1F73A

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii in complex with sialic acid alditol
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
288
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords N-ACETYL NEURAMINATE LYASE
total genus 122
structure length 288
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f73A00
3M16A 1KTBA 1F05A 3PB0A 4WUIA 3W2MA 1YPFA 4LV9A 4RXGA 5K7JA 1GG0A 5LGXA 1KW1A 1CI1A 3UQNA 5K9XA 5K9DA 3L5AA 4Y8FA 5CSRA 5AYXA 1KLZA 4LVGA 3T4CA 2NWRA 1LOSA 3VE9A 5EYWA 5CZJA 2W6RA 1W31A 1D3HA 1VRDA 2VFHA 1RQEA 2V9DA 1IGSA 1B4KA 1EUAA 3G3MA 3PUDA 1LTDA 2C6QA 2J9XA 3PUEA 2ISWA 5DY2A 2Q8LA 4GUGA 2C16A 3LCIA 4WY0F 2H3DA 5J5RA 1TTJA 1DORA 1PV8A 1PHWA 4LOCA 3A5FA 4O15A 2BLEA 4EF9A 1EWDA 2A7RA 3PS7A 1EP1A 2H8ZA 3L67A 2E77A 4LUJA 4MZ1A 4JTHA 4Y90A 2Y7GA 2YR1A 5DN1A 3C3NA 3NQVA 3E96A 4H6KA 1ZALA 2PRHA 3BLIA 4FNQA 1UJPA 4DEFA 3LTPA 2UV8G 3TMQA 3PBUA 4M6QA 4XTDA 4AWTA 1AL7A 2Z6JA 4EOUA 2JGQA 3DI1A 1CX9A 1R2RA 3MI6A 1F76A 2HMCA 3TU9A 1M7PA 1GJPA 5D2WA 3TSBA 1P0KA 1B3OA 1QPNA 3R12A 3MMTA 1XCFA 3EX1A 4X22A 3UWWA 4GUIA 3NXFA 4KWWA 4YCPA 3GR8A 4P2VA 5D2TA 4IQLA 1LLZA 3PBWA 4O18A 4O4WA 3TE9A 3USBA 5HUOA 1J4EA 1HL2A 2TYSA 2CWNA 2ZRYA 3LHTA 3ABSA 3CIWA 1G67A 1YTKA 1A5AA 4WY0B 4BF9A 1P0NA 3JRKA 2OT0A 1LLWA 3MI2A 1ZFJA 4DF2A 4EWND 3A24A 3LCLA 5LNSA 3IIZA 4FNRA 5F2MA 1HG3A 2PRLA 3RF9A 3NQDA 1OFPA 1R47A 4POCA 1I4NA 3RK8A 4WOQA 1SW3A 4MYAA 3OG3A 3QF0A 4XZ9A 1KM4A 2OT1A 2CW6A 1LZOA 3DXIA 1RQHA 1FCBA 2ATMA 3BV4A 5DCEA 3NL3A 1TPUA 2A0NA 3EWZA 4O54A 5CPMA 3TH6A 3C8FA 2NUXA 1VHNA 1PCWA 3LHWA 5D02A 4WY0A 3QW3A 2OZ0A 3EWUA 3SIZA 1H60A 3HBLA 2WSQA 4FX6M 2O7QA 1TIMA 4CQ9A 1VCGA 3TQ0A 5LNWA 4IWWA 3N19B 3FJ6A 4O8RA 5KMYA 1O5XA 4FX8A 2B7OA 4NU7A 3S9YA 2QJHA 4JTGA 4UFLA 3QYQA 2WQPA 3SGUA 1YXDA 4FXRA 2Y62A 3G1DA 3HG5A 1TPWA 2QKFA 1QMLA 2FB2A 5HWNA 1KM0A 2YZRA 3U2OA 2Y7FA 4CQ8A 5CZTA 2CLMA 3TW6A 1D9EA 1R46A 4GBUA 1PVNA 2WJZA 4JDYA 1GEQA 1V7YA 4KFNA 3UWZA 3E9AA 3NL6A 5I3HA 2BTMA 4OQVA 3MHFA 3DFOA 1A5SA 1VLIA 1JR1A 2GQAA 1JCJA 1PCKA 2A6LA 1DJNA 2NV1A 3NA8A 3TQVA 4O28A 2YDAA 3GZ3A 4EIVA 4H4IA 4K6AA 4CCCA 3LBMA 3TC7A 4UNKA 3LCWA 5SWUA 5EA9A 3G1VA 3MW7A 1F6PA 2ZZ4A 3WK1A 1JRBA 3P81A 1WXJA 5TBOA 5LKYA 2FJKA 4Q33A 5F4SA 4IXHA 1G4TA 4O52A 1FQ0A 2Z6IA 3W7IA 1LCOA 4GUJA 1DVJA 2P10A 1QPOA 4JR5A 5H2ZA 3A21A 3W7NA 2JKAA 3N73A 3S1XA 2X2GA 3Q94A 3KFTA 3OEXA 2Y7EA 5HJLA 2C1HA 2ZRUA 1DBTA 4UIOA 3UYCA 4XUGA 5D05A 3LM7A 2WSYA 3VNDA 4UTKA 1EIXA 2ISVA 1YLVA 2D73A 3DFQA 2ZZ6A 1ZY9A 1YYAA 4A3UA 1OF8A 1XUZA 4W9TA 3FKKA 2QF7A 3A22A 4LNYA 1O94A 3S0CA 5D37A 3W1QA 3ATZA 5AFDA 4GWEA 3Q37A 2WPBA 4DQWA 3DAQA 3SY5A 4MIMA 3NPXA 1S5WA 3P60A 4LS1A 4FNPA 1ZENA 1ZJIA 1EP3A 3QMSA 1W8SA 2NWSA 3OA3A 2J6XA 1OG0A 3DENA 3W88A 3M44A 3EXRA 2FDSA 4JS3A 4KKXA 3BGGA 3HF3A 4HPJA 1HTIA 1OFAA 4GE8A 1R30A 2CZFA 4WJEA 3E49A 5AC6A 1LDCA 1SZGA 3IIVA 2YW3A 1FY6A 1SO4A 3MYPA 3VKJA 4YWIA 1VYPX 3C0JA 2ZA1A 4IMCA 5L9FA 3M5VA 1WX0A 2NV2A 3NO5A 5AYYA 3W83A 2E68A 3NL2A 2FB3A 1AW1A 6TIMA 3QMTA 2QEZA 4AHQA 5KINA 3SW6A 2QJGA 3LI1A 3AO0A 3IIPA 1H5YA 3W7OA 1M6JA 1SO3A 1SU5A 3UWUA 3W1LA 4OBTA 1H7XA 3GXTA 1IXQA 4R7JA 3L21A 2HS6A 3FA5A 1W1ZA 1Z44A 3GDMA 1XL9A 1OYCA 4QIUA 3W1TA 2VEMA 1LOQA 3KHJA 2J27A 3CC1A 3ATYA 2A2IA 2VC6A 4O4VA 1XKYA 2QUUA 1EWEA 4IUOA 3PBVA 1KM3A 3DU0A 1CW2A 2B0MA 5I3KA 4RXFA 1G4EA 3KAOA 2J24A 3TMLA 3THQA 2V5BA 4RZ4A 4A2SA 3TSMA 3LTSA 2OX1A 1TTIA 3OBKA 3T44A 3G8EA 3P82A 3GVGA 4QAIA 5HR7A 1VLWA 3W2LA 2FPVA 3I7SA 2Z2UA 2O7SA 4BR1A 3WFAA 2EHHA 5LGZA 1BTMA 3M0ZA 4O1CA 1H7OA 2VFFA 1LBFA 3M5XA 3GXPA 2GJNA 1FXPA 1W5NA 3W07A 2QCDB 2WKJA 5J5DA 3P61A 3G24A 1VC4A 2GVJA 4JDBA 5BMWA 1G4PA 5C54A 2RDTA 5D2YA 1GTEA 3NVTA 3TAKA 2TSYA 1DQXA 2FPTA 4NJJA 2H3BA 2QCCA 4IJBA 3PBYA 3RU6A 3ELFA 1DHPA 5FF0A 2C18A 5U7SA 3W1PA 2YFOA 1R2TA 5HUPA 1Q6LA 4FF7A 3TCEA 3DFPA 3TK7A 4DO6A 4MZ8A 1KFKA 4S2BA 3NQ6A 3O1NA 4O19A 5BRBA 2XN2A 3L0KA 4LV4A 1ICQA 3RLVA 1YDVA 3R2GA 1VS1A 4N9CA 1W0MA 4AHPA 2ZTKA 4I7WA 4NZJA 2QCNA 4I7UA 1XBYA 4E0CA 2QCLA 2J9YA 3OIXA 3OVPA 4CCEA 4PTNA 3EX3A 1O4UA 1LRQA 2VOMA 5DBTA 2B7PA 1UUMA 1QDSA 1PS9A 3H54A 4N9EA 3T40A 1OF6A 3O05A 1Q45A 2V2CA 3T78A 3B04A 3P80A 1M7OA 4LY8A 3NPVA 4MPQA 3HG3A 2J9ZA 3F1QA 3W3OA 1PL9A 2C0AA 4UUIA 1SQ7A 5CPOA 5E1QA 4Z08A 1SFLA 3B0PA 2CZ5A 4DF1A 5HQEA 2E1DA 3S8HA 3INPA 3G1AA 3WJZA 3TX9A 3KRUA 3W22A 3EXTA 1K8XA 4JN6A 2R8WA 1KBJA 2QCHA 1W5PA 2VEKA 5AHEA 1KM6A 4RK8A 4PH6A 3LV5A 3NM3A 5F2LA 4ZQMA 3MHUA 3BK0A 5BOOA 4X2RA 4K38A 2QCGA 1L2UA 4N6FA 5E0KA 3GX9A 3N2XA 3STGA 1F2JA 3W2JA 2BX7A 4BI7A 2QAFA 4S1FA 2JK2A 4ORMA 3AJXA 3G3DA 1DOSA 1ZAIA 2NLIA 5FF3A 4MFDA 3M5ZA 3N9SA 3NQEA 3F4NA 2A85A 2A6NA 1TRDA 3FFSA 1HUVA 3IRDA 1A5CA 1SZFA 3R13A 4AVFA 1FWNA 1F73A 2XN0A 4P61A 3LTYA 4K36A 4IOTA 3W2NA 2CLFA 4QISA 3MHGA 5HWJA 3KOFA 1TQXA 4O13A 3W7PA 1WA3A 1TJPA 4JX5A 4B5NA 1PIIA 2ZRXA 3MBDA 3W7DA 4NJKA 5I3FA 4O1AA 4WXYA 5CZSA 2NUYA 1SO6A 2GPTA 3Q2DA 3BO9A 4XBKA 4IMGA 4LC6A 1H7NA 1WBHA 5G4EA 4LVAA 4UTIA 3GAYA 2VXNA 3NDOA 1T8XA 1QO2A 4AF0B 1O5KA 3BVJA 4DPQA 4HIBA 1XBZA 