1F73A

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii in complex with sialic acid alditol
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
288
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL NEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 122
structure length 288
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f73A00
4OBTA 4FNUA 4N02A 4JY9A 1GT8A 3G1HA 3B0VC 3W85A 4FF7A 1D3GA 2P1FA 1YXDA 4HHPA 5KZDA 2C6QA 1VYRA 1TPB1 2ZA3A 4ZQCA 4A29A 5F2IA 1ICPA 1UJPA 4JTEA 1SW3A 3LM7A 3LI0A 4YCOA 3F4WA 3EB2A 4UFKA 2NUXA 3FJ6A 2OMAA 3WJZA 3W72A 3WJYA 3QQ0A 5AC6A 1OFDA 1B3OA 3LCIA 1KFBA 2CZDA 2VELA 3L21A 5DXYA 4JR5A 4IGHA 1K02A 2VEIA 2QCGA 3O1NA 5KTLA 1OYCA 3TMLA 4QITA 1Q6OA 2YDAA 1U5JA 2WSRA 2JBMA 4ORIA 1SUXA 1YYAA 4IMFA 4IX0A 5G4WA 3SGUA 4BWLA 2QUUA 1I2NA 5D37A 1TTPA 2CLOA 4R53A 4DBDA 3UXDA 4HNVA 3NQMA 3NO5A 4N9DA 3VE7A 3SIZA 3TAOA 3W7IA 1HO1A 3W75A 3FKKA 4LV9A 4RR4A 4WOZA 4ICNA 4MZ8A 2V9DA 3G1YA 3PG8A 1KLYA 1TO3A 1I4NA 2DZVA 2X30A 3E96A 3MW7A 4K39A 5AFDA 5G4EA 3G1AA 1LM1A 2E6AA 2QJIA 1LOSA 3P80A 1FWSA 1V5XA 1OHLA 3W6YA 3O6YX 2WNZA 3HJZA 4KFNA 4Q4KA 2A7RA 3DZ1A 3MJYA 4N9EA 4O0ZA 2ZA1A 1YDVA 2C16A 3NGJA 1IIGA 4I7WA 5CG7A 1FDYA 2QCDA 4BI6A 3MBDA 3NQ7A 1RVGA 3G22A 2R8WA 4O11A 5HWJA 1PE1A 3W1NA 1FX6A 2GQ8A 4C1KA 3W1UA 1SZFA 3MYOA 2LLEA 3UNDA 3H54A 4IXXA 1YTKA 3CIXA 4H4IA 3HGSA 2ZQ0A 4Y9AA 1GVQA 3G1DA 1M6JA 5CZTA 3G8RA 3E12A 1GEQA 1YTDA 1Q6LA 3LGEA 2CLFA 2QCCA 2A7NA 1FUYA 1TV8A 2TPSA 1QNVA 4TU1A 3O6DA 3BG5A 4C1LA 2Z6IA 2GQ9A 3PB0A 4QQ3A 3TC6A 4NJHA 3R13A 2X2GA 3LRLA 2Y7FA 2PRHA 4NJKA 1T96A 3UZ5A 1ADOA 4DPPA 5C5YA 2WOQA 3W9ZA 3TW7A 1XDMA 2FTPA 1G6CA 3HG5A 2V81A 3C2EA 2Y63A 3M5YA 4UTTA 5D2XA 2V0TA 4A2SA 3HG2A 3NL5A 3IEBA 4N6FA 4FX6M 2A0NA 5CSSA 3I6RA 4A3UA 3WJSA 3DENA 3T44A 4I7UA 5AHFA 2EF9A 2EGZA 3LDVA 3GYEA 3NEVA 1VLWA 1KM4A 2ZZ3A 3NAVA 2EPHA 3FIGA 3SZ8A 3WK0A 3TFCA 3G1SA 4O0KA 3LERA 3GDMA 4UFJA 3LBCA 3TXVA 1NFBA 3QW3A 2NUYA 1LRNA 1FCVA 1RZMA 3IGUA 1M7OA 3LBMA 8TIMA 5HINA 4PH6A 5F4SA 2ZBTA 1TYGA 1KA9F 1D9EA 4J9JA 4OHQA 4CCEA 3O8AA 4M19A 3STEA 1VR6A 1H60A 2OT1A 3I7SA 1Z42A 5DELA 1HL2A 3UXAA 2QCLA 2QJGA 4O8RA 4JTSA 3LB0A 1K7XA 4IMCA 2NWRA 5HWNA 1FCBA 2XN2A 2VFIA 5U7SA 2RDTA 4FNQA 1R2RA 4DQWA 3BLEA 1XBVA 2CWNA 2CLIA 7TIMA 1MSSA 2X1TA 1T8XA 4UXDA 2E5BA 2CLHA 3MI2A 1KTBA 1OG0A 4Z1BA 1YLVA 3PG9A 1TPC1 2ABBA 4XBKA 1YDNA 5LKYA 1FWWA 2B7OA 5D04C 3HG3A 4LRSA 3DAQA 1AW2A 3L9CA 2DZXA 1SPQA 4JN6A 2QUVA 2I1OA 1NF7A 2PCQA 1IGSA 3FA5A 3M16A 3TMQA 5HR6A 1UASA 3OIXA 2WKJA 1LROA 2FJKA 3SGZA 3ATZA 5IBXA 3GK0A 5DY3A 1W5PA 1FWTA 1LBFA 3O63A 4UFLA 1QWGA 5C54A 3EWXA 1MXSA 3S5NA 1FY6A 1N7KA 4EF8A 3HBLA 3QSRA 4I7VA 4LVBA 5DBTA 4O10A 3O07A 1DV7A 1TQJA 2OX1A 4GUHA 4NXKA 1QO2A 5KINA 5F2MA 1IXOA 2Y7GA 1UCWA 4UIOA 1FQ0A 1DJNA 3G1FA 4UCGA 2WNQA 4JTLA 2C19A 1B57A 5F4WA 1OX6A 4NJGA 5TBOA 1OX4B 3Q2DA 1DVJA 1TQXA 1HTIA 3QFEA 2Q3RA 3U8GA 1XL9A 2QF7A 1VHNA 3LI1A 2JGQA 4KKXA 3A23A 4Y6GA 4PC8A 1MZHA 3CEPA 5AHMA 4A2RA 4R34A 1ZENA 1OFBA 2VFFA 3OVRA 3LTPA 4JNMA 1QDSA 1TPFA 3TCEA 4HSOA 3S1XA 3NM3A 3THAA 1LRTA 3W88A 1EEPA 1TREA 3M9YA 2GVGA 3CEUA 3UPWA 4HIBA 1EP3A 4GUGA 1L9WA 1AK5A 3L5LA 4N9CA 3DU0A 4JXCA 4NT0A 4O50A 3UWYA 5E0KA 1ICSA 3GDKA 5KSWA 2QDHA 4O18A 4Q32A 3N34A 3Q58A 1EUAA 4LV4A 1EIXA 1ME8A 5D32A 2RFGA 5IM51 4UTJA 3B0UX 2RHGA 2H6RA 1EWDA 4NX0A 3QRHA 4JTJA 5D05A 3JRKA 3MI6A 3V1PA 3B8DA 4TR9A 3CC1A 4KWVA 4RXFA 3W1PA 1GJPA 3BO9A 5G1YA 4KFOA 5LNSA 2ISSA 1I2PA 1SFLA 4WD0A 3TDFA 4BI7A 4Y8FA 3CWNA 3KXQA 3W7PA 1VZWA 4CQ9A 2GVJA 3P8IA 1TRDA 3CB8A 3STFA 4DXVA 4GRSA 3INPA 2NXHA 1OF6A 1FDJA 1SZGA 2ZRYA 4OGZA 1KV8A 5D30A 5E93A 4DO6A 3MHUA 3LXAA 3S5OA 3BPWA 3S0CA 4JTGA 2X1RA 1VPXA 5DY2A 2FFCA 4YMZA 3FYOA 3QEZA 1EP2A 4MPQA 2BWGA 3TC7A 4LRTA 3HF3A 3NL2A 3E02A 2AGKA 5FF2A 3TSBA 1RQHA 4UMBA 5FEPA 3GVGA 1GYLA 1PCWA 3GDTA 3LHVA 2V2DA 3LHUA 1KLZA 3LHTA 4UTLA 2Y7EA 3W2KA 1KFCA 3NQDA 3DI1A 4OQVA 4PL2A 2Z6JA 3LOTA 1W3TA 3ATYA 5K7JA 5J5RA 1KBJA 1LBLA 2WPBA 2WV8A 1F2JA 1VHCA 3LRMA 3PF3A 2C13A 3PSWA 4RLIA 1F6PA 2CU0A 1W1ZA 3NG3A 3W3OA 5AN7A 4DPQA 2FPYA 3CM4A 3NYZA 1SFJA 4IJBA 3BARA 1DL3A 3RU6A 3JR2A 2TRSA 1JQXA 1UUOA 3N2XA 2C14A 3T78A 3DH7A 5FF0A 2FB2A 4JTUA 1ME9A 4HN4A 1R46A 2A5HA 1F76A 3W1QA 1WQ5A 3IIPA 2ALDA 1H1YA 5IBXC 1MEIA 3KAOA 2JKEA 3LRKA 2E5CA 2PRMA 2PE4A 1FDZA 2V2CA 1EX5A 1EWEA 3DFPA 4Y90A 3UPBA 2ZRUA 3I7RA 5G2WA 4ALDA 5H2ZA 1G4TA 4QNEA 3TA6A 3QZEA 4JDBA 3THQA 2AAMA 2ZRZA 3M5ZA 2ZZ1A 1BKSA 4U4MA 3STGA 4ML9A 3C61A 2O7SA 3C56A 3GR8A 3LXBA 1SO6A 2X16A 3FEMA 3WK3A 4E0CA 1X1OA 3L0NA 2HMCA 4WXZA 4M6VA 1SR9A 4LOCA 3PULA 4O1BA 1TV7A 3T40A 1GQNA 1DORA 1IXNA 1JULA 1S5TA 2RKXA 4WY0B 3BLFA 3PBWA 1TCDA 4QIUA 3V75A 4LNYA 2CLEA 3P61A 3W2LA 3LLFA 2ZZ4A 2VKZG 3QF0A 3NR0A 4MYXA 5BMXA 2ATSA 1SSDA 3PBYA 1PL9A 2CZFA 4UMAA 2Z2UA 4XQ6A 3SI9A 3N2MA 3TSMA 4IMEA 3C8FA 1GVFA 2A7PA 5F2LA 5K2ZA 3NQCA 4IPIA 4QM1A 3HQ1A 2Y88A 4FX8A 4EF9A 1S3HA 4MFDA 4CQ8A 3CU2A 1W31A 4UTUA 3W1TA 5DCBA 5AC7A 4OV4A 4ZMGA 3PY2A 1TPH1 4FNTA 4CCDA 5AHEA 1K8XA 4JTKA 4AXKA 3HPSA 3CWOX 5I3IA 1G67A 