA 3W9IA 4X4QA 3K5NA 1TQLA 1JIHA 2E5LF 3DDKA 3RB4A 3CEDA 3PDNA 1Z1ZA 3MFIA 1NSKL 2HWHA 2H1YA 4H4OA 2FUG9 1NKEA 4DV0J 5ETKA 1F3FA 4LVNP 3BO4A 2GZOA 4M5HA 2ZWOA 1X9WA 1S0VA 3S1TA 1Q4RA 4K0KJ 1SJRA 2ZJPQ 4P10A 3DMJB 2MTLA 4OV1A 1VQOS 1N88A 2O5DA 4ER8A 3BBCA 1R8PA 1ICEB 1OIAA 1XMBA 2NXCA 3MDFA 5KG4A 4C2MA 5I42B 4C8LA 4R0JA 4C8NA 3KJNB 4EO6A 1F9HA 3M7VA 4LSLB 2DH9A 5K9FA 1JLFB 2RH3A 4C8YA 2L9DA 2BM0A 2G2OA 2AWZA 4LF6F 1QE1B 1BQNB 4ZPCA 2RRBA 1U2CA 5CYMA 3BKUA 1T0TV 3M4XA 3MM9B 1VJQA 4DXLA 1TUWA 3PHEA 1S1XA 1X8DA 2LVWA 2C2RA 2FY8A 2W25A 5IC6B 1D1UA 1S12A 4IRCA 3P4UB 3NCPA 1QTMA 4DWIA 1RTHA 4C8ZA 2BACA 3X3UA 1D8YA 4ED4A 1JLQB 2CNLB 2ROEA 5FDLA 2DRAA 3UDVA 1WDDA 1X5PA 5DLFA 3CC7S 4AL5A 1FJ7A 2J9EA 2JVRA 3D1QA 1CJTB 3P96A 1JNZB 1SBRA 1RWVB 3BGOP 4G65A 4M5NA 3JB9k 2CPJA 4I4BA 4ZLNA 2HHPA 2Z57B 1Y5LB 1RHMB 1JB0C 3Q89A 3FNNA 3MFHA 5LMNJ 2QC3A 3A12A 3AA9A 4M5LA 4ED7A 3QRPA 1APSA 3LOUA 3HT0A 1JLGA 3RBDA 2COLA 3UD3P 1QAJA 1RAGB 3Q2SC 4ILLA 3LP2B 1FA0A 2V8DA 4QU6A 1FKOB 4NZ6A 4PYDA 2H5JB 3FDSA 3JSMB 1R6YA 1X5SA 1UEKA 2MYFA 5MAOA 1EB0A 1MN9A 4WK3A 3CCJS 4FZVA 3MPWA 4ZP8A 2FLLA 1XTZA 2LKZA 3AJDA 2WHOA 4OLPA 6FD1A 2Z8QA 1EQ0A 1XEZA 2QSWA 3IRXA 2PIIA 2ZBQA 5D4OA 3H5YA 1XWLA 2ZHOA 3DM2B 5DJBA 3ETMA 5KOXA 5CCLA 2IBKA 4G3IA 1IVZA 5KFWA 3RTVA 1QJHA 4WF9Q 2N4DA 3MPUB 5G4DA 5IV3A 4X4UA 4O3PA 1EJ7L 5KFTA 4KR0B 2DNQA 4PWUA 5K20B 2QLFB 5KFQA 3GSIA 3MPVA 4WP8A 3V4IA 1FDNA 1O0PA 3V4MA 4DV3F 1WF1A 3DRYA 3TEHB 4AYBD 5KFCA 3PM9A 1M0SA 5HATA 2YNGB 3J80U 2YNGA 3AY0A 3H2LA 3HT3A 3VAGA 4DR1F 4ZPTR 2W9BB 4GC7A 4ZMMA 1H38A 2CZ4A 1Y10A 3FUYA 3MMBB 3LUYA 4K4VA 2JX2A 2YWEA 1C2PA 2OPSB 1Y0HA 1M5PC 4KGMA 4WJBA 2VG5A 3QWUA 4OYZA 4ZVFA 2RS8A 5B0CA 1R0AA 3VAIA 1KLNA 5LSRA 2WRMA 4L75A 4ZPBA 5KT7A 3CD7A 4OQJA 5F41A 5FLXU 1BWVA 1GTHA 3IRWP 2OKQA 4UOGA 1FI4A 3DOMA 2OTLS 2R8KA 1K73T 2XS7A 3QLHA 2EEYA 2ZJQQ 1HNWF 2D9OA 3DM2A 3Q86A 2RE1A 5IT0A 5F8LA 2A0FB 2J0SD 4ES2A 5CZXA 4PKDB 5F0UA 2J9CA 4LVOP 3CCQS 1CULA 2CZ9A 5DM6Q 1YZ7A 3PEHA 4C48A 4F67A 5KG5A 2POKA 2XSJB 2HK3A 4LF9F 1JLBB 2LEAA 1NSAA 3HZGA 4PRFA 3PFOA 3KTQA 4B3TF 3VV2B 3VVTA 1FO1A 1LK5A 2HFVA 3KG1A 1UA0A 4B3SJ 3T1AA 1FKOA 3CUNA 1TK0A 2HG4A 4LFAJ 2H4YB 3PJWA 4AXJA 5H9FK 2IIHA 5HK4A 5LL6d 3FRYA 2Q3PA 4L3NA 4MAKA 4NI2B 1NXIA 4AQYJ 1URNA 2NXUA 2DY1A 4I64A 4L73A 2NXJA 5E3AA 5EX0A 4DMZA 3IG1B 4PYAA 5HBMB 1PJ7A 4HT7A 4ZLPA 2W2MP 3RB3A 2M7SA 3TR5A 1PC4A 2CDRB 2O01C 1NUEA 2MQNA 2A1BA 3PJ9A 3D9BA 2XZWA 4P74A 4WE1B 1JNRB 2LECA 2B51A 4EBCA 2L3MA 1T9XA 3AB4B 2CQ2A 1N34F 2Z2MA 1NU4A 2DGVA 1VCTA 1S6QB 2CRLA 4DR3F 3NLCA 5E3RA 3UDLA 4AXIA 4OHXA 2ZC3A 2ZVIA 3GCXP 1NK4A 2JLFA 4M5MA 5JVGQ 5GAHI 5HVGA 3N4WA 5C42B 4Y6IA 1TV6A 5JXSA 5DG8A 1ZM9A 3UCUP 3Q24A 3PX4A 4MT1A 3EGVA 3DGPB 3QFHA 5C2CA 5IZHA 5I3UA 2FVPA 1UVIA 3OD2A 1HPZA 5ADZA 4UT4A 1S7HA 1S9EB 1X7VA 2CPHA 2F7VA 1MG7A 2Z4PA 3OXGA 5L1IA 4LRBA 1AT1B 4G6VB 3JXOA 1FE0A 4ILRA 5HO4A 1SUQA 3CCRS 3CC4S 4QWDA 5GAGI 3TAMB 1RT5A 1AYEA 1VBKA 2FHJD 5KFVA 3MCSA 2EFNA 1RYRA 2BJ1A 2XMUA 2GIQA 4UUWA 2M8DB 2HQCA 4IQMA 2DO4A 3SCLE 2OEJA 4MKAA 4USVA 4UOHA 4B9VA 1RTZA 4LR9A 4PWDB 1KLMA 3BR9A 3UVJB 1G6BA 2IRYA 4ALZA 2DNLA 3KK1A 2RF2B 4QQBA 4BS2A 1NLKL 2ALZA 3MM9A 1HNVA 2A2DA 2DCLA 6AT1B 4RNOA 3PEJA 3O8WA 3CULA 1HWKA 4EYIB 2UUBJ 3SSQA 2B6AB 4DG1B 3K58A 3D1OA 4UY85 3R8YA 4TQRA 2XS5A 3R5AA 4RW9B 3EGNA 2DIVA 1KOOA 2OPQA 4DFMA 3H42A 3KKFA 4P72A 4YB6A 1HA1A 3MM5B 4PG8A 3PR4A 3CMES 3J7Z5 1VRUA 4PXEA 3R1HA 1FJGF 1U25A 3FC9A 2JEIA 3GYGA 3WC0A 4X64F 1RT2B 3TAQA 3WX4A 2EFOA 2BJ9A 4P2FA 2FY1A 2F65A 2EBGA 1QVFR 3C19A 3DDNA 2KH9A 4RUHA 2YKNA 4DPXA 4P2MA 5GAHU 4DLEA 4PWWA 3FVYA 4RBUA 1IR2A 1XMQJ 4IFVA 2D3UA 1NCLA 1KQFB 5KG2A 4LQ9A 4O0IA 2HKEA 1IKVB 5DRKA 1DQ8A 1N36F 2ZH6A 2H9ZA 2OHDA 4U7UD 1VIOA 3KYLA 2VA2A 3DLEB 1UWBB 1ZYQA 3CDWA 5KG3A 4USKA 2E7XA 1HD1A 2E5GA 1D8ZA 3GLJA 4USJC 3I5BA 4J7CA 3NBPB 3FBEA 4NRUA 2VPXB 4WFAQ 3BSNA 3K0JA 4DN0A 4NPOA 4KTQA 1FE4A 3Q22A 3A13A 4Z7CA 2FJVA 2IAJA 3M2RB 3CCVS 5LXYA 4N47A 4OZ1A 2QLXA 2ZWPA 5A8WB 2D9PA 4F4ZA 5GMKa 2QMUB 1HR0J 2CQ4A 2YTCA 3ET6B 2BKPA 3IS9B 4ID8A 1FKAF 1TUGB 2QG9B 5I42A 4DR2F 1Q95G 4ZA1A 2KTQA 2W9BA 1NDLA 2RILA 3N28A 3CMAS 4ECQA 4ZLJA 2KT3A 2C28A 4CH0S 3SZ2A 4CTAA 5T14A 4PUOB 2LDIA 1N5VA 3LP1B 4ITSA 4CT8A 2UU9F 3X1LB 4OZLA 1S1XB 1N4LA 2UUCF 4I0WA 1PYTA 3EICA 4DQIA 3LO3A 3MM6B 5J2NB 2MQMA 5H9FJ 7FD1A 1GNKA 1OSCA 1Q8BA 2GA7A 4RBTA 2VBWA 5KFYA 4M5DB 4ENOA 1UWBA 1AROP 1Q82T 2E9TA 4CT9A 2VZ9A 4LR8A 1HNIB 2PT0A 1S6OA 2BANA 2C3MA 4CLWA 4IOCQ 1L3VA 3ZZZA 1CS4B 4N7TA 4ZVRB 4PG6A 2PD1A 2XMTA 3T5LA 2YX7A 3T3FA 3V6KA 2BRLA 4HHHA 2WVFA 2YKMA 3P45B 1FTRA 4EUVA 2Z2LA 4F36A 5A8RB 4RZRA 4BDPA 2BOPA 3H0PA 2E5IA 2K2PA 3MR5A 4KH1B 2R7RA 3WX8A 1VIXA 4N8NA 5I3UB 2W7AA 1NPPA 2ZKUA 3CD5A 3OTOF 3PVXA 2IPOB 3WZ0A 1RT2A 4CLUA 1PBAA 5J2QB 1TL3B 1H72C 1RLDA 3N5FA 4Y2KA 5B7WA 2YWHA 2B4PA 2JVOA 2IM3A 4P2XA 2O3DA 1VISA 4M95A 1NHUA 1WJ9A 1UJ5A 2KO1A 3I0SB 1WC1A 3Q0AA 3PRBA 4O3QA 2R42A 2M52A 2VFTA 1KONA 2DXEA 2LMIA 3VGVA 2XMKA 2V9KA 4MYTA 1IN0A 1FT8A 1SC4B 2CJAA 3TVKA 3MAQA 3H98A 4DR4J 3MR7A 1XQIA 1N33F 4J9NA 1Y5NB 4ZCLA 2FC9A 4DSEA 4Q2LA 1HNVB 3IG1A 3LGNA 1WSRA 4M5DA 3MCNA 5AE3A 1EP4A 1ZZNA 1KSPA 2GJIA 4KB7A 2B9EA 2V69A 3NGRA 4NCGB 1VJWA 1TK8A 1EETB 3JYTB 2E7WA 1QAXA 4URGA 1SH3A 2MSTA 3P8BB 3MD1A 3ICLA 4YDDB 1TMJA 3QIPB 2CZVC 1YJ7A 1KP6A 3IC1A 4KH0B 4NLWA 4RKUC 4F4KA 4GVBB 3CJKB 2VQEF 2VPYB 3C15B 4FXWA 4Q8EA 3I31A 4QIGA 4F0HA 1YVFA 1S49A 2V94A 3KNGA 4NXNF 3KLGB 2BEFA 4ELTA 4FDFA 4ECUA 1NSPA 1HQUB 1X4GA 1X5TA 3TOQA 5IXUA 3M9NB 3C2PA 4RW4B 1MWZA 2FJEB 3TUJC 1VLYA 1TR0A 4YQWA 3I5CA 4S0MA 5CQGA 5RUBA 1IBLJ 2W7PA 1XNRJ 1S1VB 4LRFA 3BM7A 1MU2B 1SIZA 2MQLA 2JEFA 2IVMA 3FCWA 5HJXA 3VQSA 5BR8F 2G1HA 4P9SA 1BC6A 1VDHA 3R7BB 1YJWS 4ZVQB 2IM2A 1SJ4P 1M1KT 4F2SA 4OX6A 4J9VA 1UPMB 3GB0A 1S6UA 4NEYA 3HXMA 3DOKA 4Y65A 5E5NA 2KRBA 2J76E 4UF4A 1UZHA 1MW7A 2E66A 3PX0A 2ZZMA 4TNOA 4D3GA 3HSJA 5D78A 4KFBB 3SIPB 3PRVA 4R8UA 1VRUB 5KFUA 3OFGA 2K3KA 3MUVP 4I6AA 2HQDA 2ZUGA 3NY0A 2HFZA 1TK5A 4WK1A 4O3SA 2UXCF 2V4JB 3DCAA 4OHYA 1UTAA 1Y4ZB 3LWLA 3SFUA 1TVRB 2ILYA 2A18A 3TAPA 2Q6CA 1O51A 4E8UA 1IXKA 3GFHA 4YHHF 5FD1A 2YVSA 5HBMA 3DYAB 5HROA 3I56S 4GO7X 1Q8LA 4U7UK 5AXLA 2Q1LA 2XI3A 3RW6A 4B3OB 5CD4H 1A7GE 3D5MA 3ITHB 3UNGC 4DR2J 3I0RB 3ILLA 4EBDA 2GVDB 2HHSA 4MFBB 4IG0B 3HHLD 2QA4S 1T3OA 3J7A1 5L8RC 3MMAB 4YUDA 2AJ0A 4DUTA 3CJSA 4LF7F 1FD2A 5F8JA 1DTTB 3MMCB 3QT8A 1U6BA 2VFVA 3I32A 5HMZA 2IMWP 1DQ9A 3ZNUA 1TKZA 2MMYA 3AD8C 2ZD1B 3EZUA 3GZ7A 3IS9A 1UEUA 5DZ6A 3ZZPA 4K4YA 1CJVA 4USIA 4ECTA 1D9FA 1D9AA 4LF7J 2CNKB 4FVCA 4NLQA 1YGYA 2CDQA 5I4MA 1OYDA 3DNCA 1VBYA 1M5VC 1GEHA 5AT1B 1E6YB 1JLCB 2ZC4A 4WYLA 2DGTA 3DLGA 3EGZA 2EC2A 1C0TA 3M6UA 3G6ES 5LOQA 4DQPA 1GXUA 2WW4A 5THWA 1VS3A 3TARA 2FLPA 4DV5F 4EYHB 2BE7D 1HWIA 4DL0C 3KJFB 2R7TA 3T5HA 5AXMA 2QA2A 3BV8A 2I38A 2DNYA 2GAGC 1R0AB 4J90A 2V5HG 4ETZA 3HK2A 3QJPA 1HBMA 4DV1F 1XC9A 2K7JA 3P5BP 4ZVGA 2P9CA 1KBRA 4RBVA 4XDCA 4E98A 3NMRA 1K0VA 3MMCA 3BR8A 3GONA 4RUBA 4IQXA 4FNHA 3HHNB 4DSLA 2L9WA 1RAFB 2QGFB 2W01A 4QR1A 3KHHA 1A0OB 4Y28C 4X64J 2WW8A 3UN5A 1B0PA 4QR2A 3CCTA 4DUYF 2V67A 3TQ1A 2CYYA 2DR7A 4B3TJ 2KU7A 2Z58B 1PBUA 1HMVA 2VBZA 3C16A 5HN0A 2VIHA 3JQKA 4MJKA 3UDEA 1W26A 2LU2A 4ED3A 3OL8A 1IUJA 5KG0A 3FMBA 1UPPA 2BW2A 1KD1T 1FFGB 2ASLA 1S9GA 4NI2A 2D1CA 4HTIA 4CLKA 3CJ4A 4F8RA 4OZJA 5K8PA 1FXRA 2HBRB 1YJRA 3PYGA 2HNYA 1U49A 3I82A 3IBFB 3MEDA 2F4VJ 1S72S 3CJ5A 2RF2A 1VQ8S 3GSDA 1BQXA 4ICLA 3T6JA 4I2PA 2VICA 1ELOA 1U1LA 2IC3B 4JBCA 2XYPB 2V6AA 1SB6A 2JRSA 3OL6A 2BX6A 3DGVA 3M9OB 2DJWA 1KNZA 4CLYA 2RQCA 1XR7A 2R7SA 2LQBA 1U6FA 2LP4A 1FXDA 1OY9A 2DEIA 1Y3KA 3UN3A 1U1QA 2BKOA 4KYZA 1HQEA 3IMQJ 3DI6A 1AFJA 5CA5A 3RAXA 2KHCA 1O8BA 3BSAA 3KUGA 5HQMA 1NNDA 3TUZC 5J1NA 5HQLA 1Q7LB 4Y0FA 3MAAB 3CD6S 5F3ZA 1WEXA 1FFWB 1WF2A 3R1LA 3CCES 3OVBA 1PAUB 1IKXA 2GC8A 2OGUA 1Y11A 2MB0B 1N6QA 2XC9A 4OJ3A 4NLPA 1QSLA 1JLEB 3FFIA 2XEXA 4X4RA 1EQMA 2ATCB 4NRTA 4N41A 2JWNA 3MECB 2C42A 1S9GB 1SPBP 1U8WA 4ECSA 2AGOA 2VONA 2W4DA 3P6YC 3MR2A 3MPDA 4ZS6A 1RTDB 2PI5A 3HVAA 1S1WA 4O3OA 1U2FA 2KT5A 4I69A 2JFKA 3LALA 1R8AA 4WPAA 4YDXA 3DU5A 4N56A 2RDDA 1CPZA 5B0AA 2VL1A 4LF9J 4DR3J 4EI2A 3SI8A 4P52A 3NCQA 1E6VB 5HAOA 3LA0A 2HHQA 4NLTA 2GVZA 3ISND 1YJUA 2BJDA 4DBQA 2OPPA 1ZAXA 2PC6A 1RAOA 1OMSA 1P9QC 3GIRA 4NYPA 1UVNA 3DMJA 1KTQA 3GFXA 5CYQA 4OHVA 4O0NA 4U8VA 1CJUA 2Z2YB 4KPCA 4CNYA 3MR6A 1VQPS 5A6PA 2RNEA 1ZETA 4FF3A 3PYDA 4AT1B 1QTNB 2GQCA 4Y34A 4JI0J 1JX4A 4DR7F 1JK9B 2AHOB 3POTA 2YNIA 3I9ZA 3MCOA 3UDCA 5KFMA 2R2TA 1LW2A 3PX6A 2E1RA 1LOUA 1MMLA 4F3OA 1NKCA 1OY6A 2GV1A 3DHWC 1N5YB 1F2GA 2U1AA 1Y5IB 3ADAC 3VTIA 2KG0A 1KLMB 1NKBA 5K14A 4TN2A 1YITS 2P9GA 4X4TA 3H8YA 3QWPA 1U0HB 3TVYA 5A2QU 3OPKA 2DRDA 4B3OA 1CJKA 2V68A 2OO4A 2GCFA 2DNOA 4WFXA 3PR5B 1T9UA 1QAYA 2G0IA 1NZ8A 4Q43A 2Y3YA 1U45A 1G1XA 2RSQA 2DNGA 4R8UB 1RT6A 2CAJA 3P49B 2HHXA 4J37A 3DLKA 4IYQA 3DLKB 5B0DA 1VBXA 1CJTA 4GVBA 3MURP 2HYIB 4F04B 2HPUA 2BMBA 4EK2A 1AW0A 4WU3A 1RU1A 1YBAA 2UUWA 4ECWA 1N34J 1KFSA 4FBTA 3D0GE 3AHPA 4LUBA 1Q1KA 3VCDA 1GX5A 2B5JB 5ITHA 4OYAA 2X3DA 3SDEB 2DT9A 2O67A 2WOMA 1BXNA 3ETOA 4KT0C 5E3QA 5CYJA 2E1CA 4ZPVR 2Y1IA 3NNAA 2FJDB 3J81j 4K50A 2YKAA 3TZXA 2LU1A 3KJVB 3NNHA 2JZ5A 1QE1A 1FK9B 1S1TA 4UW2A 1N0VC 1SJ1A 1VRTA 2GJFA 2G13A 3D67A 3HHLB 4TU9A 4YY3F 1TL7A 4WBFA 3NWRA 3BO3A 1WEYA 3W2VA 3SQOP 4QIEA 3KWMA 2Y1LB 5HVHA 1X4AA 1DFDA 2R8JA 3RAMA 2ILZA 3AFGA 5KFJA 3CIZA 1S77D 1DTQA 4N5SA 1FJGJ 2B9YA 1DJ0A 4F26A 2OPPB 3OXFA 2W8LA 2JL9A 5KG7A 1N54B 4JI8J 1VOMA 4YEAA 1VHFA 5GAEI 3CVKA 3FZBA 1F2HA 5CYQB 