3CHVA 1C9DA 1RQBA 5LSMA 1HO1A 2ZYFA 2ZQ0A 2PE4A 1QPRA 2GQ9A 1I2QA 3QQ1A 3M41A 4ADSA 1VGAA 2NUWA 3N3MA 1G6CA 3ZWTA 1Q3NA 5CPLA 4FEZA 1LRTA 2Y6ZA 2YGYA 1W3IA 3B03A 4OGZA 1FBAA 1A50A 3SFKA 3B8DA 3LCXA 4HPXA 4DF0A 1JRCA 4U4MA 3A5VA 2AAMA 3C6CA 2EPHA 3WJSA 4E2BA 1Q6OA 3P5ZA 4IGHA 3DH7A 3CM4A 3O06A 3W2UA 1H1YA 3LRMA 1X1ZA 1QFEA 2VFIA 1HFBA 2BSLA 2GJLA 2VFDA 4N4QA 3M6YA 3IGSA 3G1HA 4HKPA 3NPWA 3IEBA 1OVDA 3TQKA 5KSWA 3A9IA 4JICA 1WOBA 3MWAA 2XN1A 2ZA2A 3W1XA 2H8XA 3BGJA 3L66A 3HO8A 4K39A 1SW0A 3W1MA 4K7VA 1H7PA 3IGXA 1NAL1 1AW5A 1XI3A 5DCDA 4Z1BA 4TO8A 3L68A 1X7FA 1OJXA 1RD5A 2ABBA 5CGQA 3BW4A 3WJWA 4PODA 5EPDA 1KTCA 1W54A 3L0GA 3ZWSA 1SR9A 4DELA 3P74A 2FLIA 2VELA 3BW3A 3QM3A 5D33A 3MI3A 4NJHA 1IF2A 3UPWA 4O14A 4UTLA 2DP3A 5BNKA 4QNEA 1TMHA 3SGZA 4GUHA 3JS3A 1RZMA 1LM1A 2IQTA 3I6RA 5FEPA 4XKYA 3STEA 2QDHA 1MZHA 5DXXA 3W75A 3QC3A 1VZWA 4MJMA 3Q58A 3TSDA 4BFAA 1OFQA 3CLMA 4UR8A 2ATSA 3HGOA 5AOUA 2DZWA 3VE7A 1W56A 1Z42A 3M43A 3QH2A 2A7PA 2H6RA 4LVFA 5AN7A 2EAWA 2Y7DA 3PULA 3EB2A 1ZHAA 4BWLA 2QUTA 3LHVA 3TR2A 3FLUA 1LP6A 4E2DA 4ZQOA 4K8EA 1XXXA 3ZS4A 1UB3A 4I7VA 5F4WA 2JBMA 4ZVJA 3M5YA 2ZZ1A 3OHIA 4A29A 4FNSA 3N14A 3FIGA 3NQGA 1AL8A 4UTWC 3NPUA 3OVRA 5G2IA 3KXQA 4JNMA 3M1ZA 5I3JA 3L5LA 3MBFA 2E09A 3DBPA 2ZRZA 4TR9A 2CZDA 4O1DA 4AMAA 1ADOA 4IX2A 3BARA 1FCUA 4EF8A 2C3ZA 4N2YA 1RR2A 2ZTJA 1GVOA 1X6UA 4DO5A 5GVJA 1GVRA 1K8ZA 1TPB1 2ABAA 4LWWA 4MVAA 4WZHA 4NJIA 2ZA3A 1MSSA 3WK0A 3W87A 3CB8A 5FESA 3GDKA 2DZSA 1SSGA 1D3GA 1TTQA 3EWXA 1VR6A 4DBDA 2YPIA 5H91A 3G0UA 4DPPA 4J9JA 3IIOA 1WDWA 1GWJA 3HG2A 3UZJA 4MUZA 1TV5A 1FXQA 1KFEA 3W7QA 4JIQA 4JTLA 2CLEA 4NT0A 5EY5A 4UNLA 3NQ7A 2X1SA 5KITA 4UCGA 1KA9F 4UXDA 4JGDA 7TIMA 2GVGA 4LT9A 2X1UA 2RKXA 3A23A 3QFEA 1GQNA 2F7FA 2NX9A 5ABTA 4RR4A 2CLHA 2EF9A 4L4LA 4PA8A 1PE1A 2G95A 3HB9A 5K3VA 4AHOA 3GXNA 3KRSA 4OHQA 4LS2A 4FHAA 3HJZA 3IVSA 5DBUA 3PWAA 3LV6A 2QCEA 4O0ZA 3HMJG 1DL3A 1W37A 5C55A 1I45A 1GZGA 1RPXA 1XBVA 4JTIA 2QR6A 2C13A 3W70A 4LTSA 4OWGA 3S1UA 1E51A 1BKSA 1EUNA 2DU2A 3W86A 4RZ5A 4UFHA 4FB7A 1FWRA 3UD6A 5CZ0A 3W7CA 2Y89A 5MHBA 3CQ0A 5FEXA 3RLUA 4UTUA 3EEGA 4UTMA 3GAKA 1C29A 1NF0A 1OYBA 1VJIA 4JD4A 3L65A 4DBEA 4GFSA 1S3HA 2DZXA 3IVUA 2W79A 3KRZA 2WOQA 3TC6A 1LBLA 8TIMA 2VEPA 3HPXA 5AYZA 5I3IA 3C56A 1AW2A 1L6YA 3O6CA 5IBXA 2NX3A 4PEKA 3NQCA 5HINA 3LI0A 3SECA 3LHUA 5CKSA 4XQ6A 3P8IA 1KM5A 1QOQA 2E6DA 3PF3A 1LROA 3P84A 4UTHA 4HSOA 4ML9A 3O63A 4WD0A 2CLKA 4K7YA 3D0CA 1FCVA 1TCDA 1AMKA 4JX6A 3I7QA 1XM3A 4S2CA 1A5BA 3PC0A 3TAOA 5EMUA 4M7TA 4YCOA 1M5WA 2YSWA 3E12A 4YL2A 4CQAA 1U5JA 3MP4A 3I7RA 3S6DA 1U83A 1QCWA 2YW4A 1JVNA 3G1SA 1YDNA 2I14A 1P4CA 2JKPA 3VCRA 1K8YA 1FX6A 4N4PA 5LHEA 1S5VA 4CLMA 1DKWA 4UC5A 1MEWA 4UTTA 1TPFA 4RZ6A 1T0OA 1WQ5A 2PC4A 1VH7A 3LCGA 3KVMA 3UY8A 4NVTA 1LOLA 3R5EA 3L5MA 4WXZA 1TO3A 5FF4A 3G8RA 2DJXA 3LDVA 4IMDA 1MEHA 2JKEA 2ISSA 4LW7A 1OHLA 1TPH1 2EGZA 1ME8A 3UPBA 3TV8A 2WO5A 3LLDA 3C2EA 3UXAA 1A53A 2QDGA 3NM1A 3R8RA 3NZ1A 3W7EA 4WQ6A 3WK2A 4CNOA 3PG9A 1WOAA 4HT3A 4GNJA 3W9ZA 3MUXA 2P0OA 3CU2A 4JX4A 3K30A 2BZNA 3CEPA 4QSHA 3HGJA 3W76A 4LRTA 3PSVA 2V0TA 2CLOA 4ICNA 2V2DA 2YXGA 1KBIA 5CG7A 2YCEA 3N34A 1TTPA 1PHQA 2VFEA 1I2RA 3P62A 3W72A 5AC8A 4YMZA 4XBSA 1F74A 3NYZA 2PRMA 3B06A 1EEPA 3NQAA 5AC7A 2QCDA 3GYEA 2LLEA 3UY7A 1JUKA 3PY2A 3GKFA 3W7HA 4UTTC 2W0UA 1VHCA 1OX4A 3LHZA 3BG5A 2QJIA 4A21A 1ICPA 3O15A 4MOZA 3HPSA 4IX0A 3RMJA 3ANYA 3O6YX 4WX2A 4TX9A 1UUOA 3LHYA 5TIMA 5AHFA 4QJ1A 4M6PA 3MYOA 1P1XA 2Q8ZA 1KLYA 2Z0IA 1N8FA 4XWUA 2VKZG 5DLCA 2VEIA 4JTUA 3BPWA 3LXCA 2Y85A 3G0SA 4L4MA 4U28A 1SZEA 5DXYA 3TIMA 3LERA 4JTFA 3I65A 3LX9A 5LHFA 5HMSA 3QEZA 1EX5A 1UCWA 2YYUA 1H50A 1JCMP 1H51A 5FF7A 2YFNA 3S42A 3W7MA 3VI2A 3LBCA 5EL1A 4TIMA 1N55A 1THFD 4H3DA 3GDLA 3MO7A 3CIXA 1KFBA 4K37A 4NNBA 3P7YA 4PCFA 1N7KA 4X3ZA 3TXVA 5K9CA 1GG1A 5D04C 4M6VA 1GVFA 2WNQA 2ZZ7A 3FJLA 4FIRA 2Z1BA 2QUVA 4HN4A 1OX4B 4XKYB 3GKAA 4ORIA 4JY9A 3M7WA 4AF0A 1XBXA 1W5OA 3WJXA 1VCVA 3QMRA 2HSAA 1GPWA 4ZQPA 1MEIA 3QPYA 3S5OA 1G7VA 1SO5A 5G1TA 4JYDA 1ICSA 4ALDA 5KZMA 3NNTA 1Z48A 3MP3A 3MJYA 1YPIA 2DORA 3W1UA 2CLIA 3UXDA 2G96A 1H1ZA 2NXHA 2KZHA 3W2KA 3FOKA 1JQVA 3EXSA 1L6SA 3PR2A 1LBMA 4O12A 1XDMA 4YLWA 3DZ1A 2FQIA 2E6AA 1JJKA 3TDFA 2P1FA 5K4XA 2H90A 1W5QA 3W6YA 1K7EA 4IPIA 1W3NA 4RV8A 3TFXA 4QQ3A 3PUOA 2G97A 3LXBA 1NF7A 4N02A 1O60A 4TMBA 2TRSA 1RV8A 4MY1A 4JTSA 2R94A 4K8HA 3LCHA 2Y88A 3C2FA 4MKNA 5G4WA 1IXNA 1TREA 1F7BA 4OV9A 1R2SA 4JEQA 3B0UX 4G1KA 1WAUA 4HNUA 4DXVA 3HQ1A 1VYRA 1NFBA 4OT7A 3C52A 1B4EA 3TA6A 4AH7A 3P67A 3S5YA 1Y0EA 3TKFA 4LVDA 1OABA 1FWWA 4CNPA 1X1OA 5G1YA 4UR7A 3EKLA 2V5LA 3LGEA 3RFAA 4MLRA 3DI0A 5AB3A 3TUUA 3L9CA 5CPNA 5F2IA 1FDJA 4X9SA 5KZEA 1I2NA 4NXSA 3DFSA 3W7JA 1YTEA 3PAJA 4ZMGA 4HSNA 3NG3A 4IMEA 3C2RA 4PL1A 5C5YA 3NEVA 3C4UA 2AQWA 3CTLA 1F6KA 2B7QA 5AHLA 3QQ0A 3B05A 1WV2A 1OFOA 4Y6GA 4DO4A 1HO4A 1MXSA 1TPDA 4JTTA 1SPQA 3ABRA 4NNCA 5HULA 3PG8A 1VQTA 4ZZ9A 2V30A 2DZPA 4YXGA 5HR6A 2RH9A 4PC8A 1BWLA 4QNWA 4Z1AA 4HNTA 5D38A 1TPVA 2A7NA 4O57A 1B9BA 1LYXA 3M9YA 2CFFA 4Y96A 1OFDA 