1F77A

Staphylococcal enterotoxin h determined to 2.4 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISNISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords ENTEROTOXIN H
total genus 66
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f77A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f77A02
1UNSA 3BZDB 1FGBD 1LTAD 1LTRD 2CHBD 4L6TB 3GP7A 1LT4D 1B44D 1EU3A 1RCVD 4RFBA 4RH6A 1JCKB 1PTOF 4RGTA 1V1PB 4OHJA 1PRTD 1SJHD 1D5MC 1I4RA 1EWCA 1JWMD 2QEJC 3EFXD 4UDUC 4C56C 4K6LA 1I4XA 1M4VA 2XNAC 4RGOS 3URYA 1YN4A 3SEBA 1AN8A 1BCPB 2O2LD 1LT6D 1S5FD 1D6EC 2XRQD 2TSSA 1TY2A 2AQ3B 1PTOH 1T5XD 1MD2D 1PTOD 1I4HA 4RHSA 1LTSD 4L63B 1KLUD 1PRTB 4Z9CB 1S5CD 5D3IB 1XXGA 1UUPA 1PZJD 1PRTC 1JQYD 2IJ0A 1PZKD 1I4GA 1JWUD 1BCPF 1AW7A 1SJED 1FD7D 1PTOC 2AQ1B 1EEFD 4RCOA 1CHPD 2R61A 1EU4A 1FNWA 3BYYB 1EEID 1QILA 1SBBB 3R2TA 1LTBD 1JWSD 1KTKA 1FNVA 1PTOB 1TS2A 1ENFA 1HXYD 3R2IA 1ET6A 1F77A 3V05A 1ESFA 5ELEA 1TS4A 1SE4A 5ELBA 1S5BD 4NZLB 1BCPD 1DYQA 4DXFA 1I4PA 1HA5A 1B1ZA 3O13A 2NTTA 1CQVA 1LTGD 3TSSA 1STEA 5FK9C 5TSSA 1BXTA 1S5ED 2AQ2B 5FKAC 1LLRD 1RD9D 4O1NA 1XTCD 1SE2A 3BVZA 1G8ZD 3KLSX 4BWGB 3R8BA 1PRTF 1L0XB 2RDHA 1SE3A 1PZID 1V1OA 1YN3A 3BVGA 2XRSD 1V1PA 5ELDA 1FNUA 1CHQD 4ZYSA 1BCPC 1RF2D 1SXTA 3OWEB 3DWQA 2WV6D 1EFID 4TSSA 1D5ZC 4DXGA 5ELCA 1YN5A 1L0YB 1CT1D 3BVMA 1SEBD 1DJRD 1HTLD 1ET9A 1D5XC 3EA6A 3DWAA 1GOZA 2Z8LA 1LTID 2SEBD 3MFGA 3DWPA 4RHRA 1S5DD 2ICIA 2RDGA 1TS3A 1CK1A 4RGMA 1TY0A 3BYTB 1LTTD 4RGNA 5ELFA 2J4XA 1LO5D 3CHBD 1TS5A 1PYWD 2QILA 5D3DA 2NTSA 3W2DA 1KLGD 2XN9C 1JR0D 1I4QA 1LT3D 1HQRD 1LT5D 2IPKD 5I4DA 2G9HD 3MC0B 1RDPD
chains in the Genus database with same CATH superfamily
1UEAB 1V2YA 2BS4B 1TWCH 4JVZA 4A3KH 2NBVB 2EYHA 4ME3A 4IUQA 2JE6I 2KXJA 1A0IA 1Q0WB 1RODA 1PTOF 1KF6B 1N62A 3FPPA 1P1AA 3KWVA 1V1PB 1ZW7A 1PRTD 1SJHD 4DDGD 2MJDA 4DR6Q 3UGBB 3ML9A 3TJPA 4LLGM 3OIPA 3JSVB 2A74C 1Z47A 1VQ9A 4OO1H 4HCPB 1F2YA 3NUCA 4JG2A 1AN8A 3T16A 4MJSA 4AJWA 2O5JC 4DPGA 4DR5L 5JHBA 1JROA 1GO3E 3DHGC 3GTOH 1VQCA 3U8ZA 2O6VB 1PTOH 