1F73A

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii in complex with sialic acid alditol
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
288
Chain Sequence
b'MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL NEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 122
structure length 288
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f73A00
2QDGA 3C2OA 5CSSA 2QUTA 3W1TA 1OFOA 3C6CA 2XN1A 4IMDA 1VZWA 4NZJA 2VFDA 4NZFA 2ALDA 4JDYA 3W70A 3M41A 1R2RA 1SR9A 1Z48A 4FX8A 1WXJA 3MP3A 2HSAA 4UR7A 4BI7A 3RMJA 4E2DA 2ISSA 2CZEA 4ZQMA 5C5YA 1SU5A 3GDMA 2CU0A 1D3GA 3TFCA 3NQ6A 3STCA 4LV9A 5CZSA 3TROA 3BARA 2OMAA 3CEUA 2PURA 4UNKA 1R2TA 2F84A 2GVGA 4Z1BA 3T55A 4DELA 1KTBA 3S8HA 1H50A 4GNJA 3B4UA 4EF9A 3PF3A 1H7RA 4WY0F 2Y7DA 4JY9A 4CNOA 3PBYA 5DLCA 4NXKA 2EPHA 3GZ3A 5D05A 4GUJA 4JICA 5K4ZA 1WX0A 4GFSA 5AFDA 3C4UA 2P1FA 1PE1A 5LNRA 1JUKA 4ADTA 4O1BA 3I7QA 3L9CA 1C9DA 3EXSA 3NQFA 1TTQA 3DH7A 3D0CA 1O95A 4ZQNA 1DHPA 1SPQA 1XUZA 1SW3A 4PTNA 2OZ0A 4LWWA 6ALDA 5HR7A 5LSMA 4JXCA 3OVRA 3BGGA 4K38A 2V82A 1IXNA 2Q3OA 2Z6JA 2C3ZA 2R8WA 1TO3A 3GDLA 3MHUA 1FX6A 3NPXA 3IIOA 1CW2A 3W7KA 1H7PA 5C2XA 4O16A 1GT8A 4PEKA 5J5DA 5D37A 1H7XA 4PFMA 1WQ5A 1YADA 3TSBA 2W0UA 2YXGA 1VLWA 2ZZ5A 3G22A 2CLFA 3MUXA 4W9TA 5D2VA 3LDVA 4OV4A 3P81A 3BLEA 2G95A 2ZFAA 1PS9A 1QAPA 3W7HA 3LGEA 2YCEA 2QUVA 1CI1A 3O06A 3O8AA 3DAQA 5F2GA 2WNNA 1B4KA 2D73A 1BTMA 4N4PA 4CQ8A 3LCXA 4DBDA 1KW1A 3L0GA 3GK0A 5F4SA 5AC8A 3QFEA 3CU2A 3W7JA 2DJLA 3HG4A 1AK5A 4CLMA 3T7VA 4OBTA 3EWXA 4BI6A 1PHQA 3GR7A 4UFMA 1ADOA 1J4EA 1M6JA 1ZHAA 4DEFA 2ZA1A 2BWGA 3NPWA 4DXVA 2Y62A 3B8DA 1JRBA 1Q3NA 4FB7A 4FNPA 1DBTA 3PBWA 4O54A 4PCFA 5HR6A 4Z0JA 1OX6A 4O28A 1SUXA 4XUGA 3H53A 1MSSA 2H90A 4X22A 4ZQRA 2NXHA 4JTJA 4NVTA 3FKKA 4NJJA 2FPTA 2NV1A 3ZWSA 3HGRA 3I7SA 4IUOA 4IPIA 4N9BA 2A85A 1FCVA 4MFDA 4FNRA 3UXAA 4O1AA 1OJXA 3WJYA 1QPOA 1GOXA 1W31A 2NLIA 3W2LA 3G8EA 4GUGA 4P61A 4UTWA 4LRSA 4M7SA 5DCBA 3UXDA 3EWWA 1UJPA 3LBMA 3DI0A 1BWLA 4AVFA 4DPPA 3GR8A 4XZ9A 4OWGA 4QAIA 2DP3A 3L66A 3G0SA 4QISA 3G1HA 3QH2A 3OBKA 2Y70A 4FNSA 4JGDA 1C8VA 3FIGA 2RDUA 4UTUA 4FIRA 4LT9A 5D30A 1LOSA 3FFSA 3NXFA 4JX6A 4JTEA 2X1TA 2ATMA 2Z0IA 1G6CA 5AOUA 4HNVA 3KVLA 4C1KA 3W7IA 1EIXA 1B4EA 1GPWA 3HQ1A 3BW2A 5CZTA 3QW4B 3VE9A 1VPXA 4RKAA 4DF1A 2ZQ0A 3UWZA 1LBFA 1SO3A 3TAOA 3PR2A 2ZZ3A 2FB2A 4OT7A 1XBXA 4QM1A 1JCMP 4UCGA 3LCFA 4O50A 1KM0A 3NQ2A 3C2FA 5CGQA 3DFQA 4H3DA 4QIUA 3E9AA 3W7RA 4O13A 5AYYA 3KRSA 3KVJA 3JS3A 2WV8A 3L5AA 2QJIA 4N6FA 2C16A 1KTCA 2PC4A 4Y90A 3TUUA 2VFIA 1X8FA 4LOCA 2Q3RA 3PBUA 3EXTA 1TCDA 1TPB1 3GKFA 3W7LA 2WO5A 2GVJA 5ABTA 2J24A 2ISWA 3A9IA 4ZQPA 4WXZA 2NUWA 4BFAA 3FEMA 5BRBA 4WX2A 1FCQA 3FOKA 3CB8A 5H91A 4JTKA 2FQIA 1TTPA 4UTWC 1X7FA 2AAMA 1E51A 4P2VA 5FF2A 4NNCA 3O16A 3JR2A 3BK0A 3LHTA 2FLIA 1V7YA 3TJXA 3W1NA 5LGXA 4ORMA 5BW6A 1MXSA 1I4NA 1LROA 1JVNA 2GOUA 4AHQA 5E0KA 1PL9A 3HG2A 4JDBA 4YMZA 3NL2A 1F2JA 5CSRA 1SO4A 3LCHA 1G4EA 1LOQA 3L0KA 3E12A 3IGUA 1I45A 3HPXA 5AHIA 3F03K 1GG1A 3UZJA 4GUHA 2QF7A 3W7QA 2J27A 3H54A 2A0NA 2B7PA 3TKFA 1PVNA 1EP2A 4FNUA 3MI3A 2GQ8A 4QQ3A 1G69A 3NQEA 4L4MA 2VXNA 1GVQA 2CLHA 2C1HA 3N14A 3BLFA 2C0AA 2ZZ7A 5G2WA 3R8RA 2VEIA 4JTGA 1NVMA 3W1LA 3W7MA 3N73A 2NXIA 3G1DA 3A23A 1SFLA 2JBMA 1MEHA 4O53A 1R47A 5EY5A 3UWWA 1T0OA 3JRKA 4B5NA 2JK2A 3GXNA 2ZTJA 3EX3A 1XI3A 2YDAA 2EF9A 2HS6A 3IV3A 3TQ0A 3R13A 3MMTA 3C61A 2A4AA 1ICSA 3NQAA 2QUUA 3N3MA 3K30A 2CLMA 3B04A 1F76A 1Q6OA 1ICPA 2X16A 2QDHA 1BWKA 3O15A 5BOOA 3PB2A 1JCXA 2VENA 4JN6A 3TR2A 4ZL1A 3TMLA 3ZWTA 1MEWA 4NXSA 1F5ZA 1QFEA 3DXIA 3NA8A 2OCZA 1ZY9A 5GVJA 1F05A 2YW3A 4IXHA 4HN4A 4RX0A 3TAKA 3DZ1A 5D02A 1GVOA 2EHHA 1R30A 3OA3A 4AMAA 4UNLA 5U7SA 3G0UA 3MO7A 3W7GA 2QCCA 3KVMA 4AHOA 1FDYA 1EWDA 3W2NA 5CPLA 8TIMA 3CQ0A 1FQ0A 5DCDA 2B4GA 2E1DA 3GAYA 5LNWA 5KZMA 2QEZA 4MFEA 3SGUA 2H3BA 2RDTA 2AGKA 1DOSA 1W0MA 5DXYA 4JS3A 2Y89A 2EKCA 4I9AA 4UIOA 4YCOA 4LS2A 5AHLA 3FYPA 3RK8A 5D09A 3DFOA 2RFGA 1YTKA 4O4VA 5AHNA 1OYCA 1YXCA 1VYRA 1L2UA 1OFDA 3PM6A 1KLZA 1Z44A 1TQXA 2A6NA 2NZLA 4N9EA 3P8JA 2FPYA 4HIBA 3LOTA 4Y8FA 4JTUA 3TH6A 1I2PA 4Y9AA 2JKPA 4NX0A 4NJIA 2Y85A 2ATSA 5G4EA 4QITA 1AG1O 1JR1A 3NZ1A 1LBMA 5CKSA 5LKYA 2NX3A 4BWLA 3CLMA 5KSWA 2QAFA 3R2GA 1KLYA 5FEZA 5G4WA 2ZRXA 2BSLA 1KTNA 3UY7A 3PUDA 3RU6A 3LHYA 1MO0A 3TNOA 3TV8A 2PRMA 5J5RA 5K9CA 5EL1A 2B7NA 1Z41A 3OHIA 4JEQA 2CZDA 3NEVA 4K8EA 4KWWA 3NYZA 5KZDA 2E5BA 3NM1A 1P0NA 4M19A 1VJIA 1QO5A 4O18A 3DENA 4IMFA 3S5ZA 3GB6A 4Z1AA 1SSGA 1ZJIA 4RR4A 2V5BA 3M5ZA 3M5VA 1FWRA 1XBZA 4JIQA 3W7NA 4LRTA 2ZRVA 3W07A 3L65A 3NL3A 4MZ1A 4U4MA 5FF3A 3L5MA 2C14A 3QC3A 3GKAA 3EWYA 3RLUA 1WA3A 5CPOA 3TDFA 1K7XA 1RD5A 5TQLA 2OT1A 1K7EA 1YXDA 4IQLA 1LORA 1H7NA 5DXXA 2QCLA 2GQ9A 5IM51 2I14A 3E49A 3NPVA 1DKWA 4OQVA 5D2TA 4HKPA 4HPXA 3G1VA 1W3NA 3CT7A 4MUZA 3ANYA 3ABOA 5E1QA 3IIVA 3INPA 3W3OA 1G7UA 2B7OA 3EEGA 1I2QA 2XN2A 2GJLA 3G18A 3DFPA 2A7NA 3WJZA 5KITA 3Q2DA 1TPC1 1TYGA 3W7EA 1OFQA 4NJHA 3MJYA 2ZDRA 1LRTA 2RDWA 1VCGA 1Q45A 3NQVA 5HULA 2CLKA 3M1ZA 1VR6A 4BWLC 2WNZA 3PB0A 2VELA 