1JULA 1TPEA 3EKZA 1TPC1 1KFCA 1KM1A 3P8JA 4OE7A 1K02A 1FWTA 1FWSA 4Z1CA 4UFJA 5IBXC 2X30A 2YYTA 3MP5A 1I8JA 1EPXA 4JXCA 1BWKA 1OX6A 3W7LA 4TMCA 4IXXA 1JUEA 2BXVA 5LNUA 4LUIA 4UFMA 2FTPA 1ZAJA 2A5HA 5FF2A 1T96A 1IIGA 4MFEA 2G5WA 1TV8A 2WV8A 3DFNA 4JIPA 4WOZA 1OFBA 5DELA 4UTWA 3TROA 2V2HA 3QRHA 1OFEA 4UTJA 5FI8A 1TQJA 3CEUA 3C2OA 3QZEA 3CPRA 4LS0A 3BG3A 4BWLC 2A1YA 3G0XA 2DZTA 4D2JA 4ONVA 5F1VA 3PSWA 3DKJA 3GLCA 4E38A 2Q3RA 1NEYA 4ZQCA 1TJRA 4MY8A 1WBJA 2J88A 4FNTA 2QAPA 3LCFA 5TQLA 2Y63A 1QPQA 2B7NA 3F03K 5IM51 3NGJA 1KFJA 1C8VA 3O8AA 4KWVA 5K2ZA 1SW7A 2JGYA 1XC4A 1FCQA 2ZRWA 1BEUA 4R34A 3VFLA 1I2PA 3S1VA 4HNNA 1FUYA 3H53A 4QM1A 1H7WA 3W71A 3FKRA 3NZRA 3UZ5A 1OK6A 3BLEA 3GDTA 3SJ3A 3DHDA 4AWSA 4AEOA 3UWQA 1JUBA 1GYLA 3FEMA 1H7RA 1DJQA 1ME7A 2NXIA 1SUXA 2E5BA 3BW2A 4OU1A 1OX5A 2TMDA 2Q3OA 3DFTA 2NX1A 4JYEA 1FDYA 1GYNA 4LC8A 1TYGA 3TFCA 4RKAA 5DCBA 2E5CA 4GXMA 1VCFA 3W7GA 1JQXA 3TNOA 4ADUA 4R53A 2R14A 3W1AA 1XDLA 3EWBX 2FIQA 1UASA 2A4AA 4HHPA 3SZ8A 3TW7A 2E6YA 1KV5A 4UFIA 4CCDA 1J2WA 1S5TA 1G7UA 2RDUA 2VENA 2BWGA 3W73A 3O07A 2I1OA 3KVKA 1JCLA 3IGUA 2YX0A 4UMBA 5G2WA 1ZCOA 3S1WA 1YXYA 3G22A 1RVGA 4BI6A 2WNZA 4N9BA 4O10A 2QCFA 3FYPA 3GR7A 4JTKA 3E0IA 2ZDRA 2RHGA 1XUUA 2R91A 5LNVA 3G18A 1QAPA 4ZQRA 3W1NA 4PFMA 2GQ8A 4KFOA 4XTIA 3IVTA 4C1LA 3JR2A 4RLIA 5D03A 1EB3A 3W85A 5K4ZA 3T7VA 3NOEA 5D30A 4LRSA 3KVJA 3P5YA 2Y61A 4PL2A 3NL5A 4MLJA 3HG4A 2ZBTA 5AHMA 2E6FA 3GNDA 1P5BA 1H62A 1VYSX 1K7FA 3LRLA 3EX2A 1TB3A 5KZDA 3LOTA 4C1KA 1QO5A 2V8ZA 5D2XA 1EP2A 5C2XA 4IPJA 1VPXA 1DQWA 4M5PA 1G4SA 4ZQNA 4Z0SA 3C2VA 2OMAA 3SI9A 2X1RA 1G69A 3T55A 2B4GA 4NNAA 3EX4A 3GNNA 4FX7A 2ZZ5A 3FYOA 2EKCA 4GC4A 1SSDA 3NQ2A 3QJAA 3QPZA 3GK0A 2CZEA 5F2GA 1TRIA 3G1FA 5EKYA 2DJLA 2GUUA 3W1RA 1XFBA 5F1UA 2RFGA 3TJLA 1ONRA 2NXGA 3EWYA 3DHFA 2DZVA 2FPYA 5U4NA 3V75A 5D2VA 2QCMA 4O1BA 1UBSA 2ZRVA 3QSRA 4M19A 1IXPA 3UNDA 2XFWA 2OCZA 3PB2A 1AG1O 1K3UA 3W7KA 3TXZA 4RX0A 4FIQA 4QITA 4GRSA 1OFRA 1Q6QA 3HPZA 3RNDA 1F5ZA 2C14A 4A22A 5G5IA 3GB6A 3LXAA 3G1XA 4TU1A 5AHNA 1JCNA 1JCXA 2CLLA 1LRNA 1I2OA 1IXOA 4GJ1A 3QW4B 1KFLA 1QNVA 1J5TA 3WJYA 1WYIA 1H61A 4IMFA 1YDOA 4MY9A 1JCYA 3HOJA 3V1PA 3W74A 1K03A 3S5NA 5EBUA 5F4XA 3KX6A 2CU0A 3LLFA 4Z1DA 1L9WA 1ZAHA 1MO0A 1GVQA 1V5XA 3M47A 3EWWA 3KVLA 3W84A 2X1TA 5A5WA 4ZL1A 3ZR4A 4JTJA 2GOUA 3NQ8A 1YTDA 3O6DA 4LVBA 3W23A 3GIYA 1TV7A 3L2IA 2V81A 1O95A 4JTEA 5FEWA 4M7SA 3NR0A 3L0NA 1QOPA 1KV8A 3ZFHA 3E02A 3HIJA 4Q4KA 4AAJA 3ABOA 2X16A 3GDRA 3LRKA 3SSJA 3HGRA 2HTMA 1Q6RA 4AB4A 4RJEA 5KTLA 5LZLA 2V82A 3N2MA 3STCA 1H63A 5BMXA 3BG9A 4EVZA 3THAA 1QWGA 2ZZ3A 2A21A 3W7RA 4O53A 1L6WA 4UMAA 2AGKA 1W5MA 1FDZA 2WNNA 3F4WA 1GVSA 4NZFA 1K7XA 1GTHA 4MZYA 2FFCA 2E5DA 3B4UA 4HNVA 3CT7A 3U8GA 3NQMA 4NUWA 4UMCA 3NAVA 3STFA 4RCXA 2PURA 4O16A 2TPSA 1LORA 1X8FA 5LNRA 1ZNNA 2NZLA 1Z41A 1OYAA 5I3GA 5D32A 3CWOX 3SR7A 1W3TA 3PM6A 3IV3A 4NJGA 4NX0A 4Q32A 1AK5A 1SFJA 1QR7A 5FEZA 3S5ZA 5AHIA 3IIXA 1GT8A 5A8GA 3B0VC 5G2HA 5E93A 2OJPA 4OV4A 5T26A 4N9DA 2ZFAA 4FXSA 4ADTA 3G1YA 4JYFA 4O0KA 4I9AA 5HNRA 3O16A 4MYXA 1OK4A 2ZCGA 1NSJA 1ML1A 4FO4A 4N6EA 1YXCA 1T99A 4AWUA 3DGRA 1KM2A 3EX6A 2VFGA 4UFKA 4CNNA 4MJZA 4GUFA 5C6MA 4R33A 3UWVA 5BW6A 2ALDA 2DZUA 3BLFA 2RDWA 3U6WA 3YPIA 4AXKA 2GVLA 3I68A 3LB0A 4Y9AA 2C19A 2Y70A 3FS2A 5D09A 1IIHA 2PCQA 3OVQA 5CSSA 4LU0A 4BK9A 1ALDA 3H55A 1SZNA 4BI5A 2HS8A 1B57A 1KTNA 6ALDA 1TSIA 4Z0JA 3DKLA 5L6UA 2WSRA 4O17A 2F84A 3N9RA 3C61A 3NQFA 1NVMA 3ABQA 3R89A 1DV7A 5DY3A 3TJXA 2I9EA 4NX5A 3CWNA 3PVFA 3UWYA 4NQ1A 3HGSA 1GOXA 1ME9A 4NXKA 2C15A 5HWMA 3WK3A 4O11A 1EA0A 4JY8A 4A2RA 4O50A 1YADA 3QSTA 4FNUA 4KFPA 2ZZ2A
chains in the Genus database with same CATH superfamily
1KTBA 3DERA 3VIOA 2OEMA 3PB0A 1XRFA 2CC0A 4WUIA 3W2MA 4X0VA 4LV9A 1GNXA 4NL1A 1Y8BA 1GG0A 3MCMA 3AHVA 4FZIA 4H6RA 3L5AA 2OB3A 3V18A 2GL5A 3D47A 3MDUA 3P0XA 4LVGA 2NWRA 2EBNA 1QXLA 5CZJA 4AZHA 1PKLA 2W6RA 4OOZA 4MUPA 3KP0A 4NAEA 5I02A 2QVHA 3G3MA 1LTDA 5DY2A 1LL4A 3LCIA 4WY0F 4YWSA 1JNEA 1TTJA 3C0QA 2YL9A 3R58A 4EF9A 3H2CA 2J62A 2H8ZA 2E77A 2P8CA 1ZALA 2WVVA 3BLIA 3WEOA 1UJPA 3LTPA 1BQGA 3HV9A 3R1ZA 1QI5A 3PBUA 4M6QA 3RN6A 2CKSA 1AL7A 1HVXA 4WJ8A 2Q8XA 3QV7A 3NZPA 4XUYA 3MI6A 2VX4A 1M7PA 1E70M 5HQLA 2HNEA 5D2WA 1P0KA 5JH2A 1B3OA 3FJNA 2Z29A 3MMTA 1LWJA 4JFWA 3GUGA 3CXOA 4F8XA 4YCPA 3TTEA 3GXIA 1G94A 3USBA 1J4EA 2W3ZA 5D8WA 4EE9A 2ZRYA 1TJ0A 4F79A 3ABSA 5A6SA 1GZJA 3CIWA 4XSLA 3NO3A 1YTKA 4WY0B 4I9MA 4BF9A 1OT1A 1E6XM 1M68A 1ZFJA 4EWND 5LNSA 4ZO6A 3BICA 3VMPA 3RF9A 3DX5A 2NSOA 4KWSA 4POCA 3TP4A 4CEUC 1I4NA 3RK8A 4WOQA 4I90A 1SW3A 2C7FA 3QF0A 5EMMA 1IQ8A 2I16A 4XZ9A 2J66A 2WC7A 3BV4A 4XD6A 3VGDA 3A3WA 3ZQ9A 4ZSTA 4GH3A 5CPMA 3TH6A 4D6HA 1RCOB 3C8FA 1ZBVA 1VHNA 1PCWA 3LHWA 3QPEA 5D02A 3TLLA 1H60A 2DGAA 3K4WA 4D1IA 3AHXA 1DE5A 3GW3A 2WSQA 1W3JA 1O66A 1NDWA 3RR4A 3WYZA 2R1MA 4IWWA 4AZ6A 4ATDA 3GC4A 4FX8A 4DXXA 2B7OA 4NZ3A 5D4YA 2RUSA 4NU7A 4NG3A 4MWAC 3LPGA 3LZ5A 4I5RA 4IIHA 1EF2A 3SGUA 1YXDA 2CBJA 3BTNA 3G1DA 2FB2A 4YTSA 3EWCA 2Y7FA 1BSIA 4FOUA 4JTRA 1Z3NA 1FWBC 4OQVA 