1KABA 2F3IA 3HZXA 2L05A 4HROA 1QNKA 2WNMA 4LNIA 1ASZA 2JA6B 1L6VA 2KN5A 2JPHA 3EFUA 4LDTD 2K4KA 5DPRA 3H94A 1XXGA 3TZUA 1WVLA 2A5UA 1UUPA 4G11A 3FKIG 4DV1Q 2BPSA 3SGIA 3E6ZX 2UXCL 1TGZB 2O2VA 2UUCL 5CC4A 1SNOA 1K8RB 2RA4A 4MGIE 3DHIC 4FO2A 3S1MB 1L2NA 3RCZA 1ML0D 2KVRA 4LWCA 1DOLA 2G45B 4C3JH 2MP2B 2N49A 4JI6Q 1YVCA 3G6EA 1TKGA 2JQRB 1HJPA 2F0EA 2RSOA 2MWSB 4BKSD 1HQMC 1HA6A 5CTRC 3OJ4B 5EE1A 3P4SB 1VR9A 3NZUA 4AYBG 2R7ZB 5JHAA 4K8IA 2HJ8A 5ELEA 2VXWA 2RR9A 3BWUD 2L8JA 3MAQA 1DGSA 1BCPD 1DYQA 1E8ZA 3MEHA 3VR3A 1WZ0A 3F2BA 1AEXA 1K8OA 1E6EB 5FK9C 3EIVA 4K3BA 3H0GH 4TQ1A 2HDLA 2EKEC 1Q7YC 1DCZA 2LZ6A 3KLSX 2WINB 3VA7A 2CW0C 5A2QL 1PFSA 4Y7NB 4X62L 1K83H 1TWFH 5GAGC 3H1UA 2BE5C 1I6HH 1Q1OA 5IP7G 3K7AH 5ELDA 4E6IA 3V3XA 4C3IG 1OTRB 4X65L 3GTPB 1VRAB 5JJLA 1WH3A 1SYEA 2CU1A 4YTNB 2VUMH 2NPTB 1WD0A 2I5LX 3FKIH 1EFID 4HK2A 4IALA 2F0UA 3U7ZA 2UUBQ 1YN5A 4P1BC 1K0SA 4B3SQ 1PDQA 2JVCA 1ZKOA 5CBEE 3TS0A 1YJWA 1ET9A 2NBFA 2D2QA 1T9HA 4PZ6A 1UWVA 4WJ4A 1TWGB 1JOQA 2C60A 2BA1A 2GBMA 2XIWA 4W9EA 3VFKA 1I35A 4W9DA 1XNQL 3U50C 4ZKCB 4S3SA 1A6XA 3CCUA 4CYEA 2D62A 3SU8X 2PW5A 2C35B 3KLSA 1KDBA 4A3EH 2UU9L 2VZKD 1MJCA 2B2VA 3IXSA 1WTPA 3KYCD 1GB4A 1XNRQ 2O2VB 4R9WA 2Z59B 2ES2A 4A3MB 4UPAA 2NVQH 1EY5A 4GU2A 1SDFA 1C4AA 2SOBA 3J9CA 2F0SA 4W9FA 3DPDA 3TP5A 4RG1A 1L0VB 5CR3A 3HOVB 2INPE 2YEPB 1MHWC 1Z6HA 5M9OA 1Y8PB 3M7NA 3RZDB 1XT9B 2YTYA 4QL5A 3ITPA 1VQKA 1B44D 1PXUA 3RD2A 2CJNA 4KKUA 4X6AH 4HKZE 3W5UB 1NMFA 1IW7C 3JYUA 2KJHB 4B3SL 2QEJC 3T3NA 4HIKA 1CJEA 1JE4A 5IT9E 4K6LA 2DAJA 5EDSA 3GTJB 3M3YH 2R92G 4JQWC 4K1RB 3CQZB 4ZLTF 3HOZH 4MSQB 1LT6D 4HJ7A 4MDKE 4AH6A 1OQRA 2WU5B 2A1AA 4OONA 3GTQB 2M1MA 2EPBA 3DHQA 2BDOA 2WAQG 2LXKA 1PH3A 2HT1A 4O0AA 2C9WB 1KLUD 3AYHB 4GLVB 3T1HQ 3AE1B 5AUIA 1PMRA 3SFEB 5IOCA 2L1BA 3I8ZA 2G1EA 4FXDA 4KGSA 4BKTA 2A68C 1J8CA 5IT9c 3NOBA 2F0IA 5KYLA 1IBKQ 1T5EA 2E2JH 1SYDA 4IFDH 4P16A 3T8MA 1JORA 2GMIC 4A9AA 3ZJTA 4J15A 1CTMA 2JRIB 4U673 1WXAA 2UXBL 1TWHB 1WCMH 1EEFD 1VQMA 2PI2E 2D07B 2K8CA 2A6HD 2UYZB 2ZPYA 1JB3A 5EKLA 4KIKA 2CWPA 