3PUEA 1W56A 3TK7A 4XWUA 1QPNA 3WK1A 3G8RA 1VHNA 3BW4A 4M6VA 1IXOA 1LZOA 4UFLA 3VFLA 5I3JA 1H5YA 1H7WA 4E38A 5F1UA 5A5WA 3TFXA 2YR1A 5I3FA 4YXGA 2ZZ4A 1KM2A 4D2JA 3DGRA 4I7WA 2G97A 4K39A 1XDMA 4WOZA 3TX9A 4A3UA 5DY3A 2KZHA 5I3HA 3KRUA 1PV8A 3O6DA 4MOZA 2H3DA 3BG3A 4JX4A 1TQJA 1DORA 1MEIA 4MY9A 3M7WA 4ZQOA 3UWUA 1H1YA 1PCKA 1W8SA 3G1YA 3T4CA 3M9YA 3THQA 2WQPA 3EX1A 5AYXA 1GQNA 4HNTA 1OVDA 1EUAA 4AWUA 3WK2A 3ABSA 2E6AA 3PSVA 1YTDA 1VC4A 2Q8LA 5C54A 3W1RA 3GDKA 2BXVA 3N19B 4YWIA 5EMUA 4BI5A 3EX6A 1TREA 2RHGA 3M47A 1W54A 5HUOA 3BPWA 3NVTA 3W23A 4BF9A 1F6PA 2A7PA 2ZA3A 2V0TA 2H8ZA 1ML1A 3ABQA 1DJQA 5FEXA 4QJ1A 3LCGA 4R33A 4ZVJA 3C52A 2QCMA 4JNMA 4HPJA 3FJLA 4OHQA 3YPIA 1EX5A 1HUVA 3NG3A 3OVPA 4MYXA 5CG7A 4TU1A 4JYFA 1W3TA 1TPWA 1ZFJA 3GIYA 3F4WA 4MYAA 2NXGA 1H7OA 1LRQA 1QNVA 3IVUA 5DCEA 2VC6A 4MY8A 3BG9A 1R2SA 3FKRA 2DZUA 1OFAA 1L6YA 2QCNA 1KM1A 1YLVA 1FWWA 3NL6A 3KRZA 4PL2A 3M44A 4A29A 3W1MA 2JGYA 5EPDA 2GPTA 1P5BA 1WOBA 4RZ6A 3SZ8A 4K8HA 3MYOA 4K7YA 4HNNA 1W5MA 1XFBA 1JCNA 2YGYA 1GVRA 3P7YA 3STGA 3IGXA 1SZNA 3W2KA 3HGOA 4LNYA 3P5ZA 4R34A 1MZHA 1OYAA 1YDVA 2FJKA 1JCJA 3S1VA 4UTTA 3LCLA 1OABA 3P67A 5F2MA 4OE7A 5AHMA 2PE4A 2Y7EA 3BGJA 2ZRUA 3KXQA 4GJ1A 3WJWA 4RJEA 3BVJA 3PBVA 2ZZ2A 1THFD 1F6KA 3LRMA 3GNNA 4R7JA 3LCWA 5HINA 2W6RA 5LHFA 3L67A 1JUEA 1OX5A 4TO8A 1LRNA 3OG3A 2J88A 4MZYA 3VI2A 4JYEA 3PAJA 3BV4A 2TSYA 3TA6A 4LC8A 3W2JA 2ZZ1A 2CLEA 2X1UA 4AXKA 5G1TA 2FB3A 3TC7A 4NJKA 4RCXA 4NU7A 2GVLA 3E96A 3C8FA 3IVTA 3DHFA 2CFFA 1I2OA 2QCFA 1HG3A 3A21A 1K3UA 2V2CA 1Y0EA 3LBCA 3O1NA 2ISVA 4AWTA 3LTPA 2NUYA 3W75A 5LGZA 3LB0A 1T96A 3MWAA 1DVJA 4FX6M 4JY8A 4MJMA 3W22A 3S6DA 3KX6A 3VKJA 5KMYA 3TXVA 5F2IA 5HMSA 5AN7A 1KBIA 1NSJA 4Z0SA 1TPEA 3LV6A 2CWNA 3DFSA 3GXTA 3VCRA 5LNSA 3B06A 3SIZA 2C13A 3U8GA 2PRHA 3N9SA 2Z6IA 3NZRA 3P84A 3W2UA 4WXYA 3EKLA 3S1WA 2CZFA 4UTTC 2DJXA 3NQ8A 3A22A 4YL2A 1OFBA 4IX0A 3DHDA 2WSYA 3RF9A 3W7PA 3RLVA 4FF7A 1X1ZA 3Q94A 1A5SA 1KV5A 4A2RA 1TRIA 5IBXA 4IXXA 2Y63A 5K7JA 5D2XA 4DO4A 4EF8A 3NQCA 3L21A 3G3MA 2NWRA 3W85A 2CZ5A 1A53A 4UFHA 3M5YA 2ZBTA 1JQVA 3UQNA 1XBVA 5FEPA 1TJPA 4GC4A 4HSOA 3R5EA 1EUNA 4O14A 2X1RA 3GDRA 5C6MA 3RFAA 3P8IA 1F74A 1ME8A 4ADSA 1VCVA 4UTJA 5CZJA 2NV2A 1ALDA 4N9DA 1LYXA 3P5YA 3W86A 3M43A 1AW1A 1GG0A 1OFRA 1VLIA 3THAA 1GTHA 3W6YA 3G3DA 1OX4A 1UASA 2JGQA 3P62A 2YPIA 2E5CA 5EA9A 3W9ZA 4EOUA 3B05A 5KZEA 2VFEA 2WNQA 4GBUA 5D38A 3A5FA 4XTDA 4S1FA 1LDCA 1KFKA 2GJNA 4JTTA 4UMCA 1RR2A 3S42A 3O6YX 4LV4A 1O94A 2B7QA 4NUWA 3IIZA 4XQ6A 2YYUA 1NEYA 3GAKA 2OX1A 1SQ7A 2VFFA 3SR7A 2JKAA 1KFEA 1IXQA 3A5VA 2DZTA 4NNBA 1QPQA 3MI2A 1A50A 2QKFA 2ZCGA 3QQ1A 1FWSA 1TV8A 3DBPA 4PH6A 3QYQA 3EX4A 1LCOA 4GWEA 5AB3A 5HJLA 3B0PA 3U2OA 3L5LA 3QMTA 4DPQA 4C1LA 1GVFA 4Q33A 4KKXA 3NGJA 2FDSA 4MPQA 5IBXC 1SO6A 3T40A 4UMBA 2EAWA 3QSRA 2CW6A 3S5NA 2ZRYA 2ABBA 3W1UA 1SW0A 2OJPA 2TPSA 3HPZA 1EEPA 1N8FA 1VHCA 4E2BA 4N4QA 5DELA 4HHPA 1RZMA 5CPMA 4O11A 4N9CA 4O19A 4LVBA 3TU9A 1O60A 2BLEA 2Y61A 2J9XA 4JTHA 4AHPA 1PHWA 1XCFA 1LBLA 4LC6A 3TQKA 2FTPA 1UB3A 1JCYA 4UFKA 1SW7A 5AHEA 1FXQA 1W5NA 5K4XA 3EWZA 1Q6RA 3VE7A 1QOQA 1I8JA 2CLIA 2V2DA 1V5XA 3LCIA 5BMWA 3W1AA 2P10A 3I7RA 3CWOX 4GE8A 2CLLA 3P80A 2RKXA 3QMRA 1GZGA 2TMDA 4CQAA 3QJAA 5K9XA 2ABAA 3GYEA 3HJZA 1NF7A 2PRLA 1TPFA 3G1AA 5AC7A 2DU2A 3S9YA 4FO4A 3I65A 1G4SA 1RQEA 4GXMA 1WBJA 1TMHA 2TRSA 3PG9A 2V9DA 2QCEA 4HNUA 5KINA 3GXPA 1OK6A 1H1ZA 3PY2A 4O0KA 3SFKA 5H2ZA 3LXCA 1DL3A 4FX7A 4PODA 1XKYA 1ICQA 1PCWA 1W37A 3KFTA 3C0JA 5L6UA 1H62A 1Q6LA 1FDZA 1QR7A 3C3NA 4XTIA 3ZS4A 3LHWA 3BG5A 5FESA 2I9EA 2YSWA 1W5OA 3UWVA 3KVKA 1ZCOA 1A5BA 1YDOA 2E68A 1JJKA 1I2RA 1XL9A 1QDSA 2RH9A 4WY0A 3UPBA 4IX2A 1KFBA 1R46A 3L2IA 1ZNNA 4JTIA 3TJLA 3NQ7A 2P0OA 1DJNA 3W7CA 4JYDA 3LLFA 2WPBA 2YFOA 3NQMA 2NWSA 1YXYA 1XUUA 1G7VA 3NNTA 2J9YA 3TIMA 3MI6A 1K7FA 1RV8A 3MP5A 1LLZA 3OIXA 3QMSA 4FXSA 2YFNA 1G67A 1KBJA 5FEWA 3M5XA 4IMEA 3O63A 1LM1A 4AF0A 3CHVA 5D2WA 3PC0A 2NX9A 2DZXA 1ONRA 2YZRA 3EWUA 4UC5A 4PL1A 2XFWA 5K2ZA 3Q37A 4BR1A 1JUBA 1VRDA 5FF7A 4LVAA 1K8ZA 1S5WA 1FDJA 2H8XA 1O5KA 2J9ZA 4K37A 4LW7A 3LRKA 3GNDA 3W1PA 3UZ5A 1H51A 3NOEA 4L4LA 1N7KA 3NQGA 3N2XA 2B0MA 3MYPA 2QCGA 3SJ3A 4ML9A 3W73A 1FCBA 1WDWA 4QNWA 2R94A 5EYWA 3PULA 3LHUA 5AYZA 4LUJA 4MVAA 1TPDA 4KWVA 5E93A 2A5HA 1CX9A 2A21A 4LS0A 3V75A 1EWEA 2Y88A 4UTHA 5KTLA 3SI9A 3G1SA 1FCUA 1H63A 3T78A 3B03A 3OVQA 4I7UA 4Q4KA 3QF0A 4UMAA 3QZEA 1OHLA 3CIWA 4BK9A 1YTEA 3PG8A 1S5VA 3HO8A 1KFCA 1XC4A 3ELFA 4H4IA 4S2CA 4LY8A 5LZLA 4ORIA 3NAVA 3F1QA 4RXFA 2VFHA 1GEQA 4K7VA 4WQ6A 4O57A 4LTSA 1LOLA 4NNAA 4POCA 4S2BA 1VH7A 1QPRA 1W3IA 3UWYA 1QMLA 3AJXA 3MP4A 4TX9A 3W71A 3MBFA 1ZAIA 1C29A 3HG5A 3SSJA 3W88A 3LTYA 4UTMA 2R91A 4UTLA 1SSDA 3E0IA 4AB4A 1O4UA 5L9FA 3DKJA 3FLUA 3DKLA 4O17A 3HMJG 3NO5A 2AQWA 1UUMA 1IXPA 1FY6A 1VYPX 3S5YA 1J2WA 1TTJA 2HTMA 1EP3A 4O8RA 1QO2A 2C18A 5AHFA 3KAOA 1XM3A 3LLDA 3M6YA 1SZFA 3L68A 3T44A 4HT3A 3VNDA 1DQXA 2ZTKA 5TIMA 1OG0A 4XKYA 5A8GA 3STFA 1A5AA 1NAL1 3QRHA 4PA8A 3NL5A 4QSHA 4RZ4A 3GLCA 2A7RA 4M7TA 1LLWA 5HNRA 4IMCA 4CCCA 4DF0A 