2ISDA 3BWWA 2XIBA 1E9ZB 1VLIA 3GHSA 2GQAA 1NU5A 1J8VA 1US0A 3NZGA 3H4WA 4DJFD 2YDAA 3EOEA 4KRUA 4CCCA 1CXFA 3LBMA 7PTDA 1DXEA 3LCWA 4FOKA 4FLSA 2ALRA 3QVQA 3G1VA 1D8WA 1OADA 3WD2A 4PTXA 4Q33A 3LN3A 4P5UA 1S3TC 1G4TA 1FQ0A 2VURA 4MNLA 2Z6IA 4L5ZA 3VDGA 2X0HA 4P8UA 3W01A 1KCLA 1QPOA 3QLDA 3W7NA 2JKAA 5E70A 2ACUA 4WSJA 3Q94A 3KFTA 5JBEA 3GNPA 2Y7EA 4I9TA 3TTYA 5FJTA 3VOFA 5FAJA 4PULA 4DJEA 3SCNA 2C1HA 2ZRUA 3LM7A 4PB3A 4GKTA 5AC4A 3I6TA 1ZRQA 4UTKA 4JZ5A 2PDGA 2ZZ6A 3WNNA 1DJGA 5JIPA 1IEIA 3PFRA 2QF7A 3IJ8A 4RPQA 2ON3A 3VKCA 3S0CA 2VDIA 3UXLA 3DAQA 1XICA 3IRSA 1S5WA 4LS1A 4H9MA 4FNPA 5CC7A 3WBYA 4XZIA 1HW6A 4YTUA 2NWSA 1SMAA 4HU8A 2HQAA 3K13A 1OG0A 3W88A 4PMNA 4JS3A 5GJNA 3HF3A 1OFAA 1R30A 3CQKA 1C8YA 2NQHA 3A9BA 4PB4A 4BQ3A 4GI9A 3AS3A 3AI0A 1LDCA 2YW3A 1FY6A 2Z1KA 4CGTA 4YWIA 2BHYA 1A4MA 4LYKA 1BXNA 5TF0A 2YA0A 3RMEA 3NO5A 2FB3A 4H7ZA 3GU9A 3SW6A 3CZLA 3VOJA 5ABGA 2QJGA 2G37A 1NDVA 3AO0A 2YA2A 1H5YA 1POKA 1J10A 1M6JA 1GCYA 4GPNA 1OC5A 2HPMA 3GXTA 5C2CA 4IUGA 3K5XA 3WLRA 4PYSA 3FA5A 2FHBA 4Y9PA 3W1TA 4IFOA 2VEMA 3ICJA 1LOQA 2J27A 2A2IA 2VC6A 4O4VA 1XKYA 1ONWA 1EWEA 4IUOA 4AX7A 2E9BA 3W24A 2BXYA 1KM3A 3WQFA 2B0MA 5I3KA 5C9XA 4AIBA 4AMCA 3KAOA 2J24A 1O6IA 2I9UA 3THQA 1SFSA 4JKLA 5DMNA 1UPMB 1TTIA 3A4XA 4CD5A 4AU0A 8A3HA 3GVGA 2A3HA 4JL1A 4QAIA 5HR7A 2YCLA 1MDRA 4Q8QA 3W2LA 2F2HA 2WZIA 4A6GA 2EHHA 5LGZA 3OLDA 3GFYA 3URBA 1XRTA 3GXPA 4YPJA 3UT0A 2O55A 2QYGA 4LAZA 1YNYA 4WLCA 1FVPA 3G24A 3CTTA 4GACA 3V0UA 3I10A 4JDBA 4ZFMA 2RDTA 4W7VA 3VDHA 1GTEA 1GOQA 1DE6A 1QW9A 2IKGA 1UKSA 2FPTA 5HNNA 3WF4A 1LL6A 3QY7A 4HK5A 2XPKA 1NDYA 5U7SA 4DI8A 4RL3A 4PUUA 3PPHA 3TCEA 1BHGA 4PTMA 4IL0A 1M3UA 3NQ6A 2WMIB 3AS0A 5BRBA 3L0KA 3RYSA 2WC3A 3VAVA 1ICQA 1GOMA 2J8GA 3R2GA 1PYMA 2NSXA 4AZ7A 2J9YA 3OIXA 4CCEA 3SCWA 2ACSA 3FHAA 4M0XA 1BGAA 3H54A 5KETA 3T40A 1DJZA 1MVYA 4GXPA 4MDOA 4HN8A 4M3PA 4MPQA 4GIAA 2V6AA 1X98A 3VGHA 3W3OA 5A6MA 1D7FA 1XKJA 1IT8A 5GPRA 3APYA 1YW1A 4UUIA 3EB3A 2HE8A 1SQ7A 2ZXBA 4W88A 5E1QA 2CZ5A 4DF1A 1DYSA 3C3UA 3D3FA 1K8XA 1XLCA 3WUGA 1TWIA 1KM6A 3F5KA 4V1YA 2OTDA 2R6OA 4PH6A 2ZE3A 3VNMA 3NM3A 1EDGA 1QI0A 4LB3A 5E6ZA 3MHUA 3N1AA 2D0GA 2X7VA 2VYOA 4B4HA 2IUZA 4CVUA 4LCRA 2QCGA 2F2KA 3BUVA 2PDKA 3CMJA 2BX7A 4FI4A 3GC2A 3ME3A 2VZVA 4U5IA 1XINA 4ORMA 1W1VA 3AJXA 3N2OA 1ZAIA 2NLIA 4MFDA 1E43A 5FAGA 1HIZA 1HUVA 5I5RA 4US6A 3VM5A 1XLKA 4P61A 3LTYA 3ABXA 1AH0A 4RE0A 3VCCA 1MUCA 4DWSC 3VGFA 4QISA 3V16A 3KOFA 1XLFA 1TQXA 3KCOA 2YLLA 3H2FA 2OYLA 4D8ZA 4O1AA 3NJ3A 2GPTA 2IPJA 3BO9A 2VX5A 5GNYA 4LC6A 3HURA 4BS0A 3P93A 4UTIA 3GAYA 2VXNA 1MDLA 1JDAA 4E4UA 4AF0B 1O5KA 3MSRA 3W00A 4KW2A 1J2BA 1RQBA 2AKMA 2I5QA 2OOFA 4B4FA 2JEPA 4JKMA 3CL6A 2ZQ0A 1QPRA 1ESWA 3OA5A 4U3CA 1VGAA 2VCBA 1G6CA 3R11A 3KS5A 1M04A 5CPLA 1T6MA 4IGSA 4FEZA 4IP5A 1HJXA 1LRTA 2YGYA 3B8DA 1V3IA 2WVVB 4U3AA 2XYLA 2H9AA 2EPHA 3HTWA 3WJSA 1PX4A 3AXXA 1XYZA 1K9EA 3P5ZA 4IGHA 5DMMA 3O06A 3BMVA 4PMOA 2GK1A 2WMHA 4JQ2A 3IGSA 2B31A 4H2HA 3G1HA 2DSZA 4S3GA 3AHZA 2ZA2A 3L66A 1GORA 1OGGA 1V7AA 3IK4A 1Q6GA 3IGXA 4J3ZA 1NAL1 4BF5A 1XI3A 5DCDA 4EP8C 4Z1BA 1KFWA 3B97A 1EIBA 2PTDA 2VDGA 1BXCA 1XLDA 5EPDA 3L0GA 4DELA 3P74A 3PPFA 2GGJA 2FLIA 1QATA 2VELA 2ZVIA 3BW3A 3HQNA 5FJOA 5J8LA 2UY3A 4WJXA 4U31A 2DQXA 5HNUA 2DP3A 2AAAA 3QR3A 3U5UA 1LM1A 3DYMA 3STEA 2O9RA 1MZHA 1KCZA 3A64A 1KWKA 3A47A 2AQVA 4MJMA 3OBAA 1OFQA 4UR8A 1YE4A 2ATSA 3MZ2A 1CZ1A 2J7CA 4CD6A 1O68A 1RALA 1Z42A 4PFHA 2Y7DA 5A94A 3LG3A 3N4AA 5AECA 2QUTA 3TR2A 1RK5A 3WQPA 2V5KA 2JF6A 4S3EA 4ZQOA 1XXXA 2SFPA 3U5YA 4Q7BA 1TVPA 1M9HA 3WBWA 4FAMA 4JFSA 3OHIA 4A29A 3FIGA 1HKVA 1R3SA 4UTWC 4AD5A 3EOOA 5C9ZA 2HISA 1B3WA 1X97A 1MFVA 3KXQA 1FWIC 3M1ZA 5I3JA 3MBFA 2E09A 3VD3A 3DBPA 2ZRZA 4TR9A 4AISA 1RK6A 4IX2A 4OIFA 5H8PA 2FZ8A 4DO5A 1UD3A 4JPGA 2G41A 1MMFA 3H2OA 2CHRA 1HKKA 2ZA3A 4UB9A 3U9IA 4WK9A 2DZSA 1TTQA 1VR6A 4DBDA 2ZIDA 3IIOA 1WDWA 3HG2A 1DWGM 3WEZA 1V0NA 2E9LA 4XK2A 1TV5A 3GC5A 3CS2A 2QJJA 4JTLA 6TAAA 4NT0A 1IWAA 2X1SA 5KITA 3W4RA 4YIWA 1VFLA 2PF8A 4DWSA 1EOMA 2JEQA 1SJCA 4JGDA 4F66A 2E9MA 3SM0A 3K8KA 4OOUA 2RKXA 3A23A 1UBPC 3FK4A 1V3HA 1DWIM 2CESA 3PN8A 4S3KA 5K3VA 1PE1A 3HB9A 3KRSA 1BYDA 4OHQA 3HJZA 4GD0A 3IVSA 3FSUA 3IAQA 1DQUA 4FLQA 3PWAA 4OECA 1VD6A 4B91A 3IJLA 5JVLA 2JIEA 1W37A 1XBVA 2C13A 3LNPA 3W70A 4QXIA 2REQA 1EUNA 3HFYA 2DU2A 3W86A 1NELA 3BDKA 4RZ5A 3WFLA 4LAKA 3VPLA 5CZ0A 4JBRA 1IZJA 1Q85A 2Y5EA 3CQ0A 5FEXA 1KXHA 4P8VA 4CQBA 4DXKA 1OYBA 1VJIA 2FDMA 4JD4A 3OW1A 2PUZA 4LSBA 3L4VA 3GIPA 2DZXA 4PMUA 3TC6A 2VEPA 4C6MA 3C56A 1XISA 4DAIA 3G5EA 3KHDA 5IBXA 2WYSA 4XQ6A 4AIUA 5I0DA 3WH6A 4ZENA 5BCAA 4ML9A 2V5JA 1ZBKA 4H1ZA 1OSEA 2CLKA 4LPCA 1R85A 4JX6A 4S2CA 1P1MA 3KOXA 1UWRA 1Z7AA 1PKNA 1BAGA 3ENLA 4YL2A 3T08A 4CQAA 2PLJA 2GK1B 2HE5A 3PZGA 1JL8A 5A6TC 1U83A 1QCWA 2YW4A 1JVNA 3G1SA 4INFA 4QG8A 1Q4NX 2JKPA 3F5JA 2VGFA 1FX6A 3T81A 2EJAA 1DKWA 4UC5A 1MEWA 4KRZA 4GIYA 2PDJA 1E40A 1T0OA 1XRSA 1V3LA 3UY8A 4NVTA 1LOLA 3R5EA 4CN4A 3L5MA 4WXZA 2UY2A 1XGZA 3EEZA 3B0XA 3WDPP 3FXYA 5AVHA 1MW2A 1MEHA 4L1GA 1KRCC 4LW7A 1B3YA 