1NVMA 1HO4A 3PWAA 1OK6A 1WV2A 2HS8A 1F6KA 4O12A 1FCQA 2GJNA 3LCHA 1ZNNA 3NM1A 2GVLA 3HGJA 3C2FA 3M6YA 1VJIA 3W22A 3NZRA 2V5BA 1RR2A 3S1WA 1O94A 2ZYFA 3W2UA 2CLLA 1MEHA 5FEWA 1P0NA 4WQ6A 4ZQRA 1CW2A 1TB3A 3GDLA 2R14A 2E6FA 1I2RA 3MBFA 4E38A 4FXRA 5CZJA 3P84A 3P81A 2A6NA 1FXQA 1KM6A 2TYSA 4PEKA 3DGRA 3MMTA 1TJPA 1W0MA 3NQVA 1L6YA 1TIMA 3L0KA 1LDCA 4O16A 2UV8G 1H7WA 2OZ0A 3P7YA 2BZNA 1XXXA 3GZ3A 5L9FA 1Q3NA 5FEZA 1JRCA 4XKYB 2VEPA 3A22A 3ABQA 3GB6A 3P74A 1XC4A 3SY5A 1DJQA 1RPXA 4FIQA 1ME7A 5HULA 4M6PA 4M5PA 5BW6A 1A5BA 3W7RA 3BVJA 1A5SA 5CPOA 3W7LA 3RLVA 4HNNA 3W1XA 3O6CA 5EL1A 5DN1A 4WY0F 1PV8A 3PM6A 3OVPA 2NV1A 4JTTA 1QOPA 3LTSA 5EYWA 5CPNA 2ATMA 1WDWA 4DELA 4ADSA 1TPVA 4PFMA 2Q8ZA 4DO5A 1THFD 3LHYA 4NJIA 1LP6A 4JTHA 1LLZA 2R94A 1G4SA 3PAJA 5HUOA 1FBAA 2Y61A 2VC6A 1VYSX 4EVZA 1OFOA 1F7BA 5AB3A 4AMAA 2QDGA 4CLMA 4ORMA 5CZSA 3GKAA 4ZZ9A 4L4LA 4ADTA 4S2CA 4R7JA 5AHNA 1G4PA 5AC8A 1H61A 3TQ0A 3BW4A 4WXYA 3MO7A 2ZRXA 3EXRA 2GUUA 1JCYA 1JCXA 3WK1A 3B04A 1H7NA 1FXPA 1LOQA 3NPVA 3G3DA 4LVAA 1D3HA 4UFMA 2TMDA 4Z1DA 1H51A 3BG9A 4MLJA 5AYYA 4Z0SA 2GQAA 1H50A 4BFAA 1TTIA 3EXSA 3G24A 3VI2A 4LUIA 3B4UA 1BTMA 1VH7A 3F03K 2WNNA 1LBMA 4O53A 4UTIA 3A21A 1GVRA 3TQVA 5C6MA 3W7JA 3GR7A 3VNDA 2X1UA 1Z44A 1AW1A 1XM3A 1GG1A 1WXJA 2OCZA 2YPIA 3ELFA 3L5AA 3GKFA 3QH2A 1JCNA 3WJXA 2CFFA 5TIMA 5A8GA 5KZEA 2Y7DA 1KFEA 4OU1A 2J9YA 1JVNA 4E2BA 3L68A 5HUPA 1W37A 4ZVJA 4P61A 3M41A 4O54A 3CHVA 1I45A 4Z1AA 5LGZA 4BK9A 3W1MA 1TTJA 4M6QA 5EBUA 1A5CA 2BXVA 3KOFA 4DBEA 1V7YA 3KRSA 2P0OA 2NXIA 4LS0A 5CPMA 3W84A 3IGSA 1KM2A 5HMSA 1Y0EA 4K6AA 4RK8A 2G96A 3RF9A 1QFEA 3BLIA 3LCGA 4LY8A 3G1VA 1SZNA 3W7HA 4NQ1A 3DKJA 4U28A 3KVKA 3QMSA 2YXGA 3KX6A 4AVFA 1YPIA 3SECA 5KZMA 3W83A 3HMJG 1XUUA 1TRIA 2ZZ6A 4QNWA 4RZ5A 3R8RA 5G2HA 5AOUA 5FF4A 2VFHA 2YFNA 1I2OA 3CPRA 3W2NA 4IMDA 4WUIA 3NQFA 1PHQA 3KRZA 4JIQA 2PC4A 4AHPA 2ZRWA 2VEKA 4NNAA 4FX7A 4UTHA 3PS7A 4NZFA 3LX9A 2O7QA 4DF1A 1RQBA 5K9DA 3S1UA 2YSWA 3CLMA 3LV5A 2YYUA 3IRDA 1VRDA 1ZFJA 2G5WA 3OEXA 1IXQA 2GOUA 2NX1A 1XKYA 3TFXA 4B5NA 1ZJIA 3N3MA 4TMBA 3FS2A 1FWNA 3QMTA 1LCOA 4XWUA 4PODA 4N4PA 3W1RA 1G7UA 4IMGA 2YGYA 3N9RA 5LSMA 2H3DA 1EP1A 1XBXA 4DF2A 3VE9A 4RKAA 5EY5A 1VYPX 5LNWA 4NZJA 5F4XA 4XZ9A 1JUBA 4HPXA 1AL7A 3LCLA 3P67A 4LTSA 4LC6A 3S9YA 1Q45A 1OYAA 3RLUA 3ZS4A 1XDLA 4LU0A 2A6LA 3UY7A 4MIMA 6ALDA 1ZY9A 4O19A 3L0GA 1YPFA 4RX0A 5I3FA 2B7QA 3IIZA 3UYCA 4L4MA 4UNKA 3EXTA 1ZAIA 3M47A 3Q37A 4MLRA 2E77A 5CPLA 1OFAA 1MEWA 4IWWA 2WQPA 1QCWA 3LCFA 3CT7A 3NA8A 3N9SA 3IVSA 5FF7A 3NVTA 4AF0B 1DQWA 5DXXA 5D33A 3JS3A 3U6WA 5LNRA 5BMWA 3G8EA 5T26A 2YYTA 5TQLA 2HTMA 4QISA 1E51A 2PRLA 3UWUA 4GFSA 1XI3A 4OV9A 3P5YA 2Y85A 1SZEA 3LTYA 4P2VA 4N2YA 1T0OA 6TIMA 4PCFA 4LVDA 2CLKA 1ZAJA 1IIHA 1XBZA 3C3NA 4JICA 4D2JA 1C8VA 4PTNA 5DCDA 5K4XA 1JQVA 5HWMA 2R91A 3NL3A 4YXGA 2EKCA 4IPJA 4CNOA 4JTFA 3SW6A 3W7GA 3HPZA 2A4AA 2Y70A 5HNRA 2I9EA 3TXZA 5BOOA 4IXHA 1VS1A 3C2VA 3S1VA 3KVLA 1VCGA 3H55A 3UWVA 2H8ZA 3G0UA 3TE9A 1QPOA 2BTMA 3EWYA 3UQNA 5CKSA 2YCEA 4JX4A 3EWWA 4UFHA 3M43A 2A1YA 1GVSA 1ONRA 4FEZA 1CI1A 5GVJA 4E2DA 2ZZ7A 1PS9A 2ZDRA 1H62A 4DO4A 1WOAA 1R2TA 1JUKA 4WY0A 5FI8A 4MJMA 5CZ0A 2FLIA 2V82A 1S5WA 3G18A 3F4NA 4JYEA 4JYDA 3C2OA 4K37A 1QPNA 1KFLA 3DFNA 5MHBA 3DKLA 3E9AA 2E09A 2QJHA 2X1SA 3GX9A 1JJKA 3TJLA 4WJEA 3O16A 1HG3A 1OVDA 1LORA 1KV5A 5CGQA 1A5AA 1VCVA 1ZAHA 2ZCGA 3IIXA 4JGDA 4ZQNA 4ZL1A 1O5XA 3W73A 4QSHA 3IVTA 2YW4A 2P10A 1XUZA 2QAPA 3I68A 4MVAA 3NPXA 5FESA 4RCXA 1F05A 1ICQA 3ABRA 3NPWA 4FIRA 2ZZ2A 3M5XA 2Q8LA 3EX2A 1A50A 1H63A 1I8JA 2GPTA 2NX9A 3IGXA 4LW7A 4UTKA 1OFPA 3DHDA 5L6UA 4X3ZA 4AH7A 2E1DA 1KM0A 3HO8A 3CIWA 4UTMA 1GWJA 3WJWA 4HNUA 1P4CA 3WFAA 3MYPA 1AW5A 3S5ZA 1G7VA 3LLDA 4OE7A 4NU7A 1L6SA 3TU9A 3G0XA 4LS2A 4NNCA 3I65A 4BF9A 1OK4A 2ZZ5A 3C0JA 3W7MA 3HIJA 3OVQA 3ABSA 4N9BA 2WSYA 2NLIA 2NXGA 5LNUA 4AWTA 3FJLA 3MI3A 1X6UA 2Y89A 4HSNA 2G97A 3PC0A 3VKJA 1ML1A 5F2GA 4O13A 5G5IA 3SR7A 3W71A 4K38A 1GTEA 3A5FA 3TROA 3MHFA 1K7EA 2ZTJA 1QPQA 3W7OA 2YW3A 2FPTA 1TPWA 1Q6RA 5SWUA 1B4KA 3TJXA 4HPJA 2DZTA 4JY8A 3TUUA 4ADUA 1W5OA 4UTWA 2NWSA 3MUXA 3PBUA 3B03A 1SQ7A 1VLIA 1DBTA 1SO5A 4GBUA 3UWZA 3GNNA 3QMRA 3ZWTA 2ISVA 2E6YA 5I3GA 1KW1A 4MFEA 3FLUA 3GXPA 3W70A 2FB3A 2E6DA 1ZCOA 1LYXA 3RFAA 4O17A 3HGRA 1KBIA 1TSIA 1N8FA 5A5WA 1H5YA 5D38A 4XTDA 3M5VA 2W0UA 4N4QA 5KMYA 5FF3A 1GPWA 3NOEA 2VXNA 1KTCA 4IUOA 5I3HA 1X7FA 3NQ2A 2RDUA 4JX5A 1K03A 4M7SA 4HT3A 3IIOA 2W79A 4S1FA 3BG3A 1VCFA 1KTNA 2ZTKA 1KFKA 4UR8A 1QOQA 3TAKA 5LHFA 2QUTA 1G69A 3N14A 1OYBA 1H7RA 4ONVA 4Z1CA 4Z0JA 3HOJA 1Q6QA 4MJZA 1TPUA 2DJLA 2C1HA 1YTEA 3PBVA 3QM3A 2F7FA 5AYZA 3IIVA 4Q33A 1LZOA 4KFPA 4Z08A 1BWLA 3UY8A 3MP4A 4FXSA 3EX6A 3W7CA 1SW0A 3MP3A 3RK8A 1WAUA 3NQAA 3S42A 4GE8A 3SFKA 4X22A 1SO4A 3ZR4A 1QAPA 3TR2A 4CCCA 4LWWA 1EB3A 2C0AA 1J5TA 4LC8A 3HPXA 2QKFA 2C3ZA 2ZRVA 1C29A 1JRBA 4DEFA 2DJXA 1GOXA 1T99A 1W56A 1GTHA 1G4EA 2DZPA 4AEOA 4GC4A 1S5VA 3LCXA 2TSYA 4GNJA 4H6KA 3KVJA 3N73A 1PIIA 2QCEA 1JCMP 3TV8A 3W7QA 3F1QA 3PUEA 4DF0A 2GJLA 1DHPA 4RZ6A 4MYAA 4MOZA 1L2UA 