1YDNA 4KFNA 5C55A 4M6QA 5D33A 2FPVA 3M16A 1OX4B 1T99A 2GQAA 2PCQA 4N02A 5BMXA 3TXZA 1TPVA 2DZSA 2E6YA 3NDOA 4N2YA 3LM7A 4RZ5A 1M5WA 5D32A 1GWJA 2FFCA 1WAUA 1FWNA 3W84A 1RVGA 2YW4A 2E77A 3N9RA 3W74A 4Q32A 1B3OA 4TMCA 1TIMA 4WJEA 3EKZA 1YPIA 1YYAA 3IRDA 1IF2A 3LERA 4I7VA 1TPH1 2R14A 3LRLA 3STEA 1WYIA 4DO6A 1K8YA 3WJSA 1FBAA 1TV5A 4YLWA 4E0CA 2IQTA 4Y6GA 1QWGA 4O1CA 1LP6A 5CZ0A 4FIQA 1KFLA 3ZR4A 4DF2A 5HWMA 3IIPA 3QEZA 1GVSA 5D04C 1VCFA 3BLIA 1H60A 3P61A 4NQ1A 1KFJA 1KM4A 3MHGA 1XDLA 1JCLA 5G2IA 3IIXA 1HO4A 3BW3A 4TIMA 3FJ6A 1G4PA 3W1QA 1AL8A 3Q58A 1OFPA 1EA0A 1GYNA 5MHBA 1U5JA 4CNNA 3W7OA 4FHAA 2NUXA 4UUIA 3TSMA 1K03A 1EP1A 1P1XA 2C19A 2JKEA 1B9BA 2XN0A 3HOJA 4OGZA 4A2SA 4LVFA 4MJZA 4WZHA 3S1UA 3CIXA 3G1XA 1G4TA 1TV7A 5DN1A 1SZGA 1P0KA 2A6LA 3E02A 3V1PA 1FXPA 1EPXA 4LVDA 4K36A 4RLIA 3C56A 1SO5A 1DV7A 2E09A 3LHVA 2CLOA 3C2EA 4K6AA 3LHZA 4G1KA 3C2VA 2QCDA 3SY5A 2BZNA 4UXDA 4OV9A 1Z42A 1IGSA 4O0ZA 2WSQA 3FYOA 3CM4A 2A1YA 2DZVA 4MIMA 5SWUA 5DBUA 3N2MA 3TCEA 1EB3A 2ZRWA 4M5PA 4A21A 1W5PA 2C15A 5EKYA 2GUUA 1HTIA 1ZAHA 1TSIA 4YCPA 3GDTA 1NF0A 2V81A 4A22A 1HO1A 1ZALA 3LXAA 1AW2A 5FF0A 3SGZA 5T26A 3W72A 4ZMGA 3DFNA 5BNKA 2X30A 4WY0B 2Q8ZA 5G1YA 2YYTA 4FEZA 4R53A 3SW6A 1D3HA 4O1DA 4CCEA 1HL2A 2VOMA 1TRDA 5K3VA 4MKNA 3MW7A 1T8XA 2C6QA 1Q6QA 3QQ0A 2ZYFA 1FUYA 1UCWA 4MLJA 2WJZA 2A2IA 4AWSA 3UPWA 3PUOA 1DQWA 4ZQCA 3FA5A 3O05A 3PWAA 4DQWA 1U83A 3IVSA 3HG3A 2QJGA 1L6SA 3NPUA 5F2LA 4AF0B 4FXRA 1BKSA 4MLRA 4RV8A 1XBYA 3M0ZA 3W7DA 1H61A 4AH7A 3LV5A 1L9WA 4HSNA 4JTLA 3O07A 1OK4A 4OU1A 4O15A 4RXGA 3LXBA 4UFJA 2G5WA 2V2HA 1OF8A 5I3KA 1TTIA 5D03A 2VKZG 5G2HA 4X3ZA 3W83A 3B0UX 3P60A 3WJXA 1J5TA 4GRSA 1KV8A 1TPUA 1K8XA 4UR8A 4O4WA 4MZ8A 3G0XA 5I3IA 2DORA 5HUPA 4N6EA 2ZZ6A 1FWTA 3LX9A 1NFBA 3QPYA 3UNDA 3UYCA 4DBEA 3HPSA 3EXRA 4MY1A 2DZPA 1TJRA 3CPRA 2V8ZA 3EB2A 3W1XA 4JD4A 1RQHA 3EX2A 2Y6ZA 3R12A 5HWJA 3ATZA 2QR6A 2F7FA 3HGSA 4X9SA 2E5DA 3PVFA 3PSWA 3QW3A 2BTMA 2Y7GA 3U6WA 2VEPA 4GUIA 4JR5A 2E6DA 2DZWA 7TIMA 5LHEA 3S0CA 5I3GA 5D2YA 3CTLA 5EBUA 4IWWA 2YX0A 4IOTA 3G1FA 4PC8A 3UD6A 1VYSX 3W2MA 1VGAA 1OYBA 5K9DA 5FI8A 4Z08A 3L0NA 4XBSA 4LUIA 2VEKA 2ZA2A 1UBSA 1GYLA 1OFEA 1GJPA 2X1SA 3NM3A 2V5LA 1SZEA 4LVGA 3LTSA 1ZAJA 3LI0A 1B57A 1IIGA 3G24A 3TW6A 4FNTA 4JTFA 3OEXA 4AEOA 4XKYB 3HB9A 2VFGA 3USBA 1VQTA 5F4WA 4EIVA 3DU0A 3H55A 4O10A 3IGSA 2BX7A 1KA9F 3I68A 5HWNA 4NX5A 3AO0A 1LTDA 2NX1A 6TIMA 1HFBA 3TMQA 4AAJA 3MHFA 1JQXA 4WD0A 1F73A 5U4NA 3BO9A 1WBHA 1PIIA 2V30A 3LI1A 4J9JA 1I2NA 4Z1CA 1WV2A 1D9EA 4WOQA 3CWNA 4ICNA 3IEBA 2WKJA 1GTEA 2W79A 3QSTA 1K02A 2FIQA 3N34A 1SFJA 4UTKA 5DBTA 3DFTA 3ATYA 4IJBA 4X2RA 3A24A 4IPJA 3P74A 5TBOA 5G5IA 3S5OA 4FNQA 4TMBA 4Y96A 4IGHA 3CC1A 3QPZA 3W87A 3KHJA 3TC6A 2WSRA 3HBLA 5LNUA 1O5XA 2TYSA 1AW5A 2E6FA 4CQ9A 1AL7A 3WFAA 2I1OA 1A5CA 3NR0A 5LNVA 4XBKA 1RPXA 3UY8A 4UTIA 2Z2UA 2WOQA 1ME7A 1VS1A 2LLEA 1ME9A 3R89A 1QCWA 1AMKA 4JX5A 3S1XA 3TE9A 3WK0A 1UUOA 1XXXA 3TSDA 3I6RA 1IIHA 4ONVA 2X2GA 4KFOA 5F1VA 4TR9A 1JULA 3PS7A 4EVZA 1TB3A 5AC6A 1WOAA 2J6XA 3HF3A 3EWBX 1X1OA 4JIPA 2OT0A 3HIJA 4QNEA 4O52A 3GVGA 4CNPA 2QAPA 1KM5A 4ZZ9A 4RK8A 4Z1DA 2O7SA 1S5TA 4LS1A 5F4XA 4EWND 1ZENA 3O6CA 1KM6A 1M7PA 2VEMA 3NQDA 3DI1A 5HQEA 4O12A 1RQBA 1W5QA 5CPNA 4ADUA 2H6RA 2HS8A 3P82A 3UWQA 3ZFHA 1QOPA 3ABRA 2Z1BA 3FS2A 2ZRZA 5DY2A 1F7BA 2QJHA 3KOFA 4IMGA 4WUIA 2UV8G 3TQVA 3C2RA 4M6PA 4H6KA 4JTSA 4KFPA 3GX9A 1N55A 3W76A 1YPFA 2QCDB 3B0VC 1S3HA 3TW7A 1W1ZA 2Y7FA 3F4NA 3SECA 5FF4A 1P4CA 4NT0A 3WK3A 4CCDA 1BEUA 3HGJA 1KM3A 4NJGA 1X6UA 3RNDA 1JRCA 2QCHA 3QM3A 4DO5A 2HMCA 4GUFA 2O7QA 2G96A 1OF6A 3CEPA 3MBDA 1L6WA 4U28A 4ALDA 4LU0A 2EGZA 1M7OA 4UFIA
chains in the Genus database with same CATH superfamily
2Y1HA 4AWEA 3Q65A 4ZA0A 4CU7A 1VZWA 4NZJA 1TWIA 1WXJA 1PSCA 1OSEA 4UR7A 4ZQMA 1JXKA 4IQJA 2P8CA 4RNJA 4F9DA 3DYOA 4ZO7A 1KB3A 3GU2A 3A4WA 5CC3A 3E0VA 4PE8A 3OZMA 3CEUA 2PURA 2GVGA 4J3WA 4DELA 1E4NA 2F8QA 4IG2A 4AIBA 3AICA 3WCZA 2WVUA 1H7RA 3ZT7A 1JD9A 4JY9A 4JIHA 5DLCA 4J27A 2EPHA 4GUJA 1VB9A 3GUGA 2NVAA 4JQ3A 1JG9A 3C4UA 1AH4A 3RG6A 1QTWA 2IXUA 3JUGA 1DJIA 4M80A 3BOFA 4NHVA 4O1BA 1GNXA 3KCJA 4UQDA 2F6XA 4ZOBA 4QG8A 4XD4A 5BRPA 5E70A 1CXLA 1R3SA 6ALDA 2VR5A 2VC5A 3ARWA 4XO7A 3OVRA 4TVCA 1QK2A 1PDYA 3ARQA 3GDLA 2XVGA 3IIOA 1EBGA 1UP3A 1CW2A 3W7KA 1H7PA 4LALA 2ISDA 3REQA 4HYRA 2OYLA 2HE8A 1CECA 1H7XA 4NL1A 3AYSA 3GXMA 1N8WA 1YADA 3TSBA 4XZIA 3ITCA 2YXGA 3VM7A 4S38A 3FJNA 1O66A 4OV4A 3BLEA 3THDA 2X41A 1G94A 5F2GA 4N4PA 4CQ8A 1RHCA 4UQ9A 2O55A 3LCXA 1UR3M 4DBDA 4LH8A 3QFEA 3KOYA 1UZ1A 1AK5A 3T7VA 4OBTA 4BI6A 1PHQA 1PTAA 1ADOA 1HJWA 4DEFA 4MNLA 3TR9A 2ZA1A 4GY7A 4RL3A 4DXVA 3ARUA 1W9PA 3ZJ8A 3B8DA 1Q3NA 4FNPA 4U3AA 4W85A 3PFMA 1U5HA 1VFFA 4O28A 3O6AA 4XUGA 2BGSA 2C71A 1Q6CA 5E6ZA 2NXHA 3PJXA 2YL5A 2IMRA 3GXFA 1NY1A 3HV9A 3I7SA 5A2BA 4IPIA 4N9BA 2A85A 4MFDA 4FNRA 1XGDA 1OJXA 1PIFA 1ISVA 1XCXA 3NJ3A 2PEVA 2NLIA 3EDEA 4UTWA 3L7RA 2EEXA 4IIGA 4PCNA 5DCBA 3KBSA 1UD8A 1UJPA 4YVPA 1HZYA 5D8WA 1QNPA 3GR8A 4FLRA 3VXGA 4QAIA 3H22A 3KL3A 1KC7A 2DP3A 2XYLA 4QISA 