1WF0A 2L9NA 3OFEA 4OI1A 3UI3A 4CI0B 5M2PA 2XMAA 2LCWA 2AYMA 3L7UA 2V4QA 1HW8A 3GG1A 1S5ZA 3OJUA 4DQRA 1IR0A 1S99A 2AJQA 1ZAWA 3CJTA 1KWMA 3I87A 3M32B 4PXCA 4QOTA 3KXDA 5HANA 4NASA 2GS8A 2KHDA 1S4FA 2AKWB 2H3EB 1FESA 3O2IA 2I6WA 1NB7A 2HHVA 2YWKA 4PG5A 5KFIA 1OQ3A 2QL9B 3R97A 1UJ6A 2Z30B 5HL7Q 3V6JA 4ANCA 1X0FA 1ZS6A 3IFEA 3ISNC 1XMOJ 1VQ5S 1N32J 3DRPA 4PWDA 2XNRA 1NDKA 4GC6A 1S57A 1XERA 2YKMB 3FMWA 2IVFB 3L7OA 4Q0BA 3RW7A 4Q0BB 4I67A 2IY5B 4I7FB 2J0WA 2D69A 3RRGA 2VOPA 2DR5A 1LWCB 5A8KB 1EKRA 3ZO7A 2OD6A 4LFCF 4I2QA 4FBUA 2AQ4A 1ZPWX 5KFFA 1NH8A 1HI1A 3LQVA 3SMZA 2E5LJ 5D0RA 2AYEA 4LRAA 1GK8A 1UP1A 1NK7A 1R6VA 2HAIA 3BN7A 3PW4A 4LREA 1RKJA 2FLNA 5K8NA 4L6V3 4K0KF 4NA3A 3N9UC 1FRLA 5CH7B 3LWMA 2HHWA 3I4PA 1IBLF 1XNRF 4LIWA 2OPSA 3HKWA 4PG7A 1R8HA 2CVIA 4TY8A 2ZH8A 2HNYB 4O44A 1LW0B 4IH6A 1KVKA 3QGHA 4K4XA 3QSYB 1Z2ZA 3HLUA 4HKQA 2N3OA 3K89A 2PSZA 3GJQB 5HMYA 5KFBA 2M4MA 4ES1A 2BE2B 3MM7B 4QCLA 1S9FA 2GX8A 3QGPA 1RHRB 3U1LA 1HKAA 4DU8A 2GVZB 4FVMA 4UUXA 4CM0A 1O5JA 2B4VA 1LFWA 4OI3A 5HP1B 2XCAA 4R0EA 2IAJB 2OUGA 4N77A 1DZ5A 4ZLLA 2D7SA 1VBZA 2I5JB 5AXKA 5KFHA 1BHNA 4FPIA 4K4UA 2HLTA 1OWXA 3ONQA 3KHGA 1RB0A 3G82B 4QR0A 2XMVA 3H90A 1X5OA 3P3DA 3G4SS 4RLEA 1CEZA 2F8MA 1OPZA 2OPRB 3EWGA 5C24B 3OHBA 1KN6A 3AA8A 3T19A 2KVQE 1N33J 2D3OR 2B43A 1S1VA 3I0SA 4MK9A 4AL6A 3MECA 4OJ1A 4HEA9 3SV3A 7FDRA 3ZZTA 4JI4J 4EMDA 2C2EA 1V3RA 2HWIA 2IJRA 2Q6BA 3KG0A 3QT7A 2VJVA 1FTCA 3D66A 5DQGA 1CG2A 2C2DA 4E2FB 2XMMA 3EVWA 4CLTA 5KT4A 4KGZB 4RW7A 3ZXWA 1NH7A 4OYXA 3CT9A 5M2UA 2J9DA 1FXLA 3MAHA 4R25A 1U1MA 2KZZA 1VI7A 1HNXF 1TKXB 1UW4A 2VQEJ 2G0CA 5LSLA 4QW9A 4IOBA 1HQ2A 2HFNA 1RACB 4DS5A 4TLQA 4ZCMA 2GGPA 4TY9A 2VG7B 4JI3J 2FDNA 2HS3A 1EAYC 4UQGA 3OTBA 2FGOA 2M3DA 3RB0A 1HWJA 3LP0B 4OMFG 4ATNA 5A2QY 4LBPA 4OYWA 2F40A 4X4SA 1WTBA 5IT9U 2MSSA 1SL1A 4U67Q 2MY7A 2QL5B 2WVEA 4TYBA 3W5YA 2EW9A 4QWEA 4AL7A 3UCZP 3D6MB 1TFYA 4PUOA 2QO3A 3SCJE 1HWLA 1FX2A 1P1TA 5LMUJ 4I6YA 1SKWA 4E0DA 2XWXA 3RG6A 2FHKA 3GE9A 5IWAF 4TXSA 1Q5VA 3OLBA 3TZYA 2EK1A 3DLHA 3EVMA 1HWUA 4C11A 3MD3A 3IA0A 3T1HF 2DNHA 3JSBA 1FFSB 1P27B 4J91A 4KHPJ 3FBCA 3BH6B 5MLCV 3NMAA 3L95X 3DXSX 4USUA 3T1YJ 1RT6B 3ZZUA 2FC8A 2KL8A 2ZE2B 2AEMA 2IRUA 3F44A 4KRWA 4Q44A 4YB1P 1YJTA 4FNIA 1JLAA 5LMNF 2Z0GA 1KVJA 4JYAF 3M8WA 4DN9A 2AJ4A 5B0EA 3J7YU 4A8YA 4G1IA 5E3CA 3H2UB 4B02A 4Q45A 3VGUA 4ZCIA 3OXLA 1UMJA 2EI5A 1X4HA 2VQFF 3Q8VA 1NRKA 4B9TA 4YR2A 3T5KA 2CJYB 5H9EK 3IAS9 3OR2B 4TLRA 1HYSA 1YI2S 2P2CB 3BB5A 3KHRA 5J2PA 3TW0A 3LP1A 5KFOA 1RWNB 1RE1B 4GKKJ 3FEXB 4OI0A 4RW4A 5I3PA 1SQEA 1B0VA 1FD8A 3MM6A 3CTRA 1RZMA 3M9MB 1FWLA 2HK2A 3FRZA 3QO9A 3EZ5A 4J9LA 3NXZA 3J80Y 1WACA 3HMJG 2VFSA 1QUVA 3D2WA 4JOUA 5DDPC 4NWBA 1F3VA 4YR3A 3BJYA 4PXBA 1TKXA 4EZ9A 2RDJA 2E9RX 2DGOA 1IBMJ 3T6BA 1JKHA 3FBFA 1JKHB 1T95A 4MTPA 2UXDJ 3QLHB 5L9XA 4DPTA 5DQHA 3M2RA 3N79A 4EEYA 3VZHA 4NLGA 2CNOB 3PHTA 4RW6B 1YX2A 3SSSA 3ET6A 3CF5Q 3HO1A 2F9DA 1WI8A 2CNNB 1AA1B 1H98A 3QRQA 2F1FA 4NLUA 2HVHA 2KM8C 4K4TA 3ENWA 4JV2A 1IQTA 1S7IA 1T9TA 2EPIA 3C16B 5A0YB 2EFGA 2UXBJ 5LJ3Y 3OR2A 5DQIA 1WG1A 2QLWA 1AUSL 4WIQA 5E0OA 1S0OA 4KGXB 4CO3A 3DYAA 5HROB 3EVOA 4C3MA 4XAKA 3GJTB 4D3HA 1S1UA 2MLYA 1R31A 3G6XA 3NGTA 2DR8A 2WONB 2WONA 4DR5J 3OR1B 1S79A 3KK2B 4DR5F 4LQ3A 2XZTB 1U0HA 2IYIA 4CWBA 2RJZA 3C6UB 4M5IA 5H1SV 4U96A 1QLNA 1WNEA 1V6HA 2YH1A 2HLUA 1ZA2B 2FHOB 2VASA 4I2QB 4MMOA 5HVFA 1YJ9S 3C46A 3W64A 2C1EB 1HHQA 4ZHRA 4ES3A 4V1Ak 4LFBJ 1S10A 4ZPAA 4KO0B 2R3VA 4FF4A 4QYZJ 1U1NA 2CPXA 4B3MJ 3GP9A 2CJKA 4HH0A 2XHCA 4NCBA 1EZZB 2HVIA 4JI6J 2BKNA 1S4EA 4HI1A 2G0JA 2KM8B 4KJIA 3OVAA 2BA9A 1RP5A 1U47A 2Y8WA 4ED0A 4DV7J 1LW0A 2KN4A 2YQ3A 1G4CA 2NXNA 3H20A 4HHUA 4NZ7A 4DPYA 2YBVA 3DRRB 1NK0A 5D6GA 1U26A 4P71A 2NXEA 3DRSA 3UVJA 1GMWA 4K5SA 1ZM4A 3TI0A 4USWA 1BQNA 1BY9A 2NCKL 3G8SA 2FQQB 3PCOB 2BUNA 5CCMA 3C14B 3OR1A 1R8BA 1SC3B 3PIPQ 2ZHBA 4NXMF 2ZM6J 3BDPA 4HLBA 1B7YB 3AT1B 5DGAA 3DOKB 1FERA 1GX6A 3CJ0A 4I2PB 3R9LA 4DX6A 3V81A 1X60A 4IR1A 3LTOA 2KYXA 1BMQB 4KHRA 4JI1F 1PC5A 3OBIA 1C4CA 3NCRA 3IWNC 1HPZB 1HNXJ 2MKJA 1ZTTA 4DSJA 2XBPA 2GMJA 2ZNYA 3BGRA 4KPYA 3V4IB 1T03B 2XZDB 2MLXA 1U02A 4NZ0A 3IBCB 1FWPA 3OFHA 4FXVA 2ZH1A 1JWWA 5T41A 5BR8J 1WC4A 3R2CJ 3JQMA 1HW9A 2XB2D 2JC1A 5ETVA 1VRQC 1Q8IA 1SVDA 1C0TB 2WVCA 4LSLA 1LK7A 2DO0A 1XR5A 4B9LA 4K7QA 1LWEA 2W4CA 1LWEB 1YLXA 4DDFA 1HHSA 4W98A 5SZTA 4WCEQ 2XCPA 4L72B 5F8NA 4H4MB 3MEKA 4KAIA 3SCIE 4DPOA 4R5PA 2DVIA 1FKPB 1GMVA 1YK9A 4NLYA 4PEOA 1GAOA 5JUMA 5GVQA 4ECZA 2X3GA 5DZ7A 2MZ1A 4X62F 3HX9A 1RXOB 3RUBL 1EX8A 2XGPA 2Y8YA 1B64A 4WWSA 2VFRA 3FSXA 2HFOA 4PZVA 5FIIA 4X65F 3M8RA 1ZZFA 4FYDA 3IWXA 1PYSB 2NPIA 3W61A 3W63A 2C3OA 1CQMA 1BLUA 2EFQA 1QD1A 2HW3A 1FF2A 5G0RB 8AT1B 3OVSA 1YKWA 2OEKA 3JAMY 3H4DA 3EDQB 1RAJA 2AIRB 2SXLA 1B4SA 3N01A 1YSJA 2B8PA 2E1MC 4DX5A 2HMIA 3T9ZA 5F9NA 2BJ7A 2OIHA 2WB1D 3B4DA 2CQCA 3HVWA 3RB6A 1M5OC 2XY7A 4B9MA 3CDEA 3SV4A 3DLGB 4QWCA 4H4KA 3H2VE 1YIJS 3DRRA 1VRTB 1RT4A 3D6FB 2AEJA 3NGSA 4IFYB 4F7VA 2ZBRA 1OS5A 1WKJA 1LW2B 2BV3A 2XI2A 3TUIC 4MKVA 4ED1A 1NMEB 4IH7A 4BWMA 1GFWB 5KFPA 3NL0A 2AGQA 1IKYB 3HSDA 4MIAA 1NSQA 4F2RA 1ZOTA 1W2BR 5KFSA 4Y3CA 1JJCB 2FZGB 4HH1A 3V81B 1JQGA 3H4BA 1DLOB 2FIUA 1DLOA 3MGJA 3MMAA 3QT5A 5A8WA 4EZ6A 1WOSA 4DV3J 5KFGA 2Y0SD 4OI6A 3CCMS 3A3OB 3B4MA 1IWAA 4CH1A 4UZBA 3UD4P 3Q8YA 3L3CA 2BRKA 4USHA 4K8RA 4A4JA 1Q16B 2K1RA 2EWHA 1WD6A 1RWUA 1HQUA 2AP6A 2YWFA 3NS7B 5IQQA 3OHAA 4PPZA 1RWMB 3ILJA 4XDDA 3TANA 4MIBA 4JI8F 3TUPA 1VQ4S 2HNDB 4YS2A 5GAEU 1MSWD 2G2ZA 2OSQA 1RAAB 3QGGA 4DL2A 3VHQA 2KVIA 1B99A 2MZSA 1NJXA 5GMEA 4JI7F 4Q8FA 4LF1A 4IDKB 4DOZA 5F8MA 4OZ5A 5J1EB 5F8IA 3GJRB 3BKTA 2MKHA 4IG0A 1HBOA 1D09B 1HBOB 1OYEA 3IBWA 4YY3J 4ZN1A 2OD4A 2NZCA 4FKYA 5KT2A 1E6VA 3OSPA 4PABA 2O1PA 4C8MA 4DSKA 3PKMA 4JP8A 2XSJA 1UEVA 1QSYA 4I68A 4DI6A 2FVCA 2X51A 3RU0A 3G8TA 1FEHA 3KUHA 1PILA 2OPQB 2WSFC 4HT5A 3NP5A 3PACA 4KSEB 4M94A 2CQPA 3DLLQ 1FJCA 1JLBA 3M05A 1K9MT 3Q8PB 4X65J 1L3TA 1FNMA 3MTKA 2E1PA 3NOCA 1FVQA 2JFDA 3BN4A 2YNFB 7AT1B 4LF4F 5FJ4A 3ILIA 2GW8A 4WIIA 1T8EA 1H2TZ 2ZZNA 2VU5A 3MMJA 2E44A 5DS7A 1BE4A 4B9NA 2P5VA 3FSYA 1JLEA 2AZ3A 2LQJA 3FFIB 1UAWA 5J2MB 3CCSS 4DR4F 1C1BB 1GMUA 1XN9A 1C4AA 2LQ9A 3KK3A 1CBKA 2LQ8A 2BE2A 3MM7A 4W4MA 3A3NB 4CYUB 5LJ5Y 4U9RA 2AX0A 3JSYA 5ETQA 5ETSA 3W66A 2ZH4A 3RR8A 5C7PA 1LXJA 3RRHA 3HPOA 3HVTA 4AQYF 2V2VA 4LMZA 3FZ2A 3B78A 3DXBA 1VQMS 3KLHB 1YJVA 3TYTA 1MROB 1U6ZA 3BGFA 1MLAA 1OQ6A 3RR7A 1RWOB 2HS4A 2OPRA 1N52B 3VAHA 2I8EA 4O4RA 3QAUA 4CDIA 2AGPA 1S6PA 2DPJA 5DDOC 2C2OB 4P7VA 2ZM6F 2C2MB 3C66A 1RWPB 4RWXA 2DY9A 3ZZYA 1ZM2A 2U2FA 4NCAA 2XG8A 3POTB 2XYGB 2C22A 1RTJA 1WOOA 2HS0A 3LGHA 5BXIA 1K8AT 2R4FA 2B4OA 2ZBIA 3ZTPA 1L3KA 3N6LA 4DCJB 1VQ9S 3KNAA 5HLFB 4FYWB 2OMLA 5KT5A 2RB7A 2RQKA 3BH7B 3HD2A 3QGIA 3KLIB 4ID5B 2CUYA 3AB2B 3GV8B 2UU9J 3SQGB 1QVGR 1F9EB 3MEGB 1MMDA 3Q8SB 3CXCR 4HACB 1RHJB 3AOAA 1VQKS 1WC5A 3BSCA 4LSZB 1TL5A 1RT1B 5D8HB 2HVEA 4WU2A 3CW2C 3LAMA 5J1PA 5E33A 1KRPA 2UVVA 2BANB 4TQSA 3C6TB 4MK7A 1RADB 1RBAA 3W62A 2HURA 5DM7Q 2HZCA 5L1KA 4MYUA 5D0HA 3EUNA 3W7BA 2MZRA 2RUGA 3DRXA 5LSOA 4CZCA 4ECXA 1UWAA 2Z56B 3T41A 1C0UB 2WSCC 3AJ2A 1VYAA 5IFMA 1YBUA 4FYXB 3K57A 3O6QA 3R7SB 1LEOA 3A1YG 1DRZA 1RAIB 3QFWA 2XS2A 1FDAA 3OTDA 4IKAA 4XIUA 2R7WA 2VV5A 1NDPA 2CJXB 2V0NA 3N0VA 4B3MF 3S8SA 5DETA 3B54A 2LEBA 3VF0B 3BBFA 1N36J 4DLGA 3DLJA 1FWKA 3K2YA 1WUUA 2DBBA 4CTAB 2NPFA 2D3O1 4JI0F 4LFAF 3Q8RB 3ZNJ1 2ZH2A 3NAIA 1TFWA 3W9JA 2P6SA 1T11A 2LFVA 2ZUAA 4FS1A 2HIQA 4QYRA 2WVDA 3KMQA 2WK4A 4ANDA 2QIFA 4RNHA 2DNMA 2ZE2A 2ZKTA 2N82B 5LMUF 1KS2A 3G8QA 4NA2A 4QU7A 1TKZB 4RW8A 3VAKA 1DAXA 2QN6B 3ZTSA 4O4GA 2FGCA 2DHXA 2MGZA 4ELUA 1RT3B 2CVEA 5M2RA 1AUDA 3IGVA 2DHAA 1M5KC 5K5MA 2B4UA 2UXBF 3H5XA 2W1BA 4AFFA 5I3QA 2RRNA 4EU0A 3F73A 4OYIA 2ZOFA 3GV7B 5J2PB 4CCHA 2PMWA 3TJAA 2IM0A 4CLPA 2YWWA 2ALYB 5B0GA 3CGIA 5KFEA 4ZVUB 1UW9A 1AFIA 1KFDA 4FYYB 1YRTA 1V5VA 1M5SA 1T9VA 1OJ4A 2X1BA 3AOCA 3F56A 3SBMA 2YWGA 1VFJA 1X9MA 5D3GA 4F4YA 5SUHA 3MEGA 4G1QA 1ITPA 2JEJA 3WIUA 2QLJB 2VFUA 3M30B 1V3SA 5KOWA 1BWEA 2UZAA 1RI7A 3UE2A 4URQU 5IM0B 5IM0A 3K5OA 3THVA 3CNQP 2CG4A 2MJUA 4CH7A 4X4NA 1D9DA 2RQMA 4NOHA 3PO4A 4RO0A 1SIWB 1W2IA 5A8KA 1LWCA 4OJGA 3PO5A 2C3UA 1SQFA 4DFKA 1HBUB 1Q8KA 1EETA 4V19X 4ZIVA 2W24A 2VC1A 1SL0A 1RA7A 2HEKA 2PA8D 1G2EA 1Y00A 4DV1J 3I55S 1F6TA 2CQBA 4PQUB 1K1SA 2OFGX 2N7CA 1UVMA 1IKWA 4USTA 2XLKA 4M1KA 3HDSA 5EWGA 1HQEB 1LFPA 3AH6A 5CZVA 2Y0BB 3OTCA 4Q7AA 4IRKA 1T9WA 1DARA 4KV8B 3IXQA 4OX9F 4EBEA 1GQEA 2NSBA 1FRMA 3TZWA 1W7WA 4NL5A 4ZKAA 4WKRA 3CWJA 5CXTA 1VGYA 2HSEB 1F5CA 2KKHA 1LWFA 4PG4A 2B56A 1WHWA 4L74A 3CDAA 5KFZA 2RU3A 3M1VA 3WBZA 1PG5B 2F4VF 2IDEA 4XPCA 3D0IE 4Z37A 3TJ9A 3ZC4A 2AYGA 5KG1A 4NCGA 3HM9A 2KI2A 2WBMA 2BM1A 4ED2A 1FJEB 4OJHA 1XNQJ 5A8RA 1FDDA 2MZTA 4YR0A 1EIYB 4GKJF 3JAMU 3BPDA 3FEYB 3KLEA 2BOAA 3QNWB 3GQCA 1IBMF 1S6PB 5B09A 4F25A 1NAQA 3TNVA 5KT3A 4LBIA 2CQ3A 4F3MA 2WCXA 5DGBA 4NEZA 1IM6A 1UFLA 2BXJA 2OP5A 2YPZA 3NRBA 1QAIA 1Y7PA 4IFVB 4ZDNA 2F63A 2K3IA 4NYZA 4CLFA 2MKCA 2OELA 1WTFA 1V9OA 2VBXA 3IAM9 5J1EA 2RKIA 2PE8A 2HNZB 3NS5A 3SQGA 3ENVA 2DB1A 4K2JA 1I5OB 2J0XA 4UOFA 4X62J 4J9QA 1VQSA 2RMLA 4CO4A 3EJMA 4OX8A 3QRRA 2ZBPA 1N5QA 3GR0A 4ED5A 3A8IA 5FDLB 1DTQB 3EZOA 1GTEA 1KHWA 3IM8A 2BABA 2IRXA 4JI5J 3IP0A 4EFAC 3P5TL 2P6TA 2VC0A 2ZOMA 4C0HA 4A8MP 3MF5A 4IO9Q 4KE5A 3TWZA 1RISA 3BSOA 2J5AA 3DC2A 5ETRA 3R3TA 2ZEJA 1H2VZ 3PJXA 3VGSA 2FHJA 1YBTA 2Z2ZA 1B3TA 1MNEA 4O3NA 3M8PA 2C2NA 3LP0A 3SEOA 2V2QA 1SJ3P 1N8RT 1S48A 4X2BA 2XTJP 2ZOGA 4ZPDA 5JMNA 3R2DJ 2F8HA 1V5IB 3GFYA 4AUKA 2WOMB 