3A5VA 3P8JA 3NQEA 5CSRA 2H3BA 3GIYA 1FWRA 1TMHA 1K8YA 4EWND 1NAL1 3QPYA 3AO0A 4UMCA 3DFQA 4JS3A 3C4UA 3GXTA 3M7WA 1SO3A 3FYPA 2BSLA 2J27A 4NXSA 2YX0A 1YDOA 2QAFA 4UUIA 4XTIA 3MHGA 4GJ1A 4TX9A 2A85A 4Y96A 1A53A 5DLCA 1RD5A 3LHZA 2C15A 5ABTA 3P60A 1PCKA 3W87A 2H8XA 1HUVA 3NZ1A 4O4VA 1B4EA 4MY8A 3ZFHA 4GUJA 1XBYA 3W1AA 4JDYA 2BX7A 3EX1A 3TNOA 2IQTA 1R47A 4WX2A 1M7PA 3W7NA 4AHQA 3EWUA 4OT7A 4N6EA 4W9TA 3UD6A 3DFSA 1RV8A 3R12A 5E1QA 1NSJA 4MZ1A 3BW2A 4MY9A 3O15A 4S2BA 1K7FA 2B4GA 4G1KA 3G3MA 1VQTA 2J9ZA 2J24A 2YFOA 3STCA 1OABA 3A9IA 1X8FA 3VCRA 3T4CA 2CW6A 2J88A 1TPEA 3BK0A 3DHFA 1X1ZA 4NUWA 3TQKA 1O5KA 1ALDA 3BV4A 4PL1A 4A22A 4AB4A 5D09A 1DOSA 5H91A 1XCFA 4UR7A 5G1TA 3W74A 5LGXA 3W2JA 3H53A 5D2TA 3PSVA 3TIMA 4BR1A 4FNPA 1WBJA 1I2QA 3K30A 1P1XA 3P62A 4UTWC 5F1UA 1O95A 3YPIA 4O52A 1F74A 4O1CA 1PHWA 3ABOA 3QQ1A 2F84A 2DP3A 2WO5A 5LZLA 4MZYA 1OX4A 1CX9A 5I3JA 4TO8A 4FHAA 3S5YA 1LTDA 5EKYA 1KM5A 1AMKA 1AG1O 2WSQA 3BGJA 3DI0A 1O4UA 2CZEA 2CZ5A 3W23A 1U83A 1WYIA 2RH9A 2DORA 4O14A 4JX6A 2BLEA 1VGAA 4EIVA 3G0SA 3EWZA 3L67A 1M5WA 4AF0A 2XN1A 1GG0A 1W8SA 3L2IA 3P82A 5DBUA 3TSDA 4HNTA 3UWQA 3NQ8A 3GAYA 4CNNA 1N55A 3HGOA 3UWWA 2VENA 3LXCA 2G95A 2A2IA 4XUGA 3ANYA 3OHIA 3BW3A 4NJJA 4ZQPA 4RJEA 2QCNA 3KHJA 3HB9A 2JKPA 4KWWA 4MY1A 4IOTA 2QCDB 4JYFA 3M1ZA 3QC3A 3VFLA 1HFBA 4YWIA 5D03A 2YZRA 4NX5A 1OX5A 2E68A 1W5MA 4MKNA 1UBSA 1QPRA 2JGYA 2E5DA 3AJXA 1TTQA 4NVTA 2ZA2A 3TK7A 3FOKA 4UC5A 1SW7A 1B9BA 5K9CA 1GZGA 1DQXA 2FDSA 3N19B 4JD4A 2QCFA 1W3NA 1DKWA 4BWLC 3LCWA 2V30A 3WK2A 5F1VA 2WJZA 1KFJA 1P5BA 1JR1A 1ZHAA 1W54A 3EWBX 3W07A 1TV5A 3W7KA 2JKAA 3TW6A 1TPDA 2AQWA 2DU2A 1W5NA 1C9DA 1YADA 4O4WA 1ZALA 3E49A 3NQ6A 4K36A 4GXMA 4RZ4A 2FQIA 4M7TA 2Z0IA 3C2RA 3T7VA 1JUEA 3SSJA 3B05A 4X2RA 2VEMA 2QEZA 1RQEA 1TJRA 1MO0A 2ZFAA 1OFRA 3CQ0A 1OF8A 5KITA 4FNSA 2J6XA 2VFEA 3ZWSA 4O1DA 5D2YA 1W5QA 1H7OA 2FIQA 3TH6A 5AHLA 2DZUA 4K8EA 3EEGA 5EMUA 5EPDA 1UB3A 4AWSA 2ISWA 5BNKA 1KM3A 3L66A 4XBSA 2NX3A 2PURA 4UNLA 4MUZA 1EA0A 3FFSA 3W7EA 2Q3OA 3B0PA 3OG3A 3DFTA 3GAKA 4PA8A 2NV2A 4LT9A 2VOMA 1EUNA 2Y6ZA 1XFBA 2J9XA 3HG4A 3NL6A 1H7PA 1Z48A 3C6CA 4ZQMA 5K3VA 2XN0A 1BEUA 2Y62A 5U4NA 1WOBA 5I3KA 5C2XA 4JEQA 4ZQOA 2D73A 4YCPA 3GDRA 1WX0A 3EKLA 1H7XA 3QYQA 1K8ZA 5HJLA 2RDWA 4WOQA 3GLCA 2QR6A 1R30A 3NXFA 4X9SA 2V8ZA 4O1AA 3FKRA 3W86A 3IV3A 3CTLA 1O60A 2CLMA 4JIPA 3S6DA 3R89A 1UUMA 3SJ3A 3GNDA 3NNTA 3EX3A 3MWAA 3W76A 4WZHA 5LNVA 1QO5A 3O06A 3QJAA 1PVNA 4NNBA 4UTTC 5HR7A 1YXCA 2YR1A 4BI5A 4QAIA 1GVOA 1WA3A 2NZLA 3Q94A 2I14A 3KFTA 3OA3A 3LHWA 4LS1A 1NEYA 2V2HA 1J2WA 3IVUA 3W1LA 4CQAA 1WBHA 4I9AA 4K7YA 5HQEA 4TIMA 3PB2A 3QPZA 1P0KA 2NUWA 3QW4B 3D0CA 2KZHA 3NPUA 4LVGA 3DBPA 1BWKA 4QJ1A 1YXYA 2B7PA 3E0IA 4AHOA 3P5ZA 4FNRA 4GWEA 4AAJA 4R33A 3DXIA 2V5LA 3EKZA 4UFIA 3KVMA 5K9XA 3I7QA 1OFEA 4POCA 2OJPA 2FPVA 2A21A 2DZWA 4TMCA 2B0MA 1KM1A 1NF0A 1IXPA 3OBKA 1JCLA 3PUOA 4LUJA 1F5ZA 1J4EA 3KRUA 3M44A 1LOLA 1F73A 4RXGA 3R2GA 1VC4A 5K4ZA 1W3IA 1OFQA 1QR7A 2QCMA 3PUDA 4GUIA 5LHEA 2QCHA 4O15A 3GXNA 3RNDA 4LVFA 1SSGA 1SU5A 5D02A 4K8HA 3RMJA 4HKPA 1L6WA 4O57A 1FCUA 3B06A 4RV8A 1K3UA 4H3DA 3MP5A 3NDOA 2W6RA 1Z41A 4GUFA 3PVFA 4IX2A 2DZSA 4AWUA 2B7NA 5AHIA 4XKYA 3USBA 2HSAA 3R5EA 1LLWA 4OWGA 2HS6A 5EA9A 1IF2A 3TKFA 1QMLA 1H1ZA 4YLWA 3U2OA 3L5MA 5C55A 3T55A 1JCJA 2C18A 3O05A 5G2IA 3QSTA 3EX4A 3PR2A 4K7VA 3UZJA 4FO4A 2VFGA 3A24A 3C52A 3DFOA 3W2MA 1LRQA 5DCEA 2VFDA 2OT0A 2Z1BA 1R2SA 1GYNA 5D2WA 4CNPA 2JK2A 2XFWA 3S8HA 4O28A 3TX9A 4FB7A 5AYXA 3LV6A 3W7DA 2EHHA 4YL2A 2ABAA 4JTIA 3NQGA 5FEXA 2EAWA 5J5DA 5D2VA 1OJXA 1AL8A 4EOUA 3BGGA 3G1XA 3L65A 4IQLA 4A21A 1EPXA 3M0ZA 2H90A 5BRBA
chains in the Genus database with same CATH superfamily
4I3GA 4NKCA 4AY8A 5C9XA 1WZMA 4QSFA 3WQPA 6XIAA 1Q6FA 1D3GA 1UROA 1YXDA 2P1FA 4HHPA 4AC1X 1WE5A 1TPB1 4A29A 1OY0A 2VR2A 1S5MA 3VDAA 1UJPA 4H9UA 1M03A 1WKFA 3F4WA 2OLAA 3UA3A 3T8QA 4UFKA 4QLLA 3NSXA 3ZO9A 2HWGA 3WJYA 4RL3A 3BUVA 2VELA 5DXYA 1KB3A 4JR5A 3ISIX 4QLJA 2PGFA 5DQPA 3O1NA 2W67A 2DSWA 4XZMX 4ZOEA 4QITA 1EKOA 5JMUA 5GNZA 3QV9A 2GJRA 5M5DA 4G7EB 2JBMA 1FTXA 1JXKA 5G4WA 1R9YA 4H04A 1I2NA 5D37A 4MM1A 1PKNA 1V0KA 1EGVA 3CMGA 3M0KA 4Y8EA 2RGMA 2WW5A 4P5UA 3NO5A 1P6BA 3W7IA 1HO1A 4RV3A 3FKKA 3D46A 4RR4A 4GHRA 3I3DA 2V9DA 1TO3A 2XZ7A 2DZVA 4K39A 1MW1A 1N8WA 2E6AA 2QJIA 1FWSA 2WKGA 1CLXA 3A6OA 3I4EA 3M07A 4HSHA 3W6YA 3O6YX 1AODA 3DZ1A 3IUIA 1XLEA 2BFGA 1KCKA 3LYEA 3WLRA 1YDVA 3HQPA 1IIGA 3PPGA 1F8MA 2QCDA 3MBDA 4ZB5A 1RVGA 3G22A 1HIZA 4C1KA 4X61A 3WNMA 1SZFA 2J7CA 1PX8A 2Z25A 1Q63A 4H4IA 2ZQ0A 3S47A 3EA3A 1YTDA 4GIYA 1Q6LA 2CLFA 2A7NA 4A35A 1E5NA 1TV8A 2YA1A 4LY4A 5BU9A 1QNVA 1SM9A 4TU1A 1ZRQA 1C8YA 3O6DA 3QQWA 2WBGA 2DH2A 2Z6IA 1AVAA 3TC6A 1E9LA 1E9YB 3PZIA 3T08A 3R13A 2X2GA 3PN8A 5ABGA 1T96A 3UZ5A 4IFRA 2A3HA 3W9ZA 4Y2WA 1XDMA 3RPMA 2PDYA 1E72M 3M5YA 4X2PA 4Z2KA 1GGOA 3NL5A 4PTMA 4N6FA 4FX6M 1RD6A 3I6RA 1HT6A 4A3UA 4AZHA 3WJSA 1S46A 2YL8A 4GYFA 2GK1A 4I7UA 1E0TA 5AHFA 2F2HA 4UOZA 2WZHA 2DW6A 4QS5A 1E0VA 2W3ZA 1BYCA 1RP8A 1XLKA 1NP2A 1V3MA 5CBBA 3H12A 3RUBL 