5EJWA 5IP9G 4JX1C 1WTOA 3V6CB 3R3MA 1KDAA 3RR5A 3NK9A 3QWZB 2KTRB 1E3PA 3RI7C 2LMCA 4V0BA 2NTTA 4LNFA 4N9TA 1ROEA 4KD4A 3U4VA 4IFDJ 2A4ZA 1U0LA 5TSSA 3UINB 2MBQA 1NR2A 3PIOA 4JCVE 4HIMA 2Q8RE 1RD9D 5KYIA 5C44B 2M17A 3M7GA 2RVLA 1C76A 1OXSC 1SE2A 2BVCA 3NQTA 3Q69A 1YHQA 3H7SA 1SE3A 2F0DA 3BVGA 2HJ1A 3HK0A 4KMUC 3PHXB 2VS1A 2EZVA 5HFYA 1I6VC 1IXRA 2PZUA 1V9PA 1D2BA 3BDOA 2J52A 4UHVA 1DOXA 3S2HH 2K22A 2I5MX 4E3CA 2ALYB 3V6EB 3I63C 4MGKE 3C1EA 4ANUA 1SLJA 4BFRA 3G4SA 1CA5A 1Z7TA 2B2TC 4A3GH 3DWAA 3DWMA 1NI3A 4DV7Q 5IGBA 3I73A 2HCCA 5K36H 2H1EA 3A7LA 2Y0SB 1Y1VG 3NE5B 3WWVA 3CRKC 3MXNB 5FO7B 1RJTA 3GTGB 4BKSA 3RNAC 5BMHA 3CHBD 1DZ1A 2PNRC 5C5MA 3VR4A 2X69A 1STNA 3HKZE 3FHWA 2QF7A 1QVCA 2GLSA 2GRIA 4P7IA 2Q8TA 4CJ0B 2RPVA 3S1RB 4F1SA 3PO2B 2EXZA 2CW0D 2AL6A 1X54A 1E2ZA 1VQNA 2BWES 3A5UA 2WB1B 2CQAA 3A4SC 2BOSA 4A3IH 1QJOA 4QB4A 1BMLC 2F0HA 2L32A 3DVNV 2QKIC 3RN5A 2I5HA 1LT4D 3BK2A 2EY2A 3F1ZA 3NZSA 1EYDA 1FR3A 2EVBA 3CCVA 1X9NA 4GOPA 1JE5A 3TQYA 2WLBA 2HE7A 1KXLA 4GOPB 3PT2B 1HNZL 1VQ5A 1MHXA 2KHJA 4TMAB 5DNFA 3GTKH 1TTNA 2O2LD 1E0ZA 2N9KA 4M8AA 4II2B 3PIO3 4A3GG 2WP9B 3IG3A 2JYOA 2MFIA 1WTRA 2PIAA 2V1CC 4KV6A 3ML8A 5DPSA 3L17A 3I4MB 1O7LA 1Y1WB 2IO1B 3W1SC 4ZHPA 2R7ZG 3KDFB 1YOVB 1B3QA 2CHZA 3TMEA 1HNXL 3VYTA 4QIWB 4ZYNA 1IBXA 2BCOA 4ZCKA 5CMDA 3HRDD 4GGQA 4U68A 1BQQT 3PRPB 1IGCA 5IGEA 2IO0B 2KVZA 3HOWB 1XX8A 1WGKA 2ICEC 3RN9C 4G50A 4LF4L 3NQIA 4G7OC 1K53A 2BW2A 3HM3A 5J18A 2X6GA 2Q2HA 5MPOA 1QILA 1EIFA 3G6JB 4JIOU 1W3SA 1KTKA 3ND9A 3AEEB 2K33A 2ZM6Q 3KF6A 3AU4A 1SE4A 3J81L 3M62B 2NWGA 1JMCA 2KKCA 2N4FA 1IGDA 2JRHA 3DVGX 4XT1B 1CQVA 2L00B 3OHXC 4JI5L 2B76B 3Q8FA 1S5ED 4B9KA 3CPWA 4QY7A 4HJAA 2BKRB 4M8MA 2RQXA 1QCBD 1T0RC 4LK0M 1AE3A 2JA7H 2WXPA 2PNHA 2CS4A 1V1PA 1R4MI 3WA0A 4UY8C 1CHQD 1MSGA 2UUCQ 1AE2A 2QCPX 3ZJYC 2KFKA 2OF1A 3J7ZC 3AEDB 3A9JA 4J3OD 3HIZA 1MFWA 1XF5L 1XQQA 2RSUA 1ZYRD 4LF8L 5LL6S 3B9JA 1F9SA 4EZJA 5ELCA 3CIRB 4JWUC 5BR8L 2K6AA 1HE8A 4FHJA 4DUYQ 2W54A 1SEBD 4XZ4A 1DJRD 4EZKA 1J0GA 1SFOB 4J6HA 1E9MA 4RNAA 1JMLA 1OXTA 4HAEA 1B4OA 