4N8OA 4Q2MA 1DBDA 4ILMA 1VQYA 1U48A 2ZBCA 4DL5A 2MJNA 2XY6A 1WELA 4NYOA 2FYXA 4X4OA 3VR1A 3LPEA 4U7CA 2RQ4A 3A8KA 4C97A 3R5CA 2CPIA 1T02A 3KHLA 1SQGA 1FVSA 3DRSB 2GAHC 4MFBA 3U02A 1N0UA 4DX7A 2W9AA 4DV4F 1SV5B 4HDGA 5F0WA 4IRDA 4QJVA 4BHQA 2IA6A 4RW7B 1ROFA 4C9DA 2HQGA 3BQ1A 1EP4B 3ULHA 3W2VB 2WAQD 3TA1A 4NLSA 1Q53A 2YKQA 4A8SA 3TJ8A 4C98A 4X4PA 2F9JA 2EVZA 1REVB 3DKDA 5H9EJ 1SH2A 2AV5A 3OT9A 5CAAA 1U24A 3DN9A 1E6YA 3SYZA 4Q5VA 3IR6B 3D4JA 2GO8A 2OMOA 4JI2F 2YNIB 1MN7A 2GO9A 1SH0A 3HF5A 1TVRA 1LXNA 3W65A 2PFDA 1PKUA 1J27A 2NS1B 3A4TA 1BQMB 1SC6A 2DNNA 1RAEB 5IC4B 1XBWA 2W2OP 3NEKA 1IBCB 2OFHX 1WC6A 2WTFA 4DFPA 4DL4A 2JOQA 2H48B 3OFFA 3I5AA 1S1UB 1RSCA 3NAHA 4KKOB 2VJUA 5HSPA 1NPRA 1YZ6A 5D0EA 2WBRA 1SV5A 1PSDA 1SC1B 3KK2A 4K4SA 2V2KA 3NKYA 5BYSA 3TA2A 2UV8G 4IOAQ 3TP2A 1VC0A 3JTNA 1NO8A 1Q5YA 1RKIA 4I7FA 3QJLA 5KAKA 5LT5A 1FX4A 3CMQA 2VH7A 3VAMA 2VPZB 4TVAB 1T94A 5C42A 1CULB 1Y9OA 5ETLA 3PNIA 2IC3A 4DU7A 3M8QA 2W9CB 3T9NA 4NLVA 3GPAA 4OX7A 2CPDA 4NE9C 3W8GA 3PW0A 3W60A 2ASDA 4RW6A 2CQGA 2WVBA 1JXVA 2CG8A 3BDEA 4H4KC 2V4JA 4ZJLA 2FZCB 2R2RA 2ZJRQ 2W2QP 3BPSP 2RHQB 3TAMA 1N56A 1B7FA 2BE9B 2D74B 2VG5B 4LRCA 4P73A 2QT7A 4NLRA 1RTIB 4P2SA 2DGQA 1P6TA 3VQTA 1HNZF 3MOZA 3UW1A 1DHMA 2BBEA 1Q81T 4DV7F 4CO0A 3OW2R 2QTWA 1RYSA 3QJJA 3HHKA 2BR0A 5K8MA 1WOPA 3GG0A 2M2BA 2V8HA 1PGZA 4JV5J 4OYOA 2VQFJ 5FLXY 5D0GA 4DR6F 4HACA 3G96A 3O3LA 3C6UA 2Y9HA 3KDOA 4ECYA 4O23A 3M8SA 4H54A 4ZP9A 5AE2A 2Y1RI 2XULA 2LLZA 2BJ8A 3W2WB 5IT4A 3GILA 2RRAA 2ZH3A 1TV6B 2W2PP 4OI2A 2XY5A 3E3XA 1URRA 4LFCJ 1TKTB 1RHQB 3M2UB 3N5BA 1D0EA 4NLOA 1RBLA 4U8YA 2ZVSA 5GADI 1N5TA 5KFLA 2YQ1A 1F5BA 4B17A 4P75A 3R5GA 3S6EA 4U6PA 1U1KA 5BYQA 1N6QB 3CB4A 3MM8B 2QA1A 1B70B 4QPXA 4DUZJ 1L3UA 1RQ0A 4RUCA 2BW7A 2YKNB 4UY8T 4B3RJ 2AF6A 1VR6A 5HQ8A 2EBEA 3GV5B 1PAEX 3R6LB 5C25A 5D3GB 3LPYA 1IBKJ 1JXLA 1T05A 3ZTQA 3HJVA 2C3YA 2L48A 3AXKA 1WHXA 2ASYA 3UPFA 4F0MA 1J5EJ 5D4LA 3OL9A 3QPIA 3ZZRA 4RL1A 2X1AA 1HL6A 1TKDA 2R8GA 2I2YA 2DHGA 3K7RA 4YB5A 2MEWA 2NUHA 2VUGA 3IR5B 1XR6A 5ETTA 1RLCL 1TL7B 1RHUB 2HZAA 3AQOA 3EDRB 4M63A 4RWWA 9RUBA 1RWXB 2QEXS 3RJMB 3M2VA 2W7OA 3GYXB 4LIRA 2GFFA 1DTTA 4ECRA 1WORA 4ETXA 5EHHA 4ZK7M 2L08A 3UR3C 1QDUB 2RDIA 3K5PA 4RW8B 3V2UC 2FJWA 4RUAA 5JVHQ 1T03A 2CFXA 2KXHA 1FNOA 2J8AA 2NYHA 3TZZA 2HZVA 1I6JA 4I6WA 3CJQA 4M5KA 5A6WA 1LWXA 2DD8S 2GNKA 1M5HA 5CABA 2BQUA 1RT5B 3QBCA 2HAFA 2GJ2A 2EG2A 2IBOA 2KYZA 5HI7A 1WHYA 1L3SA 3WC2A 1HMVB 1HLWA 1IKXB 2GMLA 2P8IA 3VVUA 3KDNA 3NOGA 4LF2A 3W8PA 4DSIA 4ZP6A 2HHUA 3OUYB 1ACMB 3MOJB 4QBUA 2I9SA 4A8KA 1I51B 1QUPA 2CWKA 3PYEA 4JYAJ 3AJ1A 3OTEA 3ZTRA 2AW0A 3QO9B 3FQKA 5E41A 1S0NA 1CJKB 4KY3A 2V8PA 2VBYA 3BZQA 1NM2A 9ATCB 1UVLA 3I0RA 2PEHA 2YKOA 3M6XA 4WKYA 5KFKA 1S0MA 3KLVA 3W3SA 4ZVEA 2JNJA 2MKYA 3HHEA 1AZSB 1UCNA 3OJSA 1I1GA 1NJYA 1OO0B 1FRHA 2H51B 5EDWA 4H4OB 2V8VA 2CQ1A 4HHJA 3BGUA 3UQSA 2MXYA 2HBZB 1NK9A 2NQPA 3HSZA 2AJ2A 2VKRA 5CHCB 5EX3A 4AE5A 4DR6J 2CJBA 1F1BB 2MKSA 3GIIA 1W25A 2APOA 2CPZA 4DJBA 1L5UA 1OPIA 1J5OB 3O44A 5A0YA 1NJIT 3J81Y 1P1LA 1JLCA 1RHKB 1HI8A 2CQDA 4FPRA 4TU7A 4K4WA 3PZPA 4JI3F 3IO1A 4RNNA 5CD4A 1TL4A 2UUAF 1UVKA 2NREA 3HHLA 1R27B 1ZAVA 2KRRA 2IYGA 2H65B 2VPWB 3ZZ0A 2NYIA 3KLIA 3MCMA 4PR6A 4JV1A 4O44B 3RGIA 3NBPA 1FRJA 1GXTA 1JJ4A 3IWLA 2PMHA 5KG6A 1IQZA 1WI6A 2RS2A 3D68A 1RUSA 2J9DE 3ENAA 2EFVA 3DHXA 3IN5A 3DOMB 4AD6A 2VF3A 2M0GB 3EXYA 5C5JA 3CCUS 1I94J 1A6LA 3BGRB 4DL3A 4FXDA 2CA9A 1U8SA 1WHVA 3MI7X 2B7BB 4EWTA 1HNWJ 2KXFA 1HYSB 1TZ0A 4WFZA 2DYAA 2KFZA 1HBUA 3LAKA 2OH2A 4DSFA 1H73A 1NZAA 3M6VA 4TKTA 1RCOB 2LYVA 3L7PA 5ETMA 3OL7A 2R2SA 2KFNA 1NJZA 3ENQA 4PQUA 1YG0A 2PO4A 1M90T 4WXWA 3GIJA 2VODA 2CADA 1RT7A 3TA0A 2J0QD 3MEEA 3V6HA 1O6XA 3M30A 3TRGA 4DCOB 3DRPB 1JXEA 2DGUA 2IMOA 1SI9A 2BZ2A 1R8CA 2VKZG 3KK3B 2QMXA 4DV6J 2MQ8A 5KFDA 3VZIA 2K8GA 2HRUA 4WTOB 3EE3A 2E5JA 1JLAB 2ZDOA 1SJFA 4ERDA 4B08A 4ZVPB 3UWTA 1OSDA 2IJNA 2PEBA 3M8QB 4OYPA 2VB6A 2W9CA 4GKJJ 4J5OA 3J7YI 1X31C 3PY8A 3J7ZT 1GT8A 1X4FA 4KO0A 3L09A 4F50A 1IJFB 3UFCX 4RPFA 1JJ2R 2P9EA 4DHVA 4ZHRB 2WZ1A 3HJFA 2QLBB 3FCHA 3NNCA 1TKTA 2IM1A 3M2UA 4X84A 5HMWA 1VK3A 1ZBTA 2RAQA 2XSFA 4HI2A 4IUFA 2E5HA 1HR0F 2LXIA 1VQ6S 1DURA 3MWBA 4ZIWA 2J8SA 4X66J 1HBNA 4RU9A 1HBNB 3HD1A 2Q79A 5B08A 1QY7A 3HSGA 1SKRA 4K59A 3UR0A 1T05B 1RWWB 2DISA 3M1VB 4WZQA 2W4PA 2DNZA 1U09A 2XGQA 4NA1A 1KVIA 1R89A 3QQCD 1LKZA 1LWFB 5DO2A 5C2GA 4V19J 3U1MA 2VOOA 4ZJOA 2J7WA 1HBMB 3O1LA 3C14A 2R2UA 1S76D 4GVLA 3D54A 3JYTA 1NJWA 1M1HA 2DNRA 1Q86T 2NLWA 2QA4G 2Y1JA 2HBYB 2BVZA 5E7OB 1B0TA 2PMZD 2VDHA 3NGDA 4RR5A 2N3LA 1FEEA 2MZQA 3KLHA 3UO0A 4DF4A 1TUVA 2MGZB 4QWAA 2DPIA 1C0UA 1NDCA 1HIYA 2YXLA 2FJXA 3US5A 1HI0P 4A8FA 4Z2XA 1K0TA 1N5SA 2GGPB 8RUCA 1RABB 4WP9A 1S9EA 1IKWB 2YY3A 4CO2A 3OTOJ 2B8QA 1PYOB 3DFEA 1UJ4A 3CIMA 1XMOF 2UXCJ 1TL1A 1RT7B 4OYMA 1TU0B 4OI4A 2LA6A 1JLFA 5C24A 4DV6F 4C8OA 1VK8A 1UZDA 2X1GA 4B9SA 2ERRA 5B0BA 1R43A 4K4ZA 3EGWB 4PPDA 2CQIA 2M88A 3GTYX 1OY8A 4I56A 4F0KA 2K06A 3BREA 4ID5A 1QSSA 2RHSB 4L76A 4JUZA 3HHLC 1CVJA 2UUTA 1RDRA 5IT9Y 3IRXB 3KFWX 3JQJA 4J9KA 4ZITA 1U7LA 4W90B 3E2EA 4UTGA 3DLEA 4QIVA 2OLWA 4DL7A 3R27A 2A10A 4MKBA 2FVQA 3MM5A 3NS6A 1HNIA 2EKNA 4GKKF 5E2QA 2EXUA 1NPKA 5G0RA 3AODA 2VG6B 2AJ1A 1N48A 2FLOA 1HARA 3R6GB 2GHWA 2MZJA 2DK2A 2M70A 1T3NA 4NX9A 2DNPA 2DKOB 2B0GA 1FRKA 2MHNA 4UZCA 4JV0A 3K17A 2MKKA 4W92B 1KOHA 3DDIA 1REVA 3MUTP 5F8HA 4DS4A 2FD2A 3BYPA 4TU8A 2V4RA 2DXDA 5AE1A 4CLZA 3R5BA 3LP2A 2BYCA 2DHSA 8ATCB 2ABYA 4RJVA 1TAQA 2UVUA 1U1PA 1Q79A 4OHZA 5AJ3J 2D3ZA 3HHDA 4OZ2A 4HDHA 4A48A 2B3TB 3GIKA 5DG7A 4KGVB 4JI7J 5ETPA 1XIQA 3UN2A 1C1CB 4NLXA 2W8KA 1H2UX 2F4FA 1GH8A 2J7UA 3VWSA 5JJBA 2X1FA 3JTPA 4Y00A 1NK8A 2CPEA 4FF1A 3MHYA 4LF5J 1U0SA 2PN6A 2CPYA 4ZP7A 2MLZA 4CO5A 5GMDA 4FF2A 4DV2J 5D15A 3BF4A 5U47A 4OLOA 1XMQF 2MY8A 2XQCA 2QJ3A 3BS9A 4QIWD 3AOBA 1SXLA 2CJ9A 3KG4A 4OHWA 4ECVA 4ELVA 5DLGA 4B3SF 3U7JA 3TQEA 4DR7J 1F9FA 2RU9A 2LA4A 3CO0P 4DQSA 3H59A 3V6DA 1X9SA 1F60B 3BO2A 2FZKB 4JI5F 2C2KB 3QSIA 2JH3A 2KB2A 2RT3A 1IR1A 3C15A 3IR7B 2MQQA 1WWHA 2OI2A 3GIMA 3Q23A 2I0XA 3D3BJ 3I4HX 4M5GA 2AZ1A 3M32A 1R0CB 5F8GA 3HULA 2MPUA 1AB8A 1X4BA 3BQ0A 2GQQA 4J9UE 2A6OA 1I94F 5J2MA 1WC3A
chains in the Genus database with same CATH topology
1WKLA 4F4AA 3PRVA 3FBEA 1S59A 4ANCA 1ZS6A 2VU5A 3BBBA 1KDNA 3VGTA 1BE4A 1LWXA 1NDKA 4UOGA 2AZ3A 3ZTOA 5CABA 1S57A 3DKDA 1U8WA 3Q86A 3VGUA 1HLWA 5CAAA 3VVUA 3MPDA 1NHKL 4W98A 3Q8VA 1NDLA 2CWKA 1MN7A 3ZTRA 5C7PA 1F6TA 3JS9A 1PKUA 1NSKL 3VVTA 1EHWA 1F3FA 1NDCA 3EICA 1HIYA 4DUTA 1UCNA 3EM1A 4O0NA 1W7WA 3BBCA 4KPCA 4ENOA 2B8QA 3ELHA 2DY9A 1B4SA 2B8PA 3FBFA 5BXIA 1NUEA 3PJ9A 4F36A 3ZTPA 3EMTA 1K44A 3BH7B 3GPAA 4ANEA 3WX8A 3FBBA 3NGSA 1JXVA 1WKJA 4FKXA 5IOLA 2HVEA 4CP5A 1BHNA 1BUXA 1NSQA 1NPKA 2HURA 2DXEA 3VGVA 3EVOA 4EK2A 1XQIA 3ENAA 2DXFA 1VYAA 3Q89A 4C6AA 1WKKA 3DDIA 3NGTA 1LEOA 2DXDA 4UOHA 3Q8YA 1NDPA 3NGRA 2DYAA 4UOFA 3B6BA 3B54A 3EVWA 1NLKL 3Q8UA 3BBFA 1MN9A 3EJMA 1HHQA 1XIQA 3GP9A 2ZUAA 3G2XA 4WBFA 2HVDA 1B99A 3VGSA 4ANDA 2BEFA 3ETMA 1NSPA 1PAEX 3FC9A 3ZTSA 4S0MA 4DZ6A 3ZTQA 3EE3A 4FKYA 3Q83A 1NB2A 3FCWA 3L7UA 2NCKL 2BX6A 1S5ZA 4DI6A 4HR2A 1NCLA 3NGUA 2AZ1A 3R9LA 3EVMA 3FKBA 3FCVA 3FBCA 3BH6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKL A;  4F4A A;  3PRV A;  3FBE A;  1S59 A;  4ANC A;  1ZS6 A;  2VU5 A;  3BBB A;  1KDN A;  3VGT A;  1BE4 A;  1LWX A;  1NDK A;  4UOG A;  2AZ3 A;  3ZTO A;  5CAB A;  1S57 A;  3DKD A;  1U8W A;  3Q86 A;  3VGU A;  1HLW A;  5CAA A;  3VVU A;  3MPD A;  1NHK L;  4W98 A;  3Q8V A;  1NDL A;  2CWK A;  1MN7 A;  3ZTR A;  5C7P A;  1F6T A;  3JS9 A;  1PKU A;  1NSK L;  3VVT A;  1EHW A;  1F3F A;  1NDC A;  3EIC A;  1HIY A;  4DUT A;  1UCN A;  3EM1 A;  4O0N A;  1W7W A;  3BBC A;  4KPC A;  4ENO A;  2B8Q A;  3ELH A;  2DY9 A;  1B4S A;  2B8P A;  3FBF A;  5BXI A;  1NUE A;  3PJ9 A;  4F36 A;  3ZTP A;  3EMT A;  1K44 A;  3BH7 B;  3GPA A;  4ANE A;  3WX8 A;  3FBB A;  3NGS A;  1JXV A;  1WKJ A;  4FKX A;  5IOL A;  2HVE A;  4CP5 A;  1BHN A;  1BUX A;  1NSQ A;  1NPK A;  2HUR A;  2DXE A;  3VGV A;  3EVO A;  4EK2 A;  1XQI A;  3ENA A;  2DXF A;  1VYA A;  3Q89 A;  4C6A A;  1WKK A;  3DDI A;  3NGT A;  1LEO A;  2DXD A;  4UOH A;  3Q8Y A;  1NDP A;  3NGR A;  2DYA A;  4UOF A;  3B6B A;  3B54 A;  3EVW A;  1NLK L;  3Q8U A;  3BBF A;  1MN9 A;  3EJM A;  1HHQ A;  1XIQ A;  3GP9 A;  2ZUA A;  3G2X A;  4WBF A;  2HVD A;  1B99 A;  3VGS A;  4AND A;  2BEF A;  3ETM A;  1NSP A;  1PAE X;  3FC9 A;  3ZTS A;  4S0M A;  4DZ6 A;  3ZTQ A;  3EE3 A;  4FKY A;  3Q83 A;  1NB2 A;  3FCW A;  3L7U A;  2NCK L;  2BX6 A;  1S5Z A;  4DI6 A;  4HR2 A;  1NCL A;  3NGU A;  2AZ1 A;  3R9L A;  3EVM A;  3FKB A;  3FCV A;  3FBC A;  3BH6 B; 
#chains in the Genus database with same CATH topology