1GVEA 3QW3A 3WUBA 1KRBC 2HNEA 1MNSA 3IGUA 3LBMA 4HCHA 5HINA 1BSIA 1KD0A 2XWEA 3CPUA 1DIEA 2QJGA 4M56A 1DWHM 3EOOA 4P8XA 4DQWA 3POHA 1V03A 2A3BA 3GH4A 1OG0A 4S39A 1MWOA 1SR0A 1YLVA 3PG9A 1TPC1 2ABBA 3ARYA 4JN6A 1PYMA 2I1OA 1ADSA 1TV4A 3MMDA 4HZ6A 3EWCA 3EA2A 4JIHA 1KRCC 4AW7A 5IFTA 1DQUA 3SGZA 5DY3A 4IGMA 4UFLA 3O63A 1QWGA 5M03A 5C54A 1RLCL 4MB4A 3QSRA 4O10A 4Q4PA 1QUMA 1BTCA 3WL0A 1QO2A 2OEJA 3DN5A 4G9PA 1FQ0A 4WGXA 3T2OA 2C19A 4NRRA 5F4WA 5TBOA 3WD1A 3AIWA 1TQXA 2UBPC 2BNJA 4GGBA 4H2CA 3QFEA 1VHNA 1OZQA 1XR2A 2VDIA 4Y6GA 4NYUA 4PC8A 4PBFA 3UXKA 5AHMA 4A2RA 3B4YA 2AMXA 1DWFM 2FZMA 3OVRA 1XIBA 3LTPA 3FEQA 1EGMA 4PUKA 1TPFA 3BL3A 3TCEA 4HSOA 3S1XA 3CQJA 4C6BA 3N12A 2FZBA 1LRTA 3SSZA 3VKDA 2GVGA 3CEUA 4E4PA 5IHRA 2NLYA 1IWAA 1HZYA 5HMDA 4LF2A 2YLAA 5E0KA 1RJQA 2W5FA 4F0KA 3AU2A 5KSWA 3SN1A 2PDLA 5CGMA 2J75A 1EUAA 4PUMA 1EIXA 2OPJA 5D32A 2RFGA 3FSUA 3S2LA 2YBTA 2RHGA 1E4NA 1EWDA 4PMNA 9RUBA 4RDWA 3N15A 4KEMA 4BF5A 1EGZA 3S2MA 2O9PA 4XIAA 2WXDM 4TR9A 2DUZA 2F6KA 5BXRA 2J8FA 2PGWA 2VM8A 5G1YA 3A13A 5A6BD 2ISSA 3R43A 1OC7A 1SFLA 3TDFA 4BI7A 5BRPA 4Y8FA 4CQ9A 2JIEA 3WF1A 1TJ0A 1TRDA 3STFA 4JHMA 3EDJA 3SCOA 4NG3A 1SZGA 4OGZA 5D30A 1KGXA 3MUY1 3MHUA 4UQDA 4L61A 1ITCA 4J27A 3S0CA 1V3KA 5JIPA 3FYOA 4C7GA 2ACRA 4UBPC 1XLAA 2OWWA 3SCNA 2BWGA 2D69A 2R1MA 1ODZA 3HF3A 4HMNA 4TV6A 3E02A 5FF2A 4CGTA 4JHOA 4L80A 3GVGA 1GYLA 4CU7A 3AMGA 3WQOA 4DBUA 4XVEA 3LHVA 2V2DA 2VGFA 1L2QA 3C0LA 3LHTA 4UTLA 1YNYA 2GVYA 4PUWA 2XSBA 1RH9A 3UG8A 3FAWA 3DI1A 1SMDA 4C6EA 1U30A 4OQVA 3LOTA 3CK5A 3QXBA 2WV8A 1F2JA 3B8WA 4F9JA 1UP2A 1F6PA 4QGCA 1JI1A 5AN7A 4KW2A 3IAPA 3CM4A 3H21A 1S1RA 1SFJA 4IPLA 3U0HA 4B5XA 1TUFA 1JQXA 3N2XA 4G56A 3XINA 4ICCX 2FB2A 5BWFA 1IEWA 5T8GA 3U48A 1XDJA 1F3TA 3GDBA 3IIPA 3MUCA 5IBXC 2JKEA 2BP1A 3W53A 2XIBA 5I02A 3DFHA 1J0IA 5A2BA 1J12A 3AIQA 3MMWA 3AU6A 1IEXA 1FDZA 3NZGA 1EX5A 2PDHA 1RY0A 4XD3A 5CCZA 3ES8A 4IH3A 1NU5A 5H2ZA 4Q22A 2WVUA 4ALDA 3TA6A 2ZRZA 1JXJA 4GKLA 2O7SA 1SO6A 3WK3A 3L0NA 4WXZA 4DNHA 4M6VA 2JFEX 1GQNA 2WHJA 3BLFA 3PBWA 5HOSA 3ANVA 4LNYA 3LLFA 6CGTA 3T2QA 2QDEA 4G7FA 1SSDA 3E5BA 5DRCA 2Z2UA 4HPNA 1MXGA 2CXGA 3QLDA 2A7PA 1FHVA 1W9PA 3HQ1A 3VOHA 2WVSA 4FX8A 2BVWA 1S3HA 3AFBA 4QBXA 1W31A 3LUTA 1BGGA 5AC7A 1GQIA 1QI0A 4FNTA 4CN6A 4AXKA 3CWOX 1JAEA 3BURA 4W89A 4MAZA 2HS8A 4O12A 1JZ6A 3KBWA 3WF0A 3RCYA 4I6KA 3KM8A 1ESWA 3M6YA 3W22A 2FHFA 1DJZA 3O3RA 3BH4A 1O94A 2ZYFA 2JIWA 4UCFA 1HKIA 3R79A 1Q8AA 3F5LA 1XLBA 2J62A 3TJ4A 4DAIA 1HKWA 3P81A 4HD5A 4FI4A 2D3NA 2VUNA 1L6FA 3RN6A 3BLPX 1H7WA 4GI8A 2BZNA 3BJSA 3MCNA 4M1RA 9XIAA 3GZ3A 5FEZA 4WGHA 3AIEA 4GXWA 1W17A 2VEPA 4MHBA 4AZ5A 1W9DM 2VGBA 1RPXA 1N8IA 5DT7A 4M5PA 2V38A 3BAIA 3VZXA 1A5SA 2INEA 4GJIA 5CPOA 3SGGA 4DJFD 4HNNA 3WLMA 4BQ3A 1PV8A 3PM6A 1PZ1A 3OVPA 5C9RA 1QOPA 4A8LA 3LTSA 1U2YA 4IGSA 2JF7A 3KDOA 2ATMA 1TV2A 1TPVA 1GJUA 4IISA 3LA4A 2AOSA 4PFMA 3C8NA 5CC6A 1LLZA 5HUOA 1NJJA 3GVWA 3CHEA 1UD4A 2YDQA 4AMAA 4ORMA 5CZSA 1WPCA 3K1GA 3OOQA 3TQ0A 1FP8A 4JNZA 4YNGA 5JXQA 1J01A 4GXPA 2GUUA 1JCYA 1JCXA 1H7NA 2AMGA 3NPVA 4H83A 3G3DA 4WDWA 2CKRA 1M3UA 1D3CA 3WG6A 1CB2A 3G24A 3AS3A 4DZIA 3CUXA 1BTMA 3F03K 2B81A 3OGRA 2C91A 3VOIA 1I1WA 3TQVA 3W7JA 3ARPA 1FWFC 1Z44A 1BG4A 3GU2A 1POKA 2PD9A 1IEIA 3RU8X 4UTFA 3MANA 2Y7DA 1TE6A 2GVEA 3CYJA 1KFEA 4OU1A 1PAMA 3UVAA 3F2CA 2J79A 5T9BG 4AU0A 2JEQA 4E2BA 4DJFC 3T9PA 3HQNA 3VDGA 1Y5WA 4BK9A 2R82A 1TTJA 4C6NA 1MQRA 3J7HA 4M6QA 4A8RA 4QDWA 2PEVA 1WO2A 4RPQA 1XYLA 3L4VA 1UA3A 3W84A 4MMWA 5HMSA 1Y0EA 1QHPA 4NQ1A 2FGBA 3KVKA 2YXGA 2VL4A 3QHNA 3UA4A 3SECA 1XUUA 1TRIA 4QNWA 4RZ5A 1QI3A 3BV7A 3TWAA 1TWWA 3CPRA 1HW6A 2G4FA 1PHQA 3KRZA 4JIQA 5IXEA 1B3ZA 5F7UA 4KESA 2O0TA 2AL2B 1FWAC 3H7VA 3PS7A 4NZFA 4HZ8A 4DF1A 5K9DA 5CPSA 2YYUA 3VOGA 3IRDA 2DT1A 4C6JA 3ZT6A 1XGDA 2GOUA 3PZUA 4HA4A 5CQ1A 1YX1A 4B5NA 3KL3A 2PDPA 4MSSA 3GG1A 1FWNA 5A6BA 4W7WA 4DWSC 3HZ3A 4G1NA 4PODA 3W1RA 2YGYA 1HKKA 1XBXA 3VE9A 3WQEA 4ROPA 4W8BA 5LNWA 3LM3A 2V3DA 3M0XA 4LC6A 1Q45A 3EAUA 1XDLA 4R27A 4LU0A 2GJPA 4DM2A 2RDXA 4PUJA 3VC6A 3BTNA 2VR4A 6ALDA 4O19A 4RX0A 5I3FA 2YLLA 1XYMA 4KGJA 4PMUA 4L4MA 3KTSA 1FFRA 2VOTA 3Q37A 2HE5A 5HAOA 2XISA 4C6PA 1RLDA 1MEWA 1E1FA 4IWWA 4P7RA 1QCWA 1V02A 5A6SA 1EYEA 4CUCA 2PP1A 5DXXA 3JS3A 2XGIA 4J2MA 4JTQA 1OGSA 2WZTA 5FJTA 1ONEA 5BMWA 1V6TA 5T26A 2YYTA 5TQLA 1QNOA 3EKGA 4DNMA 1VFMA 4QISA 1E51A 3UWUA 1XSJA 2GJXA 4IIEA 3QY8A 2XZ9A 3VMPA 3S83A 2V5DA 2EG7A 2ACQA 1ZGDA 4PCFA 4LB4A 2CLKA 3GH7A 1C8VA 2ZC1A 3OTRA 5K4XA 1E15A 1H0IA 1QU4A 3NL3A 1EC7A 4XKMA 3TJIA 1KBLA 4QROA 1W6TA 3BZGA 5HNRA 3AXXA 2WAGA 2OKTA 3KVLA 1EQCA 3TE9A 1QPOA 4L9ZA 1WKYA 2OZ8A 4I8YA 4UFHA 1JPDX 1DJWA 1GW9A 2CC0A 3MCMA 1UA7A 2ZDRA 1H62A 4B4HA 2ZX6A 1R2TA 4GBDA 3AUOA 4ACZA 1C8QA 1EX1A 4MKVA 5D9NA 4V27A 1CXIA 4H6QA 5CZ0A 1XC6A 3G18A 4JYEA 4NI8A 1WZAA 5MHBA 1M01A 1Q2RA 5A2AA 4LX4A 3ZT5A 3TYZA 1W3HA 3TJLA 1SYTA 1AQ0A 1HG3A 1OVDA 1LG2A 1LORA 3DG6A 5HPOA 2DQWA 3GTIA 2ZCGA 3IIXA 4B5VA 3WD4A 4ZL1A 2P3EA 4S23A 1VPYA 2P10A 1P48A 2YW4A 1XUZA 3I68A 3C0SA 4HTBA 4M81A 3KWSA 4ECLA 1ZL1A 