1TPH1 2EGZA 1RXOB 3LLDA 3H12A 1B5TA 4S23A 3R8RA 3IUIA 3W7EA 1WZAA 4NAFB 5LYRA 4C6EA 3R7MA 3SN1A 3UGVA 2P0OA 4JX4A 3K30A 3E38A 2DIKA 3CEPA 4E4PA 3W76A 3PSVA 3SN0A 4HOWA 3BGAA 1UP3A 1WNOA 3JU2A 1PHQA 2VFEA 2Z4GA 4QE1A 3P62A 4DNMA 5E0CA 4GABA 4B2DA 1C92A 3ZOAA 2PDHA 1UOKA 3CIVA 1Q5MA 1JUKA 2XISA 1N8WA 1B90A 3GKFA 3W7HA 1VHCA 1ZUAX 4L4PA 3WH5A 4IX0A 2BHZA 4E2VA 3ANYA 3O6YX 3KOZA 4WX2A 4TX9A 4RE2A 3SUUA 4QJ1A 3WQEA 4W4QA 4M6PA 1I60A 2Q8ZA 1KLYA 5LA2A 4L6HA 3LXCA 1TZZA 1Q7QA 1XYCA 4FMVA 2PTZA 5LHFA 5HMSA 4MWAB 1HJVA 5DO8A 1JCMP 5FF7A 3S42A 3AU6A 4TTUA 2OX4A 4G8TA 5GNXA 4H6QA 1A5KC 3CIXA 4GZIA 1NOWA 3P7YA 4PCFA 3ZO9A 5K9CA 1AFSA 3HQPA 5D04C 2WMGA 1E4IA 1GVFA 3ARPA 1JI2A 2QUVA 3LBOA 1WCGA 5RUBA 1EJWC 4ORIA 1L8NA 4AF0A 4G1NA 1VCVA 4XAGA 5E9XA 3M0VA 4NZ5A 4JYDA 2ZX5A 4GVHA 1UC5A 3RX4A 4ALDA 2AMGA 3MP3A 3MJYA 1YPIA 3KL3A 2NXHA 1EHNA 3W2KA 1L6SA 2TAAA 4IFKA 5K4XA 3R94A 3WQ6A 4Y2WA 4F2TA 2CKRA 4RV8A 1XIDA 3D3AA 2V5DA 3GYCA 3MZNA 1WE5A 1W9DM 3LXBA 4N02A 1O60A 4MY1A 2R94A 2Y88A 3ARZA 1QBAA 1KWGA 1I9CB 4HZ7A 1JZ6A 1VJSA 4QR6A 1V3KA 1XCWA 4F0SA 2HXTA 4DXVA 1XX1A 2FHCA 3GG1A 2PMQA 4OT7A 1W9XA 4HNCA 3TWBA 3S5YA 3AALA 1U2YA 1X1OA 3MKCA 5G1YA 3O2LA 1QNQA 2V5LA 1X8CA 4UBPC 3H7VA 3DI0A 4GZJA 3TUUA 4AXNA 1QJWA 2XUCA 4GQ0A 3QTGA 1I2NA 4NXSA 3DFSA 1VEOA 4QX4A 1X6LA 4HA4A 4RZBA 1OM0A 2YL5A 3TJ4A 1YTEA 4ZMGA 4HSNA 3NG3A 4J2PA 4LAOA 4WF7A 1FFQA 4C6DA 4LJ3A 3WNOA 3C4UA 2AQWA 2DDXA 3PTQA 3QQ0A 3B05A 4MMWA 4DM1A 4DO4A 1TPDA 3L4ZA 1LWIA 7A3HA 5HNTA 1ZJAA 4M8UA 5FOOA 3IV8A 3NEHA 5HULA 3ITGA 3KTXA 4ZZ9A 6A3HA 3TNBA 4HB7A 5CXPA 4YXGA 5HR6A 3QZAA 4HMCA 4HNTA 3AIBA 1OG6A 3VKBA 3PJTA 3CMGA 1UA3A 3O0KA 4U2YA 3TOYA 2PODA 2CFFA 5BU9A 2JFEX 4KH2A 1JULA 3AIQA 1BF2A 3WH8A 1KFCA 4KRTA 1KM1A 4OE7A 3CWHA 4UFJA 5IBXC 1L2QA 3MP5A 4JXCA 4ZTXA 1JUEA 4UFMA 2A5HA 5FF2A 2ESCA 1T96A 1IIGA 2G5WA 3DGBA 2WV8A 3QHMA 3N29A 3S2LA 3OO2A 1OFEA 4UTJA 5FI8A 3POHA 5C0QA 2C0HA 3BAXA 1C9WA 1FWHC 4KBXA 3EMQA 3VILA 4BWLC 2VM8A 4ONVA 3DKJA 3S2CA 4XZWA 1NEYA 1PJ9A 1WBJA 4FNTA 2QAPA 3NQBA 1C8VA 3WMSA 3B4YA 2G3IA 2ZRWA 1BEUA 4XG1A 4AY8A 3H53A 1R9YA 3PFMA 4E8DA 3BLEA 2XIOA 3SJ3A 2EXOA 1JUBA 3FEMA 3CO8A 4QAWA 1OX5A 2Q3OA 1FDYA 5E09A 1TYGA 5DCBA 3TNOA 2R14A 3W1AA 4HYVA 1J0IA 4MJ4A 3H4XA 2VZOA 1KV5A 4LALA 1S5TA 2WMJA 3RM9A 3W73A 3A3XA 1KR1A 4KCVA 3GR4A 2YX0A 1ZCOA 3V36A 3G22A 2ICSA 3DG7A 4BI6A 2WNZA 3WLNA 4O10A 3WMLA 1EL3A 3WZ0E 2ZDRA 3V1HA 1XUUA 2R91A 2ZXDA 3ARRA 3SRHA 4ZQRA 2DSKA 4B9YA 1W1IE 3WD4A 4AVOA 2OWCA 2NQ5A 1EB3A 3W85A 3OU8A 5K4ZA 3T7VA 1ENUA 3PNZA 5CBBA 5D30A 4A05A 2UWFA 3KVJA 3OQ8A 4PRWA 2MANA 3U4AA 1OWQA 4KEUA 4MLJA 4WKHA 1H62A 1TB3A 4DWSD 3PANA 2VQUA 5CGTA 1R86A 1D7KA 1EP2A 5BU6A 5C2XA 4IPJA 2DSVA 2OMAA 3CHDA 2X1RA 4R7OA 3EX4A 2ZZ5A 5FA5A 2JQXA 3NQ2A 3QJAA 5HBFA 3GK0A 3ES8A 5F2GA 6CGTA 5EKYA 5I77A 5LIKX 4EX4A 2GUUA 3NFUA 1JZ4A 1J11A 3SQSA 1N82A 2D3LA 4TX8A 3P0WA 4R3UA 3OZOA 4KEMA 2NXGA 3LNMA 2QMKA 2DZVA 3OP2A 1B30A 5D2VA 1M41A 1RBLA 2OYMA 1UROA 2CXEA 1RLDA 4M19A 3LMZA 1XS2A 3ARUA 3W7KA 4HZMA 1UYQA 2YOCA 1OFRA 3HPZA 4HSHA 1F5ZA 2Q02A 5D9PA 5ECVA 2OLAA 4FOJA 3G1XA 3EDKA 5AHNA 1W8GA 2BBFA 2R1NA 4TUFA 4CD8A 1Q8AA 2ZC1A 3QW4B 4XAZA 3WJYA 2CETA 1H61A 3V1PA 3P3BA 1JCYA 4AIEA 3W74A 5F4XA 2PBOA 3RPTA 3LLFA 1J18A 1L9WA 1BSLA 3EWWA 4DAFA 3W84A 1TX2A 3K4DA 1BTCA 1RP8A 3LPPA 4W8LA 1TV7A 3L2IA 1IEXA 1C8QA 4KWUA 4EACA 2G3NA 1FOBA 4R9OA 3WBAA 5REQB 2YKKA 3L0NA 4HZ6A 2VP8A 3WIJA 3WFZA 4HMNA 4EXQA 3E02A 3ABOA 3VUSA 1DWHM 4ZBCA 3MV01 4W5UA 2PDIA 1DPMA 1PTDA 1HP4A 1H09A 3THAA 4YNGA 3W7RA 2YLAA 2VJXA 1GJUA 3HU7A 1JD9A 1XIMA 4MKSA 4NZFA 1GVSA 1HJWA 1K7XA 3EZ4A 4GI4A 4PCNA 3ALGA 4O0QA 2E5DA 4TVCA 3N2TA 4NUWA 4RCXA 4IIGA 2TPSA 1ZNNA 2YIHA 1OYAA 3CWOX 3BV7A 2X0SA 4J3XA 1UIPA 1AK5A 1SFJA 4G5DA 1QR7A 3VKAA 3S5ZA 1FKWA 1GT8A 3HA1A 5E93A 1R8LA 4FXSA 3UA4A 3G1YA 4AG0A 4GX9A 1NQ6A 4HPNA 4MYXA 1B3VA 1E1FA 1N2VA 1NSJA 1ML1A 2Z1XA 1R3TA 4UFKA 5IOBA 5B7YA 1QHZA 4HK6A 3PZUA 4J2MA 1UHVA 2ALDA 4FK9A 2ZUSA 1U1HA 1DJXA 1RBOB 4GHRA 3YPIA 5FIPA 2GVLA 4I5UA 3I68A 4Y9AA 2C19A 2PTYA 2PCQA 1SZNA 3WMCA 4P8WA 1B31A 1EBHA 3EB4A 4RDVA 1XG3A 2HJPA 3H2MA 2ZX9A 3VMNA 1RUSA 3UWYA 1ME9A 1XYFA 3ZIZA 3QSTA 2DSUA 2GDQA 1CIUA 4FNUA 4DM2A 2AMXA 1K8CA 1F05A 4HBKA 3PZVA 5LGXA 4S3JA 4CD7A 1R3VA 3UQNA 5K9DA 1H2JA 3N4EA 1KLZA 1W9PA 1R7AA 4IL2A 3T4CA 3WLKX 3MMUA 3VE9A 1LQAA 1W31A 3N11A 1D3HA 5BXTA 1B4KA 3NTYA 2J9XA 3PUEA 2ISWA 5J5RA 1PHWA 4LOCA 1V6XA 1F8IA 2XSBA 3L67A 4MPKA 2EG6A 2W5FA 2TODA 3BOLA 2WVTA 5DN1A 3NQVA 2WKGA 1O5RA 3USZA 3OTRA 2UV8G 3TMQA 4W87A 4HCHA 1XLAA 3WD1A 4XTDA 4AWTA 3C2YA 4EOUA 5CJMA 3SURA 2JGQA 3DI1A 1CX9A 1R2RA 3BLOA 2HMCA 3UJFA 4S3FA 1GJPA 2V5CA 3SJNA 1MYRA 1QPNA 3L12A 3R12A 4BCEA 3EX1A 2OELA 1HN1A 3C8NA 3VIIA 5ABHA 5D2TA 2OVLA 3PBWA 1ONXA 1PZ1A 1HL2A 2TYSA 4ZSUA 1U5HA 1A3WA 1J93A 1AJ2A 4LGXA 4ZA0A 2O4QA 1J01A 3JRKA 1SR0A 4GIEA 1GQJA 3IANA 2OZ3A 4DLMA 3ITXA 1C91A 3A24A 4RUBA 2PRLA 4KF1A 3OYZA 1OFPA 1YNQA 3U48A 2YBUA 4QQUA 1VFMA 4AEEA 2DEPA 3B8IA 3GXDA 3OG3A 1W1PA 1K9DA 1UD8A 2CW6A 3DXIA 2XGBA 1Y65A 2ATMA 4H41A 