 5E3P A;  1WKL A;  4F4A A;  4BWJ A;  4IDK A;  5A76 A;  2H5E A;  3UD5 A;  2AEF A;  4KHP F;  4LRD A;  4JB8 B;  4K5R A;  1CQN A;  4KIA A;  4WXO A;  1UL3 A;  2GVD A;  1KDN A;  2DTJ A;  2RKI B;  3BBB A;  3VGT A;  5L1L A;  4F02 A;  2V50 A;  2VHG A;  3M8Z A;  2CXE A;  3E01 A;  2R7U A;  2BQ3 A;  4LR7 A;  1ZM3 A;  2B6A A;  3BGL A;  2H5I B;  2E29 A;  3GR1 A;  2VG6 A;  4DG1 A;  5L46 A;  2HHH J;  1NHK L;  5L39 A;  4PAA A;  1H0H B;  2M9K A;  5D4P A;  3QAT A;  4RNF A;  1NBE B;  4A8Q A;  1TMM A;  2I5J A;  1X4E A;  3KLE B;  3C3L A;  2DIT A;  4KFB A;  5EWE A;  1A9N B;  1P9Y A;  2KG1 A;  1DY3 A;  1TL3 A;  3THT A;  1FHT A;  3ILO A;  2BDP A;  4X4V A;  5KTQ A;  1H3D A;  2Q43 A;  3TO8 A;  4C8K A;  1H74 A;  4OYB A;  3GCW P;  3CD0 A;  3QZ8 A;  1HHT P;  3NGK A;  5GAG U;  4ZCK A;  2HWT A;  3GJS B;  1YTY A;  2RIJ A;  3PKY A;  2M8H A;  2NSC A;  5AJ3 F;  2XM3 A;  1RBO B;  3N6M A;  4WFB Q;  2JSX A;  2FPH X;  4QWB A;  3QYY A;  4EO8 A;  3D28 A;  4USM A;  3CPW R;  4DL6 A;  1SKU B;  2DNK A;  3HFK A;  5DDQ C;  3RAQ A;  4A47 A;  4DUZ F;  4MKY A;  3K5M A;  1UKU A;  2KDO A;  1WEZ A;  3A8E A;  4CYU A;  4LSN B;  2IFX A;  1FNX H;  4OZ0 A;  3T5J A;  3FGV A;  1RJJ A;  5HMX A;  4FP9 A;  1CC8 A;  1S6Q A;  1RAH B;  2DHH A;  3OV7 A;  4RW9 A;  2XO7 A;  3FSI A;  2A6M A;  2A2C A;  3CCW A;  3JTO A;  2YNH B;  2G2Y A;  3V5R A;  4LF8 F;  1KHV A;  4FKX A;  4C7Q A;  5IOL A;  2KJV A;  6FDR A;  2FB0 A;  3D3C J;  2DRB A;  2YNF A;  3TX8 A;  3KLF B;  2PI4 A;  4F4W A;  2VDI A;  1P8G A;  2ADB A;  2HMI B;  2V2Z A;  3VAL A;  4OFZ A;  3H7H B;  3PIO Q;  3A8J A;  2FHM A;  4NXM J;  1ZH5 A;  3J7A N;  1ZTW A;  1RA6 A;  4N76 A;  1RWK B;  2CIM A;  4ED6 A;  1WKK A;  4YP3 A;  2B9X A;  4IR9 A;  3MZI A;  2ROP A;  1NEE A;  4OZ3 A;  3FEZ A;  4J9P A;  4CLL A;  1KR4 A;  3CJR A;  2PDA A;  1KQK A;  2NR0 A;  5K14 B;  1YHQ S;  1YDL A;  3PG9 A;  1REG X;  3SXL A;  3PTW A;  1N32 F;  4DUY J;  1PIE A;  2F5G A;  2ACM A;  3F41 A;  3LAN A;  4RU2 A;  3D7S B;  1GMW D;  1M1G A;  2LXF A;  2KZM A;  4HL9 A;  3VAF A;  4QYZ K;  3KUE A;  2PGC A;  2ACY A;  2YQ0 A;  4LJM A;  3G2X A;  2X7I A;  1NK5 A;  3EXC X;  3K59 A;  2E1A A;  1KQG B;  1AZS A;  1CJU B;  2NUU G;  3DU6 A;  4BC9 A;  4B3R F;  3M8Y A;  2ZDP A;  4HTJ A;  1RK8 A;  2HGL A;  3MAA A;  3VAJ A;  3HFV A;  1MWY A;  2B5J A;  2JLE A;  3WIV A;  1VLO A;  4DZ6 A;  1HD0 A;  1ULR A;  2QZ8 A;  3K8V A;  3OQ2 A;  4WFY A;  4QPT A;  3MMB A;  4ZVO B;  4BCA A;  4C3L A;  1SUQ B;  3HKZ D;  5KFX A;  2K7K A;  3T1H J;  4DCP B;  4IG3 B;  4JI1 J;  1JLG B;  3FK4 A;  4LBH A;  3AXM A;  2DR6 A;  4FN5 A;  3WDO A;  2HHT A;  2NZ4 A;  5IWA J;  3CJ2 A;  3NGU A;  3R7N B;  2UVR A;  4X66 F;  2XLJ A;  2GHP A;  2V8G A;  4CO1 A;  5KFN A;  4J9R A;  5LM7 E;  5IS2 A;  4C3K A;  5J2N A;  1RTD A;  4NXN J;  3KJV A;  3BQ2 A;  4MH8 A;  2M5Y A;  3PV8 A;  3E01 B;  1IKY A;  3THP A;  3MR3 A;  5L1J A;  1R7I A;  1S59 A;  2XNQ A;  1KQS R;  1MRO A;  2EK6 A;  2GQ2 A;  2I1R A;  2N4C A;  1R3N A;  4NML A;  2FVS A;  1RT3 A;  2GMH A;  1ZPV A;  2H54 B;  1JJH A;  3AAW B;  3ZTO A;  3S7R A;  4UQT A;  5K8O A;  3PW2 A;  4WP3 A;  1LV5 A;  2J6S A;  2VG7 A;  4KGK A;  2J6T A;  3QIP A;  4J9O A;  2IJF A;  3HVR A;  1R0B G;  1AXQ A;  5D4N A;  3KMS A;  4ED8 A;  4IH5 A;  1U4B A;  3JSM A;  4GRS A;  2UUB F;  5IQ6 A;  2HVZ A;  3V6D B;  4KV8 A;  1K1Q A;  2QRR A;  5BYR A;  3K5L A;  2FVR A;  1T7P A;  1EHW A;  3BEG B;  1FRX A;  1QM9 A;  4DF8 A;  3EX7 B;  4KQZ A;  1G3O A;  4YOE A;  3LW5 C;  4JI4 F;  4G1Q B;  4M8L A;  2LQ5 A;  1F5A A;  4KKO A;  1IKV A;  5ETN A;  2G4B A;  2Q66 A;  4RNM A;  4DEZ A;  5HJY A;  1TTH B;  3RYL A;  4B9U A;  3H5S A;  2QYG A;  3L4B C;  5DDR C;  1VQN S;  1U2R A;  4FS2 A;  2DGS A;  4XK8 C;  3GMG A;  1BD6 A;  1JMT A;  2R7O A;  3PYF A;  2KT2 A;  2VD3 A;  2O66 A;  3QAE A;  4LT6 A;  4LF6 J;  1KEK A;  3N6N A;  1YJN S;  3CDB A;  5HP1 A;  4WYW A;  2E9Z A;  4ZOS A;  3Q2T C;  1WSV A;  3D6H B;  3A3P B;  3I9V 9;  5EGY A;  2K1R B;  4XPE A;  2IVY A;  4P7T A;  4URS A;  3D0H E;  4CLS A;  5KFR A;  2QX0 A;  2KJW A;  1VC5 A;  4JI2 J;  3SDE A;  4J9S A;  3H25 A;  1ZA1 B;  1UVJ A;  2MHE A;  3T1Y F;  1H6K X;  4YN3 B;  4DR1 J;  1Q7Y T;  4WZM A;  1GXL A;  4LF5 F;  1IJE B;  4ZVH A;  1F0X A;  2B9W A;  1FRI A;  2UUC J;  4CNZ A;  1EKS A;  2AU0 A;  2UUA J;  4BC7 A;  1X0P A;  3MXH P;  1XNQ F;  3KOA A;  3OUY A;  3CE8 A;  4C11 B;  2CKW A;  2DXF A;  2EKY A;  2IA0 A;  2IDL A;  2V34 A;  2AYB A;  4ZVT B;  4ICL B;  4NMX A;  4CIO A;  1C1B A;  3MED B;  3ZFV A;  3CCL S;  4ZN3 A;  1MMN A;  3D1H A;  3HI9 A;  1Y3J A;  1KKH A;  2E7V A;  3OSN A;  2JDJ A;  1LNQ A;  4Z7Y A;  1VQ7 S;  4L3K A;  4OZN A;  1IBK F;  3B6B A;  4KHM A;  4OIX A;  1UET A;  3J81 U;  3Q8U A;  2AJF E;  3DI6 B;  2XMJ A;  2IHR 1;  1IWG A;  1WC0 A;  2YNH A;  3DGP A;  1WG5 A;  4OX9 J;  3CJK A;  4Y2M A;  2XLI A;  1TAU A;  1KTV A;  1NK6 A;  3G82 A;  2QE5 A;  2HIY A;  4PXD A;  2EC0 A;  2PFF B;  2HVD A;  4CRJ A;  5T7L A;  5BJR A;  3HP6 A;  4GMK A;  3GWC A;  2VA3 A;  2BQR A;  2MKI A;  2A3J A;  4LFB F;  2ZH7 A;  2L41 A;  4XTT A;  2CQ0 A;  1J5O A;  4I1T A;  4OL8 A;  5C25 B;  2ZIT A;  4A8W A;  3Q8Q B;  2DH8 A;  1RT4 B;  1TEL A;  2HGM A;  3AQP A;  1RTJ B;  5LXR A;  1DQA A;  2D41 A;  2YH0 A;  3CJ3 A;  3W5X A;  5KT6 A;  2CJQ A;  2FTR A;  2HNZ A;  1FKP A;  3Q83 A;  4PCQ A;  3TEG A;  2ZH9 A;  3G9C A;  4MK8 A;  5HLF A;  2AT1 B;  1SCJ B;  3G71 S;  4F4X A;  1TP7 A;  1N5Y A;  3W1Y C;  5GAD U;  2HBQ B;  3FJ2 A;  3G86 A;  2YPY A;  2G1D A;  1SL2 A;  4O3R A;  2DCU B;  3AD7 C;  1CS4 A;  2QL7 B;  5ETO A;  1SKS A;  1G7C B;  4OV6 A;  2R7X A;  2LEP A;  2DGW A;  1RTH B;  3FCV A;  1RT1 A;  3NWG A;  4Y2C A;  2ZZT A;  2BJ3 A;  2RVJ A;  4FYV B;  4UOC A;  2JEG A;  2YX4 A;  2ZFH A;  3R5J B;  1YWX A;  1YQH A;  3C6T A;  1RGV A;  1T9Y A;  1UFK A;  4IO1 A;  1EAR A;  4ZPW R;  2XHW A;  4C4W A;  2RUS A;  3RBE A;  2JLG A;  2MDA A;  1MWQ A;  3ZZO A;  3LH2 S;  3DOL A;  4G1P A;  2CQH A;  4PQA A;  1BGX T;  4TYA A;  3TX0 A;  4WFN Q;  1K47 A;  3CDU A;  1WG4 A;  5DG9 A;  3EPI A;  2BJE A;  2FJB B;  3E8O A;  4ZVS B;  3KLG A;  2GIR A;  3L9Z A;  3MPY A;  2CWX A;  3B82 A;  3CCZ A;  1U1R A;  1PJ6 A;  3OLA A;  3W9H A;  4GO5 X;  4DV0 F;  2ADC A;  2OAU A;  2R8H A;  3KJQ B;  3KK1 B;  3HZE A;  1D3W A;  3JS9 A;  1XK8 A;  1MU2 A;  3SSR A;  1PO6 A;  4Y2I A;  1FK9 A;  1JLQ A;  4RX6 A;  2XMW A;  2OJ3 A;  3ITH A;  1IM4 A;  2DEJ A;  1UFW A;  3CSK A;  2XO6 A;  4NLD A;  2R9L A;  2QYC A;  2AX1 A;  2CPF A;  2V63 A;  1VHI A;  2YX1 A;  3HCX A;  2HQ3 A;  5D77 A;  2XYH B;  3AD9 C;  1CC7 A;  3EM1 A;  3FQL A;  3QID A;  3RBZ A;  2KXN B;  1S97 A;  4BBY A;  4DX8 H;  3WQP A;  3EYZ A;  4DFJ A;  1LQ9 A;  3ELH A;  3M8P B;  3W5Z A;  2ZH5 A;  2ZD1 A;  2QV6 A;  3RRK A;  4DV2 F;  1KC8 T;  3D6T B;  1YRX A;  1Q0N A;  3EMT A;  2XWY A;  2QFJ A;  1X4C A;  2V9W A;  3GFZ A;  3DOL B;  2RD5 C;  4IG3 A;  1K44 A;  1PCA A;  3R5D A;  3CJ8 A;  3S01 A;  4ANE A;  4J9M A;  3M6W A;  3E51 A;  3FBB A;  3QZ7 A;  3H40 A;  3U27 A;  2J6U A;  3CO9 A;  3WHI A;  1C1C A;  1UA1 A;  1V3Z A;  2HFS A;  2HND A;  1HNZ J;  2R7V A;  2FJA B;  1FDB A;  3IGN A;  2HRY A;  2ROG A;  1I3O B;  3BKF A;  1BQM A;  2HHH F;  1U1O A;  3G87 A;  4CP5 A;  4TY8 B;  1BUX A;  1CLF A;  4JV5 F;  1WDT A;  2N7Y A;  2QFI A;  2KFY A;  4U95 A;  4WE1 A;  3NG8 A;  2W2N P;  3BYR A;  3HFZ B;  2C2Z B;  2JJ4 D;  4KBI A;  4KC5 A;  4QW8 A;  2ASJ A;  3PRD A;  5F9L A;  4LF8 J;  2DGX A;  4C6A A;  1J2V A;  5L38 A;  4BLG A;  4QZV B;  4YHH J;  3PW5 A;  3SCK E;  2UP1 A;  2WB4 A;  3I6P A;  4O4G B;  2HQI A;  2LXU A;  3JSR A;  2UXD F;  1PJ5 A;  3UCG A;  3PXG a;  3LGM A;  4HVZ A;  4M5J A;  2WSE C;  3QMQ A;  3GU0 A;  3IM9 A;  2C3P A;  2ZHA A;  2LDY A;  1FCA A;  5T7L B;  1X4D A;  3SFG A;  4A8X A;  3CC2 S;  2DH7 A;  2MQP A;  2QSF A;  3K8W A;  5L9N A;  1VC6 A;  5J2Q A;  1RU2 A;  2HQF A;  2QMW A;  1TL1 B;  4P6Q A;  2EFP A;  2ATL A;  4H4M A;  1YRU A;  3LF0 A;  4IFY A;  4K2X A;  1J5E F;  1CSJ A;  2AMC B;  4DQQ A;  2UV8 A;  4XO0 A;  4WTY A;  5CYM B;  1VMB A;  3UNY A;  4YFU A;  2HGN A;  2PA3 A;  4CM2 A;  4EGL A;  1HFE L;  2OTJ S;  2JC0 A;  2HRT A;  2ZNZ A;  2OSR A;  3I96 A;  3ISZ A;  4JI6 F;  3MTJ A;  4Y2A A;  2MQO A;  3M2V B;  1NHV A;  2DR9 A;  2G9O A;  3PFE A;  2H4W B;  3HVT B;  5KFA A;  1NB2 A;  2R8I A;  1SJQ A;  2F8E X;  2OEM A;  3MUM P;  1VQL S;  5IV4 A;  4DV5 J;  3H5U A;  4HR2 A;  2GIF A;  4F3Q A;  1H7W A;  1CJV B;  1XJW B;  3RBX A;  2AD9 A;  4DPU A;  1Q78 A;  2R7Q A;  3PW7 A;  3RZA A;  4ZJQ A;  2UVW A;  3FKB A;  2EG1 A;  1H7X A;  1Z4U A;  4YME A;  4DZD A;  3G6V A;  5EN1 A;  1RTI A;  4CQ1 A;  3KLF A;  4A8O A;  3GYN A;  5EWF A;  2YKP A;  4YB7 A;  3F0N A;  3DLB A;  4A46 A;  1Z2L A;  2JHE A;  3MM8 A;  4MIW A;  2F3J A;  3U1N A;  3EPG A;  3MEE B;  5F3T A;  3O5T B;  3G6Y A;  5EUH A;  4C0O C;  4DPW A;  3TVZ A;  4R5P B;  4HYK A;  5B0F A;  2J7K A;  4LF4 J;  2HFU A;  1S1T B;  3C8Y A;  5AXN A;  1S1W B;  4DV4 J;  2GHV C;  2B7C B;  4LSN A;  3QT6 A;  2DIU A;  4QIF A;  3W2W A;  1RCX B;  4C0B A;  3B8H A;  3W9I A;  4X4Q A;  3K5N A;  1TQL A;  1JIH A;  2E5L F;  3DDK A;  3RB4 A;  3CED A;  3PDN A;  1Z1Z A;  3MFI A;  1NSK L;  2HWH A;  2H1Y A;  4H4O A;  2FUG 9;  1NKE A;  4DV0 J;  5ETK A;  1F3F A;  4LVN P;  3BO4 A;  2GZO A;  4M5H A;  2ZWO A;  1X9W A;  1S0V A;  3S1T A;  1Q4R A;  4K0K J;  1SJR A;  2ZJP Q;  4P10 A;  3DMJ B;  2MTL A;  4OV1 A;  1VQO S;  1N88 A;  2O5D A;  4ER8 A;  3BBC A;  1R8P A;  1ICE B;  1OIA A;  1XMB A;  2NXC A;  3MDF A;  5KG4 A;  4C2M A;  5I42 B;  4C8L A;  4R0J A;  4C8N A;  3KJN B;  4EO6 A;  1F9H A;  3M7V A;  4LSL B;  2DH9 A;  5K9F A;  1JLF B;  2RH3 A;  4C8Y A;  2L9D A;  2BM0 A;  2G2O A;  2AWZ A;  4LF6 F;  1QE1 B;  1BQN B;  4ZPC A;  2RRB A;  1U2C A;  5CYM A;  3BKU A;  1T0T V;  3M4X A;  3MM9 B;  1VJQ A;  4DXL A;  1TUW A;  3PHE A;  1S1X A;  1X8D A;  2LVW A;  2C2R A;  2FY8 A;  2W25 A;  5IC6 B;  1D1U A;  1S12 A;  4IRC A;  3P4U B;  3NCP A;  1QTM A;  4DWI A;  1RTH A;  4C8Z A;  2BAC A;  3X3U A;  1D8Y A;  4ED4 A;  1JLQ B;  2CNL B;  2ROE A;  5FDL A;  2DRA A;  3UDV A;  1WDD A;  1X5P A;  5DLF A;  3CC7 S;  4AL5 A;  1FJ7 A;  2J9E A;  2JVR A;  3D1Q A;  1CJT B;  3P96 A;  1JNZ B;  1SBR A;  1RWV B;  3BGO P;  4G65 A;  4M5N A;  3JB9 k;  2CPJ A;  4I4B A;  4ZLN A;  2HHP A;  2Z57 B;  1Y5L B;  1RHM B;  1JB0 C;  