3VOCA 1NOUA 1WAWA 1E1FA 2J66A 2RDUA 3W0KA 5D30A 2VGIA 2X1TA 4IGMA 3GRIA 4AD4A 1PZ0A 3KVLA 3CV1A 3QKZA 1PO9A 3HJEA 3PWIA 4WF7A 2PDGA 2VURA 3CT2A 1A3WA 1GPWA 3HQ1A 5CZTA 3QW4B 3ABXA 5DMYA 9XIAA 2ZQ0A 2QULA 4LEFA 5HDRA 1WP6A 3F7JA 4YYFA 4UQEA 1XBXA 4HYWA 1BQCA 2CYGA 3CQIA 1P7TA 1V08A 5CGQA 2XUCA 4O13A 5AYYA 4XVDA 3KVJA 3L5AA 4N6FA 1TV4A 3ICJA 1KTCA 4GABA 2V67A 3PBUA 1TCDA 1TPB1 1XRFA 4QJ4B 2WO5A 4X2PA 3SCOA 4ZE4A 2L5HA 1DIDA 3ARSA 1X7FA 1NJJA 3ZT5A 5BU9A 4P2VA 4IPLA 3L4VA 3CAQA 1VFHA 1V7YA 1E4LA 1GCYA 1I4NA 1E55A 1JVNA 3T8LA 1PL9A 1F2JA 3WSUA 3BSGA 3WUFA 5AHIA 3WH7A 2XSBA 3UZJA 4GUHA 3UGVA 3VK5A 2IKHA 1IHIA 3M46A 4KEVA 1ODZA 3H54A 3TKFA 3FEQA 1K9DA 1EDGA 2OWWA 4KRZA 4NILA 3H2OA 4QQ3A 3NQEA 3BLDA 5JIWA 7REQA 4L6DA 1S46A 2HK0A 3VX1A 2O9PA 4JNYA 5G2WA 1ZRQA 3RCYA 2F2HA 3AMCA 3G1DA 1MEHA 1Z32X 3UWWA 1T0OA 3IK4A 4MDOA 1XI3A 4QXIA 4AZ7A 4GIEA 3C0LA 2OELA 3TQ0A 1ICSA 1DXIA 2QUUA 2CLMA 3B04A 1Q6OA 4E3VA 4IHCA 2QDHA 1BWKA 2QXWA 2VENA 1UQYA 5GPRA 3TYEA 3TMLA 4DBWA 2ZADA 4M24A 3JW7A 4NXSA 3DXIA 4W7WA 2PDQA 2YW3A 3BCFA 3RO6A 1TELA 3KP0A 1TR1A 2QCCA 3KDOA 2BY1A 1FDYA 2OG9A 5CPLA 3ZJ7A 3LUTA 2B4GA 3GAYA 5LNWA 3GUWA 5DXYA 4JS3A 4KMQA 2CETA 4I9AA 3B97A 3FYPA 1W1A1 4KS0A 1S3TC 2UY3A 4OBRA 3CJPA 1OFDA 1IEVA 1KLZA 4HIBA 1PDZA 2HK1A 4NI3A 1K9FA 4M56A 3BAKA 4G8TA 4Q8MA 4TVDA 1JF6A 4NX0A 3WYZA 2ATSA 1DJYA 3E0FA 1JR1A 1NOWA 4OUEA 1NP2A 3L4YA 5LKYA 4H7ZA 5JQ9A 2QAFA 3VNLA 4PMUA 5G4WA 2ZRXA 1KTNA 1TVPA 1EJTC 2ZKMX 3T0DA 4UOQA 3RU6A 3OLIA 2VC7A 4N7QA 1MO0A 3UVAA 4L1GA 5GNZA 1B3XA 4M19A 1MUWA 1VJIA 3S5ZA 3GB6A 1SSGA 2W67A 3WENA 4PUNA 2GYIA 4JFVA 1W3HA 3IJ7A 1JAEA 2GZXA 3W7NA 2D20A 4LRTA 1U1UA 2X8RA 3JVAA 4GI6A 5C2CA 2ZRVA 4W7VA 5FF3A 3L5MA 2C14A 5TD4A 5CPOA 3TDFA 1L6GA 1PZ1A 4NYYA 1K7EA 1YXDA 4IGSA 1LORA 4Q7IA 5DXXA 2QCLA 4J3ZA 3E3HA 4MAVA 4HPXA 3G1VA 4A8IA 1BYBA 4AEFA 3VIKA 3L12A 5E1QA 1G7UA 1G0CA 1S2AA 3UXIA 1TWSA 3STPA 3AQUA 3L2MA 3G18A 2NQ9A 3PNZA 3L4ZA 3KCLA 2A7NA 4HMEA 4S3KA 1E5JA 3Q2DA 3K8LA 1TYGA 4V15A 4OKDA 2GDVA 1OFQA 2W66A 5MF5A 1E0UA 1XFCA 4CCZA 4H19A 3AC0A 4BWLC 3M1ZA 1VR6A 3PB0A 1E6SM 5EGRA 3WZ0E 1W56A 4XWUA 3OIHA 3PZMA 3WK1A 1VHNA 5I3JA 8XIAA 5A5WA 1CIUA 1JFXA 1VEPA 4ZTXA 4UNIA 4XD3A 3LD5A 4MB3A 1LL4A 4YXGA 1RJPA 3MT1A 2G97A 1XDMA 4C7DA 5DY3A 2WZMA 3V18A 2Z4GA 1PV8A 4DAFA 4QJ3B 3SEPA 2H3DA 5IFTA 3TJ4A 1XV8A 1MEIA 4MY9A 3M7WA 1WKDA 5FACA 3TQPA 4KQNA 2PS2A 1H1YA 3PTKA 4DXKA 1A3XA 4V27A 3G1YA 1UR1A 3FYYA 3GU1A 4KWOA 1A0DA 1EUAA 1MRAA 3ABSA 1YTDA 3WD2A 4G2DA 4CNUA 3PPHA 5C54A 1Z9AA 2FMOA 3N19B 2I17A 5EMUA 3K4WA 4XVEA 3WUEA 1HQTA 5HUOA 3NVTA 4BF9A 2A7PA 2J8GA 3ZLHA 4HA0A 4CGTA 3ABQA 1DJQA 1V3IA 4QJ1A 3BWWA 1IEXA 4ZB0A 4XKMA 2VJXA 2NW0A 1W3TA 3QOKA 3ANUA 4BQ2A 4QS6A 3VYLA 1LRQA 1U22A 1QNVA 1XYBA 2VC6A 4LANA 1UR0A 4S3JA 4I8DA 1FH8A 3CYVA 3TYDA 1YLVA 2WMFA 1KFWA 4PL2A 3AS3A 3PPFA 4GCXA 3DHUA 4A29A 2GPTA 5JU6A 3SURA 3SZ8A 4KGLA 2XSAA 1JL8A 4K7YA 3STGA 1XFBA 1LL6A 1QVBA 1SZNA 3OGSA 3HGOA 4HOXA 4LNYA 3P5ZA 1OYAA 3RJYA 4E3TA 4OE7A 4F66A 2ZRUA 3KXQA 3VD5A 2WSPA 3DX5A 4RJEA 3BVJA 2FFIA 3LRMA 3GNNA 3S6OA 3GO2A 1AQFA 1DXEA 3UXLA 2VCAA 4GKTA 2EG7A 4Y8EA 4DJEA 1VBJA 1JUEA 1V0LA 4TO8A 4JYEA 1XQLA 1LWHA 1BSLA 1NWTA 1WKEA 3WH8A 4GY0A 5ABHA 4MMWA 1XLBA 3TC7A 4FXFA 4NJKA 1LG2A 4Q7BA 1VD6A 4HK5A 1UWSA 1CB7B 2ZUVA 2QCFA 5KEZA 2GVEA 3LTPA 3E2RA 4Z1YA 3QV7A 1ZPTA 4FX6M 3DCPA 1GHRA 1W91A 3I10A 4JBRA 4FP1A 2D3NA 3O9NA 4GNVA 3TXVA 3M07A 5F2IA 1UROA 1MXDA 4CUCA 2DQXA 1JD7A 4Z0SA 1TPEA 1BGGA 1ZBCA 4F2UA 3DFSA 3GWQA 5CXPA 1B5TA 5LIXX 3NOYA 3B06A 2ACRA 4WKFA 3NFUA 2Z6IA 2XWEA 4H6EA 3MTWA 3W2UA 3UR8A 4KT2A 2R6OA 3MKKA 2CKSA 3S1WA 1EJWC 1OFBA 4YL2A 4FF7A 3GXDA 1A5SA 4OECA 1TRIA 5IBXA 4R88A 5K7JA 1JYVA 3VDBA 3SY8A 4PTXA 4DO4A 4EF8A 3BQ6A 5H8MA 1QW8A 4GQQA 3DERA 3A4XA 3G3MA 4FOUA 3W85A 4UFHA 1A3HA 3A13A 1TJPA 2ZX9A 4HP5A 4O14A 3GDRA 5HAOA 3AYTA 5C6MA 1CLKA 2GGEA 1XGEA 1OZMA 1VCVA 3C3UA 3QN3A 1V7AA 3PZOA 2PTDA 4HPNA 3GSMA 1IT0A 3W86A 1F3EA 2PDBA 1GG0A 1OFRA 4PUWA 3W6YA 4Q4SA 1OX4A 2ACSA 4ZB2A 3P62A 5EA9A 1Q2SA 3B05A 3T2QA 2WNQA 3RPMA 5D38A 4XTDA 2DH2A 2GJNA 1RR2A 2ODOA 3S42A 4LV4A 2B7QA 4NUWA 4XQ6A 2YYUA 1NEYA 4F0LA 2PGEA 3SR7A 2F38A 2JKAA 1KFEA 3A5VA 4FA3A 4NNBA 3FHQA 1MW2A 1TVNA 3MI2A 3AHTA 3BZGA 3VNIA 5AYBA 3SRKA 2ZCGA 1TV8A 4PH6A 1AMYA 1LCOA 1L8PA 5HJLA 1OCQA 3QMTA 2J8FA 2Z1SA 4Q33A 4KKXA 5CGTA 3NGJA 3THCA 4PSPA 3GC5A 1MYRA 2EAWA 3U2ZA 2CW6A 4ZFCA 4UOZA 1BGAA 5HANA 1UH4A 3W1UA 1SW0A 1VRXA 5A2AA 1KGUA 3L2LA 4RDVA 1ISXA 3WKZA 2QQ6A 1VHCA 3V0SA 3MZNA 4N4QA 2JALA 1FHLA 4PMQA 3I6TA 2VNCA 1R3YA 2J9XA 3AISA 1PHWA 1LBLA 2X7VA 4ZOEA 4LC6A 3QV9A 3CAWA 1UB3A 1JCYA 1ZP4A 1QOXA 1SW7A 4B5VA 2I16A 1MW0A 2F9RA 4K3ZA 3S83A 1Q6RA 4M29A 1A49A 1QOQA 4HYVA 1I8JA 4P8UA 5LA0A 3B8WA 3LCIA 3PNUA 5BMWA 2P10A 4YIWA 2CLLA 2RKXA 3VKAA 2CXGA 1PZ3A 2OX4A 5K9XA 3KDNA 4W8LA 1K9EA 3AU6A 1DTUA 2PRLA 4ERIA 3G1AA 2NQHA 1UP0A 1VPYA 3I65A 4H00A 1TMHA 3MWCA 3PG9A 2V9DA 2PCEA 1VF8A 3T4WA 1UA3A 3LY0A 4JKKA 1XYLA 3PY2A 5H2ZA 1JGMA 4FX7A 2PDNA 4B2DA 2OYKA 2IQDA 2HNHA 2VZUA 6XIMA 2WANA 3KFTA 1Q6LA 