5DCEA 1TPUA 2CLPA 2FTWA 3EWZA 3EPNA 4O54A 2W67A 4X60A 3C5QA 2NUXA 1US2A 3U0HA 1B2YA 3F4DA 1WDPA 3EWUA 3SIZA 1XRVA 3HBLA 2XIJA 4FX6M 2O7QA 3K46A 1TIMA 1UG6A 3TQ0A 5LNWA 3ZJ7A 1FP9A 4PUDA 5C70A 4H9YA 5IFTA 1NARA 3S9YA 4JTGA 4UFLA 3QYQA 5JH1A 2WZMA 4DZHA 1NDZA 2XWDA 4ACZB 1W1A1 2YZRA 4ZR8A 4V15A 2CLMA 1J0ZA 3LY0A 3HM7A 4QEHA 4JDYA 1GEQA 4AQLA 3UWZA 2HWGA 1S2VA 1PZ0A 3NL6A 1AQFA 4F48A 3WUFA 1A5SA 1JR1A 4MKVA 3BQ6A 2XIQA 1EXPA 3D6NA 4QG6A 1DJNA 3T2PA 3TQVA 4O28A 4IISA 4B5UA 4K6AA 5GJMA 3ES7A 3TC7A 4IZGA 1Z69A 5SWUA 4JTCA 4EANA 5LXXA 3E2VA 4PR4A 2ZZ4A 4CN6A 1JRBA 5LKYA 4AD4A 3M0XA 4FLRA 3IWPA 4IM4A 1PUDA 1E1CA 5CBIA 3VUPA 1WPCA 2AOSA 3I3EA 1KXVA 3V3WA 4LB4A 3LGDA 3A21A 3KL5A 4F0KA 1G0CA 2Z24A 1VEMA 3UYCA 5D05A 1NTHA 2WSYA 4L64A 4YYCA 3TQPA 3F4VA 2BGQA 1OT2A 2ISVA 1YLVA 3DFQA 3U2EA 4GVFA 1ZY9A 5BXSA 3NDYA 1HP5A 1XIHA 3S46A 2Z2BA 1QBBA 3THUA 1O94A 1W1B1 3W1QA 3ATZA 1I1XA 5AFDA 2X7WA 3Q37A 2WPBA 2YCKX 4HD5A 4MIMA 3QV8A 5BWFA 3P60A 4MADA 4U5KA 2NVCA 4UTFA 3QMSA 4JAWA 1Y5XA 3OA3A 1LLOA 2OO0A 4D8AA 4DJDA 2OOGA 3FYYA 3W6MA 2GGGA 3U2CA 4HPJA 4J28A 3NGFA 5T9BG 2CZFA 4WJEA 1PEZA 3AXIA 3E49A 2Y8KA 5A6BA 2GOKA 2FMOA 3VKJA 1SGJA 1PTGA 1EJVC 2I5IA 3C0JA 1CB7B 1UQYA 4L6DA 2E68A 3NL2A 3WLPA 3CZJA 4A3HA 9RUBA 3QMTA 4DN1A 4AHQA 4XAYA 4DBUA 5A6LA 1M53A 3TTOA 5A2AA 2F6XA 4OVXA 3IIPA 3M0KA 1PWLA 1SO3A 3UWUA 3GWQA 1YIXA 2FZ9A 1P0DA 3H2AA 2PWFA 4Q4RA 3ARYA 4G7EA 1G01A 1XL9A 3GDMA 2C1IA 1OYCA 1TV3A 3T0TA 3MC5A 3KHJA 4NRSA 3O3RA 2GZXA 3CC1A 3ARWA 3W82A 4JHMA 1RSCA 3EKGA 3NWRA 1FHLA 4UOJA 2QT3A 4YJ5A 1GKQA 2OSWA 3MS8A 3DU0A 1JXJA 4Q4SA 4HU3A 3RO8A 4HCLA 3TMLA 1CXEA 3WLSA 2V5BA 3EYPA 3K2GA 4RZ4A 4A2SA 1M03A 3TSMA 2BVDA 3LTSA 3OBKA 4TV6A 3G8EA 1IEWA 3P82A 1M01A 4MNMA 1VLWA 3WQWA 2AL2A 3BXWA 1TZ9A 4GVIA 1XDJA 2FPVA 1VIWA 3I7SA 3SY8A 3WFAA 3WELA 1H7OA 4QLKA 4W5ZA 3M5XA 1ZP3A 2GJNA 4L7ZA 4Z42C 1KNWA 5J5DA 2ZADA 3AIWA 5BMWA 4DVOA 3BJFA 5C7HA 1G4PA 5C54A 2TSYA 1QNPA 3PWIA 2WQDA 1FWGC 5D9MA 1W2VA 2H3BA 3TWAA 4WSHA 5H6HA 1UUQA 3ELFA 1CGWA 2C18A 1E9YB 2RGMA 3GQYA 1R2TA 1Q6LA 1XIBA 4FF7A 4YVXA 3TK7A 4MZ8A 3F2BA 4S2BA 1M7JA 3WX7A 2OLHA 4I7WA 3ZLFA 4I7UA 3TTQA 3H23A 1KRBC 2FMNA 3SADA 3OVPA 4PTNA 3RM8A 1O4UA 3LSCA 1LRQA 4XVDA 1BWVA 1UUMA 4C6IA 1QDSA 2XFRA 5JMUA 3W25A 1HJQA 2V2CA 3B04A 2XIMA 4LY8A 4Q7NA 1PZ2A 3E5BA 3SUTA 3QY8A 5DANA 4YTRA 3F1QA 1PL9A 1ZBCA 2YDQA 3ORWA 1SFLA 3M0JA 1S5NA 1S2TA 3S8HA 3B40A 2KAUC 3TX9A 3OLGA 2R8WA 1KBJA 2VEKA 5AHEA 1BVZA 3RPMA 3Q67A 1NY1A 3N18A 2E40A 2Q01A 2UBPC 3N2CA 4NSBA 3V7PA 4X2RA 1LUCA 3Q45A 1V6YA 1W1TA 1AD4A 4GK8A 1A5OC 3RITA 1HQTA 1X1NA 1IWBA 2GDUA 4D71A 3N2BA 2FZDA 3R13A 1Q2RA 3LENA 4AVFA 4FA3A 5BOFA 2J78A 2PP0A 3OPSA 1E55A 3BSGA 1KRAC 1XLBA 4MNKA 2JALA 1UKTA 4IPPA 4JX5A 1PIIA 4H8NA 5I3FA 3H70A 4W84A 1SO6A 2VZTA 5G1MA 3ITYA 3LPFA 4H83A 3RM4A 1IYXA 2GQ3A 1ONEA 1WBHA 5G4EA 4LVAA 3CZGA 1JGIA 3HJEA 1G9HA 1NH6A 2WHLA 1QO2A 4ZEPA 3BVJA 4DPQA 2PFHA 1XBZA 3RU8X 1EJRC 4EXAA 1HO1A 2GUBA 3SSZA 1DWAM 3M41A 1A5LC 2G50A 2W9MA 3ZWTA 1OZMA 2NVAA 7REQB 1E4NA 1U30A 1FFRA 3B9DA 2Y6ZA 1F8MA 3B03A 4OGZA 4H8HA 4DF0A 1JRCA 3LZ3A 4JIHA 2A3AA 3SB0A 4E2BA 1FA2A 1E73M 1TJ1A 1NWUA 3THDA 3OJGA 1XLLA 3CUJA 3W2UA 1H1YA 1PIFA 5HPOA 2BG5A 1X1ZA 4QRNA 2BSLA 2GJLA 2VFDA 5CPQA 4N4QA 1P48A 1WP6A 3L4UA 1J0JA 1OY0A 3NPWA 5HMEA 1J0KA 1V6UA 3W81A 4JICA 4HJWA 3MWAA 1TWZA 4IHCA 1SW0A 2BHUA 5HJYA 3COTA 1AW5A 2OYKA 4TO8A 1OJXA 2ABBA 3UYIA 5CGQA 4M82A 4GA8A 4B92A 1XYLA 3ZWSA 2BOEX 3TYZA 1OCJA 1NM9A 4D72A 4O14A 4UTLA 5BNKA 3GW0A 5FD0A 1ODZA 3LQLA 3JS3A 2OGJA 2IQTA 3I6RA 5FEPA 3TEVA 3AHYA 1PBGA 4X2PA 3EMCA 3F5LA 2F9RA 3QFWA 4TX6A 1VZWA 4LYRA 3R8GA 2DZAA 4BFAA 1KXQA 1TG7A 2DW6A 5AOUA 2PB1A 3GHRA 3AFBA 2A7PA 2H6RA 4LVFA 4GZEA 3PULA 3EB2A 2XHYA 3U4FA 3DG6A 2QS8A 3LHVA 1AQMA 3POCA 4K8EA 3ZS4A 1UB3A 3XISA 4I7VA 3PUGA 1O1HA 2R1PA 4LUTA 1JD7A 3M5YA 4URIA 1AL8A 1AH3A 3GFXA 5I00A 3DOPA 4JNMA 3L5LA 1V6TA 3QV9A 3VC6A 2CZDA 3IJ7A 2D23A 1ADOA 1TA3A 4N2YA 2ZTJA 4LH8A 4PUMA 2IXVA 2NT0A 1EZ2A 1K8ZA 3WD0A 1JI1A 1TPB1 4MVAA 5I3DA 3DIPA 3VDAA 3PZIA 4ATLA 4NJIA 3WLHA 5HA7A 1EO5A 1YBQA 1XCXA 2Q09A 2DT2A 4XIMA 5FESA 3GDKA 2VGGA 2D2OA 4MWAA 2C91A 1MQQA 3G0UA 2NW0A 1GWJA 3UZJA 2VVNA 4ERIA 1KFEA 3W7QA 2J74A 2CLEA 4LBUA 4HA3A 1EQPA 4GZ7A 3WH7A 3FA4A 4UXDA 7TIMA 1XC6A 3W27A 4IJRA 2QVNA 4RR4A 1KB3A 3VDBA 3T0BA 2EO7A 1GUVA 2CLHA 4L4LA 1HJUA 4LY4A 4BQ5A 2FJUB 1F3EA 3VXGA 4GNVA 2YXOA 3AYSA 2XGIA 4H6EA 1GK8A 3HMJG 4E5TA 1GZGA 1UOZA 3LLXA 4LTSA 4OWGA 3A6OA 4GGBA 1KRMA 4UFHA 1FWRA 2Y89A 3P2VA 3RLUA 4B15A 3GU2A 4UTMA 3BL3A 5DFAA 1NF0A 1CGTA 2WJDA 4E2OA 1JEZA 4DBEA 3L4XA 3DFHA 1XR2A 1C3FA 1RY0A 3IVUA 2W79A 2WOQA 8TIMA 3PZOA 5AYZA 1UR1A 1AW2A 3O6CA 2P88A 1D8CA 2CITA 2OQHA 3NQCA 5HINA 1E9LA 3SECA 3W26A 3P8IA 3LMYA 3CASA 1QOQA 3P84A 4HSOA 3O63A 5CJNA 4DBSA 3D0CA 1FCVA 1TE1A 5EMUA 4OBRA 1U5JA 3STPA 1G5AA 4QROA 3HZ3A 3MP4A 4EAMA 2DT0A 4HJFA 4KPLA 2ZUTA 4DJDC 4AVNA 4MWAD 2FGZA 2WHKA 1VBHA 2PDYA 1FHUA 1P4CA 1KKOA 3VCRA 1K8YA 4PUEA 2G8ZA 5A8MA 3CAQA 4RZ6A 3BQ5A 2INEA 3MV11 1A49A 1W9BM 3SEPA 4HP5A 