3Q89 A;  3FNN A;  3MFH A;  5LMN J;  2QC3 A;  3A12 A;  3AA9 A;  4M5L A;  4ED7 A;  3QRP A;  1APS A;  3LOU A;  3HT0 A;  1JLG A;  3RBD A;  2COL A;  3UD3 P;  1QAJ A;  1RAG B;  3Q2S C;  4ILL A;  3LP2 B;  1FA0 A;  2V8D A;  4QU6 A;  1FKO B;  4NZ6 A;  4PYD A;  2H5J B;  3FDS A;  3JSM B;  1R6Y A;  1X5S A;  1UEK A;  2MYF A;  5MAO A;  1EB0 A;  1MN9 A;  4WK3 A;  3CCJ S;  4FZV A;  3MPW A;  4ZP8 A;  2FLL A;  1XTZ A;  2LKZ A;  3AJD A;  2WHO A;  4OLP A;  6FD1 A;  2Z8Q A;  1EQ0 A;  1XEZ A;  2QSW A;  3IRX A;  2PII A;  2ZBQ A;  5D4O A;  3H5Y A;  1XWL A;  2ZHO A;  3DM2 B;  5DJB A;  3ETM A;  5KOX A;  5CCL A;  2IBK A;  4G3I A;  1IVZ A;  5KFW A;  3RTV A;  1QJH A;  4WF9 Q;  2N4D A;  3MPU B;  5G4D A;  5IV3 A;  4X4U A;  4O3P A;  1EJ7 L;  5KFT A;  4KR0 B;  2DNQ A;  4PWU A;  5K20 B;  2QLF B;  5KFQ A;  3GSI A;  3MPV A;  4WP8 A;  3V4I A;  1FDN A;  1O0P A;  3V4M A;  4DV3 F;  1WF1 A;  3DRY A;  3TEH B;  4AYB D;  5KFC A;  3PM9 A;  1M0S A;  5HAT A;  2YNG B;  3J80 U;  2YNG A;  3AY0 A;  3H2L A;  3HT3 A;  3VAG A;  4DR1 F;  4ZPT R;  2W9B B;  4GC7 A;  4ZMM A;  1H38 A;  2CZ4 A;  1Y10 A;  3FUY A;  3MMB B;  3LUY A;  4K4V A;  2JX2 A;  2YWE A;  1C2P A;  2OPS B;  1Y0H A;  1M5P C;  4KGM A;  4WJB A;  2VG5 A;  3QWU A;  4OYZ A;  4ZVF A;  2RS8 A;  5B0C A;  1R0A A;  3VAI A;  1KLN A;  5LSR A;  2WRM A;  4L75 A;  4ZPB A;  5KT7 A;  3CD7 A;  4OQJ A;  5F41 A;  5FLX U;  1BWV A;  1GTH A;  3IRW P;  2OKQ A;  4UOG A;  1FI4 A;  3DOM A;  2OTL S;  2R8K A;  1K73 T;  2XS7 A;  3QLH A;  2EEY A;  2ZJQ Q;  1HNW F;  2D9O A;  3DM2 A;  3Q86 A;  2RE1 A;  5IT0 A;  5F8L A;  2A0F B;  2J0S D;  4ES2 A;  5CZX A;  4PKD B;  5F0U A;  2J9C A;  4LVO P;  3CCQ S;  1CUL A;  2CZ9 A;  5DM6 Q;  1YZ7 A;  3PEH A;  4C48 A;  4F67 A;  5KG5 A;  2POK A;  2XSJ B;  2HK3 A;  4LF9 F;  1JLB B;  2LEA A;  1NSA A;  3HZG A;  4PRF A;  3PFO A;  3KTQ A;  4B3T F;  3VV2 B;  3VVT A;  1FO1 A;  1LK5 A;  2HFV A;  3KG1 A;  1UA0 A;  4B3S J;  3T1A A;  1FKO A;  3CUN A;  1TK0 A;  2HG4 A;  4LFA J;  2H4Y B;  3PJW A;  4AXJ A;  5H9F K;  2IIH A;  5HK4 A;  5LL6 d;  3FRY A;  2Q3P A;  4L3N A;  4MAK A;  4NI2 B;  1NXI A;  4AQY J;  1URN A;  2NXU A;  2DY1 A;  4I64 A;  4L73 A;  2NXJ A;  5E3A A;  5EX0 A;  4DMZ A;  3IG1 B;  4PYA A;  5HBM B;  1PJ7 A;  4HT7 A;  4ZLP A;  2W2M P;  3RB3 A;  2M7S A;  3TR5 A;  1PC4 A;  2CDR B;  2O01 C;  1NUE A;  2MQN A;  2A1B A;  3PJ9 A;  3D9B A;  2XZW A;  4P74 A;  4WE1 B;  1JNR B;  2LEC A;  2B51 A;  4EBC A;  2L3M A;  1T9X A;  3AB4 B;  2CQ2 A;  1N34 F;  2Z2M A;  1NU4 A;  2DGV A;  1VCT A;  1S6Q B;  2CRL A;  4DR3 F;  3NLC A;  5E3R A;  3UDL A;  4AXI A;  4OHX A;  2ZC3 A;  2ZVI A;  3GCX P;  1NK4 A;  2JLF A;  4M5M A;  5JVG Q;  5GAH I;  5HVG A;  3N4W A;  5C42 B;  4Y6I A;  1TV6 A;  5JXS A;  5DG8 A;  1ZM9 A;  3UCU P;  3Q24 A;  3PX4 A;  4MT1 A;  3EGV A;  3DGP B;  3QFH A;  5C2C A;  5IZH A;  5I3U A;  2FVP A;  1UVI A;  3OD2 A;  1HPZ A;  5ADZ A;  4UT4 A;  1S7H A;  1S9E B;  1X7V A;  2CPH A;  2F7V A;  1MG7 A;  2Z4P A;  3OXG A;  5L1I A;  4LRB A;  1AT1 B;  4G6V B;  3JXO A;  1FE0 A;  4ILR A;  5HO4 A;  1SUQ A;  3CCR S;  3CC4 S;  4QWD A;  5GAG I;  3TAM B;  1RT5 A;  1AYE A;  1VBK A;  2FHJ D;  5KFV A;  3MCS A;  2EFN A;  1RYR A;  2BJ1 A;  2XMU A;  2GIQ A;  4UUW A;  2M8D B;  2HQC A;  4IQM A;  2DO4 A;  3SCL E;  2OEJ A;  4MKA A;  4USV A;  4UOH A;  4B9V A;  1RTZ A;  4LR9 A;  4PWD B;  1KLM A;  3BR9 A;  3UVJ B;  1G6B A;  2IRY A;  4ALZ A;  2DNL A;  3KK1 A;  2RF2 B;  4QQB A;  4BS2 A;  1NLK L;  2ALZ A;  3MM9 A;  1HNV A;  2A2D A;  2DCL A;  6AT1 B;  4RNO A;  3PEJ A;  3O8W A;  3CUL A;  1HWK A;  4EYI B;  2UUB J;  3SSQ A;  2B6A B;  4DG1 B;  3K58 A;  3D1O A;  4UY8 5;  3R8Y A;  4TQR A;  2XS5 A;  3R5A A;  4RW9 B;  3EGN A;  2DIV A;  1KOO A;  2OPQ A;  4DFM A;  3H42 A;  3KKF A;  4P72 A;  4YB6 A;  1HA1 A;  3MM5 B;  4PG8 A;  3PR4 A;  3CME S;  3J7Z 5;  1VRU A;  4PXE A;  3R1H A;  1FJG F;  1U25 A;  3FC9 A;  2JEI A;  3GYG A;  3WC0 A;  4X64 F;  1RT2 B;  3TAQ A;  3WX4 A;  2EFO A;  2BJ9 A;  4P2F A;  2FY1 A;  2F65 A;  2EBG A;  1QVF R;  3C19 A;  3DDN A;  2KH9 A;  4RUH A;  2YKN A;  4DPX A;  4P2M A;  5GAH U;  4DLE A;  4PWW A;  3FVY A;  4RBU A;  1IR2 A;  1XMQ J;  4IFV A;  2D3U A;  1NCL A;  1KQF B;  5KG2 A;  4LQ9 A;  4O0I A;  2HKE A;  1IKV B;  5DRK A;  1DQ8 A;  1N36 F;  2ZH6 A;  2H9Z A;  2OHD A;  4U7U D;  1VIO A;  3KYL A;  2VA2 A;  3DLE B;  1UWB B;  1ZYQ A;  3CDW A;  5KG3 A;  4USK A;  2E7X A;  1HD1 A;  2E5G A;  1D8Z A;  3GLJ A;  4USJ C;  3I5B A;  4J7C A;  3NBP B;  3FBE A;  4NRU A;  2VPX B;  4WFA Q;  3BSN A;  3K0J A;  4DN0 A;  4NPO A;  4KTQ A;  1FE4 A;  3Q22 A;  3A13 A;  4Z7C A;  2FJV A;  2IAJ A;  3M2R B;  3CCV S;  5LXY A;  4N47 A;  4OZ1 A;  2QLX A;  2ZWP A;  5A8W B;  2D9P A;  4F4Z A;  5GMK a;  2QMU B;  1HR0 J;  2CQ4 A;  2YTC A;  3ET6 B;  2BKP A;  3IS9 B;  4ID8 A;  1FKA F;  1TUG B;  2QG9 B;  5I42 A;  4DR2 F;  1Q95 G;  4ZA1 A;  2KTQ A;  2W9B A;  1NDL A;  2RIL A;  3N28 A;  3CMA S;  4ECQ A;  4ZLJ A;  2KT3 A;  2C28 A;  4CH0 S;  3SZ2 A;  4CTA A;  5T14 A;  4PUO B;  2LDI A;  1N5V A;  3LP1 B;  4ITS A;  4CT8 A;  2UU9 F;  3X1L B;  4OZL A;  1S1X B;  1N4L A;  2UUC F;  4I0W A;  1PYT A;  3EIC A;  4DQI A;  3LO3 A;  3MM6 B;  5J2N B;  2MQM A;  5H9F J;  7FD1 A;  1GNK A;  1OSC A;  1Q8B A;  2GA7 A;  4RBT A;  2VBW A;  5KFY A;  4M5D B;  4ENO A;  1UWB A;  1ARO P;  1Q82 T;  2E9T A;  4CT9 A;  2VZ9 A;  4LR8 A;  1HNI B;  2PT0 A;  1S6O A;  2BAN A;  2C3M A;  4CLW A;  4IOC Q;  1L3V A;  3ZZZ A;  1CS4 B;  4N7T A;  4ZVR B;  4PG6 A;  2PD1 A;  2XMT A;  3T5L A;  2YX7 A;  3T3F A;  3V6K A;  2BRL A;  4HHH A;  2WVF A;  2YKM A;  3P45 B;  1FTR A;  4EUV A;  2Z2L A;  4F36 A;  5A8R B;  4RZR A;  4BDP A;  2BOP A;  3H0P A;  2E5I A;  2K2P A;  3MR5 A;  4KH1 B;  2R7R A;  3WX8 A;  1VIX A;  4N8N A;  5I3U B;  2W7A A;  1NPP A;  2ZKU A;  3CD5 A;  3OTO F;  3PVX A;  2IPO B;  3WZ0 A;  1RT2 A;  4CLU A;  1PBA A;  5J2Q B;  1TL3 B;  1H72 C;  1RLD A;  3N5F A;  4Y2K A;  5B7W A;  2YWH A;  2B4P A;  2JVO A;  2IM3 A;  4P2X A;  2O3D A;  1VIS A;  4M95 A;  1NHU A;  1WJ9 A;  1UJ5 A;  2KO1 A;  3I0S B;  1WC1 A;  3Q0A A;  3PRB A;  4O3Q A;  2R42 A;  2M52 A;  2VFT A;  1KON A;  2DXE A;  2LMI A;  3VGV A;  2XMK A;  2V9K A;  4MYT A;  1IN0 A;  1FT8 A;  1SC4 B;  2CJA A;  3TVK A;  3MAQ A;  3H98 A;  4DR4 J;  3MR7 A;  1XQI A;  1N33 F;  4J9N A;  1Y5N B;  4ZCL A;  2FC9 A;  4DSE A;  4Q2L A;  1HNV B;  3IG1 A;  3LGN A;  1WSR A;  4M5D A;  3MCN A;  5AE3 A;  1EP4 A;  1ZZN A;  1KSP A;  2GJI A;  4KB7 A;  2B9E A;  2V69 A;  3NGR A;  4NCG B;  1VJW A;  1TK8 A;  1EET B;  3JYT B;  2E7W A;  1QAX A;  4URG A;  1SH3 A;  2MST A;  3P8B B;  3MD1 A;  3ICL A;  4YDD B;  1TMJ A;  3QIP B;  2CZV C;  1YJ7 A;  1KP6 A;  3IC1 A;  4KH0 B;  4NLW A;  4RKU C;  4F4K A;  4GVB B;  3CJK B;  2VQE F;  2VPY B;  3C15 B;  4FXW A;  4Q8E A;  3I31 A;  4QIG A;  4F0H A;  1YVF A;  1S49 A;  2V94 A;  3KNG A;  4NXN F;  3KLG B;  2BEF A;  4ELT A;  4FDF A;  4ECU A;  1NSP A;  1HQU B;  1X4G A;  1X5T A;  3TOQ A;  5IXU A;  3M9N B;  3C2P A;  4RW4 B;  1MWZ A;  2FJE B;  3TUJ C;  1VLY A;  1TR0 A;  4YQW A;  3I5C A;  4S0M A;  5CQG A;  5RUB A;  1IBL J;  2W7P A;  1XNR J;  1S1V B;  4LRF A;  3BM7 A;  1MU2 B;  1SIZ A;  2MQL A;  2JEF A;  2IVM A;  3FCW A;  5HJX A;  3VQS A;  5BR8 F;  2G1H A;  4P9S A;  1BC6 A;  1VDH A;  3R7B B;  1YJW S;  4ZVQ B;  2IM2 A;  1SJ4 P;  1M1K T;  4F2S A;  4OX6 A;  4J9V A;  1UPM B;  3GB0 A;  1S6U A;  4NEY A;  3HXM A;  3DOK A;  4Y65 A;  5E5N A;  2KRB A;  2J76 E;  4UF4 A;  1UZH A;  1MW7 A;  2E66 A;  3PX0 A;  2ZZM A;  4TNO A;  4D3G A;  3HSJ A;  5D78 A;  4KFB B;  3SIP B;  3PRV A;  4R8U A;  1VRU B;  5KFU A;  3OFG A;  2K3K A;  3MUV P;  4I6A A;  2HQD A;  2ZUG A;  3NY0 A;  2HFZ A;  1TK5 A;  4WK1 A;  4O3S A;  2UXC F;  2V4J B;  3DCA A;  4OHY A;  1UTA A;  1Y4Z B;  3LWL A;  3SFU A;  1TVR B;  2ILY A;  2A18 A;  3TAP A;  2Q6C A;  1O51 A;  4E8U A;  1IXK A;  3GFH A;  4YHH F;  5FD1 A;  2YVS A;  5HBM A;  3DYA B;  5HRO A;  3I56 S;  4GO7 X;  1Q8L A;  4U7U K;  5AXL A;  2Q1L A;  2XI3 A;  3RW6 A;  4B3O B;  5CD4 H;  1A7G E;  3D5M A;  3ITH B;  3UNG C;  4DR2 J;  3I0R B;  3ILL A;  4EBD A;  2GVD B;  2HHS A;  4MFB B;  4IG0 B;  3HHL D;  2QA4 S;  1T3O A;  3J7A 1;  5L8R C;  3MMA B;  4YUD A;  2AJ0 A;  4DUT A;  3CJS A;  4LF7 F;  1FD2 A;  5F8J A;  1DTT B;  3MMC B;  3QT8 A;  1U6B A;  2VFV A;  3I32 A;  5HMZ A;  2IMW P;  1DQ9 A;  3ZNU A;  1TKZ A;  2MMY A;  3AD8 C;  2ZD1 B;  3EZU A;  3GZ7 A;  3IS9 A;  1UEU A;  5DZ6 A;  3ZZP A;  4K4Y A;  1CJV A;  4USI A;  4ECT A;  1D9F A;  1D9A A;  4LF7 J;  2CNK B;  4FVC A;  4NLQ A;  1YGY A;  2CDQ A;  5I4M A;  1OYD A;  3DNC A;  1VBY A;  1M5V C;  1GEH A;  5AT1 B;  1E6Y B;  1JLC B;  2ZC4 A;  4WYL A;  2DGT A;  3DLG A;  3EGZ A;  2EC2 A;  1C0T A;  3M6U A;  3G6E S;  5LOQ A;  4DQP A;  1GXU A;  2WW4 A;  5THW A;  1VS3 A;  3TAR A;  2FLP A;  4DV5 F;  4EYH B;  2BE7 D;  1HWI A;  4DL0 C;  3KJF B;  2R7T A;  3T5H A;  5AXM A;  2QA2 A;  3BV8 A;  2I38 A;  2DNY A;  2GAG C;  1R0A B;  4J90 A;  2V5H G;  4ETZ A;  3HK2 A;  3QJP A;  1HBM A;  4DV1 F;  1XC9 A;  2K7J A;  3P5B P;  4ZVG A;  2P9C A;  1KBR A;  4RBV A;  4XDC A;  4E98 A;  3NMR A;  1K0V A;  3MMC A;  3BR8 A;  3GON A;  4RUB A;  4IQX A;  4FNH A;  3HHN B;  4DSL A;  2L9W A;  1RAF B;  2QGF B;  2W01 A;  4QR1 A;  3KHH A;  1A0O B;  4Y28 C;  4X64 J;  2WW8 A;  3UN5 A;  1B0P A;  4QR2 A;  3CCT A;  4DUY F;  2V67 A;  3TQ1 A;  2CYY A;  2DR7 A;  4B3T J;  2KU7 A;  2Z58 B;  1PBU A;  1HMV A;  2VBZ A;  3C16 A;  5HN0 A;  2VIH A;  3JQK A;  4MJK A;  3UDE A;  1W26 A;  2LU2 A;  4ED3 