1UP0A 1A50A 1QW8A 3TLLA 3BSMA 3IGXA 3VZZA 1OFPA 1OM0A 3DHDA 3SM0A 3T1GA 4X3ZA 4L1GA 2X09A 3PTKA 1Q13A 4UTMA 5FOOA 4QAWA 2YCKX 1GW1A 3LLDA 1CEOA 4YN5A 3BJTA 4NNCA 4BF9A 3W7MA 3FX4A 1XP3A 4MNMA 4N9BA 3USZA 2WANA 3GNXA 5BOFA 1MUCA 1VAHA 4CD6A 1QASA 5D8WA 5RUBA 4XO6A 4C90A 3HURA 3PC0A 2E8YA 4PRWA 1UQYA 4FOUA 1MFUA 5F2GA 5IDZA 1ZJAA 3AC0A 4KPLA 1GOQA 1W1TA 3SR7A 3W71A 1EDTA 1GTEA 3A5FA 2GZXA 1QWKA 3W37A 2ZTJA 4HOXA 3EOLA 2Q02A 1EYWA 1W5OA 4UTWA 3UXIA 3MUXA 3PBUA 3B9DA 1SQ7A 4EPBC 4GBUA 3GNNA 3QMRA 1EDGA 4DJFA 4GYPC 4YJ5A 3V1HA 5I3GA 3W70A 1J8VA 3IK4A 3FDKA 1FWJC 1LYXA 4IP7A 1KBIA 1TWDA 2YOCA 5A5WA 1UMYA 2X0YA 3OP2A 1M04A 4ERIA 1EFZA 3NOEA 4DZ5A 3RO8A 1KTCA 1I0BA 2XH7A 2XIOA 2WLZA 3PZGA 2W79A 3BG3A 2EJAA 2ZXQA 1LG1A 1CTNA 4HK5A 3VD4A 1SVDA 1FKWA 1PTAA 3TAKA 4Q4OA 2PLCA 1G69A 2UY5A 1OYBA 3VGBA 4ONVA 3WDJA 5CAHA 5BXSA 3HOJA 1TPUA 1JZ2A 1AH4A 4XSMA 3IIVA 1LZOA 3WBYA 3UY8A 2W91A 5CGTA 1P6CA 2VVNA 3MP3A 1WAUA 4JCMA 3NO1A 3AHYA 1RCQA 3AUJA 3EB3A 1QAPA 4CCCA 4LWWA 1EB3A 2C0AA 3ZVHB 1OGGA 3IJLA 1XS2A 1BF6A 1FWGC 3SBFA 4P7NA 3P2VA 5GQBA 4DWSA 1DJYA 4GC4A 1QI4A 3LCXA 2TSYA 3KVJA 3OBEA 1A5NC 5FSEC 1JDEA 3LG3A 3GC2A 4H7CA 3A5VA 3P8JA 3NQEA 2H3BA 3MSYA 4LAZA 4MNJA 1HL8A 4D72A 4BQ2A 2HISA 1S2TA 4OTKA 3QFWA 3EDDA 3GW0A 3GXTA 1SO3A 3T07A 4NXSA 4GINA 4E4UA 4XTIA 3KTCA 5DLCA 2FKPA 5ABTA 1PCKA 2ZC8A 1IEVA 3KUMA 2HV5A 3K8LA 1ISWA 4MY8A 2OXNA 1HL9A 2BX7A 2SFPA 1R3WA 1WZLA 2IQTA 5EFDA 4F2TA 3N17A 5C9WA 3LSBA 3EWUA 4N6EA 3DFSA 1RV8A 1TCMA 3QKZA 5REQA 3LY0A 1EJ7L 3CV7A 2B4GA 1WXZA 1BVWA 1VQTA 3W27A 2J24A 2YFOA 3STCA 4GJJA 4M82A 2I5QA 3A9IA 2CW6A 2J88A 1J11A 2EPKX 4NUWA 1N2VA 2VURA 3H2EA 3A47A 4LAUA 4PL1A 4A22A 3CQIA 2QJNA 2QIIA 3GY1A 3H53A 3MV01 2XM1A 5D2TA 3PSVA 1DIOA 1I2QA 4E4FA 1MDLA 1PIGA 5A94A 1BD0A 1O95A 3LNMA 4MNKA 1US0A 4O1CA 5C7VA 3H70A 3QQ1A 4FSAA 4UWMA 3PPCA 4GQRA 2WO5A 1XG4A 4V28A 2FH6A 1CX9A 5I3JA 4TO8A 4FHAA 3DYOA 1AMKA 1Q4WA 2DW7A 1E4MM 2WMIA 1K9TA 3I3EA 3CO4A 1UZ4A 1DWJM 2G3NA 2RH9A 4O14A 1UR9A 1DP0A 3K8MA 3KW3A 3L67A 3WENA 4AF0A 1GG0A 1W8SA 3P82A 5DBUA 3TSDA 3CL8A 4PTWA 3UWQA 4U3AA 3GAYA 5HJYA 3LXCA 2G95A 4XUGA 3OHIA 1NH6A 2HRWA 4QJ3B 4ZQPA 2XM2A 4MY1A 4H9VA 2QCDB 3WMBA 2VCAA 4JYFA 1K9FA 4KEUA 2QXWA 2Q8XA 4GPNA 4M24A 4YS1A 2CLPA 4MKNA 1QPRA 4O1EA 1TTQA 2ZA2A 2F9RA 3TOYA 3T81A 2FDSA 1R5YA 3N19B 4Z2HA 1QW7A 4S3CA 4CD7A 1HN1A 3LCWA 1JGMA 1CGYA 3WK2A 4OUEA 2V68A 1NWTA 3SUWA 2BGNE 4CNUA 4E6MA 3JVAA 3TYCA 3W81A 3R10A 3OQEA 2OTDA 3W7KA 5LIXX 2JKAA 1F9CA 1GPFA 1TPDA 4RE3A 1YADA 3RG6A 3TP4A 2FZ9A 4GXMA 4M7TA 3BAXA 1JUEA 1ZLPA 1L6GA 3AXKA 1KR1A 1XIFA 3CZKA 1K8CA 2QEZA 1RQEA 4A3RA 4HA1A 1E70M 4OKDA 5KITA 4FNSA 2GK1B 3LZ5A 2VD8A 1Z69A 2IKHA 4Q6JA 3CNYA 4GYPA 1W5QA 4JFWA 3WH9A 4IIFA 3W00A 2QMKA 1UZHA 4AWSA 2P76A 1V6WA 3EEZA 3IS4A 3CV6A 3L66A 4XBSA 2Z1KA 5E70A 3FFSA 5T91A 3W7EA 1GEHA 3PTMA 1M68A 4Y9OA 1YNPA 3DFTA 3GAKA 4PA8A 2NV2A 3KOXA 4LT9A 3AXHA 2X40A 3URBA 4PCTA 3FYYA 1H7PA 1Z48A 5M1TA 1JL8A 1DWGM 1BEUA 2WB5A 2Y62A 3FSTA 1WOBA 5I3KA 4ZQOA 3NO3A 2D73A 4YCPA 1WX0A 3FHAA 1H41A 2RDWA 1Z89A 4GY7A 4WOQA 3HM7A 1MUWA 2Z28A 2R6OA 4DX3A 2CLMA 3S6DA 2FJUB 1UUMA 3SJ3A 1M9HA 3EX3A 5LNVA 3O06A 2XSXA 3QJAA 3II1A 3DESA 1NDWA 5XINA 4QAIA 3KTXA 1IZCA 1JYWA 2VEGA 1WA3A 1Q4NX 2E9LA 3WBWA 3RPTA 4MB3A 1HGWA 2F6UA 4M80A 5HMEA 3VDBA 1JG9A 4PMDA 1DYSA 2NVDA 3D0CA 1A5KC 2B7PA 3DHUA 3OLGA 2INFA 3EMQA 2BY1A 1EA9C 3KVMA 2TODA 1OFEA 2A21A 4X0VA 1YHTA 4TMCA 3HPFA 2B0MA 4K3ZA 1IXPA 1TR1A 3OBKA 3VIOA 2IS7A 3VNMA 2C7FA 3M0HA 4XB3A 3E0VA 2PB1A 1F5ZA 1J4EA 1XPGA 1P43A 3M44A 4AD1A 1FWCC 1WXYA 5K4ZA 2V5KA 4AX6A 1QR7A 2QCMA 3PUDA 3ZMRA 4GUIA 1Q8JA 3RMJA 2ALRA 4DLFA 3OW1A 4H3DA 3TTQA 3WNOA 1F3EA 2W6RA 1C92A 1T6MA 1Z41A 4GUFA 3CHCA 8CGTA 2PLMA 1D7FA 4XBJA 3UYIA 3IK2A 3GU9A 4M3PA 4AEFA 2HNHA 4C65A 1LLWA 1QNRA 3BOXA 3TKFA 3L5MA 4M6UA 3N1AA 4EX4A 1E0UA 5H6HA 2QPSA 3OPSA 3EX4A 3SAZA 3REQA 2PDWA 3VA8A 2OEMA 2OYKA 1CB7B 4YIWA 3VKAA 1VIWA 2X42A 2O55A 2XFWA 1LF1A 3LV6A 3W7DA 4MTVA 2EHHA 1JPHA 4JTIA 5FEXA 2EAWA 5D2VA 1AL8A 4EOUA 4GVHA 5AVNA 3G1XA 3L65A 1OT2A 2XGZA 1EPXA 3M0ZA 2QJJA 2VZVA 4OBTA 1GT8A 2I9UA 5KZDA 4IPNB 5G4HC 1M65A 4PE8A 4JTEA 4NILA 4C7DA 2EO7A 3EB2A 4GZ7A 1CNVA 3P14A 1H0GA 2YL9A 4HGXA 2OMAA 1B3OA 1B3YA 1KFBA 4Q8UA 2CZDA 4UR9A 4IG2A 3L21A 4IP5A 3UT0A 2EPMX 4PRRA 2XJ7A 1OBAA 2ZVIA 1OYCA 1VFSA 1QW9A 2BHYA 3VIIA 1U5JA 4BCEA 2WSRA 2BASA 4XIMA 1WDPA 4ORIA 1SUXA 1YYAA 4IX0A 1JEZA 5EBAA 3BMXA 2QUUA 2Z1WA 3RGTA 4WKFA 1CT5A 1TTPA 5I7GA 4CVUA 3FCPA 1ZCCA 3L4WA 4HNVA 4N9DA 3VE7A 3W75A 5AZ1A 4WOZA 3RLHA 5EMMA 1M53A 1SJCA 3G1YA 3T0AA 4Z2LA 1I4NA 2X30A 2BVYA 3MW7A 5G4EA 3O0KA 2F61A 3QV7A 1LM1A 4LB3A 1MDRA 5HMFA 2QUMA 1D8CA 1W2VA 1DHKA 2WNZA 1OC5A 3VGFA 5ECVA 3MJYA 3B9NA 3COTA 3L7RA 3LPPA 4MPKA 4O0ZA 2D2JA 5LA0A 5CG7A 3LENA 3BCFA 2EBNA 4E8CA 2R8WA 1X6NA 3ITTA 3A4WA 3KBJA 1UYQA 2GQ8A 3W1UA 1Z32X 1XH0A 1FFQA 2FTWA 1PDYA 2GGIA 3CIXA 3PFRA 3G1DA 4J35A 1M6JA 4S3EA 3SO7A 4LUSA 3TTYA 5AECA 4KCUA 4A3HA 1TE1A 1TELA 4KF1A 4PMJA 2QCCA 2GGEA 2PDBA 1FUYA 4RUBA 1XYAA 3WQ6A 2DPEA 3ARWA 3W0KA 