4ZE5A 3LHWA 2Z27A 5ABFB 2YSWA 4IFRA 3MY9A 3PJWA 5FJPA 1JJKA 1M03A 1I2RA 1XL9A 2RH9A 3BLLA 3ZO9A 3GH5A 1R46A 4DJDD 1DWHM 3TJLA 4CQDA 3NQ7A 4GYPA 1DJNA 4NAFB 1XUUA 1G7VA 3ZR5A 3TN3A 3CZJA 3PTDA 1K7FA 2ACUA 2BXYA 3N25A 1NWSA 2PDXA 1EDTA 2X42A 3M5XA 4IMEA 1Q65A 1WE5A 5PTDA 4AF0A 5CLTA 2VP8A 5D2WA 1H4PA 1VPQA 3SRDA 3EWUA 4PL1A 1VRDA 4U5KA 2GJPA 3VMNA 1KRMA 1O5KA 1VIWA 1HJQA 2QZRA 1O12A 2WJFA 2ZX6A 3LM3A 3LRKA 4W7UA 1V4YA 3M0VA 3UZ5A 1H51A 3NOEA 4C6NA 2PDUA 2W4XA 3NQGA 1W9BM 3N2XA 3AU2A 4M1BA 2B0MA 1M53A 3GNXA 2BB0A 1FCBA 4BF7A 5AYZA 4I3GA 2OB3A 3DFHA 1X96A 4KWVA 4NRSA 5E93A 5KTLA 3NURA 1H63A 1TG7A 2HWGA 4FLOA 3T78A 3QF0A 1EYEA 3L4XA 3WEZA 1MWOA 2PDMA 5CJ5A 1VFLA 2WVSA 4HSHA 2VFHA 1GEQA 4O57A 1ONEA 4JEJA 1YNQA 3BDKA 3MP4A 3MBFA 2HVOA 5I3DA 4AC1X 3HG5A 2NQLA 3SSJA 4NRRA 1OC5A 2VD9A 2D2JA 4REQB 4IIDA 4MNJA 1XLAA 2GGJA 4O17A 4U33A 3NO5A 3KW3A 3FHAA 1IXPA 4ZO9A 3CGTA 1RBLA 4O8RA 3KAOA 1XM3A 3M6YA 5HPCA 1SZFA 4HT3A 1TX0A 1V79A 1OG0A 2WSKA 1NAL1 4PA8A 4JHZA 4UWMA 4RZ4A 5I78A 4PUJA 5IRPA 4M7TA 4CVWA 1LLWA 2IPFA 3VNKA 1RUSA 2G3JA 4BY3A 2G3IA 4LUTA 5C55A 2DSKA 2WMIB 3M16A 3BGAA 4Q4QA 3H2EA 2Q02A 4N02A 3UZXA 1LQAA 2O92A 1A4MA 4B5TA 3NDOA 4N2YA 1ZBVA 1M5WA 2DT0A 5D32A 1GWJA 2Z24A 3URAA 3MMWA 5D4YA 4GBDA 1XD1A 3W74A 2G37A 4Q32A 3T2OA 1B3OA 1TIMA 4I7VA 2VT0A 3VPLA 4YLWA 4E0CA 4CKQA 2Q71A 5CZ0A 5HATA 4QFUA 5EU9A 4E4FA 3ZR4A 5HWMA 5I06A 2YL8A 2YXOA 3QEZA 4ROQA 3DGBA 3DN5A 3V1HA 4UTFA 2J79A 3QZAA 3P61A 3A3XA 1KFJA 3SQLA 1SJCA 3TTSA 1CLVA 4MWAB 1VFUA 1HO4A 3FJ6A 1G4PA 3H4WA 1D7FA 2ZC1A 2AL2A 3CUGA 3Q58A 1OFPA 2VZVA 3ZVIA 1EA0A 3AAMA 1U5JA 4XUYA 3W24A 4FHAA 4HU4A 4WVXA 3QY6A 4UUIA 4O1EA 1RK5A 1EJRC 3MQTA 5KZ6A 3TSMA 1SFSA 3USZA 3WQ6A 2JKEA 2CC0A 3B9OA 4IUGA 3CS2A 3EPNA 4MJZA 5LXXA 3CIXA 3G1XA 1G4TA 1RD6A 4OUIA 1VFSA 3E02A 4B92A 1E6QM 4RW5A 4LVDA 1UOKA 1UJQA 3C56A 4INFA 2E09A 3VD3A 4A8LA 4MNKA 3SQSA 2CLOA 4LUSB 2J7CA 3C2VA 3CHEA 1UC5A 2Z25A 1Z42A 1PYFA 4O0ZA 1FWAC 2YLLA 3AMGA 4C7FA 3OU8A 3BCDA 3VX0A 1YEYA 5A8PA 1EEXA 4LYQA 4F8XA 2A1YA 2DZVA 3N2MA 4M5PA 4GXWA 2OR2A 3WLHA 4GZEA 1EPVA 2GUUA 1ZAHA 3OYXA 4A22A 1HO1A 1AW2A 3LSBA 1E4IA 3MVIA 1NFGA 4DUWA 1HKKA 1OQFA 5B80A 2WMHA 4XO6A 3DFNA 3WNNA 3MUY1 4R53A 3BUVA 1HL2A 1XPGA 5K3VA 2AMGA 1BVZA 4X61A 3BANA 4YTSA 3LGGA 2PA6A 3WBXA 3FDKA 4IZGA 3BC9A 3UPWA 3RAOA 1OT2A 4ZQCA 1BRLB 2GGHA 3O05A 1VBGA 1XYCA 1SJAA 3PWAA 3IVSA 1NWUA 3L23A 1TV3A 5HQMA 1E1CA 4D6EA 3CUFA 3RRXA 1ZQ5A 3M0ZA 1QATA 2FTYA 4NASA 3LV5A 3GFZA 1L9WA 1CXIA 4ZO8A 3E2VA 4O15A 3GTFA 3DHPA 1VBHA 5BYWA 5I3KA 4HD5A 1TTIA 5G2HA 4X3ZA 3T08A 1IZKA 3B0UX 3MV01 5FJIA 3WJXA 3V0UA 4GRSA 1TVLA 4EK7A 1TPUA 2VO5A 3VDAA 4O4WA 1E0XA 4I5XA 3G0XA 2INZA 4C7GA 3E38A 2EBNA 3LX9A 4GINA 3UZZA 3BLKA 2FH6A 5A6MA 2DZPA 3N29A 2DH3A 2V8ZA 3QHOA 1ZJHA 2Z1VA 3W1XA 2YA1A 3W53A 4JL1A 2P8BA 1TZZA 4S39A 2AQOA 2F7FA 3K1GA 2E5DA 1OT1A 5CG0A 3M64A 1V6XA 1HJXA 4D6JA 2WC7A 3UG8A 2I57A 4GKLA 8A3HA 3TN6A 5LHEA 3IAPA 4W88A 5EBUA 4IWWA 2W63A 2YX0A 4TTGA 2J13A 1OYBA 3PBGA 1B3WA 1CXFA 3WQOA 4XBSA 3WLQA 5I02A 3POCA 3GE7A 5A2CA 5A6JA 4C65A 3LLXA 2DSUA 2WWCA 3FAWA 4ICMA 2JFEX 3LI0A 3GBEA 4ML4A 3OEXA 4GGBA 3HB9A 5F4WA 4EIVA 3DU0A 3H55A 1QXLA 1WZMA 2BX7A 1KA9F 3T07A 4HU8A 3VIPA 1EHAA 4YTQA 1LTDA 2NX1A 1N2VA 1EDQA 3TMQA 4DZ5A 4DBUA 1JQXA 4HU3A 3OJGA 4J9JA 2V30A 4WIWA 5REQB 4AMCA 1KCKA 4KEUA 5FL0A 3CWNA 4LEQA 1GKPA 2YCIX 2EPMX 3MMUA 3OPSA 4GCAA 1K02A 1GONA 3P93A 5CJMA 3MUIA 5A69A 3ATYA 5DF0A 3A24A 3P74A 5TBOA 3E0LA 4KRTA 4FNQA 4GIYA 4J5NA 4UR9A 3KBMA 2DVUA 4Y96A 4DWDA 1DEDA 4D6IA 3CZEA 2ANUA 3QPZA 3KHJA 1EQPA 3BTNA 3HBLA 4D6DA 2I1OA 4JTCA 2W61A 1RPXA 2OLAA 2WOQA 2Z7KA 1BWVA 1VS1A 4KRUA 1WB0A 5AC5A 3SN1A 3GG1A 1QU4A 4GQBA 5CSYA 4DVOA 4IIFA 3K2GA 3KOWA 4MWAC 1UUOA 5GNXA 4ERGA 1CENA 2CIPA 4B91A 4CVUA 3EB4A 4EVZA 5IFPA 1TB3A 1H1NA 3UR5A 4QNEA 3VOFA 4NZ1A 4HHHA 2VRKA 4NZ4A 3ITYA 3S47A 3K1DA 1IEQA 3ANVA 4UQAA 2WK2A 3GS6A 4MADA 5HQEA 2WQDA 5CPNA 4ADUA 2H6RA 3UWQA 2GLKA 4CNTA 2VWTA 5DMMA 4QHRA 1CDGA 4RE2A 2QJHA 4KH2A 3N04A 2UV8G 3TQVA 3UBPC 3C2RA 3DEQA 3SUTA 3NQBA 4Q8WA 4H9TA 3MMDA 4IPPA 3W76A 4QG6A 2XTKA 3BJSA 3B0VC 3N2CA 4W8BA 3A4JA 1V93A 1UD3A 4PMOA 1KM3A 4I9MA 1X6UA 3RNDA 4YPJA 1SMDA 3M0MA 1A0CA 3H21A 3KL5A 3SCWA 2W3ZA 3OGVA 3MUAA 4HZMA 1L6WA 4ALDA 3CASA 4LU0A 4U10A 2WJDA 3AXHA 4A3HA 2QDGA 3W1TA 3SCPA 1OFOA 4IMDA 2WXDM 2VFDA 3WLLA 4HHMA 2Y2WA 5LA1A 4HU0A 2QV4A 4KWUA 4FX8A 1DJWA 2HSAA 4BI7A 1OGSA 4E2DA 3TYCA 4QEEA 3CK5A 3GDMA 1D3GA 3BSHA 3BARA 1R2TA 3ZJKA 2G50A 1KTBA 2GDQA 3S8HA 1H50A 4GNJA 3CL8A 2BV9A 4CD6A 3PF3A 4WY0F 2Y7DA 3CUIA 2NSXA 1UR8A 4GQ0A 4CNOA 1M3UA 3RUBL 3WD1A 1XYAA 3VD7A 4M51A 2R82A 4NXKA 1YKWA 3SY1A 1FWFC 4GFSA 4RDWA 3UPMA 4PTVA 2P1FA 5IXEA 1PE1A 1T6MA 1JUKA 4ADTA 1MW1A 2X0HA 1XSKA 3I7QA 3A9BA 1C9DA 1TTQA 4L6HA 1KRAC 3UT0A 1J79A 1XUZA 3DG3A 4PTNA 5EMYA 3N17A 2OLSA 4K38A 4PUMA 4ZR8A 4DJDC 3TZFA 4BHYA 1UBPC 2C3ZA 2R8WA 4US6A 1UD4A 2Y0FA 1MI3A 1TWWA 2POZA 2E8ZA 1OD8A 5C2XA 5I6SA 1XLLA 1CWYA 1IE7C 2FGZA 4PEKA 1JDCA 3PAOA 1J6OA 1WQ5A 2DIEA 4ZODA 2J7HA 3RR1A 2ZZ5A 2CLFA 4DJED 