1PX3A 2DJXA 4GY7A 3AYTA 3U7BA 2QIWA 2DH3A 3E5PA 3IAPA 1BPLB 2ISSA 4AZBA 1E6QM 1K77A 3UPBA 4HOXA 4OBSA 3C2EA 3UXAA 4M51A 1A53A 1XGEA 3WD3A 3WK2A 4CNOA 1TWDA 2IPFA 4UR9A 1IR1A 1FWJC 5DF0A 1WOAA 2WC4A 3PG9A 4HT3A 1UP0A 3CUGA 4RW3A 3MUXA 3FVDA 1LT7A 5DEZA 2OFJA 2BZNA 3QLLA 3KWSA 4PTWA 4LRTA 3S2MA 5M2FX 4ICNA 2V2DA 5E0FA 1VEPA 2YXGA 1KBIA 4XZNX 5CG7A 3VD5A 1TTPA 3TYUA 3CK5A 1C7SA 4YMZA 3PBGA 5I06A 3AWNA 3NYZA 3B06A 1HKWA 1R9XA 3WNLA 1ZCCA 4IGNA 4DYJA 1A47A 1HL8A 3GYEA 3WF0A 4AZIA 4CNSA 4GISA 1RPKA 4AZ5A 1OX4A 4XKMA 3G77A 2PEVA 1ICPA 3O15A 4MOZA 3LYEA 3F2DA 1NFPA 1TWSA 3MUCA 2P53A 2Z2AA 3FA3A 1E6SM 3MYOA 3ANUA 1AJZA 4ZE4A 5CCZA 4XWUA 3CUFA 2EG8A 3AIVA 2Y85A 4L4MA 4TVUA 1SZEA 2VUYA 4JTFA 3LX9A 1P0EA 1ZQ5A 3QEZA 1UCWA 2YYUA 3LM3A 1H50A 1YNPA 3VKDA 1H51A 3SY1A 3VI2A 2A3CA 4QS6A 6ENLA 5EL1A 4TIMA 3CYVA 4H3DA 3NIYA 3BJTA 1UWSA 3IPWA 4K37A 4NNBA 1F6YA 4X3ZA 3XINA 4GQGA 4FLOA 2DQWA 1K70A 2WNQA 4PE8A 2Z1BA 3M64A 4I8DA 1VAHA 4XKYB 3GKAA 4JY9A 2YZ5A 1XBXA 1W5OA 2PDCA 3WJXA 4LYQA 2V69A 2ZXQA 3GHUA 1E3ZA 1MEIA 3QPYA 4QTGA 1G7VA 5G1TA 2X2YA 3MMDA 4EPDC 2DORA 3UXDA 2BV9A 2G96A 1Q2SA 3JUGA 1VBUA 1DXIA 3EXSA 1EFZA 1HZYA 1V6VA 3EDJA 4W93A 2E6AA 2PDUA 2P1FA 1W5QA 3W6YA 1UR0A 4LBRA 4PUWA 4Q8WA 4DI9A 5M03A 4DNHA 4DJDD 1EEXA 3DG3A 4JTSA 4K8HA 4AFYA 2QXWA 3S4TA 1JGMA 4IIBA 4UOZA 1F7BA 4OV9A 1ZLPA 4IP4A 2BB0A 3KDNA 2L5HA 1CLVA 4HNUA 3VK5A 3HQ1A 1O12A 1U33A 5T9CE 1VYRA 3DDMA 2OU4A 1NFBA 1UKOA 3R8HA 1B4EA 2F61A 1CEOA 4QJ3B 3TKFA 1OABA 3T2QA 4A8NA 4E8GA 4UR7A 1GEHA 2VRJA 3ZJ6A 4L9XA 2W62A 5CPNA 4X9SA 5KZEA 3O0FA 3VTRA 4C6KA 3MSYA 2E25A 3WQGA 4MWAE 3W7JA 4WIWA 3QN3A 4IFKB 2AKZA 4PL1A 3TR9A 1F6KA 4GOAA 4R9XA 5AHLA 5FJRA 4OZOA 3BSMA 7ENLA 4Y6GA 2HV5A 4UOQA 1MXSA 4JTTA 3ABRA 3KOYA 4NNCA 4AY7A 1VQTA 4HYWA 4IG2B 3KL0A 2IPGA 4XIAA 4Y8EA 2VZUA 1BWLA 2XFYA 4OTKA 1J6OA 4U33A 1TPVA 2A7NA 1LYXA 3M9YA 3TJIA 4GBDA 1V0LA 3PZMA 3WH9A 4DX3A 1Q6EA 3TYAA 1XH1A 1FWTA 2VL4A 3ANVA 4IQDA 2X30A 1I8JA 3BH4A 4IPLA 4TMCA 2YL6A 3OLIA 2FZBA 2BOGX 4LUIA 2FTPA 3KLKA 4DB7A 1GOOA 5DX7A 4BKNA 1TV8A 3DFNA 5FJJA 4XO6A 4C1NB 3TROA 1CLXA 4J3VA 3WQ8A 1TQJA 2PLCA 3C2OA 4LS0A 1HNYA 3WQVA 3BG3A 2YCLB 3URAA 3OHMB 1TV2A 3G0XA 4PMYA 3PSWA 1E15A 1QHPA 1OINA 1QRQA 4ZQCA 4MY8A 3C86A 1AH4A 3KTSA 3LCFA 2Y63A 1QPQA 1P0BA 2CHOA 3F03K 3NGJA 3O8AA 1CYGA 1SW7A 2EKGA 2JGYA 3FW6A 1DIDA 2Y8VA 3VX0A 3QKZA 3RCYA 4HNNA 3OIHA 4EWJA 2E0PA 3UFYA 2DT3A 4XD5A 1R3YA 4UQCA 4GIRA 3UCCA 3B0YA 2ACRA 1WZMA 4XVEA 1H7RA 1DJQA 2NXIA 1SUXA 2E5BA 4OU1A 4QCEA 1WKEA 1KXTA 3DFTA 4F9JA 4JYEA 2BGSA 4LC8A 3AYRA 3TFCA 3B9AA 4GJIA 4GXMA 1VCFA 1W9UA 1NOFA 2FIQA 2GVEA 4HHPA 3LQGA 1R87A 1G7UA 4BA0A 1RJRA 2OSXA 4ZFCA 2EPLX 3KVKA 3O07A 2I7GA 3KBJA 4E6MA 2FKPA 1ZJHA 4AYSA 1YXYA 2GGEA 4K8GA 4GXWA 3ZR5A 3BLLA 2CNCA 5H8UA 1HKIA 1UR3M 4JTKA 4UZUA 2VT0A 5LNVA 3G18A 3GHTA 4NP7A 4PFMA 3GD6A 1JF5A 1SVDA 5D8ZA 3RPDA 1HGWA 2BY1A 2VRQA 4C5ZA 1R3RA 3GTXA 1JYVA 1TUXA 3S6OA 3CGTA 4CUCA 3MUZ1 4PMZA 1E0UA 1EJUC 2DV0A 1UIOA 2P8BA 1AZ1A 3HG4A 3DBNA 5BXPA 4HGXA 2ZBTA 5AHMA 2E6FA 2PI6A 1P5BA 1K7FA 3EX2A 5KZDA 1F3WA 4C1KA 1CGUA 2V8ZA 4JFUA 1IHIA 1MNSA 3B8TA 1ITCA 3W28A 4P7OA 4ZQNA 4EAYA 4JN7A 4QDMA 3CPGA 4FX7A 4DUOA 1CNVA 4JIEA 4JTAA 1QTWA 1VENA 5C2GA 4PSRA 4ZOCA 3FNDA 4F2BA 2IKHA 1ISVA 2VQTA 4PUKA 1FWEC 1DJIA 1X39A 3H24A 1DWJM 1FH9A 1IT0A 3TJLA 2CXGA 3EWYA 4NI8A 1BYCA 3DHFA 4KGLA 3PZNA 1S2UA 5M5DA 4NZ1A 3GO2A 1W1YA 4O1BA 2XSAA 1IXPA 2OCZA 3PB2A 3QGVA 1AG1O 1VBJA 4H8UA 3TXZA 4O1FA 4B90A 1UKQA 1XYBA 4GRSA 3W29A 5I7GA 1ITUA 3WENA 4A22A 5CSUA 5G5IA 3GB6A 2QW5A 1JCNA 2QHAA 4JOMA 1S5MA 5BROA 3PNUA 1PDZA 1UMLA 1RLCL 2OR2A 2Y5SA 1T7LA 4LUYA 4MAVA 3WSUA 1J5TA 1YDOA 4MY9A 3HOJA 3ITOA 5A8OA 3KX6A 4Q4MA 2X8RA 2CU0A 2HROA 4Z1DA 3KRBA 1V77A 1A5NC 1XF0A 3SIMA 1GJWA 1Z89A 2FYMA 3KVLA 4ZL1A 4JTJA 2Y24A 3PP7A 1EKOA 1GQLA 2X42A 2XH2A 4Q4QA 4LVBA 3W23A 1VFOA 4TTGA 1E9IA 3WNKA 2J79A 4N42A 3VU2A 4F0MA 4YHEA 4XAPA 4NIRA 1JCTA 1H5VA 4B5VA 1O95A 4KCWA 5FEWA 1EZWA 1KV8A 3ZFHA 3HIJA 5T91A 1X6NA 2X16A 4ES4A 4WKFA 5LZLA 1DWFM 4ZTYA 2QV5A 1ISWA 1H63A 1QWGA 3T0DA 2A21A 1L6WA 1T8QA 1W5MA 4B3KA 4BEUA 1UR4A 3F4WA 1WDDA 5AY7A 1DXFA 3R0UA 3NQMA 1WAWA 3STFA 1XIFA 1NWRA 2PA6A 3BE7A 3LPOA 3BJSA 1X8FA 1Z41A 1SMDA 1DEDA 4PRRA 5CZKA 4B5SA 1S38A 1W3TA 2BS9A 3PM6A 3BZGA 2Z26A 5FEZA 3B9NA 3B0VC 5A8GA 1BRLB 2ZFAA 4UQ9A 3URNA 4GG9A 3B3DA 4O0KA 3FJ4A 4B5XA 1SJBA 1E1EA 3O16A 5HNRA 1GKRA 1OK4A 3K4AA 1XHGA 3V35A 2WSKA 4N6EA 4NASA 1YXCA 2RJHA 1KM2A 4CNNA 3O6AA 1LL7A 4GUFA 3ZMRA 4R33A 3UWVA 5BW6A 1M7XA 6REQA 2WMKA 3U6WA 4WSKA 3FS2A 1IIHA 1IEQA 1I75A 2YJQA 1ZS2A 6ALDA 1TSIA 1UQZA 7CGTA 4Z0JA 3DKLA 5L6UA 1XG4A 4A8IA 3PJWA 3BMWA 3N9RA 3ABQA 3RX2A 3TJXA 3FDKA 3KBMA 5CPSA 1HKJA 3HGSA 1GOXA 5HWMA 4O11A 1EA0A 4TXEA 1R38A 1UZ1A 1WZLA 4KFPA 3BOXA 1ZL1A 3M16A 2AL1A 3DEQA 3WQCA 1QW7A 3S5SA 5A2CA 4RXGA 2Z25A 5C9UA 5A8PA 5C7VA 3CLWA 4Y8FA 5CSRA 5AYXA 2GFTA 3CBWA 1DJYA 3WBEA 1ECEA 4C6OA 5JBFA 4DZIA 3CAWA 1LOSA 2OPJA 1UD6A 1VRDA 3GZAA 3E2QA 5I2UA 3PUDA 4LBSA 2C6QA 4GYFA 1P6BA 4GUGA 1XIIA 2H3DA 3AZRA 4RNHA 