1E6ZA 3BG5A 4C1LA 3MSRA 1PUDA 4CNSA 2GDUA 4JN8A 3B3DA 2BHZA 3PP7A 2PRHA 4NJKA 5H1WA 4JFSA 1UH3A 4H8HA 3Q4DA 3G6MA 3SRKA 5MF5A 1EO5A 6REQA 3HG5A 1E3ZA 2WLYA 2DSUA 3C2EA 5D2XA 4FOJA 3KZSA 4A2SA 1W2PA 3HG2A 3TA9A 2UY2A 4XD6A 3GSMA 3P3BA 2CIPA 2ZX8A 1W1A1 4BZYA 2EGZA 2J4GA 3GYEA 1KGWA 3NEVA 2DEPA 3FY1A 4B9YA 1KM4A 2ZZ3A 4X60A 3NAVA 2HDJA 1F07A 2ADAA 3TFCA 2UY4A 3G1SA 4O0KA 1J5SA 1NFBA 2YA0A 1RA5A 3FK4A 3TEVA 4J7RA 1MRQA 1RZMA 1M7OA 4AUBA 3L23A 4PH6A 3V3WA 1TYGA 3VUSA 3STEA 2X1IA 1CLVA 2BOGX 2HPMA 1VR6A 3EPNA 2OT1A 3ZJ6A 2DSVA 4K8GA 3UXAA 3JZUA 4DY1A 2QCLA 2H9AB 3ARTA 3CZGA 4JTSA 3M0IA 1HNYA 2XG9A 3ALGA 4LUTA 2GDQA 3K5XA 3MU7A 5HWNA 4LAMA 2VFIA 4FNQA 1R2RA 3BLEA 1XBVA 4F0MA 2CLIA 1UKTA 2BXZA 4UXDA 2E5BA 2CLHA 3MI2A 4TOQA 3GD6A 1U1UA 4Z1BA 5CPTA 4XBKA 5LKYA 1YDNA 2ONEA 4J28A 3HG3A 3DAQA 1AW2A 3OYZA 1EXBA 1RK5A 4URIA 1NQ6A 2YB1A 2OR2A 2QUVA 4NSBA 1VBGA 2VJXA 5HNTA 3VINA 1FOBA 1CGXA 5HR6A 2XHYA 4F0HA 4GY0A 1BQGA 4KS0A 5HANA 3ATZA 5I3DA 1W5PA 3ABZA 4AVOA 4W7UA 1KXHA 1XW8A 3EWXA 3GC5A 1MXSA 4JOMA 4NF7A 3S9IA 2AQVA 1XICA 1FY6A 4EF8A 4PMYA 3EWDA 1UOZA 7REQA 1MVYA 3SQLA 5A6LA 3WH5A 4IL2A 1UH4A 5F2MA 1IXOA 3GE7A 1OCNA 1DJNA 4WK9A 4UCGA 2WNQA 3W24A 1VEMA 3WEZA 1B57A 3R11A 1OX6A 4NJGA 3MDWA 5CJNA 5E5CA 1DVJA 4AG0A 3T0TA 3RLGA 3U8GA 3LI1A 2QS8A 1MZHA 3CEPA 4Y7EA 3T8LA 4QE1A 1UD2A 3CJPA 4R34A 4IFKA 3WH6A 2X0SA 2PMQA 4QTGA 5A6JA 1B3WA 1TREA 3M9YA 1BKHA 4C1NA 4HIBA 1EP3A 1AK5A 4GX8A 1VJZA 3L5LA 4JXCA 5PTDA 2I7GA 2YCIX 4NT0A 4O50A 3CH0A 1NOWA 3WDPP 3U5UA 5BOEA 2P5NA 2E0PA 1MW3A 3CUHA 3N34A 1WKDA 3WSUA 1I75A 3B0UX 4KGLA 2PI6A 4U31A 3ERPA 1V93A 3GXIA 4NX0A 4R85A 4ES4A 2AKMA 1VFUA 3AZRA 3GRIA 4Z2GA 4RXFA 3BO9A 1V51A 4DXXA 3W7PA 4ZFCA 1VZWA 3P8IA 2FZ8A 3ALFA 1FDJA 3S6TA 4EPEC 1MMFA 4BA0A 3D3FA 4WEVX 4QR6A 2ZUWA 4YMZA 2DUAA 5FCZA 3RX4A 3ZIZA 4PULA 3UZWA 2EG6A 4ZO8A 4XZLX 5HPCA 5FD0A 4NZ1A 1H3GA 1JF5A 1TR9A 2WYSA 1KLZA 2VX5A 3L2MA 4HOWA 4IJCA 1PKLA 4UNIA 2Z6JA 1W3TA 2Q09A 5K7JA 1KBJA 2Z1XA 2ANUA 1P0BA 4LBSA 1LQ0A 1J0KA 4AZ6A 1ZB5A 3QY6A 4RLIA 1PZ2A 1W1ZA 3W3OA 1REQA 3N13A 2GJXB 1R3TA 2E4TA 1H5VA 4IJBA 3BARA 2TRSA 1UUOA 3LSCA 3DH7A 5FF0A 4JTUA 3E1F1 3WZ0E 2QHAA 1C91A 1ME9A 1QI5A 4HN4A 2A5HA 4B5UA 4Y9PA 2PGRA 2G50A 3E3HA 4NYYA 3W1QA 4PYSA 3TN5A 2ALDA 4ZE5A 3KAOA 2Q71A 1I0DA 1EJTC 2QJMA 2PRMA 2PE4A 1KC7A 2V2CA 1AJZA 1EWEA 3DFPA 2G4JA 1E4IA 5G2WA 2O92A 2ACSA 3QZEA 1HVQA 4EKJA 4M1BA 2ZZ1A 4HHHA 4U4MA 3GR8A 3IGHX 4KEVA 2X16A 3AMDA 3WLSA 3HFYA 2F38A 1B3XA 3LMYA 3B8TA 5HQMA 2OEKA 3NOYA 3PULA 4O1BA 4ACZB 3BSGA 4H9YA 1IXNA 2RKXA 4R9XA 1TCDA 2CCRA 2CLEA 3AICA 3P61A 2ZZ4A 4F0SA 2VKZG 2D1ZA 3NR0A 1UQZA 3PBYA 1EJVC 1PL9A 1XGEA 2CZFA 2VC9A 4UB9A 4UMAA 4ACYA 2VNCA 5H8PA 3GTHA 1GVFA 2WHKA 2FFIA 3R8GA 5F2LA 5K2ZA 3NQCA 4QM1A 1JZ3A 1VB9A 3SRHA 4EF9A 5G1MA 4NY2A 4CQ8A 3GS6A 3NYDA 3W1TA 5DCBA 2FGLA 3B8SA 5J04A 3PZTA 4OV4A 3PY2A 3V4BA 5AHEA 1K8XA 4JTKA 1R38A 3CAKA 3K4AA 3VCCA 2FVLA 1NVMA 1DIKA 1OK6A 3UCCA 5I00A 4ZO7A 1FVPA 2GVLA 1U1HA 1VJIA 4AZGA 1E73M 3NVDA 4PUUA 1MEHA 5HK4A 4ZQRA 1CW2A 1TB3A 2E6FA 4GA8A 1I2RA 3JU2A 4FXRA 2PBOA 5C0QA 2TYSA 5B7ZA 4PEKA 3DGRA 5C9ZA 5BU6A 1TA3A 1LWJA 1TIMA 3IJ9A 3L0KA 1LDCA 2UV8G 1UJQA 2ESCA 2Z1SA 2JE8A 1EC8A 2A3EA 1XG3A 4JQ1A 4XZIA 4TVUA 1Q3NA 2D20A 4EXAA 1TVLA 2QNEA 1JRCA 1NFGA 4XKYB 1UG6A 4WIWA 5LA2A 3MZNA 3PZOA 3T42A 1XHGA 4FXFA 3SY5A 1DJQA 1G0CA 4FIQA 1HKMA 5HULA 2DH3A 1A5BA 1B1YA 1P7TA 3W7LA 3O6CA 5DN1A 2VYOA 1ZJBA 2NQ5A 4HU3A 2XH2A 1S5NA 1KCZA 5CPNA 4H00A 1IGWA 3ZJ7A 2HCVA 4L9YA 2W4XA 1F61A 4AIOA 3GIQA 4JTHA 1EQPA 1G4SA 1R9ZA 3NSNA 2PC8A 1EHNA 4IF2A 5AB3A 3KOZA 1XLHA 2QDGA 3GM8A 4UQBA 3UNTA 4L4LA 1XLFA 5CC3A 1H49A 1H61A 3BW4A 4WXYA 3UVIA 2XH4A 3MT1A 2OYLA 2ZRXA 3EXRA 2D22A 5A1AA 1ISVA 3BLLA 3P0WA 4GC3A 4LYRA 1LOQA 3N4EA 3WD2A 4AZCB 1H51A 4KCTA 4MLJA 1EBHA 3BGAA 1SJDA 1GHRA 4BFAA 1TTIA 1ADDA 2A79A 3OZYA 4O53A 5BXTA 3HA1A 3LPFA 4UTIA 3A21A 1GVRA 1K4HA 2CXEA 3GR7A 4AD3A 1BXBA 3A4XA 3JZEA 1AW1A 3TNBA 1JF6A 1RJRA 3CQKA 3ITXA 3V7PA 1GG1A 2OCZA 3APTA 3ELFA 3MKKA 2A3LA 3QH2A 1JCNA 3WJXA 3EOUA 4RE2A 4PEEA 3UZYA 4ROQA 2VRJA 1JVNA 3UPMA 5HUPA 1W37A 4ZVJA 4P61A 5A6AA 1L8PA 3M41A 4QCEA 1UBPC 3WQVA 2DIJA 3VVGA 4B3ZA 3IV8A 1YMYA 4A3QA 1A5CA 3KOFA 3H2OA 4XX6A 3WD3A 1V7YA 1A5UA 2NXIA 3MSGA 3VU2A 5CPMA 4JN7A 4V2XA 5AY7A 2PDCA 1GUVA 3GVQA 5DO8A 3LCGA 4Y9MA 4AZIA 2ACUA 3DKJA 3QMSA 3TN3A 2HVMA 4AVFA 3EGJA 1EJRC 3WELA 3N2TA 3HMJG 5AOUA 2HVNA 2WMJA 2VFHA 1I2OA 3PTQA 1J9YA 1E71M 2WJEA 1SMAA 3ZR6A 3DG3A 2ICSA 5GJNA 4NNAA 4FX7A 4UTHA 5ABFB 3OIHA 1KGUA 4HK7A 2Z2BA 1O7AA 3LX9A 3SCUA 2W92A 3S1UA 4DXKA 3DECA 1TZZA 5D4YA 1VRDA 2VGGA 3N2CA 1ZFJA 2Q01A 1KO0A 1IXQA 2NX1A 4DJED 3TFXA 2E67A 3CAVA 4N4PA 5LXEA 1G7UA 4IMGA 1D2KA 5LSMA 2H3DA 1S3TC 3A3HA 2NQJA 5EY5A 4NZJA 1AL7A 3DG7A 3LCLA 3P67A 5LIUX 3ZS4A 4ZENA 2A6LA 3SIMA 1WAWA 3L0GA 1PSCA 3UYCA 4IQDA 3W26A 1JPIA 3M47A 2WMIB 3SQSA 2CERA 9XIMA 2WQPA 4DUOA 2OOGA 3NA8A 3N9SA 3W6LA 4J40A 4AF0B 1DQWA 3C3UA 4HCDA 1XYBA 1ISXA 2VRKA 3U6WA 5LNRA 4NZ3A 1GVIA 4H9TA 4L4PA 3WLPA 3UGVA 2Y24A 1O5RA 2PRLA 4GFSA 1XI3A 