5D2VA 3AHYA 3EOOA 3R0DA 1VFMA 1UWUA 3W7HA 4B9YA 1Z89A 3O8AA 4LSBA 3DAQA 3GHSA 1B4KA 1UD5A 1PX4A 2D73A 2O4MA 4D8AA 3BAYA 3KRBA 3GK0A 3L0GA 1BXCA 1SFTA 5AC8A 2XWDA 3W26A 3VA8A 4B5XA 3GR7A 1B90A 1QPKA 1ZHAA 1JAKA 5M03A 1TIWA 1E43A 4PFHA 4LAUA 1TJ0A 1DBTA 5HR6A 3OYZA 1RXOB 1AQMA 3H53A 4ZQRA 5DRCA 3C5QA 4PB3A 1BVNP 1IGWA 2BOFX 4NJJA 4IJCA 2NV1A 3ZWSA 1V6UA 5CGMA 4H01A 1W1TA 3WJYA 1QPOA 3G8EA 4GQRA 4P61A 1ECEA 3LK6A 4WDWA 4M7SA 3C8NA 2GVYA 1F4AA 1CXHA 3TLLA 4KEZA 4Y7EA 1S1RA 4OWGA 4JIIX 4FSAA 3L66A 3MPGA 3C0SA 3KWSA 3OBKA 2Y70A 1EOKA 4JGDA 4W86A 1HXJA 5T9CE 4KCVA 4JX6A 1WKFA 3AZRA 1G6CA 1Y8BA 1XIDA 5BZAA 4C1KA 1EF3A 3M0LA 4B16A 3WLOA 3UNTA 1F07A 3VE9A 1VPXA 4RKAA 5A6BA 4DF1A 1QI3A 3UWZA 1LBFA 1SO3A 5C9RA 1G9HA 3PR2A 7A3HA 4QBXA 3WQ4A 1PKNA 4QDPA 3DFQA 4H3DA 2RAGA 4DM2A 4X0NA 3KRSA 2XIJA 2FKPA 4Y90A 1SM9A 2VFIA 1X8FA 3NGFA 3OGRA 3MSDA 3N2TA 1GOWA 3EXTA 1J8VA 2KAUC 4I90A 4U2ZA 3BOXA 2Z26A 2ISWA 3ORWA 4ZQPA 4AXNA 4BFAA 3FEMA 3KS6A 1H0GA 2J75A 3VKDA 5FJTA 4IMAA 1QI5A 3CB8A 4UTWC 2AAMA 1L6FA 3HQPA 5FF2A 3IUDA 2VGGA 3BK0A 4D9PA 5GNYA 3MB9A 4L6OA 3R7MA 3WLJA 2QJMA 3W1NA 1EGVA 2YBUA 1EBHA 1MXSA 1PIGA 5AYIA 2GOUA 3IV8A 2WC4A 2ESCA 2CHOA 2QVNA 2QPSA 1G4EA 1XIMA 1LOQA 4AYGA 2PDYA 5HNTA 1I45A 2J77A 1BLIA 4K8GA 3K8MA 1EZ2A 1UWAA 3B4YA 3GW0A 3WQGA 2A0NA 1PVNA 3MI3A 5AKQA 3WDQA 2VZOA 4B3LA 4L4MA 1GVQA 2CLHA 4GGHA 2C1HA 3RU8X 3BLFA 3B8VA 3UERA 3VNJA 2VEIA 2GFTA 3EB3A 3ZOAA 3A23A 1EO5A 4IM4A 3RPDA 4KWSA 3ALFA 1I0DA 4H9VA 3EX3A 2HS6A 2G3MA 1B2YA 1BVWA 2QV5A 3NQAA 3N3MA 1F76A 1EXPA 1ICPA 1QBAA 4AIEA 1P43A 4KF1A 4AY1A 1GW9A 4GVGA 4JN6A 3TR2A 3S2JA 2PLKA 1F5ZA 1UPPA 1QFEA 4RPPA 4RX0A 3UA3A 3RGTA 1R30A 4YU1A 4AMAA 2EJAA 2W62A 3G0UA 3MO7A 3KVMA 3M4HA 4AHOA 4K68A 1EWDA 3W2NA 3FA4A 3CQ0A 5DCDA 4H9MA 4MFEA 1SJDA 2Y89A 4JTQA 4LS2A 1DJXA 3RK8A 1TWDA 2DUXA 4US5A 1YTKA 1OYCA 3LG3A 4A8NA 1JDAA 2WZHA 1V3KA 3T81A 1TQXA 2A6NA 2VVSA 2YL6A 5C9ZA 2NZLA 3F4DA 4JIEA 2BGNE 5ABGA 2V38A 4F0MA 1SR0A 2XFYA 1A47A 1GZJA 2DT1A 3SCTA 1W17A 2PDCA 1I2PA 1TCMA 4GIAA 4Y9AA 3CV7A 1RA0A 3NWRA 5G4EA 4QITA 1XIGA 1LBMA 4I8YA 2NX3A 3I4KA 1ZUAX 1A5MC 3R2GA 2BSLA 3CHCA 1GOQA 5J5RA 3GM8A 5K9CA 3WDHA 3KTCA 1Z41A 3NZPA 1POJA 4K8EA 3IJQA 3VGEA 3DENA 2XIMA 4EP8C 1ZGDA 1Q7ZA 2YJQA 2V5BA 1N82A 2IPGA 4FF5A 3R6IA 1FWRA 2XIOA 1NQ6A 4DB7A 1V3MA 1GKQA 5HA7A 3W07A 3L65A 3U9IA 4MZ1A 4U4MA 3CUJA 3RLUA 3GKAA 3EWYA 4L9YA 5TQLA 2P5NA 4BZYA 3GHTA 5IM51 4PULA 3UGRA 4NG3A 1OBAA 4MUZA 1TUFA 3ABOA 4DM1A 5DT7A 3R11A 3U4AA 4WR3A 3IIVA 3UZYA 2GUYA 2B7OA 3RRAA 4PMDA 4C6EA 3DFPA 1PBGA 3WJZA 4I5RA 3W7EA 3R0KA 2ZDRA 2VM8A 4ACZB 1Q45A 3NQVA 2AKMA 3AI0A 2VELA 2WYSA 6A3HA 3TK7A 1QPNA 3SB0A 4UZSA 1ZZMA 1PAMA 4GY1A 3JU2A 4UQCA 3TFXA 4JQ2A 2ZUMA 1RK6A 1KM2A 3LMYA 4PYSA 1CNVA 4W8AA 3BAJA 3DGRA 3NDZA 3V3WA 1YNYA 2PP1A 3TX9A 4A3UA 5I3HA 3UJRA 3RM9A 1PB0A 4MOZA 2QNEA 3P0XA 3WL1A 1XKJA 1TQJA 4E4UA 1CGVA 3WMSA 1V0NA 5EMJA 1PCKA 2Z28A 2HQAA 3RLGA 2GJRA 1FVPA 1E73M 2C0HA 3EX1A 1HVXA 1Z3NA 2CBUA 4H8HA 2D0HA 2Q8LA 3VIFA 3W1RA 3T2PA 4ZTYA 2ISFA 1T5AA 3FK4A 2R1LA 5XINA 4JQ1A 3F4VA 1IEIA 3OQEA 1TREA 3M47A 4KCWA 1W54A 2OLHA 3BPWA 3W23A 3SJNA 3TTQA 2ZA3A 2NQZA 2H8ZA 1ML1A 5C9XA 5FEXA 1JDEA 3AWNA 4R33A 1E40A 4ZVJA 1WDSA 3C52A 1QUMA 4LGXA 5DT5A 3WG6A 1HUVA 1X8CA 2BVYA 4TU1A 2XISA 3GIYA 3CMJA 4RDYA 1Z69A 3IVUA 3ZSSA 4MY8A 2ZC8A 1XIFA 5ABFA 2VL4A 1R2SA 3FKRA 4IP7A 4XZLX 5BROA 1OFAA 1L6YA 1KQZA 3KRZA 3QLDA 3WDIA 1NDZA 1CGYA 4WDXA 3RIKA 1P5BA 4RZ6A 4DRSA 3ZYZA 4HNNA 4NAFA 1W5MA 2OFJA 3P7YA 1E5NA 2FDMA 3W00A 3IGXA 3W2KA 1TA3B 1EZWA 1CT5A 4R34A 2QW5A 3EBVA 1RLDA 4UTTA 1BYAA 3POHA 1OABA 4HHLA 5F2MA 2PE4A 5CC5A 3CHDA 3GTNA 3BGJA 4GJ1A 3VIJA 1RP8A 1THFD 4JKLA 5HINA 3AXIA 2GUBA 3TVAA 1LRNA 3T09A 2X40A 2ZE0A 3TA6A 3F2BA 3W2JA 2CLEA 2X1UA 5G1TA 3SCRA 3GG8A 4NU7A 4JPGA 1LF1A 3DHFA 3MUCA 2CCRA 1Q85A 5DMLA 1Q8AA 1NOFA 2REQB 1XG4A 4XV0A 1NARA 1Y0EA 3LBCA 4AWTA 3HZ3A 3EYPA 1T96A 4WKHA 1F6YA 1PWMA 3H2FA 3R79A 4JY8A 1UKTA 3KX6A 4GYJA 5EMKA 2E0PA 3GHUA 1B3VA 4DUXA 1TR9A 3AYVA 3GXTA 2AOSA 4EPKA 3U8GA 4LNCA 1XYFA 3KTXA 4WXYA 1JDFA 3G1RA 1CZ1A 1UH2A 2CZFA 2DJXA 3NQ8A 3SRHA 3DHDA 2OU4A 3UG5A 3W7PA 4YTTA 2HPMA 1X1ZA 3Q94A 1TWZA 4H04A 4REQA 4TV6A 2Y63A 2VUYA 3PHAA 3NQCA 3EPOA 2NWRA 1VAHA 1EC7A 4IGNA 3I3BA 4ZXOA 5EMLA 3TZNA 3O7UA 4DJEC 3T9PA 1B54A 3UQNA 4X9YA 3C86A 4GC4A 2VCCA 1UP2A 1RPKA 4ZGYA 3WMCA 4LXFA 4DI9A 4YYCA 2XH0A 9RUBA 4ADSA 3VVGA 2QHAA 4GI9A 3E74A 1C8QA 1LYXA 1UWTA 3M6DA 3BZJA 3NIYA 2HVNA 4LCSA 3V5FA 1GTHA 4GVHA 2WMIA 3G3DA 5HXMA 2JGQA 4HGXA 1CCWB 3W9ZA 4EOUA 4GBUA 3WN6A 3A5FA 1GQJA 4R7WA 1LDCA 4J3TA 1KFKA 4JTTA 4UMCA 1XH2A 1HKJA 2J7BA 5A6TC 1A5LC 3PTQA 3WLKX 3WL0A 1CGWA 1S39A 3VKBA 2PZNA 3I6EA 3IIZA 3WQ8A 4G7FA 3GAKA 1E4MM 3GR4A 1T40A 3O2LA 2YCJA 2PDKA 4AYSA 1PZ2A 1RLCL 1K6AA 2QKFA 3CO4A 1KGXA 3EX4A 4GWEA 3B0PA 3U2OA 1P6WA 3GTIA 4XZWA 2CEQA 2FDSA 4BA0A 5IBXC 5E09A 3T40A 2CITA 4UMBA 4WDTA 3QSRA 4OOUA 3BE7A 3S5NA 4MWAA 1EEPA 2NT1A 1WZLA 1JZ2A 1LT7A 4E2BA 5DELA 1CXKA 1XX1A 4O11A 4P8VA 2CNCA 1O60A 2BLEA 3EDDA 4ILSA 3E0WA 4LF2A 3UJEA 2KX9A 