3GG7A 3GFZA 4H01A 3WG6A 2P5NA 4Q6JA 2BLEA 1EWDA 3PS7A 5FACA 4MZ1A 4JTHA 2PCEA 4Q4OA 3C3NA 4RDYA 3LS9A 4HA0A 4LCSA 2PRHA 4FNQA 4LYPA 2Y5JA 6XIAA 3GU1A 2OKOA 4NI3A 1UR8A 2Z6JA 1RJQA 4OJYA 1ZP4A 1FH8A 1F76A 1OQFA 1DJWA 4IQEA 2E3ZA 3KCJA 4KGJA 1B9ZA 1XCFA 4ZB2A 3S3GA 3GH4A 3RX3A 2PWHA 4X22A 4GUIA 3VZZA 1JYXA 2P3ZA 4KWWA 3AXMA 1YX1A 4ZODA 4IQLA 3HV8A 1LLZA 4ZO8A 7TAAA 2CWNA 3V4BA 2WANA 3LHTA 2ZKMX 2E1WA 1A5AA 4BJHA 3QGKC 4IPNB 4RNFA 2OT0A 3MI2A 3IIZA 4JKKA 3AMDA 5F2MA 1HG3A 4MG4A 2DZBA 3NQDA 1R47A 4MYAA 4ZO9A 3WNPA 1KM4A 1OIMA 3QC0A 1KCXA 1FCBA 4LNCA 2A0NA 3WQ4A 2D20A 2PZNA 3T0CA 1LQ2A 3ONCA 4GH1A 4G6CA 3BURA 5CG0A 4WY0A 3QW3A 3CH0A 4KETA 1HT6A 3S6TA 3N9KA 4MB3A 4JTDA 1Z8AA 4CQ9A 1VCGA 2J7FA 4O8RA 1O5XA 5XINA 3DESA 3NURA 2O9PA 3GG0A 2GYIA 2ZUMA 3KCLA 4L9YA 3MMWA 5EFDA 1F4HA 2Y62A 3HG5A 1TPWA 3JW7A 2QKFA 1QMLA 4DUVA 3N6HA 1KM0A 3DC8A 3M46A 4AC7C 1UWUA 1BRLA 3U2OA 1KBKA 5CZTA 3WDHA 3TW6A 1OIFA 1YKWA 1D9EA 3S2JA 1PVNA 2WJZA 1V7YA 3E9AA 4J7RA 4GCAA 2BTMA 1DHKA 3N04A 5DT5A 1BYBA 1ITQA 3GRIA 3DFOA 3MHFA 2XVLA 5M3WA 1TVNA 1B54A 1JCJA 5T8GA 2Q6ZA 1TCMA 2O9OA 1T5AA 2NV1A 1V8EA 4IH3A 4EIVA 1PIGA 2PZ0A 2A79A 2G3FA 1PAMA 4DUXA 3GSMA 3C0LA 3WDIA 5EA9A 4WEVX 5I23A 2OSYA 3MW7A 1F6PA 3WK1A 3KUMA 2QGHA 2ZXAA 5F4SA 5AZ0A 5EB8A 2BP1A 4AY1A 4O52A 1LWHA 4BEQA 3UR8A 3W7IA 4HHHA 4GUJA 3ITTA 2XH4A 2P10A 4JR5A 5H2ZA 1BXBA 2NQZA 3BC9A 3WEMA 3RRXA 3N73A 3S1XA 3AUJA 1S2WA 3CUHA 1O5QA 1DBTA 1U1UA 4UIOA 4XUGA 5JBDA 2EEXA 3SCVA 4JQ1A 1RAKA 3VNDA 2A3LA 5ECUA 3FN9A 1EIXA 2D73A 4A3UA 1TV4A 1U1JA 1EDTA 3SRKA 3FKKA 5A6JA 1NWSA 1H0GA 3ZSSA 3CNYA 4GWEA 4Q8VA 2E28A 4DQWA 3SY5A 4J3WA 4EK7A 2OWXA 3V5OA 1N8IA 1ZENA 2X0YA 3VM7A 1EP3A 2X05A 2Z00A 4W7WA 3GTIA 3BCJA 3BAYA 2J6XA 3M44A 4RE3A 3W02A 2FDSA 4KKXA 1CB2A 4AD2A 1HTIA 2C71A 3MVIA 4GE8A 3GTNA 4KS0A 1XSIA 3T8QA 5AC6A 1ECQA 1WKFA 2QUMA 2C1GA 4OKDA 4D6IA 3SCQA 1WX0A 4IIEA 6TIMA 3AIUA 1M65A 2J47A 4HQVA 3RLHA 5KINA 1YE6A 4C7DA 2D1ZA 3CV6A 1SU5A 2YCJA 4OBTA 3F7JA 4GO8A 1IXQA 4R7JA 3OGRA 1KGWA 1W1ZA 1Z44A 3CPUA 1LUCB 3AYVA 3SAZA 4BQ4A 4ROPA 1T41A 4W85A 2QUUA 4XBJA 3PBVA 4GI6A 4PSPA 1CW2A 2V3FA 2FVMA 1G4EA 2GWGA 3RO6A 1CT5A 1O7AA 4PRTA 2XGZA 3IS4A 4Z2IA 2OX1A 3NDZA 1CXIA 2F6UA 3T44A 3I4EA 3ISIX 2CEQA 5EFFA 3S9ZA 5A1AA 4W8AA 3V5CA 2H9AB 3R4IA 2O7SA 4BR1A 2PSNA 1BTMA 3M0ZA 4O1CA 1J0HA 3V0TA 3KZPA 1BQCA 1W5NA 3W07A 2J77A 2VWTA 2QCDB 2D69A 4DY1A 1VC4A 2GVJA 1I0DA 3ZJ8A 3NVTA 3PPGA 3TAKA 3G2GA 2GSEA 1DQXA 1MFUA 4PGLA 4NJJA 4NKCA 3H22A 2QCCA 2YB1A 5FF0A 3KOWA 2YFOA 3RCNA 4DO6A 3DFPA 4GVGA 3WN6A 3KLLA 3NZQA 3QOKA 1EJSC 1QK2A 4F0LA 2XN2A 3B9EA 4LV4A 3RLVA 3CL8A 4FALA 5FSDC 5FKYA 2ZTKA 2QCNA 1TUFA 1Z32X 3W37A 4E0CA 2QCLA 3DECA 3EX3A 1UA7A 1A0CA 5HK4A 5DBTA 2B7PA 3EA1A 2GWNA 4L65A 5BRQA 1PS9A 4N9EA 1R5YA 4KQNA 1EF3A 2FVKA 4GINA 3MU7A 4AUBA 3O05A 2ACQA 3T78A 1E0WA 1U22A 3GDBA 3NPVA 2WZTA 2HPIA 3HPFA 2VNCA 2QZRA 2C0AA 3WQ5A 4O8AA 2OQLA 5CPOA 2PGWA 4GJJA 4RDZA 1GQIA 3UJRA 2NT1A 2PGFA 3INPA 3G1AA 3WJZA 2D2GA 4E3TA 3KRUA 3EXTA 2RDXA 4C1NA 3ZR6A 2O56A 1W5PA 4AX6A 3OVGA 4RK8A 5REQA 4EPBC 1K4HA 3LV5A 5HANA 5F2LA 2VHLA 2BY3A 4P7NA 3BK0A 5BOOA 3SO7A 1RCQA 4K38A 5KZ6A 2V67A 1BKHA 2IW0A 4N6FA 3GX9A 3N2XA 5E0KA 1ZGDA 4CQCA 1JZ8A 4BI7A 4S1FA 4DZ5A 5B7ZA 4JIRA 1IV8A 1DOSA 5FF3A 3M5ZA 3N9SA 3NQEA 3F4NA 2A85A 2A6NA 1TRDA 3AMKA 2WNWA 1FWNA 3NSMA 1VP5A 4JCMA 3N6JA 4HA1A 4K36A 1R7OA 2BODX 3R79A 4IOTA 3W2NA 3AMGA 3PWGA 5HWJA 3W7PA 1B0IA 1WA3A 3H21A 1TJPA 3II1A 4B5NA 3MBDA 3GG8A 4NJKA 3ZVIA 2NUYA 3UWEA 1RA5A 2DFAA 4MNJA 4UWMA 1H7NA 3SBFA 3WF2A 3SUWA 1UH2A 2PP3A 3TLQA 3VGBA 4QDPA 3UZZA 3VNIA 5I03A 1C9DA 2QDEA 1JFHA 2F6KA 2PE4A 3M0LA 4GCXA 1I2QA 3QQ1A 5TD4A 2NUWA 3MKKA 3A4JA 2FHFA 5CLTA 2NVDA 1W3IA 3SQLA 1A50A 1FBAA 3SFKA 4HPXA 5EMKA 4U4MA 4E8CA 2X09A 2BY2A 4NYYA 3C6CA 3QTPA 3TA9A 3DH7A 2RJGA 3CM4A 1E0XA 4PCTA 3LRMA 2WBGA 2PD9A 1Y5VA 3PHAA 2VFIA 3K8MA 3EPOA 4K1GA 1PX8A 4HKPA 1NQKA 2J25A 5KSWA 1HL9A 3A9IA 3ZLHA 1OGSA 3BAWA 2H8XA 3BGJA 3HO8A 1XWYA 3W1MA 1DJHA 4K7VA 4H04A 3VDCA 1GOIA 4C7GA 3T07A 3L68A 3UZYA 4HU4A 1X7FA 4B3ZA 3M0YA 3VNLA 2FH6A 3WDJA 2Z1WA 5CGMA 3BW4A 1MUWA 4IIDA 4C6QA 4Q8OA 3WJWA 3FAXA 3N6QA 4NYUA 1KTCA 1W54A 2PS2A 2XH7A 1SR9A 2CPUA 1HVQA 2WB5A 2J7EA 3CAKA 3QM3A 3TCSA 3SCTA 3FGCB 1IF2A 3UPWA 4BQ2A 1TMHA 4IGMA 3MY9A 3SGZA 4GUHA 3VABA 1BD0A 4DYEA 2UY4A 2WMIA 4XKYA 4L1XA 4HHMA 2QDHA 5DXXA 3VNJA 3JZUA 2OXNA 3TSDA 3ZYZA 3KW3A 4U2ZA 3HGOA 2DZWA 2E4TA 3VE7A 1W56A 4M29A 1V6WA 3GH5A 5AN7A 1ZHAA 3URQA 4BWLA 3GIQA 1A5MC 1LP6A 2WAGA 3LD5A 4H19A 4EPKA 2WBKA 2JBMA 4ZVJA 5J04A 1AD1A 3OG2A 2QLYA 3ZM8A 3OVRA 3CHEA 2I17A 3RGTA 5G2IA 3SCSA 1XLGA 3L2MA 3VZYA 4XZHA 4AMAA 2EPNA 3FSTA 3UZXA 3BARA 1K6WA 4HHLA 4EF8A 1GVOA 1X6UA 3N17A 4DYKA 2ABAA 4LWWA 2VMFA 2QNEA 2BDQA 3W87A 2Y8UA 8XIMA 2ODOA 1P43A 1EC9A 1SSGA 1W3KA 2G4JA 3EWXA 1EYEA 4DPPA 4IP7A 2YXXA 3OGVA 2JE8A 1S2CA 4MUZA 3QXBA 3SGGA 4JIQA 3WL0A 3CQIA 4GLEA 3NQ7A 4B2DD 3A3HA 4UCGA 1KA9F 3ZT6A 2DIJA 3AJ7A 1UR9A 2YL8A 3GUWA 1VIZA 1GHSA 2GVGA 3CV7A 2QV4A 4W8BA 3QFEA 1GQNA 5CAHA 1JDFA 2NX9A 5ABTA 4CKQA