3SN4A 1ZJHA 3P5YA 1OSEA 2YCLA 4IICA 1EJWC 2Y85A 3UJEA 3CZLA 6TIMA 3RJYA 4H9XA 3K2GA 1HJWA 1ZAJA 1XBZA 1Z3NA 4JZ5A 4D2JA 5DCDA 1JQVA 5HWMA 2EKCA 4IPJA 4DO7A 4NZ4A 3W7GA 3HPZA 1EC9A 2A4AA 1KKRA 4UOQA 1WDQA 2J77A 5I0DA 4I5XA 4GZEA 3TXZA 1YPXA 4IXHA 1BYBA 3GG0A 1VS1A 4TUFA 1GKPA 2H8ZA 1U1JA 2R24A 3EWYA 3UQNA 3CAQA 4CVWA 1ONRA 4FEZA 3A3WA 1CI1A 1MNZA 3WQ8A 5JUVA 1JUKA 2EJ1A 4ZODA 4WY0A 5FI8A 2X7WA 2FLIA 1CDGA 1S5WA 1LL6A 3F4NA 4JYDA 2NVAA 3VK5A 3DFNA 4P7LA 4J3SA 3SCTA 4E8DA 1F3XA 3AYSA 1UWIA 2QJHA 5I2UA 3GIPA 2YXOA 2Y8KA 2GL5A 4HCLA 3ARXA 3WFLA 1QK0A 4CQDA 5CGQA 2DVXA 3EZ4A 3GU1A 4FA3A 1Q6CA 4FF5A 1Q66A 2Z26A 2P88A 5FESA 3ABRA 3NPWA 4FIRA 4GQQA 2D2GA 2EEXA 1UWUA 2WPGA 1DPMA 4EXBA 1H63A 2NX9A 3N2OA 4LW7A 1BYAA 1K6AA 1J96A 3VXGA 1KM0A 3CV2A 3TR9A 3CIWA 3WJWA 4GI9A 1P4CA 3WFAA 2FMNA 3S5ZA 1UD3A 4OE7A 7ODCA 1L6SA 4C91A 3TU9A 3R1ZA 4FS9A 5A6KA 1OK4A 2WSYA 2Z00A 5LNUA 3FJLA 1NWSA 2BV9A 4WHBA 3AYRA 2G97A 4GISA 1JDCA 3PFMA 3FJNA 1R9XA 3S2CA 1EJXC 4K38A 3THDA 2FVKA 3TROA 1C8XA 1K7EA 3BMVA 1QPQA 3W7OA 4GH3A 2FPTA 3M7SA 4WRHA 1Q6RA 5SWUA 3LBOA 1B4KA 3TZNA 4GO8A 2DZTA 2NWSA 4PCNA 4IPPA 3BQ6A 3PBGA 4JIRA 1DBTA 1SO5A 4GVIA 3UWZA 1ZP3A 3WLLA 1FWDC 3H23A 5DEZA 3WBEA 8A3HA 2E6YA 1KW1A 4MFEA 1UC4A 3CB3A 3GXPA 4PFHA 2E6DA 3NCOA 4HMDA 1TSIA 1H5YA 1DWIM 4N4QA 1VBUA 4Q4SA 4DUWA 3QVQA 2L5HA 2VXNA 4IUOA 3RR4A 1LT8A 3IIOA 3LEPA 1VCFA 2ZTKA 1KTNA 3ZVIA 3KCLA 3GH5A 3F4DA 4UR8A 3AAMA 3WH7A 3S4TA 5LHFA 3N14A 2DVTA 1H7RA 4E3TA 3AMKA 2YJQA 4Q3MA 1U22A 4H2HA 1BRLA 2C1HA 3RCNA 1YTEA 3QM3A 5AYZA 5IHSA 3U2CA 4KFPA 4Z08A 1BWLA 1LQ2A 4FXSA 1NWUA 3URNA 1S38A 3B9EA 1A5OC 2Z4GA 4HHLA 1SO4A 2NT1A 3IAQA 2MANA 3UR7A 2P0IA 3UGRA 1J5TA 4LC8A 2QKFA 1EH9A 2PS2A 4XO7A 5CJMA 3GTNA 1OG6A 1PIFA 2ZRVA 1C29A 3N29A 3SCWA 1GOXA 1GOKA 2WMKA 4B15A 4OIFA 3RO6A 1G4EA 1S5VA 4D6DA 1BYDA 4HU8A 1UZDA 3TV8A 1JCMP 3ITGA 3W7QA 4ILSA 3PUEA 1SGJA 3E38A 4G2DA 2GJLA 1DHPA 1KQYA 3O0FA 4MOZA 4MYAA 3GIYA 3DGBA 4DZAA 2BVTA 1X8CA 1IHIA 3LS9A 1EZ2A 1TFVA 2C8NA 1NAL1 1RUSA 4C6FA 4HB7A 4JS3A 1QVBA 2WK2A 3FYPA 2BSLA 3FDGA 1YDOA 1YBQA 1PWMA 4UUIA 1JZ4A 3ZR5A 2A85A 4DJDC 1W3LA 4R9OA 3DUGA 2C15A 4R5EA 3W87A 4PMXA 2GWNA 2H8XA 2WCAA 2D2OA 5E9AA 3WIJA 1B4EA 4GUJA 5C9UA 3MPGA 1Y65A 2QQ6A 1R47A 4WX2A 4Q4MA 4PMOA 2IQDA 4TVDA 3R12A 4J4KA 4MZ1A 1E1CB 2DFAA 1K7FA 3RCMA 4G1KA 4IG2B 1W1B1 2G3JA 1K6WA 5GJMA 4GABA 1OABA 5A2CA 3BZJA 3LNPA 2D24A 3DHFA 4YHGA 1XRTA 4NAEA 4DJEA 3BV4A 6PTDA 4F79A 1G5AA 1S39A 4AB4A 4AZBA 5JBEA 5H91A 4L4OA 1XCFA 3W2JA 4LFYA 3V36A 1WBJA 3WNPA 4CEXC 5FJIA 3OG2A 1GQKA 2F84A 4MZYA 2ZX9A 1K1DA 3QR0A 1ITUA 3S5YA 1SZRA 3LQLA 1OCQA 2WSQA 3W23A 1WYIA 3AWNA 1OZMA 4JX6A 4EIVA 4E5TA 1M5WA 3RPDA 4HNTA 1TMLA 4IZGA 5AC5A 4C6LA 5A8OA 4S3FA 1CGUA 4CNNA 1N55A 2DDXA 5HNUA 1Q5MA 1VEOA 1RSCA 2OO0A 3IJ6A 2QCNA 3KHJA 4D9PA 4KWWA 4G6CA 3OZOA 3EOSA 3T09A 4CKQA 5A8NA 3VFLA 4YWIA 2PTXA 1UPMB 2AGTA 4EPKA 1CENA 4NX5A 3A4AA 4H8UA 1W5MA 3EPMA 3T05A 2E5DA 2FVMA 5CLTA 3TK7A 4Q8TA 3FOKA 3EB4A 1CXHA 2KX9A 4LUSB 1B9BA 5K9CA 1GZGA 1ZBVA 4JD4A 2OQHA 1CGVA 2EKGA 5IFPA 1W3NA 4I9TA 4HYRA 4BWLC 2V30A 4Q4RA 5F1VA 3ITLA 2QMJA 1M41A 1KBKA 3IACA 3TW9A 3N6JA 1ZHAA 1W54A 1EJSC 3EWBX 4AIUA 1FRBA 1TV5A 4E2VA 1ZALA 3E49A 3NQ6A 4K36A 3TN4A 1Z8AA 3S2NA 1AZ2A 3DC8A 6REQB 4AISA 3UR2A 2BY2A 5DX7A 1H11A 4X2RA 3SURA 1SFTA 2VEMA 1MO0A 1MW0A 1BGAA 2D2HA 4EPDC 4EAMA 4HU4A 3UG4A 1OF8A 2XIJA 2UY3A 4JIEA 5JIWA 2BY0A 1PX4A 4GCXA 4LQ1A 2QDDA 5D2YA 2XVPA 5CG0A 3TH6A 1T8QA 5BNKA 3E0FA 2QUNA 3UJSA 4HA0A 1Y5VA 4LAOA 5LXXA 3B0PA 3PJUA 4UQAA 1CZ1A 4BJHA 3TYEA 1XQLA 2J9XA 1IT8A 4YTRA 3QOKA 2YB4A 3C6CA 1A4MA 1A5MC 4ZBCA 3CTTA 5CZKA 4ZQMA 3VGDA 5CBIA 5JVLA 1BVZA 3U9IA 4FPSA 4LUTB 5GJPA 3I6EA 2Z27A 4UQ9A 1QRQA 1LWHA 3LMZA 2AL1A 3GDRA 1H7XA 2PGEA 1KWGA 6TAAA 4IP4A 2OLSA 4X9SA 4NRSA 4O1AA 3CAWA 3FKRA 3TQPA 1QATA 3D47A 4ERGA 3S6OA 5E09A 4JIPA 4D6IA 3R89A 2IKJA 3PAOA 1WUEA 3NNTA 3MWAA 3W76A 4PBGA 1QO5A 3LN3A 5BWAA 1O5QA 4UTTC 4OBRA 3TYDA 1GVOA 2D0HA 3SCSA 4V15A 1P6WA 1XWYA 3GVVA 1F6YA 1UKQA 1J2WA 1DE6A 4ZO6A 3I3BA 1WBHA 3V0SA 4HA3A 1FWHC 3QW4B 2KZHA 4MADA 1XPYA 4LVGA 3DBPA 3IJ7A 3NDZA 1RBAA 3SFWA 4LGXA 1E6RA 3KS5A 3WO8A 4AHOA 3P5ZA 2QPUA 4GNVA 4KWUA 3OVGA 4R33A 4ZSTA 3OLDA 4A3YA 3UZZA 2INZA 3DFYA 4DJDA 5K9XA 3I7QA 4CN1A 2FPVA 3WLNA 4L7ZA 4IFKB 4CU8A 4DLMA 1JCLA 3BMWA 3ICJA 3EMCA 2XINA 4GYJA 4LUJA 2RJHA 1OADA 3KRUA 4GH1A 1LOLA 1F73A 4C1NB 3CV1A 2PBGA 1V6UA 3CPGA 4DN1A 1W3IA 5LHEA 4O15A 2QCHA 3E2SA 4LVFA 1SSGA 1SU5A 4K8HA 2JEPA 1L6WA 1FCUA 8XIAA 1K3UA 3MP5A 3NDOA 4H01A 3D3AA 4V1YA 1HKVA 2XUCA 3WDQA 4HQVA 4NHVA 1KXQA 2HSAA 3A3XA 3RR1A 5EMLA 1XRFA 4YLWA 3U2OA 5C55A 3M0YA 3T55A 1POJA 1JCJA 1QTWA 3WLTA 5G2IA 3PR2A 3UZJA 3VIJA 4WJ8A 2YDSA 2VFGA 3C52A 4F48A 1PYFA 2BOEX 3DFOA 1GVYA 1R2SA 2Z1BA 3FNDA 4CNPA 4FB7A 1OEPA 4GVGA 5AYXA 2VZSA 4YL2A 1MZRA 4JBRA 2ZUUA 4KT2A 4YPJA 3SEPA 1ISYA 2H90A 1RBLA 4FNUA 4N02A 2OGYA 4JY9A 4RNFA 3RAOA 1LQAA 3VIPA 2C6QA 1VYRA 4ZQCA 1XD1A 5C8BB 3LM7A 1AUSL 3KOWA 3M64A 3OHMB 4PZVA 3FJ6A 3KCJA 3WJZA 1Q6GA 5AC6A 3LCIA 2PDMA 1X39A 1HX0A 