1B31A 4W84A 3SCQA 5I07A 2OZ8A 1Q6EA 5AHEA 4E6MA 3VZXA 2BHZA 3EWZA 3DUGA 2WZTA 2CLIA 1BYCA 3WF1A 1V5XA 3W1AA 4HMNA 3I7RA 3KP1A 2CLPA 3P80A 5EB8A 1AH0A 1GZGA 3CNYA 2TMDA 2IS7A 5I77A 1GJUA 4L1XA 1FWJC 1NWRA 1GOMA 2DU2A 3S9YA 4LUSA 3UW6A 3GG7A 1RQEA 5HMEA 1WBJA 4B5SA 1JZ8A 4HNUA 4KESA 1DL3A 3E2SA 4IIEA 2O9TA 2WHLA 2ZUNA 1ICQA 3QBUA 4HZ7A 3C0JA 2HISA 3ALGA 5ENLA 1QR7A 3C3NA 5AVNA 3ZS4A 1V77A 3D47A 3SCUA 3WFLA 4HCHA 2YZ5A 1A5BA 4Q6XA 2E68A 4J2MA 4Q8PA 3VGBA 3B3DA 1ESWA 3H7UA 1UG6A 4KGJA 2Y5SA 1XRVA 2VRQA 2YFOA 3SCNA 2NWSA 1YXYA 1XR2A 2J9YA 3MP5A 1TUXA 4GZJA 1BRLA 3UVIA 1X98A 3ITGA 3IS4A 4XISA 5JH2A 4C5YA 3UCDA 5GJMA 1FP9A 4BEQA 5C71A 4J40A 2X0SA 3PC0A 1ONRA 2GK1B 2FZBA 5K2ZA 2XZ9A 8CGTA 4LVAA 4M3PA 1FDJA 2H8XA 1JEZA 4H1ZA 4K37A 1R85A 4EWJA 2J7GA 2BVTA 3RXZA 3EDKA 4L4LA 5EBAA 1UA7A 2HXTA 4LAMA 3MYPA 1E1EA 2QCGA 3SJ3A 5C70A 1JZ4A 1WDWA 4GC3A 2R94A 4R9XA 3PULA 4MVAA 1TPDA 3PK7A 2R1NA 1RCXB 4GFIA 4PB4A 2E67A 4Z2LA 3OP2A 5FSDC 1O1ZA 3SI9A 1FCUA 5DX7A 3OVQA 4Q4KA 1DQUA 4BF5A 4UMAA 1E6PA 2FHCA 5JUVA 3QZEA 1ONWA 3DIPA 3QTPA 3BLOA 1XC4A 1UUQA 4S2CA 3NAVA 4RXFA 4K7VA 3VKCA 2ZDSA 4GYPC 3UWYA 1QMLA 4Z2KA 2DT2A 4LF1A 1ZAIA 1JI2A 2WJEA 3W88A 4G56A 2R91A 1I0BA 1SSDA 2VDIA 2WLZA 1ZBKA 3FLUA 3BAXA 1ONXA 4JOMA 4PEEA 1E0VA 4KERA 1UUMA 3LPFA 1EHNA 3S5YA 1TTJA 3QV8A 1Q4NX 1E1CB 2FZNA 3GXIA 2OOFA 4JAWA 3L68A 4R3UA 2RUSA 3VNDA 1V51A 2G3NA 2W27A 5A8GA 1UKPA 5E0CA 1A5UA 1XICA 3QRHA 3NL5A 4QSHA 1V0MA 4C6FA 2YDQA 4XAYA 1M7XA 1DIOA 1S5MA 4JFWA 4AVNA 1V6VA 5HNRA 2ZE3A 2FPVA 4J4KA 1KBLA 1T99A 2GQAA 3CH0A 5REQA 3N4EA 1KKOA 3DFYA 2E6YA 4RZ5A 1JPDX 4GYKA 2QMJA 1WAUA 3WF2A 2F61A 4J3XA 3U4FA 2UBPC 1YYAA 3IRDA 3LERA 1XIBA 2WMGA 3LRLA 3WJSA 3W38A 2MUCA 4XZHA 2PWUA 4W93A 2IQTA 2OSWA 5HJYA 1RJRA 3RX2A 5A6AA 4O1CA 2I5QA 4FIQA 1KFLA 2VHLA 2VX5A 3IIPA 3E5BA 1VCFA 3BLIA 4JQAA 3RCNA 4NQ1A 1KM4A 5LA2A 5IHRA 3PZUA 4D6HA 5G2IA 1QT1A 5LIKX 4GXPA 3BW3A 2VWSA 2PD5A 1GOIA 3BH4A 1AL8A 3FA3A 1HL9A 4QX4A 1XF0A 1A5NC 1CB2A 1WZAA 2NUXA 3LMZA 4ATLA 1JPIA 3O3RA 3A6OA 1EP1A 1P1XA 3I3DA 4H83A 3CBWA 6TAAA 2XN0A 3HOJA 2UY4A 4OGZA 4GZIA 4LVFA 4WZHA 1P0KA 2V3GA 5CBBA 2WVVB 5FL1A 3V1PA 4I6VA 1FFRA 1F4HA 1EPXA 2PWDA 3AHXA 4LJ3A 4K36A 3TOYA 3G6MA 4YTRA 1DV7A 1OB0A 4K6AA 3VFCA 2PFHA 3QR3A 3EOLA 1FH7A 3NVDA 1MQRA 3WD0A 3TOPA 2RGLA 1J10A 1AJZA 3FGCB 3TCEA 4PR4A 3AUJA 1R3RA 5ECUA 3WF0A 1TSIA 4YCPA 2RJHA 4C6PA 3LXAA 1NDYA 3FXGA 5GJPA 4QLJA 1CGTA 1BXBA 3SGZA 2NT0A 2V68A 3W72A 4ZMGA 2X30A 2Q8ZA 1L0PA 2OPJA 1DIEA 4FEZA 4XAGA 3OW1A 5FJRA 1D3HA 1BD0A 3KUMA 4O1DA 4MKNA 1V02E 2OXNA 2C6QA 2Q09A 3QQ0A 2ZYFA 1G1YA 1I75A 6PTDA 4TOQA 4GLEA 2WJZA 2HE5A 4WGXA 4AUBA 3PUOA 3WD4A 1K70A 3A4AA 4DQWA 1U83A 4M1RA 4D6CA 5BWFA 3HU7A 3WX7A 5C9WA 4RV8A 3AIRA 3OTRA 2ZXAA 4L9ZA 5BRQA 4F4RA 4AH7A 4Q7NA 1VFTA 3TYBA 3BQ5A 3O07A 1OK4A 2VI0A 5DO8A 3I4EA 1E70M 1O5RA 1OF8A 1V02A 4AFYA 5GQBA 4D8ZA 2PTWA 4X60A 3BMVA 5CZKA 1J5TA 3EDJA 1EJ7L 3IJ6A 1KV8A 2CHNA 2Z2AA 1TE1A 1HKIA 5I3IA 2DORA 4N6EA 3IARA 3G6LA 2O9RA 1HIZA 1R38A 3PANA 3AMDA 4MY1A 5I09A 4DZHA 1TJRA 2DGAA 3ZIZA 4JD4A 1W1VA 1AVAA 5G1MA 1RCOB 3EX2A 4ROPA 5HWJA 3CTTA 3ATZA 2WBKA 4X9SA 3PVFA 2BTMA 3U6WA 1V3JA 2VEPA 2E6DA 2QPUA 3AIQA 3PUGA 4IOTA 2EPLX 1VGAA 3MUZ1 4US5D 5K9DA 1LWJA 2FGBA 3SN4A 3B0YA 1GYLA 1OFEA 2RGMA 1HJVA 2I56A 3L4UA 3LTSA 1ZAJA 3K13A 3G24A 1IIGA 4LUYA 3TW6A 4FNTA 4JTFA 3CB3A 4QRNA 2OQHA 4O10A 4KBXA 3I68A 2V5CA 1B0IA 2ACQA 3QR0A 4HTBA 3ZZ1A 6TIMA 2BOEX 1HFBA 2A3CA 2PPGA 5U4NA 3S2CA 3BO9A 3H70A 1I2NA 1WV2A 1D9EA 2XVLA 3ARVA 5I5RA 4ICNA 3IEBA 1GTEA 1KXTA 3N34A 2PF8A 4IP5A 5DBTA 4AG0A 1PKYA 1SYTA 4CD7A 4S3FA 4IGHA 4BKNA 2INFA 3CC1A 4Q8UA 2NSOA 2OTDA 3W87A 2WSRA 1AD1A 2E40A 5FIPA 4CQ9A 3BJFA 4LFYA 2MANA 5LNVA 4XBKA 3GU9A 3U2EA 1E9YB 1ME7A 4BEUA 3R89A 2HVMA 1W2PA 1BSIA 1AZ2A 3VGFA 3WLSA 4JX5A 1H41A 3HFYA 1TMLA 4D71A 4L4PA 2QJNA 4C5ZA 2D3LA 2A3LA 2CHRA 3TSDA 1JZ6A 1IIHA 4ONVA 2YCKX 2X2GA 4NIRA 4QCFA 1JULA 1FWHC 3PS7A 2V5JA 2J6XA 1NDVA 3HF3A 2YCLB 4JIPA 2WLYA 3M0IA 4O52A 4EE9A 4CNPA 4QEHA 4Z1DA 2J7EA 2O7SA 2C1IA 3FXYA 1E9ZB 5F4XA 1PWLA 3WLPA 3P0WA 4YVVA 3O6CA 1C9WA 1KM6A 3NQDA 3DI1A 5I2UA 2YDRA 1US2A 1CXEA 3FX4A 1E3ZA 1MFUA 1P6CA 1M68A 1LLOA 2R1PA 3P3BA 3P82A 5EFDA 3ZFHA 1V3HA 3ABRA 3FS2A 5AY7A 5DY2A 1F7BA 4WUIA 1H3GA 2GWGA 4E4PA 1GOKA 1N55A 1GZ1A 3SAZA 3U57A 4HPGA 4AD1A 2HXUA 1YPFA 2QCDB 1S3HA 3W37A 2Y7FA 3APYA 4JFUA 1P4CA 4JCMA 1QNRA 4NT0A 4CCDA 1BEUA 4MHBA 4NJGA 3SCVA 3QM3A 2A79A 3AHVA 4DO5A 1XDJA 5A6SA 2O7QA 2G96A 3MKCA 1PX8A 3WQEA 5A3HA 2XFFA 1IYXA 2FZMA 4UFIA 4MB1A 3V0TA 4IQDA 5CSSA 3C6CA 2G4JA 2Z1XA 2ALDA 4JN8A 2BY3A 3W70A 3M41A 2A3EA 2BHYA 2NVCA 1SR9A 1Z48A 3MP3A 3RMJA 2ISSA 5FOOA 1Q6DA 1SU5A 1R6WA 3AS2A 1Q5MA 3STCA 4LV9A 3TROA 1XW8A 4Z1BA 5BOFA 4URIA 3T55A 4FZIA 3B4UA 4EF9A 1RH9A 1XP3A 2BODX 3PBYA 2HRWA 4JQ4A 3QZ6A 4Q3MA 3GZ3A 1RJQA 5D05A 4JICA 5K4ZA 3WF4A 3ITVA 3VUSA 2WWDA 5AFDA 5A6KA 3AXXA 4MAZA 4CQCA 5LNRA 3AIWA 1RA5A 4H9ZA 4FLSA 4JIRA 3V4BA 1UWIA 1XIEA 3FDGA 3NQFA 1JNEA 2XJ7A 3DH7A 2WZIA 3D0CA 4JTAA 2OEKA 4ZQNA 1DHPA 1SPQA 1SW3A 1TKKA 1R86A 