A;  3OL8 A;  1IUJ A;  5KG0 A;  3FMB A;  1UPP A;  2BW2 A;  1KD1 T;  1FFG B;  2ASL A;  1S9G A;  4NI2 A;  2D1C A;  4HTI A;  4CLK A;  3CJ4 A;  4F8R A;  4OZJ A;  5K8P A;  1FXR A;  2HBR B;  1YJR A;  3PYG A;  2HNY A;  1U49 A;  3I82 A;  3IBF B;  3MED A;  2F4V J;  1S72 S;  3CJ5 A;  2RF2 A;  1VQ8 S;  3GSD A;  1BQX A;  4ICL A;  3T6J A;  4I2P A;  2VIC A;  1ELO A;  1U1L A;  2IC3 B;  4JBC A;  2XYP B;  2V6A A;  1SB6 A;  2JRS A;  3OL6 A;  2BX6 A;  3DGV A;  3M9O B;  2DJW A;  1KNZ A;  4CLY A;  2RQC A;  1XR7 A;  2R7S A;  2LQB A;  1U6F A;  2LP4 A;  1FXD A;  1OY9 A;  2DEI A;  1Y3K A;  3UN3 A;  1U1Q A;  2BKO A;  4KYZ A;  1HQE A;  3IMQ J;  3DI6 A;  1AFJ A;  5CA5 A;  3RAX A;  2KHC A;  1O8B A;  3BSA A;  3KUG A;  5HQM A;  1NND A;  3TUZ C;  5J1N A;  5HQL A;  1Q7L B;  4Y0F A;  3MAA B;  3CD6 S;  5F3Z A;  1WEX A;  1FFW B;  1WF2 A;  3R1L A;  3CCE S;  3OVB A;  1PAU B;  1IKX A;  2GC8 A;  2OGU A;  1Y11 A;  2MB0 B;  1N6Q A;  2XC9 A;  4OJ3 A;  4NLP A;  1QSL A;  1JLE B;  3FFI A;  2XEX A;  4X4R A;  1EQM A;  2ATC B;  4NRT A;  4N41 A;  2JWN A;  3MEC B;  2C42 A;  1S9G B;  1SPB P;  1U8W A;  4ECS A;  2AGO A;  2VON A;  2W4D A;  3P6Y C;  3MR2 A;  3MPD A;  4ZS6 A;  1RTD B;  2PI5 A;  3HVA A;  1S1W A;  4O3O A;  1U2F A;  2KT5 A;  4I69 A;  2JFK A;  3LAL A;  1R8A A;  4WPA A;  4YDX A;  3DU5 A;  4N56 A;  2RDD A;  1CPZ A;  5B0A A;  2VL1 A;  4LF9 J;  4DR3 J;  4EI2 A;  3SI8 A;  4P52 A;  3NCQ A;  1E6V B;  5HAO A;  3LA0 A;  2HHQ A;  4NLT A;  2GVZ A;  3ISN D;  1YJU A;  2BJD A;  4DBQ A;  2OPP A;  1ZAX A;  2PC6 A;  1RAO A;  1OMS A;  1P9Q C;  3GIR A;  4NYP A;  1UVN A;  3DMJ A;  1KTQ A;  3GFX A;  5CYQ A;  4OHV A;  4O0N A;  4U8V A;  1CJU A;  2Z2Y B;  4KPC A;  4CNY A;  3MR6 A;  1VQP S;  5A6P A;  2RNE A;  1ZET A;  4FF3 A;  3PYD A;  4AT1 B;  1QTN B;  2GQC A;  4Y34 A;  4JI0 J;  1JX4 A;  4DR7 F;  1JK9 B;  2AHO B;  3POT A;  2YNI A;  3I9Z A;  3MCO A;  3UDC A;  5KFM A;  2R2T A;  1LW2 A;  3PX6 A;  2E1R A;  1LOU A;  1MML A;  4F3O A;  1NKC A;  1OY6 A;  2GV1 A;  3DHW C;  1N5Y B;  1F2G A;  2U1A A;  1Y5I B;  3ADA C;  3VTI A;  2KG0 A;  1KLM B;  1NKB A;  5K14 A;  4TN2 A;  1YIT S;  2P9G A;  4X4T A;  3H8Y A;  3QWP A;  1U0H B;  3TVY A;  5A2Q U;  3OPK A;  2DRD A;  4B3O A;  1CJK A;  2V68 A;  2OO4 A;  2GCF A;  2DNO A;  4WFX A;  3PR5 B;  1T9U A;  1QAY A;  2G0I A;  1NZ8 A;  4Q43 A;  2Y3Y A;  1U45 A;  1G1X A;  2RSQ A;  2DNG A;  4R8U B;  1RT6 A;  2CAJ A;  3P49 B;  2HHX A;  4J37 A;  3DLK A;  4IYQ A;  3DLK B;  5B0D A;  1VBX A;  1CJT A;  4GVB A;  3MUR P;  2HYI B;  4F04 B;  2HPU A;  2BMB A;  4EK2 A;  1AW0 A;  4WU3 A;  1RU1 A;  1YBA A;  2UUW A;  4ECW A;  1N34 J;  1KFS A;  4FBT A;  3D0G E;  3AHP A;  4LUB A;  1Q1K A;  3VCD A;  1GX5 A;  2B5J B;  5ITH A;  4OYA A;  2X3D A;  3SDE B;  2DT9 A;  2O67 A;  2WOM A;  1BXN A;  3ETO A;  4KT0 C;  5E3Q A;  5CYJ A;  2E1C A;  4ZPV R;  2Y1I A;  3NNA A;  2FJD B;  3J81 j;  4K50 A;  2YKA A;  3TZX A;  2LU1 A;  3KJV B;  3NNH A;  2JZ5 A;  1QE1 A;  1FK9 B;  1S1T A;  4UW2 A;  1N0V C;  1SJ1 A;  1VRT A;  2GJF A;  2G13 A;  3D67 A;  3HHL B;  4TU9 A;  4YY3 F;  1TL7 A;  4WBF A;  3NWR A;  3BO3 A;  1WEY A;  3W2V A;  3SQO P;  4QIE A;  3KWM A;  2Y1L B;  5HVH A;  1X4A A;  1DFD A;  2R8J A;  3RAM A;  2ILZ A;  3AFG A;  5KFJ A;  3CIZ A;  1S77 D;  1DTQ A;  4N5S A;  1FJG J;  2B9Y A;  1DJ0 A;  4F26 A;  2OPP B;  3OXF A;  2W8L A;  2JL9 A;  5KG7 A;  1N54 B;  4JI8 J;  1VOM A;  4YEA A;  1VHF A;  5GAE I;  3CVK A;  3FZB A;  1F2H A;  5CYQ B;  1WF0 A;  2L9N A;  3OFE A;  4OI1 A;  3UI3 A;  4CI0 B;  5M2P A;  2XMA A;  2LCW A;  2AYM A;  3L7U A;  2V4Q A;  1HW8 A;  3GG1 A;  1S5Z A;  3OJU A;  4DQR A;  1IR0 A;  1S99 A;  2AJQ A;  1ZAW A;  3CJT A;  1KWM A;  3I87 A;  3M32 B;  4PXC A;  4QOT A;  3KXD A;  5HAN A;  4NAS A;  2GS8 A;  2KHD A;  1S4F A;  2AKW B;  2H3E B;  1FES A;  3O2I A;  2I6W A;  1NB7 A;  2HHV A;  2YWK A;  4PG5 A;  5KFI A;  1OQ3 A;  2QL9 B;  3R97 A;  1UJ6 A;  2Z30 B;  5HL7 Q;  3V6J A;  4ANC A;  1X0F A;  1ZS6 A;  3IFE A;  3ISN C;  1XMO J;  1VQ5 S;  1N32 J;  3DRP A;  4PWD A;  2XNR A;  1NDK A;  4GC6 A;  1S57 A;  1XER A;  2YKM B;  3FMW A;  2IVF B;  3L7O A;  4Q0B A;  3RW7 A;  4Q0B B;  4I67 A;  2IY5 B;  4I7F B;  2J0W A;  2D69 A;  3RRG A;  2VOP A;  2DR5 A;  1LWC B;  5A8K B;  1EKR A;  3ZO7 A;  2OD6 A;  4LFC F;  4I2Q A;  4FBU A;  2AQ4 A;  1ZPW X;  5KFF A;  1NH8 A;  1HI1 A;  3LQV A;  3SMZ A;  2E5L J;  5D0R A;  2AYE A;  4LRA A;  1GK8 A;  1UP1 A;  1NK7 A;  1R6V A;  2HAI A;  3BN7 A;  3PW4 A;  4LRE A;  1RKJ A;  2FLN A;  5K8N A;  4L6V 3;  4K0K F;  4NA3 A;  3N9U C;  1FRL A;  5CH7 B;  3LWM A;  2HHW A;  3I4P A;  1IBL F;  1XNR F;  4LIW A;  2OPS A;  3HKW A;  4PG7 A;  1R8H A;  2CVI A;  4TY8 A;  2ZH8 A;  2HNY B;  4O44 A;  1LW0 B;  4IH6 A;  1KVK A;  3QGH A;  4K4X A;  3QSY B;  1Z2Z A;  3HLU A;  4HKQ A;  2N3O A;  3K89 A;  2PSZ A;  3GJQ B;  5HMY A;  5KFB A;  2M4M A;  4ES1 A;  2BE2 B;  3MM7 B;  4QCL A;  1S9F A;  2GX8 A;  3QGP A;  1RHR B;  3U1L A;  1HKA A;  4DU8 A;  2GVZ B;  4FVM A;  4UUX A;  4CM0 A;  1O5J A;  2B4V A;  1LFW A;  4OI3 A;  5HP1 B;  2XCA A;  4R0E A;  2IAJ B;  2OUG A;  4N77 A;  1DZ5 A;  4ZLL A;  2D7S A;  1VBZ A;  2I5J B;  5AXK A;  5KFH A;  1BHN A;  4FPI A;  4K4U A;  2HLT A;  1OWX A;  3ONQ A;  3KHG A;  1RB0 A;  3G82 B;  4QR0 A;  2XMV A;  3H90 A;  1X5O A;  3P3D A;  3G4S S;  4RLE A;  1CEZ A;  2F8M A;  1OPZ A;  2OPR B;  3EWG A;  5C24 B;  3OHB A;  1KN6 A;  3AA8 A;  3T19 A;  2KVQ E;  1N33 J;  2D3O R;  2B43 A;  1S1V A;  3I0S A;  4MK9 A;  4AL6 A;  3MEC A;  4OJ1 A;  4HEA 9;  3SV3 A;  7FDR A;  3ZZT A;  4JI4 J;  4EMD A;  2C2E A;  1V3R A;  2HWI A;  2IJR A;  2Q6B A;  3KG0 A;  3QT7 A;  2VJV A;  1FTC A;  3D66 A;  5DQG A;  1CG2 A;  2C2D A;  4E2F B;  2XMM A;  3EVW A;  4CLT A;  5KT4 A;  4KGZ B;  4RW7 A;  3ZXW A;  1NH7 A;  4OYX A;  3CT9 A;  5M2U A;  2J9D A;  1FXL A;  3MAH A;  4R25 A;  1U1M A;  2KZZ A;  1VI7 A;  1HNX F;  1TKX B;  1UW4 A;  2VQE J;  2G0C A;  5LSL A;  4QW9 A;  4IOB A;  1HQ2 A;  2HFN A;  1RAC B;  4DS5 A;  4TLQ A;  4ZCM A;  2GGP A;  4TY9 A;  2VG7 B;  4JI3 J;  2FDN A;  2HS3 A;  1EAY C;  4UQG A;  3OTB A;  2FGO A;  2M3D A;  3RB0 A;  1HWJ A;  3LP0 B;  4OMF G;  4ATN A;  5A2Q Y;  4LBP A;  4OYW A;  2F40 A;  4X4S A;  1WTB A;  5IT9 U;  2MSS A;  1SL1 A;  4U67 Q;  2MY7 A;  2QL5 B;  2WVE A;  4TYB A;  3W5Y A;  2EW9 A;  4QWE A;  4AL7 A;  3UCZ P;  3D6M B;  1TFY A;  4PUO A;  2QO3 A;  3SCJ E;  1HWL A;  1FX2 A;  1P1T A;  5LMU J;  4I6Y A;  1SKW A;  4E0D A;  2XWX A;  3RG6 A;  2FHK A;  3GE9 A;  5IWA F;  4TXS A;  1Q5V A;  3OLB A;  3TZY A;  2EK1 A;  3DLH A;  3EVM A;  1HWU A;  4C11 A;  3MD3 A;  3IA0 A;  3T1H F;  2DNH A;  3JSB A;  1FFS B;  1P27 B;  4J91 A;  4KHP J;  3FBC A;  3BH6 B;  5MLC V;  3NMA A;  3L95 X;  3DXS X;  4USU A;  3T1Y J;  1RT6 B;  3ZZU A;  2FC8 A;  2KL8 A;  2ZE2 B;  2AEM A;  2IRU A;  3F44 A;  4KRW A;  4Q44 A;  4YB1 P;  1YJT A;  4FNI A;  1JLA A;  5LMN F;  2Z0G A;  1KVJ A;  4JYA F;  3M8W A;  4DN9 A;  2AJ4 A;  5B0E A;  3J7Y U;  4A8Y A;  4G1I A;  5E3C A;  3H2U B;  4B02 A;  4Q45 A;  3VGU A;  4ZCI A;  3OXL A;  1UMJ A;  2EI5 A;  1X4H A;  2VQF F;  3Q8V A;  1NRK A;  4B9T A;  4YR2 A;  3T5K A;  2CJY B;  5H9E K;  3IAS 9;  3OR2 B;  4TLR A;  1HYS A;  1YI2 S;  2P2C B;  3BB5 A;  3KHR A;  5J2P A;  3TW0 A;  3LP1 A;  5KFO A;  1RWN B;  1RE1 B;  4GKK J;  3FEX B;  4OI0 A;  4RW4 A;  5I3P A;  1SQE A;  1B0V A;  1FD8 A;  3MM6 A;  3CTR A;  1RZM A;  3M9M B;  1FWL A;  2HK2 A;  3FRZ A;  3QO9 A;  3EZ5 A;  4J9L A;  3NXZ A;  3J80 Y;  1WAC A;  3HMJ G;  2VFS A;  1QUV A;  3D2W A;  4JOU A;  5DDP C;  4NWB A;  1F3V A;  4YR3 A;  3BJY A;  4PXB A;  1TKX A;  4EZ9 A;  2RDJ A;  2E9R X;  2DGO A;  1IBM J;  3T6B A;  1JKH A;  3FBF A;  1JKH B;  1T95 A;  4MTP A;  2UXD J;  3QLH B;  5L9X A;  4DPT A;  5DQH A;  3M2R A;  3N79 A;  4EEY A;  3VZH A;  4NLG A;  2CNO B;  3PHT A;  4RW6 B;  1YX2 A;  3SSS A;  3ET6 A;  3CF5 Q;  3HO1 A;  2F9D A;  1WI8 A;  2CNN B;  1AA1 B;  1H98 A;  3QRQ A;  2F1F A;  4NLU A;  2HVH A;  2KM8 C;  4K4T A;  3ENW A;  4JV2 A;  1IQT A;  1S7I A;  1T9T A;  2EPI A;  3C16 B;  5A0Y B;  2EFG A;  2UXB J;  5LJ3 Y;  3OR2 A;  5DQI A;  1WG1 A;  2QLW A;  1AUS L;  4WIQ A;  5E0O A;  1S0O A;  4KGX B;  4CO3 A;  3DYA A;  5HRO B;  3EVO A;  4C3M A;  4XAK A;  3GJT B;  4D3H A;  1S1U A;  2MLY A;  1R31 A;  3G6X A;  3NGT A;  2DR8 A;  2WON B;  2WON A;  4DR5 J;  3OR1 B;  1S79 A;  3KK2 B;  4DR5 F;  4LQ3 A;  2XZT B;  1U0H A;  2IYI A;  4CWB A;  2RJZ A;  3C6U B;  4M5I A;  5H1S V;  4U96 A;  1QLN A;  1WNE A;  1V6H A;  2YH1 A;  2HLU A;  1ZA2 B;  2FHO B;  2VAS A;  4I2Q B;  4MMO A;  5HVF A;  1YJ9 S;  3C46 A;  3W64 A;  2C1E B;  1HHQ A;  4ZHR A;  4ES3 A;  4V1A k;  4LFB J;  1S10 A;  4ZPA A;  4KO0 B;  2R3V A;  4FF4 A;  4QYZ J;  1U1N A;  2CPX A;  4B3M J;  3GP9 A;  2CJK A;  4HH0 A;  2XHC A;  4NCB A;  1EZZ B;  2HVI A;  4JI6 J;  2BKN A;  1S4E A;  4HI1 A;  2G0J A;  2KM8 B;  4KJI A;  3OVA A;  2BA9 A;  1RP5 A;  1U47 A;  2Y8W A;  4ED0 A;  4DV7 J;  1LW0 A;  2KN4 A;  2YQ3 A;  1G4C A;  2NXN A;  3H20 A;  4HHU A;  4NZ7 A;  4DPY A;  2YBV A;  3DRR B;  1NK0 A;  5D6G A;  1U26 A;  4P71 A;  2NXE A;  3DRS A;  3UVJ A;  1GMW A;  4K5S A;  1ZM4 A;  3TI0 A;  4USW A;  1BQN A;  1BY9 A;  2NCK L;  3G8S A;  2FQQ B;  3PCO B;  2BUN A;  5CCM A;  3C14 B;  3OR1 A;  1R8B A;  1SC3 B;  3PIP Q;  2ZHB A;  4NXM F;  2ZM6 J;  3BDP A;  4HLB A;  1B7Y B;  3AT1 B;  5DGA A;  3DOK B;  1FER A;  1GX6 A;  3CJ0 A;  4I2P B;  3R9L A;  4DX6 A;  3V81 A;  1X60 A;  4IR1 A;  3LTO A;  2KYX A;  1BMQ B;  4KHR A;  4JI1 F;  1PC5 A;  3OBI A;  1C4C A;  3NCR