3UR8A 1REQB 4AY1A 1K02A 2PSNA 1A3HA 3V5CA 2FHBA 3B0XA 3OA5A 1V4YA 3TMLA 4B90A 2WZMA 2VWTA 5CLWA 3ENLA 3LPOA 3MVIA 1EPVA 1TUXA 4IMFA 3FN9A 4BWLA 1XINA 4A6GA 3DYMA 3F2DA 1I1XA 2CLOA 1FWBC 5MKGB 4J5NA 2CITA 4DBDA 2R1KA 1GOIA 3NQMA 2AKZA 3SIZA 5B80A 1TIWA 4LV9A 2VT0A 4ICNA 2BHUA 4PMVA 4F66A 1KLYA 3FV9A 2UZ9A 2GGGA 2IPGA 4AY7A 5AFDA 1V6VA 1IR1A 1LOSA 3GWQA 2Y5EA 1OHLA 2PU0A 3CMJA 1DXFA 5AVHA 3M46A 2G3FA 2GYIA 3VNLA 2CHOA 3MCOA 1HGYA 3B8UA 4Q4KA 3W82A 1IT0A 2A7RA 4P8VA 4DUXA 4HMCA 2C16A 3VD7A 2W61A 3AYVA 1CXFA 2ODOA 4Q7BA 5HWJA 4H19A 3W1NA 1FX6A 1EIBA 4L64A 2XVNA 5LA1A 2PZ0A 1YNQA 4IXXA 1YTKA 4V1XA 1UR0A 3HGSA 3OQ8A 5FJJA 4LSBA 2BMBA 3LGEA 2IXUA 3DEQA 3ZLGA 1BAGA 4JTAA 2X8RA 2YZ5A 1QK2A 4MWAE 4J3TA 1N82A 3LGDA 4AYSA 3IJIA 2G3MA 4IIBA 3LLXA 2GQ9A 3PB0A 4QQ3A 4NJHA 1A49A 1XLLA 2IKGA 1ADOA 3KLKA 2WOQA 4ZOCA 4HYWA 3TW7A 5HA7A 1TA3B 4WJXA 1G6CA 5TAOA 1A80A 1OIFA 3GYCA 3V5FA 1E9IA 2V81A 2Y63A 4UTTA 3IUHA 2J7HA 4DWSD 5EGRA 2V0TA 1E6SM 5CBJA 2WQDA 3WLKX 4B3LA 2A0NA 3WMSA 2FHCA 3VNYA 1UD6A 2F8QA 3LDVA 3U7VA 1KBBA 3DIPA 4HN8A 5ABHA 4U5KA 2WSKA 3TTOA 2EPHA 3FIGA 1S2UA 1P7TB 3H7RA 3WK0A 4HNLA 4UFJA 3LBCA 1V08A 3H24A 3TXVA 1QT1A 3EOEA 2HK0A 1D7KA 2NUYA 1LRNA 4ERAA 4LPCA 4LAKA 1FCVA 1KQZA 8TIMA 3BCJA 4J9JA 1KA9F 1D9EA 4OHQA 3O8AA 4M19A 3WNNA 2G8ZA 1H60A 3PNZA 2OOFA 3IUDA 4O8RA 2V3EA 3WF3A 3LB0A 1K7XA 1ZPTA 1UD8A 1KKOA 3LK6A 1PBGA 1FCBA 1G01A 5HXMA 5U7SA 2HK1A 2RDTA 3L4YA 1AZ1A 2DVUA 1RP9A 4PSPA 1MSSA 5JQ9A 4REQA 2E1WA 7TAAA 4IIDA 4M29A 3IJDA 3AROA 4X9YA 1HJSA 4LRSA 7CGTA 1W32A 3L9CA 3SUTA 1JD9A 1H1NA 4RW5A 3M16A 3TMQA 4W5ZA 3O6AA 4AEEA 1UASA 3W4RA 2FJKA 4F9DA 1S2VA 5IBXA 3GK0A 4NIRA 3UWEA 3LZ3A 1Q2SA 1VBHA 3S5NA 1XLGA 1N7KA 3HBLA 4LVBA 3ZT7A 3UCQA 5DBTA 3O07A 2OB3A 1DV7A 1TQJA 1Q6DA 2OQYA 4GUHA 4NXKA 3N25A 4GFIA 3DOPA 5KINA 2Y4SA 3MUIA 2Y7GA 1UCWA 4UIOA 4ZOBA 3NEHA 3MWCA 4D6EA 4K1GA 3N6QA 1IZKA 1OX4B 2HXTA 2PLJA 4DB7A 4PUNA 4GQGA 1HTIA 2Q3RA 1H09A 2JGQA 4KKXA 3CUFA 1SFSA 1F4AA 2J7FA 1PKYA 1ZENA 4JNMA 2DGAA 4H9ZA 2WJFA 3NM3A 4ZFMA 1EEPA 7A3HA 3WMLA 1L9WA 1NP0A 1XIIA 5CJ5A 2PWHA 4I5RA 4HPGA 4YYCA 3UWYA 3GVRA 4Q32A 3WQDA 4LV4A 1V77A 2G3IA 4UTJA 2PF0A 2OWXA 1NDYA 1UR1A 4AXNA 4JTJA 1CXEA 5D05A 3VUPA 3AZTA 3ORWA 3B8DA 1LT7A 2PDKA 2RUSA 3CC1A 4PTXA 4KWVA 3AQUA 2OKOA 3W1PA 1GJPA 1Z6KA 4KFOA 5LNSA 4WD0A 1UR4A 3MA8A 1M1BA 4FR6A 3KXQA 2GVJA 4ZCWA 8XIMA 3SCPA 4DXVA 1CECA 3INPA 2IPJA 3U57A 4ZB0A 3GQYA 5E93A 2ZRYA 3VOFA 5DMLA 1AH0A 1Q65A 3S5OA 3BPWA 4MGGA 1TJ2A 1VPXA 5DY2A 3MKVA 2FFCA 3GFYA 1EP2A 4MPQA 4CEUC 3TC7A 4LRTA 4KRTA 4NI3A 3NL2A 1E4LA 3WY1A 3F5JA 3IARA 3TSBA 4W86A 1PCWA 1YDYA 2FZNA 2QZRA 4D6HA 1B2YA 4R88A 3WD0A 2ON3A 2Y7EA 3GHSA 4XZNX 3VM5A 3WQGA 1KFCA 3EBVA 3NQDA 4PL2A 3WLIA 4NZCA 4CD8A 5J5RA 3W6MA 2CKSA 2D0GA 4Q8PA 1LBLA 1EF3A 1VHCA 3LRMA 3PF3A 3PSWA 2C1IA 4LCQA 3NG3A 4S3DA 2HEJA 1CYGA 1JPKA 3VKKA 3ARVA 5FSDC 1WDDA 4D6CA 3NYZA 4JFTA 4GK8A 1DL3A 2PP0A 2YCLB 3JR2A 3T78A 3VO0A 1MI3A 3N4AA 1J0ZA 1K9EA 2NW0A 1Z7AA 4P7QA 2V69A 4W4QA 3NXLA 4DI9A 3ARRA 1MEIA 3SCRA 4KCWA 3LRKA 2E5CA 1NOUA 2VO5A 1PX3A 2WHMA 3I7RA 4QNEA 4JDBA 1EJUC 3WF4A 3EPOA 3M5ZA 1BKSA 5JU6A 3STGA 4ML9A 3C61A 3LXBA 4E0CA 2FH8A 2QULA 3RX3A 1SR9A 2NQHA 3T40A 1R85A 4WY0B 2R1LA 3V75A 3FW6A 5FIPA 3QF0A 2F6XA 1BG9A 2NT0A 4MYXA 5FJPA 4QEHA 3H2MA 4U2ZA 4XQ6A 3SI9A 4ZE4A 4IMEA 4EK7A 4W7VA 2VP8A 2Y88A 1NIUA 3KRBA 5FJUA 3UJFA 1XRVA 4K68A 1TVNA 3UR5A 1JYNA 1K4GA 4GZIA 3KL5A 3CU2A 4UTUA 3DBNA 1E40A 1YIXA 5ECUA 1DJHA 2J7GA 1TPH1 4US6A 5H8MA 1JZ5A 1A4LA 4JNYA 4TX6A 2V3FA 1G67A 3KCOA 2QV5A 3CIVA 3PWAA 1F6KA 3OJGA 1CPUA 1ZNNA 2YCJA 3N9KA 3C2FA 1J18A 1AH3A 3CUIA 3NZRA 3W2UA 3WDIA 5FEWA 4WQ6A 4F8XA 1LL7A 1CWYA 2R14A 3MBFA 2R1NA 5CZJA 3P84A 2A6NA 1ZTVA 1CLKA 1PXGA 1TJPA 1W0MA 4HHMA 3B8IA 5A3HA 4O16A 2QPXA 1S2CA 5AC4A 3MDUA 2WMFA 4S3KA 4AX7A 5L9FA 1E3XA 2DV0A 1JNEA 4XAZA 1YQ2A 1DTNA 2CHNA 4JQ3A 3A22A 4NAFB 2DSKA 3ABQA 3GUGA 1T41A 1XC4A 2RJGA 4U2YA 3TTEA 4X0NA 3TN6A 4Q7IA 2Y8VA 2I16A 3UBPC 3TYUA 3ZLFA 3W7RA 5CC7A 3RLVA 3BOLA 5EL1A 4WY0F 1B3VA 4WVXA 4W8LA 1FP9A 3WNLA 5EYWA 1Q7MA 4DELA 1UOKA 4MWAD 3Q45A 3WDRA 1NY1A 1ZS2A 4QCFA 4DO5A 6XIMA 5I09A 3WBXA 1NWRA 1O1ZA 4B9ZA 2R94A 3PAJA 1PZ0A 1FBAA 4W84A 4EVZA 1OFOA 4CLMA 4ZZ9A 4ADTA 1AJ2A 4PB4A 1G4PA 3GHUA 3MO7A 1SJAA 2OO6A 4CQCA 3TONA 3RITA 2CWXA 4WCJA 1T7LA 3ONBA 4GNKB 4P8WA 1V7AA 1FXPA 4JAWA 1BRLB 1W9VA 3BG9A 4AQLA 5AYYA 4Z0SA 5BROA 3AJ7A 3B4UA 1UWTA 2WNNA 1LBMA 1O6IA 2DZAA 1DE5A 5LYRA 5C6MA 3VNDA 4F40A 2EQDA 1E1EA 2WNWA 3G6LA 4W93A 3NURA 1XM3A 1WXJA 3L5AA 4A05A 2VC7A 2CFFA 3DCPA 4WR3A 1V0LA 2O9TA 5FL0A 5TIMA 5A8GA 2VHLA 4Z2IA 1C3FA 1IV8A 4JL2A 4PN2A 1G1YA 3KP0A 4G5DA 4HP5A 4O54A 3VIKA 3CHVA 1OT1A 4P7OA 4MWAC 4D6FA 5H8UA 1ZSXA 4XG1A 3KRSA 2P0OA 5DMYA 1EOMA 4LS0A 2C0HA 5FL1A 4D6GA 4K6AA 1YBQB 4RK8A 1QFEA 4F3HA 3QGAC 4I5UA 4LY8A 1SZNA 3W7HA 3KX6A 5ENLA 1J2BA 5KZMA 3W83A 2ZZ6A 3R8RA 1AA1B 4WKHA 5FF4A 1R3SA 2Y0FA 4PTDA 2YFNA 3WQ5A 1FHLA 3N04A 1CGTA 3W2NA 4M0XA 4IMDA 4XAGA 4ZTXA 5FAJA 3UETA 2PC4A 4XAYA 4AHPA 2ZRWA 2VEKA 3CZJA 4L1WA 4IIGA 5DT5A 1A47A