1HKWA 5HR7A 5LSMA 4JXCA 4H9XA 2V82A 3ES7A 1IXNA 2Q3OA 2Z6JA 1OD0A 4XAPA 3MHUA 1FX6A 4LAOA 4PUDA 4F79A 1GGOA 3EDFA 3SO7A 4O16A 1CPUA 4MB5A 3VOJA 1GT8A 2VVNA 1NELA 3ARRA 5J5DA 5D37A 4NYUA 2R1MA 4XSLA 3DG6A 1YBQB 3VOGA 1EL3A 2CZVA 1BF6A 4F9JA 2XM1A 2WMKA 3G22A 3MUXA 4W9TA 5F7UA 1MNZA 4YWSA 3CV2A 3LDVA 1Q6GA 2G95A 1PS9A 1QAPA 5LIYX 2Z29A 3LGEA 5FJJA 2XVKA 3O06A 4P7QA 1E9LA 2WNNA 2DUZA 1PYMA 2UWFA 1D8WA 1QHOA 5F4SA 3VD4A 1LUCB 2DV0A 3CU2A 2DJLA 3ID7A 4CLMA 1MMFA 2D24A 4Q4OA 4J2PA 4F2BA 2GJXB 3T05A 3EWXA 1R7AA 1QRQA 1M6JA 5EMMA 2BWGA 4DWSB 4X0VA 2MNRA 3SRFA 1R7OA 1JRBA 1BKHA 1FOBA 4O54A 3AYRA 4AZCB 2VOTA 4Z0JA 1OX6A 1R5YA 1SUXA 4ZBCA 3BV7A 2H90A 2BOGX 4X22A 3WEMA 3QVQA 4JTJA 3RX4A 4EAMA 2FPTA 3B9EA 3ZSTA 4IFOA 1GHSA 2SFPA 1EJXC 3HGRA 1J0YA 2FGLA 1DHKA 2IKJA 4YTUA 5E9XA 1FCVA 1Q7QA 3LEPA 3LPOA 3UXAA 3NYDA 3W2LA 2VRJA 4GUGA 2C1GA 2GGGA 1ITCA 2CBVA 3TTYA 4C6CA 2V5DA 3EWWA 4DPPA 1BWLA 3N18A 2WC3A 2HNEA 1F61A 2PP3A 4ATWA 2C91A 3N3TA 4AIUA 2ZX5A 2QDEA 1JCTA 6XIAA 3FIGA 1Y7VA 4UTUA 2QVHA 4FIRA 4U5IA 2E9MA 2OZTA 2XM2A 2ATMA 2XGBA 4B3ZA 5AOUA 4HNVA 3SUSA 4ACZA 5BXPA 4L65A 1EIXA 1B4EA 2V3DA 4NAEB 3BW2A 4PCSA 4JFTA 3VNMA 1BQGA 1VFOA 3K4DA 4M81A 2XDFA 3TAOA 4C6JA 3ME3A 2JEQA 4OJYA 1SMAA 4FAMA 1W3JA 1G01A 4QM1A 1FA2A 1JCMP 1R87A 4UCGA 3LCFA 3H2AA 3F5LA 3URBA 3NQ2A 2VX4A 4M8UA 3E9AA 1XYZA 2WCAA 4C1NB 1B30A 2WV8A 3JS3A 3ITLA 3KZSA 4NZ5A 2C16A 2XFRA 3WH5A 2WW5A 2Q3RA 3GKFA 1VEMA 4DXXA 4HMCA 2VQTA 2GVJA 4J35A 4YVXA 4WXZA 2NUWA 1XRSA 3ARPA 1FCQA 3TYAA 3NUKA 3FOKA 3ZR6A 4H9YA 2Z1WA 2J74A 5H91A 2FQIA 1TTPA 3S3GA 1E51A 4YHEA 3A3WA 1ITXA 2PWFA 4P8XA 2PD9A 1T8QA 2XGZA 3IUIA 3LHTA 4B4FA 4MWAD 3CXOA 4I5UA 1LROA 4AHQA 2Q01A 1UMLA 1B1YA 5E0KA 4JDBA 5CSRA 3NL2A 1SO4A 1E6ZA 5FSEC 2PTXA 3IACA 3L0KA 3A64A 1R3QA 5I79A 3E12A 3IGUA 3F03K 1GG1A 3ZVHB 3AWOA 3ITXA 3K4AA 2QF7A 3AMLA 4Q8VA 3MU7A 1RBAA 2QDDA 1S5NA 5TNVA 4C6LA 5HNUA 1G69A 4ZO6A 1JZ5A 2VXNA 1A5OC 2YIHA 4Q8QA 1HKMA 2OO6A 5LIWX 2C0AA 3UP8A 2EPOA 1Y5VA 4J3UA 2D0FA 3FNDA 1AUSL 1NVMA 3GFXA 3MZ2A 4UB9A 2FVMA 3N73A 2NXIA 3AXKA 1SFLA 3AIVA 3GYCA 2JBMA 1EC9A 5FAJA 3JRKA 2QS8A 2D69A 2ZTJA 3GXNA 3HURA 4UCFA 4MPKA 1J0ZA 3IV3A 3R13A 2WNWA 3MMTA 4NY2A 1UKOA 3T0CA 2VCBA 3IUHA 1TA3A 1LL7A 2X16A 5E9AA 3O15A 1JCXA 2NVDA 3QC0A 2PBGA 1QBBA 4ZL1A 3ZWTA 3NEHA 1MEWA 5HK4A 3N6QA 3NA8A 5GVJA 4HN4A 3DZ1A 5D02A 2ZVIA 5CC6A 2XIQA 1UZHA 3TW9A 3UJ2A 3UU0A 2YB1A 1YX1A 1UR9A 1GK8A 8TIMA 2ALRA 1FQ0A 1VKFA 2E1DA 5H8UA 4GACA 2H3BA 1E72M 2RDTA 2AGKA 1DOSA 1I1WA 1W0MA 4GH1A 3U7BA 3DFOA 2REQA 1XLGA 1XSJA 1YXCA 1Z8AA 3A3HA 5C9UA 1L2UA 1ZB5A 2AKZA 1XLIA 4MGGA 3BLPX 4HA1A 5FCZA 3WQWA 3GNPA 2WPGA 2BY2A 3LOTA 4JTUA 3N13A 2JIEA 5JBFA 4NJIA 2Z1KA 2Y85A 1YMYA 3S5SA 3CLMA 2EG6A 1V0KA 5KSWA 1EA9C 3FVDA 4D8LA 1KLYA 3R1ZA 3UY7A 2PTYA 3APTA 1J93A 3H6OA 3TV8A 2PRMA 5EL1A 2B7NA 3KM8A 2QT3A 3OHIA 4JEQA 2CZDA 3KZPA 4KWWA 3K46A 3NM1A 4NSBA 4HN8A 1QO5A 4N0RA 4O18A 3VIGA 4Z1AA 1X6LA 4KCTA 3QHMA 2WZEA 4FXJA 1OADA 3M5VA 1XBZA 3SIMA 9XIMA 4JIQA 4V1YA 4KETA 5M5DA 3CH9A 2PWHA 2VC9A 2FZ8A 4AX6A 3H2MA 3GDBA 4F0KA 4V33A 4RDZA 2OT1A 4IQLA 1H7NA 3W25A 1DKWA 4RNIA 5D2TA 4HKPA 2INEA 3WNLA 4GH3A 3ANYA 3TCSA 4GISA 5DMNA 2WHKA 1TJ1A 3LQLA 3EEGA 1I2QA 2GJLA 5JVLA 3OO2A 2EQDA 1K4HA 1F9CA 3V5OA 2AL1A 2OKOA 2J7FA 4NJHA 3KOXA 1LRTA 1VCGA 5HULA 1EC8A 1MDRA 3LPPA 3RLHA 3PUEA 4QJ5B 4K2SA 2PTZA 2HROA 4J3SA 2FTWA 4H2CA 1QHZA 1T41A 3G8RA 2O4QA 1W9UA 4PUUA 1H7WA 4E38A 4DYKA 5F1UA 3HQOA 4O0QA 3N15A 5KETA 5RUBA 3AALA 2YR1A 5I3FA 1VEOA 2D23A 5D9PA 4HPHA 4GZ7A 1QW7A 5I00A 1DE6A 3U5YA 4WOZA 3RX3A 4E8DA 3QQWA 2PGWA 1IV8A 4JX4A 5IDIA 3N6HA 1KR1A 4ZQOA 3UWUA 2OEMA 1ZCCA 4AZBA 4CD4A 2PWVA 4XAZA 3MVTA 3M9YA 2WQPA 4WCJA 4Y2WA 1GQNA 3VOIA 1OVDA 4AWUA 3AXMA 2E6AA 2ZUWA 3CUXA 3GDKA 1I9CB 2BXVA 3CO8A 3MSYA 3PZ9A 3VOHA 4G5DA 6ENLA 3HFTA 3WBEA 1Q63A 2PDFA 1YE6A 1LQ2A 3NZQA 3A12A 4E5TA 2V0TA 5ECVA 3BXWA 2W5FA 4Q4PA 3FVMA 4FOKA 3S6TA 2WM0A 1ITUA 3H8AA 3DC8A 4HPJA 2YXXA 3FJLA 4OHQA 3FJ4A 3YPIA 3NG3A 1Q7MA 3OVPA 4MYXA 3PZNA 3LU2A 1IQ8A 2YB4A 2PDHA 4F2TA 2H9AB 4MYAA 2OZ3A 1E3XA 3AOFA 1JPKA 2BVDA 3GVWA 3V16A 4QR6A 1J01A 3CZKA 4L7ZA 2UY2A 1KM1A 1FWWA 2A3AA 3NL6A 3VIOA 1I60A 1XGZA 3M44A 3VTRA 3W1MA 2JGYA 2X1IA 5EPDA 1WOBA 3MYOA 3UG3A 1JCNA 4AISA 2EG8A 1IEWA 3TN5A 1J6PA 2PODA 3LCLA 3P67A 3FV9A 2Y7EA 3WJWA 1F3XA 3PBVA 4AZHA 1F6KA 4R7JA 1C7TA 3WNKA 5LHFA 2OVLA 2BVWA 4LBSA 3L67A 1Q2RA 3W02A 1OX5A 2J88A 4PZVA 2GK1A 4MZYA 3PAJA 3BV4A 4JNZA 4LC8A 2R24A 3MC5A 1Z7AA 3C8FA 4EPEC 4QE5A 3WO8A 1HG3A 2BASA 4HZ8A 3APGA 2PSNA 2V2CA 4D72A 1YRRA 3O1NA 2ISVA 2NUYA 3LB0A 4ZSTA 3MWAA 1MRQA 2PU1A 4S3AA 3TTOA 1HNYA 4MJMA 1KBBA 3W22A 4C6MA 3A47A 4JHOA 3S6DA 3VZYA 2FHBA 2C8NA 3VKJA 3GIQA 1RBOB 4PRWA 3S2LA 2BHUA 1BYDA 1FHVA 4PUKA 4QSFA 3M0HA 3VZZA 1KBIA 1NU5A 3LV6A 2CWNA 3IANA 2PDLA 1OG6A 3VCRA 5LNSA 3N6JA 2C13A 1NQKA 1RVKA 3N9SA 3R0UA 3P84A 5DQPA 4QGCA 4DX3A 3EKLA 1XLEA 2DW6A 3U7VA 4UTTC 1S2VA 4MNMA 2GL5A 4DN1A 5M17A 3RLVA 1ELSA 4HK7A 1KV5A 2FYMA 2Z2BA 3EWCA 1QHPA 4J7RA 2CBJA 2VEGA 5D2XA 1TFVA 3CAVA 4OOZA 1QNSA 2CZ5A