A;  3IWN C;  1HPZ B;  1HNX J;  2MKJ A;  1ZTT A;  4DSJ A;  2XBP A;  2GMJ A;  2ZNY A;  3BGR A;  4KPY A;  3V4I B;  1T03 B;  2XZD B;  2MLX A;  1U02 A;  4NZ0 A;  3IBC B;  1FWP A;  3OFH A;  4FXV A;  2ZH1 A;  1JWW A;  5T41 A;  5BR8 J;  1WC4 A;  3R2C J;  3JQM A;  1HW9 A;  2XB2 D;  2JC1 A;  5ETV A;  1VRQ C;  1Q8I A;  1SVD A;  1C0T B;  2WVC A;  4LSL A;  1LK7 A;  2DO0 A;  1XR5 A;  4B9L A;  4K7Q A;  1LWE A;  2W4C A;  1LWE B;  1YLX A;  4DDF A;  1HHS A;  4W98 A;  5SZT A;  4WCE Q;  2XCP A;  4L72 B;  5F8N A;  4H4M B;  3MEK A;  4KAI A;  3SCI E;  4DPO A;  4R5P A;  2DVI A;  1FKP B;  1GMV A;  1YK9 A;  4NLY A;  4PEO A;  1GAO A;  5JUM A;  5GVQ A;  4ECZ A;  2X3G A;  5DZ7 A;  2MZ1 A;  4X62 F;  3HX9 A;  1RXO B;  3RUB L;  1EX8 A;  2XGP A;  2Y8Y A;  1B64 A;  4WWS A;  2VFR A;  3FSX A;  2HFO A;  4PZV A;  5FII A;  4X65 F;  3M8R A;  1ZZF A;  4FYD A;  3IWX A;  1PYS B;  2NPI A;  3W61 A;  3W63 A;  2C3O A;  1CQM A;  1BLU A;  2EFQ A;  1QD1 A;  2HW3 A;  1FF2 A;  5G0R B;  8AT1 B;  3OVS A;  1YKW A;  2OEK A;  3JAM Y;  3H4D A;  3EDQ B;  1RAJ A;  2AIR B;  2SXL A;  1B4S A;  3N01 A;  1YSJ A;  2B8P A;  2E1M C;  4DX5 A;  2HMI A;  3T9Z A;  5F9N A;  2BJ7 A;  2OIH A;  2WB1 D;  3B4D A;  2CQC A;  3HVW A;  3RB6 A;  1M5O C;  2XY7 A;  4B9M A;  3CDE A;  3SV4 A;  3DLG B;  4QWC A;  4H4K A;  3H2V E;  1YIJ S;  3DRR A;  1VRT B;  1RT4 A;  3D6F B;  2AEJ A;  3NGS A;  4IFY B;  4F7V A;  2ZBR A;  1OS5 A;  1WKJ A;  1LW2 B;  2BV3 A;  2XI2 A;  3TUI C;  4MKV A;  4ED1 A;  1NME B;  4IH7 A;  4BWM A;  1GFW B;  5KFP A;  3NL0 A;  2AGQ A;  1IKY B;  3HSD A;  4MIA A;  1NSQ A;  4F2R A;  1ZOT A;  1W2B R;  5KFS A;  4Y3C A;  1JJC B;  2FZG B;  4HH1 A;  3V81 B;  1JQG A;  3H4B A;  1DLO B;  2FIU A;  1DLO A;  3MGJ A;  3MMA A;  3QT5 A;  5A8W A;  4EZ6 A;  1WOS A;  4DV3 J;  5KFG A;  2Y0S D;  4OI6 A;  3CCM S;  3A3O B;  3B4M A;  1IWA A;  4CH1 A;  4UZB A;  3UD4 P;  3Q8Y A;  3L3C A;  2BRK A;  4USH A;  4K8R A;  4A4J A;  1Q16 B;  2K1R A;  2EWH A;  1WD6 A;  1RWU A;  1HQU A;  2AP6 A;  2YWF A;  3NS7 B;  5IQQ A;  3OHA A;  4PPZ A;  1RWM B;  3ILJ A;  4XDD A;  3TAN A;  4MIB A;  4JI8 F;  3TUP A;  1VQ4 S;  2HND B;  4YS2 A;  5GAE U;  1MSW D;  2G2Z A;  2OSQ A;  1RAA B;  3QGG A;  4DL2 A;  3VHQ A;  2KVI A;  1B99 A;  2MZS A;  1NJX A;  5GME A;  4JI7 F;  4Q8F A;  4LF1 A;  4IDK B;  4DOZ A;  5F8M A;  4OZ5 A;  5J1E B;  5F8I A;  3GJR B;  3BKT A;  2MKH A;  4IG0 A;  1HBO A;  1D09 B;  1HBO B;  1OYE A;  3IBW A;  4YY3 J;  4ZN1 A;  2OD4 A;  2NZC A;  4FKY A;  5KT2 A;  1E6V A;  3OSP A;  4PAB A;  2O1P A;  4C8M A;  4DSK A;  3PKM A;  4JP8 A;  2XSJ A;  1UEV A;  1QSY A;  4I68 A;  4DI6 A;  2FVC A;  2X51 A;  3RU0 A;  3G8T A;  1FEH A;  3KUH A;  1PIL A;  2OPQ B;  2WSF C;  4HT5 A;  3NP5 A;  3PAC A;  4KSE B;  4M94 A;  2CQP A;  3DLL Q;  1FJC A;  1JLB A;  3M05 A;  1K9M T;  3Q8P B;  4X65 J;  1L3T A;  1FNM A;  3MTK A;  2E1P A;  3NOC A;  1FVQ A;  2JFD A;  3BN4 A;  2YNF B;  7AT1 B;  4LF4 F;  5FJ4 A;  3ILI A;  2GW8 A;  4WII A;  1T8E A;  1H2T Z;  2ZZN A;  2VU5 A;  3MMJ A;  2E44 A;  5DS7 A;  1BE4 A;  4B9N A;  2P5V A;  3FSY A;  1JLE A;  2AZ3 A;  2LQJ A;  3FFI B;  1UAW A;  5J2M B;  3CCS S;  4DR4 F;  1C1B B;  1GMU A;  1XN9 A;  1C4A A;  2LQ9 A;  3KK3 A;  1CBK A;  2LQ8 A;  2BE2 A;  3MM7 A;  4W4M A;  3A3N B;  4CYU B;  5LJ5 Y;  4U9R A;  2AX0 A;  3JSY A;  5ETQ A;  5ETS A;  3W66 A;  2ZH4 A;  3RR8 A;  5C7P A;  1LXJ A;  3RRH A;  3HPO A;  3HVT A;  4AQY F;  2V2V A;  4LMZ A;  3FZ2 A;  3B78 A;  3DXB A;  1VQM S;  3KLH B;  1YJV A;  3TYT A;  1MRO B;  1U6Z A;  3BGF A;  1MLA A;  1OQ6 A;  3RR7 A;  1RWO B;  2HS4 A;  2OPR A;  1N52 B;  3VAH A;  2I8E A;  4O4R A;  3QAU A;  4CDI A;  2AGP A;  1S6P A;  2DPJ A;  5DDO C;  2C2O B;  4P7V A;  2ZM6 F;  2C2M B;  3C66 A;  1RWP B;  4RWX A;  2DY9 A;  3ZZY A;  1ZM2 A;  2U2F A;  4NCA A;  2XG8 A;  3POT B;  2XYG B;  2C22 A;  1RTJ A;  1WOO A;  2HS0 A;  3LGH A;  5BXI A;  1K8A T;  2R4F A;  2B4O A;  2ZBI A;  3ZTP A;  1L3K A;  3N6L A;  4DCJ B;  1VQ9 S;  3KNA A;  5HLF B;  4FYW B;  2OML A;  5KT5 A;  2RB7 A;  2RQK A;  3BH7 B;  3HD2 A;  3QGI A;  3KLI B;  4ID5 B;  2CUY A;  3AB2 B;  3GV8 B;  2UU9 J;  3SQG B;  1QVG R;  1F9E B;  3MEG B;  1MMD A;  3Q8S B;  3CXC R;  4HAC B;  1RHJ B;  3AOA A;  1VQK S;  1WC5 A;  3BSC A;  4LSZ B;  1TL5 A;  1RT1 B;  5D8H B;  2HVE A;  4WU2 A;  3CW2 C;  3LAM A;  5J1P A;  5E33 A;  1KRP A;  2UVV A;  2BAN B;  4TQS A;  3C6T B;  4MK7 A;  1RAD B;  1RBA A;  3W62 A;  2HUR A;  5DM7 Q;  2HZC A;  5L1K A;  4MYU A;  5D0H A;  3EUN A;  3W7B A;  2MZR A;  2RUG A;  3DRX A;  5LSO A;  4CZC A;  4ECX A;  1UWA A;  2Z56 B;  3T41 A;  1C0U B;  2WSC C;  3AJ2 A;  1VYA A;  5IFM A;  1YBU A;  4FYX B;  3K57 A;  3O6Q A;  3R7S B;  1LEO A;  3A1Y G;  1DRZ A;  1RAI B;  3QFW A;  2XS2 A;  1FDA A;  3OTD A;  4IKA A;  4XIU A;  2R7W A;  2VV5 A;  1NDP A;  2CJX B;  2V0N A;  3N0V A;  4B3M F;  3S8S A;  5DET A;  3B54 A;  2LEB A;  3VF0 B;  3BBF A;  1N36 J;  4DLG A;  3DLJ A;  1FWK A;  3K2Y A;  1WUU A;  2DBB A;  4CTA B;  2NPF A;  2D3O 1;  4JI0 F;  4LFA F;  3Q8R B;  3ZNJ 1;  2ZH2 A;  3NAI A;  1TFW A;  3W9J A;  2P6S A;  1T11 A;  2LFV A;  2ZUA A;  4FS1 A;  2HIQ A;  4QYR A;  2WVD A;  3KMQ A;  2WK4 A;  4AND A;  2QIF A;  4RNH A;  2DNM A;  2ZE2 A;  2ZKT A;  2N82 B;  5LMU F;  1KS2 A;  3G8Q A;  4NA2 A;  4QU7 A;  1TKZ B;  4RW8 A;  3VAK A;  1DAX A;  2QN6 B;  3ZTS A;  4O4G A;  2FGC A;  2DHX A;  2MGZ A;  4ELU A;  1RT3 B;  2CVE A;  5M2R A;  1AUD A;  3IGV A;  2DHA A;  1M5K C;  5K5M A;  2B4U A;  2UXB F;  3H5X A;  2W1B A;  4AFF A;  5I3Q A;  2RRN A;  4EU0 A;  3F73 A;  4OYI A;  2ZOF A;  3GV7 B;  5J2P B;  4CCH A;  2PMW A;  3TJA A;  2IM0 A;  4CLP A;  2YWW A;  2ALY B;  5B0G A;  3CGI A;  5KFE A;  4ZVU B;  1UW9 A;  1AFI A;  1KFD A;  4FYY B;  1YRT A;  1V5V A;  1M5S A;  1T9V A;  1OJ4 A;  2X1B A;  3AOC A;  3F56 A;  3SBM A;  2YWG A;  1VFJ A;  1X9M A;  5D3G A;  4F4Y A;  5SUH A;  3MEG A;  4G1Q A;  1ITP A;  2JEJ A;  3WIU A;  2QLJ B;  2VFU A;  3M30 B;  1V3S A;  5KOW A;  1BWE A;  2UZA A;  1RI7 A;  3UE2 A;  4URQ U;  5IM0 B;  5IM0 A;  3K5O A;  3THV A;  3CNQ P;  2CG4 A;  2MJU A;  4CH7 A;  4X4N A;  1D9D A;  2RQM A;  4NOH A;  3PO4 A;  4RO0 A;  1SIW B;  1W2I A;  5A8K A;  1LWC A;  4OJG A;  3PO5 A;  2C3U A;  1SQF A;  4DFK A;  1HBU B;  1Q8K A;  1EET A;  4V19 X;  4ZIV A;  2W24 A;  2VC1 A;  1SL0 A;  1RA7 A;  2HEK A;  2PA8 D;  1G2E A;  1Y00 A;  4DV1 J;  3I55 S;  1F6T A;  2CQB A;  4PQU B;  1K1S A;  2OFG X;  2N7C A;  1UVM A;  1IKW A;  4UST A;  2XLK A;  4M1K A;  3HDS A;  5EWG A;  1HQE B;  1LFP A;  3AH6 A;  5CZV A;  2Y0B B;  3OTC A;  4Q7A A;  4IRK A;  1T9W A;  1DAR A;  4KV8 B;  3IXQ A;  4OX9 F;  4EBE A;  1GQE A;  2NSB A;  1FRM A;  3TZW A;  1W7W A;  4NL5 A;  4ZKA A;  4WKR A;  3CWJ A;  5CXT A;  1VGY A;  2HSE B;  1F5C A;  2KKH A;  1LWF A;  4PG4 A;  2B56 A;  1WHW A;  4L74 A;  3CDA A;  5KFZ A;  2RU3 A;  3M1V A;  3WBZ A;  1PG5 B;  2F4V F;  2IDE A;  4XPC A;  3D0I E;  4Z37 A;  3TJ9 A;  3ZC4 A;  2AYG A;  5KG1 A;  4NCG A;  3HM9 A;  2KI2 A;  2WBM A;  2BM1 A;  4ED2 A;  1FJE B;  4OJH A;  1XNQ J;  5A8R A;  1FDD A;  2MZT A;  4YR0 A;  1EIY B;  4GKJ F;  3JAM U;  3BPD A;  3FEY B;  3KLE A;  2BOA A;  3QNW B;  3GQC A;  1IBM F;  1S6P B;  5B09 A;  4F25 A;  1NAQ A;  3TNV A;  5KT3 A;  4LBI A;  2CQ3 A;  4F3M A;  2WCX A;  5DGB A;  4NEZ A;  1IM6 A;  1UFL A;  2BXJ A;  2OP5 A;  2YPZ A;  3NRB A;  1QAI A;  1Y7P A;  4IFV B;  4ZDN A;  2F63 A;  2K3I A;  4NYZ A;  4CLF A;  2MKC A;  2OEL A;  1WTF A;  1V9O A;  2VBX A;  3IAM 9;  5J1E A;  2RKI A;  2PE8 A;  2HNZ B;  3NS5 A;  3SQG A;  3ENV A;  2DB1 A;  4K2J A;  1I5O B;  2J0X A;  4UOF A;  4X62 J;  4J9Q A;  1VQS A;  2RML A;  4CO4 A;  3EJM A;  4OX8 A;  3QRR A;  2ZBP A;  1N5Q A;  3GR0 A;  4ED5 A;  3A8I A;  5FDL B;  1DTQ B;  3EZO A;  1GTE A;  1KHW A;  3IM8 A;  2BAB A;  2IRX A;  4JI5 J;  3IP0 A;  4EFA C;  3P5T L;  2P6T A;  2VC0 A;  2ZOM A;  4C0H A;  4A8M P;  3MF5 A;  4IO9 Q;  4KE5 A;  3TWZ A;  1RIS A;  3BSO A;  2J5A A;  3DC2 A;  5ETR A;  3R3T A;  2ZEJ A;  1H2V Z;  3PJX A;  3VGS A;  2FHJ A;  1YBT A;  2Z2Z A;  1B3T A;  1MNE A;  4O3N A;  3M8P A;  2C2N A;  3LP0 A;  3SEO A;  2V2Q A;  1SJ3 P;  1N8R T;  1S48 A;  4X2B A;  2XTJ P;  2ZOG A;  4ZPD A;  5JMN A;  3R2D J;  2F8H A;  1V5I B;  3GFY A;  4AUK A;  2WOM B;  4N8O A;  4Q2M A;  1DBD A;  4ILM A;  1VQY A;  1U48 A;  2ZBC A;  4DL5 A;  2MJN A;  2XY6 A;  1WEL A;  4NYO A;  2FYX A;  4X4O A;  3VR1 A;  3LPE A;  4U7C A;  2RQ4 A;  3A8K A;  4C97 A;  3R5C A;  2CPI A;  1T02 A;  3KHL A;  1SQG A;  1FVS A;  3DRS B;  2GAH C;  4MFB A;  3U02 A;  1N0U A;  4DX7 A;  2W9A A;  4DV4 F;  1SV5 B;  4HDG A;  5F0W A;  4IRD A;  4QJV A;  4BHQ A;  2IA6 A;  4RW7 B;  1ROF A;  4C9D A;  2HQG A;  3BQ1 A;  1EP4 B;  3ULH A;  3W2V B;  2WAQ D;  3TA1 A;  4NLS A;  1Q53 A;  2YKQ A;  4A8S A;  3TJ8 A;  4C98 A;  4X4P A;  2F9J A;  2EVZ A;  1REV B;  3DKD A;  5H9E J;  1SH2 A;  2AV5 A;  3OT9 A;  5CAA A;  1U24 A;  3DN9 A;  1E6Y A;  3SYZ A;  4Q5V A;  3IR6 B;  3D4J A;  2GO8 A;  2OMO A;  4JI2 F;  2YNI B;  1MN7 A;  2GO9 A;  1SH0 A;  3HF5 A;  1TVR A;  1LXN A;  3W65 A;  2PFD A;  1PKU A;  1J27 A;  2NS1 B;  3A4T A;  1BQM B;  1SC6 A;  2DNN A;  1RAE B;  5IC4 B;  1XBW A;  2W2O P;  3NEK A;  1IBC B;  2OFH X;  1WC6 A;  2WTF A;  4DFP A;  4DL4 A;  2JOQ A;  2H48 B;  3OFF A;  3I5A A;  1S1U B;  1RSC A;  3NAH A;  4KKO B;  2VJU A;  5HSP A;  1NPR A;  1YZ6 A;  5D0E A;  2WBR A;  1SV5 A;  1PSD A;  1SC1 B;  3KK2 A;  4K4S A;  2V2K A;  3NKY A;  5BYS A;  3TA2 A;  2UV8 G;  4IOA Q;  3TP2 A;  1VC0 A;  3JTN A;  1NO8 A;  1Q5Y A;  1RKI A;  4I7F A;  3QJL A;  5KAK A;  5LT5 A;  1FX4 A;  3CMQ A;  2VH7 A;  3VAM A;  2VPZ B;  4TVA B;  1T94 A;  5C42 A;  1CUL B;  1Y9O A;  5ETL A;  3PNI A;  2IC3 A;  4DU7 A;  3M8Q A;  2W9C B;  3T9N A;  4NLV A;  3GPA A;  4OX7 A;  2CPD A;  4NE9 C;  3W8G A;  3PW0 A;  3W60 A;  2ASD A;  4RW6 A;  2CQG A;  2WVB A;  1JXV A;  2CG8 A;  3BDE A;  4H4K C;  2V4J A;  4ZJL A;  2FZC B;  2R2R A;  2ZJR Q;  2W2Q P;  3BPS P;  2RHQ B;  3TAM A;  1N56 A;  1B7F A;  2BE9 B;  2D74 B;  2VG5 B;  4LRC A;  4P73 A;  2QT7 A;  4NLR A;  1RTI B;  4P2S A;  2DGQ A;  1P6T A;  3VQT A;  1HNZ F;  3MOZ A;  3UW1 A;  1DHM A;  2BBE A;  1Q81 T;  4DV7 F;  4CO0 A;  3OW2 R;  2QTW A;  1RYS A;  3QJJ A;  3HHK A;  2BR0 A;  5K8M A;  1WOP A;  3GG0 A;  2M2B A;  2V8H A;  1PGZ A;  4JV5 J;  4OYO A;  2VQF J;  5FLX Y;  5D0G A;  4DR6 F;  4HAC A;  3G96 A;  3O3L A;  3C6U A;  2Y9H A;  3KDO A;  4ECY A;  4O23 A;  3M8S A;  4H54 A;  4ZP9 A;  5AE2 A;  2Y1R I;  2XUL A;  2LLZ A;  2BJ8 A;  3W2W B;  5IT4 A;  3GIL A;  2RRA A;  2ZH3 A;  1TV6 B;  2W2P P;  4OI2 A;  2XY5 A;  3E3X A;  1URR A;  4LFC J;  1TKT B;  1RHQ B;  3M2U B;  3N5B A;  1D0E A;  4NLO A;  1RBL A;  4U8Y A;  2ZVS A;  5GAD I;  1N5T A;  5KFL A;  2YQ1 A;  1F5B A;  4B17 A;  4P75 A;  3R5G A;  3S6E A;  4U6P A;  1U1K A;  5BYQ A;  1N6Q B;  3CB4 A;  3MM8 B;  2QA1 A;  1B70 B;  4QPX A;  4DUZ J;  1L3U A;  1RQ0 A;  4RUC A;  2BW7 A;  2YKN B;  4UY8 T;  4B3R J;  2AF6 A;  1VR6 A;  5HQ8 A;  2EBE A;  3GV5 B;  1PAE X;  3R6L B;  5C25 A;  5D3G B;  3LPY A;  1IBK J;  1JXL A;  1T05 A;  3ZTQ A;  3HJV A;  2C3Y A;  2L48 A;  3AXK A;  1WHX A;  2ASY A;  3UPF A;  4F0M A;  1J5E J;  5D4L A;  3OL9 A;  3QPI A;  3ZZR A;  4RL1 A;  2X1A A;  1HL6 A;  1TKD A;  2R8G A;  2I2Y A;  2DHG A;  3K7R A;  4YB5 A;  2MEW A;  2NUH A;  2VUG A;  3IR5 B;  1XR6 A;  5ETT A;  1RLC L;  1TL7 B;  1RHU B;  2HZA A;  3AQO A;  3EDR B;  4M63 A;  4RWW A;  9RUB A;  1RWX B;  2QEX S;  3RJM B;  3M2V A;  2W7O A;  3GYX B;  4LIR A;  2GFF A;  1DTT A;  4ECR A;  1WOR A;  4ETX A;  5EHH A;  4ZK7 M;  2L08 A;  3UR3 C;  1QDU B;  2RDI A;  3K5P A;  4RW8 B;  3V2U C;  2FJW A;  4RUA A;  5JVH Q;  1T03 A;  2CFX A;  2KXH A;  1FNO A;  2J8A A;  2NYH A;  3TZZ A;  2HZV A;  1I6J A;  4I6W A;  3CJQ A;  4M5K A;  5A6W A;  1LWX A;  2DD8 S;  2GNK A;  1M5H A;  5CAB A;  2BQU A;  1RT5 B;  3QBC A;  2HAF A;  2GJ2 A;  2EG2 A;  2IBO A;  2KYZ A;  5HI7 A;  1WHY A;  1L3S A;  3WC2 A;  1HMV B;  1HLW A;  1IKX B;  2GML A;  2P8I A;  3VVU A;  3KDN A;  3NOG A;  4LF2 A;  3W8P A;  4DSI A;  4ZP6 A;  2HHU A;  3OUY B;  1ACM B;  3MOJ B;  4QBU A;  2I9S A;  4A8K A;  1I51 B;  1QUP A;  2CWK A;  3PYE A;  4JYA J;  3AJ1 A;  3OTE A;  3ZTR A;  2AW0 A;  3QO9 B;  3FQK A;  5E41 A;  1S0N A;  1CJK B;  4KY3 A;  2V8P A;  2VBY A;  3BZQ A;  1NM2 A;  9ATC B;  1UVL A;  3I0R A;  2PEH A;  2YKO A;  3M6X A;  4WKY A;  5KFK A;  1S0M A;  3KLV A;  3W3S A;  4ZVE A;  2JNJ A;  2MKY A;  3HHE A;  1AZS B;  1UCN A;  3OJS A;  1I1G A;  1NJY A;  1OO0 B;  1FRH A;  2H51 B;  5EDW A;  4H4O B;  2V8V A;  2CQ1 A;  4HHJ A;  3BGU A;  3UQS A;  2MXY A;  2HBZ B;  1NK9 A;  2NQP A;  3HSZ A;  2AJ2 A;  2VKR A;  5CHC B;  5EX3 A;  4AE5 A;  4DR6 J;  2CJB A;  1F1B B;  2MKS A;  3GII A;  1W25 A;  2APO A;  2CPZ A;  4DJB A;  1L5U A;  1OPI A;  1J5O B;  3O44 A;  5A0Y A;  1NJI T;  3J81 Y;  1P1L A;  1JLC A;  1RHK B;  1HI8 A;  2CQD A;  4FPR A;  4TU7 A;  4K4W A;  3PZP A;  4JI3 F;  3IO1 A;  4RNN A;  5CD4 A;  1TL4 A;  2UUA F;  1UVK A;  2NRE A;  3HHL A;  1R27 B;  1ZAV A;  2KRR A;  2IYG A;  2H65 B;  2VPW B;  3ZZ0 A;  2NYI A;  3KLI A;  3MCM A;  4PR6 A;  4JV1 A;  4O44 B;  3RGI A;  3NBP A;  1FRJ A;  1GXT A;  1JJ4 A;  3IWL A;  2PMH A;  5KG6 A;  1IQZ A;  1WI6 A;  2RS2 A;  3D68 A;  1RUS A;  2J9D E;  3ENA A;  2EFV A;  3DHX A;  3IN5 A;  3DOM B;  4AD6 A;  2VF3 A;  2M0G B;  3EXY A;  5C5J A;  3CCU S;  1I94 J;  1A6L A;  3BGR B;  4DL3 A;  4FXD A;  2CA9 A;  1U8S A;  1WHV A;  3MI7 X;  2B7B B;  4EWT A;  1HNW J;  2KXF A;  1HYS B;  1TZ0 A;  4WFZ A;  2DYA A;  2KFZ A;  1HBU A;  3LAK A;  2OH2 A;  4DSF A;  1H73 A;  1NZA A;  3M6V A;  4TKT A;  1RCO B;  2LYV A;  3L7P A;  5ETM A;  3OL7 A;  2R2S A;  2KFN A;  1NJZ A;  3ENQ A;  4PQU A;  1YG0 A;  2PO4 A;  1M90 T;  4WXW A;  3GIJ A;  2VOD A;  2CAD A;  1RT7 A;  3TA0 A;  2J0Q D;  3MEE A;  3V6H A;  1O6X A;  3M30 A;  3TRG A;  4DCO B;  3DRP B;  1JXE A;  2DGU A;  2IMO A;  1SI9 A;  2BZ2 A;  1R8C A;  2VKZ G;  3KK3 B;  2QMX A;  4DV6 J;  2MQ8 A;  5KFD A;  3VZI A;  2K8G A;  2HRU A;  4WTO B;  3EE3 A;  2E5J A;  1JLA B;  2ZDO A;  1SJF A;  4ERD A;  4B08 A;  4ZVP B;  3UWT A;  1OSD A;  2IJN A;  2PEB A;  3M8Q B;  4OYP A;  2VB6 A;  2W9C A;  4GKJ J;  4J5O A;  3J7Y I;  1X31 C;  3PY8 A;  3J7Z T;  1GT8 A;  1X4F A;  4KO0 A;  3L09 A;  4F50 A;  1IJF B;  3UFC X;  4RPF A;  1JJ2 R;  2P9E A;  4DHV A;  4ZHR B;  2WZ1 A;  3HJF A;  2QLB B;  3FCH A;  3NNC A;  1TKT A;  2IM1 A;  3M2U A;  4X84 A;  5HMW A;  1VK3 A;  1ZBT A;  2RAQ A;  2XSF A;  4HI2 A;  4IUF A;  2E5H A;  1HR0 F;  2LXI A;  1VQ6 S;  1DUR A;  3MWB A;  4ZIW A;  2J8S A;  4X66 J;  1HBN A;  4RU9 A;  1HBN B;  3HD1 A;  2Q79 A;  5B08 A;  1QY7 A;  3HSG A;  1SKR A;  4K59 A;  3UR0 A;  1T05 B;  1RWW B;  2DIS A;  3M1V B;  4WZQ A;  2W4P A;  2DNZ A;  1U09 A;  2XGQ A;  4NA1 A;  1KVI A;  1R89 A;  3QQC D;  1LKZ A;  1LWF B;  5DO2 A;  5C2G A;  4V19 J;  3U1M A;  2VOO A;  4ZJO A;  2J7W A;  1HBM B;  3O1L A;  3C14 A;  2R2U A;  1S76 D;  4GVL A;  3D54 A;  3JYT A;  1NJW A;  1M1H A;  2DNR A;  1Q86 T;  2NLW A;  2QA4 G;  2Y1J A;  2HBY B;  2BVZ A;  5E7O B;  1B0T A;  2PMZ D;  2VDH A;  3NGD A;  4RR5 A;  2N3L A;  1FEE A;  2MZQ A;  3KLH A;  3UO0 A;  4DF4 A;  1TUV A;  2MGZ B;  4QWA A;  2DPI A;  1C0U A;  1NDC A;  1HIY A;  2YXL A;  2FJX A;  3US5 A;  1HI0 P;  4A8F A;  4Z2X A;  1K0T A;  1N5S A;  2GGP B;  8RUC A;  1RAB B;  4WP9 A;  1S9E A;  1IKW B;  2YY3 A;  4CO2 A;  3OTO J;  2B8Q A;  1PYO B;  3DFE A;  1UJ4 A;  3CIM A;  1XMO F;  2UXC J;  1TL1 A;  1RT7 B;  4OYM A;  1TU0 B;  4OI4 A;  2LA6 A;  1JLF A;  5C24 A;  4DV6 F;  4C8O A;  1VK8 A;  1UZD A;  2X1G A;  4B9S A;  2ERR A;  5B0B A;  1R43 A;  4K4Z A;  3EGW B;  4PPD A;  2CQI A;  2M88 A;  3GTY X;  1OY8 A;  4I56 A;  4F0K A;  2K06 A;  3BRE A;  4ID5 A;  1QSS A;  2RHS B;  4L76 A;  4JUZ A;  3HHL C;  1CVJ A;  2UUT A;  1RDR A;  5IT9 Y;  3IRX B;  3KFW X;  3JQJ A;  4J9K A;  4ZIT A;  1U7L A;  4W90 B;  3E2E A;  4UTG A;  3DLE A;  4QIV A;  2OLW A;  4DL7 A;  3R27 A;  2A10 A;  4MKB A;  2FVQ A;  3MM5 A;  3NS6 A;  1HNI A;  2EKN A;  4GKK F;  5E2Q A;  2EXU A;  1NPK A;  5G0R A;  3AOD A;  2VG6 B;  2AJ1 A;  1N48 A;  2FLO A;  1HAR A;  3R6G B;  2GHW A;  2MZJ A;  2DK2 A;  2M70 A;  1T3N A;  4NX9 A;  2DNP A;  2DKO B;  2B0G A;  1FRK A;  2MHN A;  4UZC A;  4JV0 A;  3K17 A;  2MKK A;  4W92 B;  1KOH A;  3DDI A;  1REV A;  3MUT P;  5F8H A;  4DS4 A;  2FD2 A;  3BYP A;  4TU8 A;  2V4R A;  2DXD A;  5AE1 A;  4CLZ A;  3R5B A;  3LP2 A;  2BYC A;  2DHS A;  8ATC B;  2ABY A;  4RJV A;  1TAQ A;  2UVU A;  1U1P A;  1Q79 A;  4OHZ A;  5AJ3 J;  2D3Z A;  3HHD A;  4OZ2 A;  4HDH A;  4A48 A;  2B3T B;  3GIK A;  5DG7 A;  4KGV B;  4JI7 J;  5ETP A;  1XIQ A;  3UN2 A;  1C1C B;  4NLX A;  2W8K A;  1H2U X;  2F4F A;  1GH8 A;  2J7U A;  3VWS A;  5JJB A;  2X1F A;  3JTP A;  4Y00 A;  1NK8 A;  2CPE A;  4FF1 A;  3MHY A;  4LF5 J;  1U0S A;  2PN6 A;  2CPY A;  4ZP7 A;  2MLZ A;  4CO5 A;  5GMD A;  4FF2 A;  4DV2 J;  5D15 A;  3BF4 A;  5U47 A;  4OLO A;  1XMQ F;  2MY8 A;  2XQC A;  2QJ3 A;  3BS9 A;  4QIW D;  3AOB A;  1SXL A;  2CJ9 A;  3KG4 A;  4OHW A;  4ECV A;  4ELV A;  5DLG A;  4B3S F;  3U7J A;  3TQE A;  4DR7 J;  1F9F A;  2RU9 A;  2LA4 A;  3CO0 P;  4DQS A;  3H59 A;  3V6D A;  1X9S A;  1F60 B;  3BO2 A;  2FZK B;  4JI5 F;  2C2K B;  3QSI A;  2JH3 A;  2KB2 A;  2RT3 A;  1IR1 A;  3C15 A;  3IR7 B;  2MQQ A;  1WWH A;  2OI2 A;  3GIM A;  3Q23 A;  2I0X A;  3D3B J;  3I4H X;  4M5G A;  2AZ1 A;  3M32 A;  1R0C B;  5F8G A;  3HUL A;  2MPU A;  1AB8 A;  1X4B A;  3BQ0 A;  2GQQ A;  4J9U E;  2A6O A;  1I94 F;  5J2M A;  1WC3 A; 
#chains in the Genus database with same CATH homology
 1WKL A;  4F4A A;  3PRV A;  3FBE A;  1S59 A;  4ANC A;  1ZS6 A;  2VU5 A;  3BBB A;  1KDN A;  3VGT A;  1BE4 A;  1LWX A;  1NDK A;  4UOG A;  2AZ3 A;  3ZTO A;  5CAB A;  1S57 A;  3DKD A;  1U8W A;  3Q86 A;  3VGU A;  1HLW A;  5CAA A;  3VVU A;  3MPD A;  1NHK L;  4W98 A;  3Q8V A;  1NDL A;  2CWK A;  1MN7 A;  3ZTR A;  5C7P A;  1F6T A;  3JS9 A;  1PKU A;  1NSK L;  3VVT A;  1EHW A;  1F3F A;  1NDC A;  3EIC A;  1HIY A;  4DUT A;  1UCN A;  3EM1 A;  4O0N A;  1W7W A;  3BBC A;  4KPC A;  4ENO A;  2B8Q A;  3ELH A;  2DY9 A;  1B4S A;  2B8P A;  3FBF A;  5BXI A;  1NUE A;  3PJ9 A;  4F36 A;  3ZTP A;  3EMT A;  1K44 A;  3BH7 B;  3GPA A;  4ANE A;  3WX8 A;  3FBB A;  3NGS A;  1JXV A;  1WKJ A;  4FKX A;  5IOL A;  2HVE A;  4CP5 A;  1BHN A;  1BUX A;  1NSQ A;  1NPK A;  2HUR A;  2DXE A;  3VGV A;  3EVO A;  4EK2 A;  1XQI A;  3ENA A;  2DXF A;  1VYA A;  3Q89 A;  4C6A A;  1WKK A;  3DDI A;  3NGT A;  1LEO A;  2DXD A;  4UOH A;  3Q8Y A;  1NDP A;  3NGR A;  2DYA A;  4UOF A;  3B6B A;  3B54 A;  3EVW A;  1NLK L;  3Q8U A;  3BBF A;  1MN9 A;  3EJM A;  1HHQ A;  1XIQ A;  3GP9 A;  2ZUA A;  3G2X A;  4WBF A;  2HVD A;  1B99 A;  3VGS A;  4AND A;  2BEF A;  3ETM A;  1NSP A;  1PAE X;  3FC9 A;  3ZTS A;  4S0M A;  4DZ6 A;  3ZTQ A;  3EE3 A;  4FKY A;  3Q83 A;  1NB2 A;  3FCW A;  3L7U A;  2NCK L;  2BX6 A;  1S5Z A;  4DI6 A;  4HR2 A;  1NCL A;  3NGU A;  2AZ1 A;  3R9L A;  3EVM A;  3FKB A;  3FCV A;  3FBC A;  3BH6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...