5CV6A 3SDZA 1X56A 1STBA 4LF9L 2PQEA 2EXDA 1UE1A 4HSVA 1XLOA 3U9SA 3ZNGC 2JWUA 1TS3A 1QG7A 4BKGA 1PDXA 1FGUA 3STBC 4L8JA 1YJNA 3CCLA 2NN6G 2J4XA 4WH4A 1LO5D 2JA7G 4MELA 1DOMA 1E8YA 3C2PA 3VYRA 2WXRA 1PQSA 3PHWB 2FCSA 1V43A 1L1OA 5C0XJ 4A3DH 4DAYA 3DUZA 2VB2X 4Q2JA 1LT5D 3SR1A 4A3FH 4BBRB 1G2TA 1VMPA 1M8AA 1QQRA 3QAQA 2L0CA 3KLWA 3K0YA 2KCCA 4WQOB 1LFDA 1JRPA 4ANWA 4YY3Q 2CHBD 4L6TB 2D0PA 1RYJA 3I55A 3BZCA 1JCKB 2MP1A 4YWMA 4KVGB 2HTHA 4A3BH 2LJIA 4WWPA 1RLFA 2GBJA 1D5MC 4YTMB 2AEHA 3SVMA 2OQ0A 2UWQA 2IY5B 4BA1I 2INNE 1E7UA 1W2BA 5FLXE 1SSOA 4C2MB 5CV4A 1BCPB 3WAPA 1N9WA 4IPHA 2BS2B 1PFMA 1VQAA 2YVCA 4IM2A 1W6JA 4J8QA 3IVFA 3VH4B 3UQBA 4A75A 3ECIA 5JVH3 3OIQA 4XDDA 5C44G 5H92C 4ARCA 5G2NA 2GBKA 1H9JA 1ACCA 1N60A 1S1QB 4KDLB 1LTSD 1OO9B 1HZAA 2B3GA 2BGFA 4GOCA 2QDBA 2KHSA 2GA4B 4A8XC 2V0GA 1GUAB 1HUMA 4G7HC 3IRBA 1IP9A 3RULA 3KVFB 3HOUG 3DEPA 3E56A 3MJ5A 2UXDL 1MIUA 3I70A 1MJDA 3PO2G 1N34Q 2IJ0A 1WD1A 2ZNVB 1P98A 3N30A 1STYA 3A9KB 3W1BA 1E7PB 1FIQA 3CKIB 2L5TA 4DV4Q 1VF5C 3VTUA 4H13C 3G48A 4L23A 4K7UA 1XJVA 1P9DU 1LTBD 4YIJA 2YU9H 4FVMA 3PS6A 2K04A 2K5VA 3BINA 2IHEA 4YHHQ 2R93G 2F4IA 3PZ8A 4AJYB 1EYAA 4URKA 3E9IA 3NY5A 2FMMA 4JV5L 3A55A 4M8NA 5M3FG 4WWOA 1XCTL 4R4CA 5I9OA 3F2DA 4IO9A 1ICFB 4GKKQ 3T3OA 3JAMi 2XK5A 3TEZA 1A63A 4MN3A 1BXTA 2AQ2B 4UP9A 1IBKL 1OFFA 1S3SG 2C7HA 4PNYA 4GXBA 4O1NA 4NDXA 3PV0A 3WDNA 4AQ7A 2Y0SE 1FRDA 4XX5A 4L2YA 1V1OA 5M3MG 1WR6E 4UP7A 4M02A 2WU2B 3I4OA 1RTNA 1B8AA 1Y1VB 4HN7A 4PQXA 4LFAQ 1MVKA 1F2LA 4BOZB 3J7AV 2K8BA 3H0GB 5HGQA 2N7EA 2VQEQ 3A8KE 4JI7L 1F9RA 2LASA 3FKYA 3TIXA 1L0YB 1NI2A 4BBRH 1CZGA 3AN1A 2IT1A 1TT5B 1M1KC 4FBJB 4IW0A 2BYEA 2R7ZH 1C78A 1IBXB 2FCQA 4RHRA 1Q90A 2MUYA 3KQ4A 3PSIA 3KW5B 3DWGC 2MA9B 2BDNA 4IOIE 3FVQA 1KAAA 1BF4A 3VH3B 3P20A 1V8CA 3D6WA 1N36Q 2WXJA 2PO4A 2M0AA 2R2OA 3GTMB 3OW2A 1WGGA 2FHTA 2XN9C 2KA7A 5DM63 2SNSA 2D3BA 2H89B 1K3BC 5EE9A 1E90A 2AX5A 3V96A 5DAUA 2K05A 4POFA 4ACFA 3CW2C 3M4YA 4GKJL 3RZOH 3DDCB 3RPFC 1H9RA 4OWXB 3I4NB 2RBMA 3P7JA 2OHFA 5LMNW 5M5WH 5I6WA 4GLSC 4P74A 1UEBA 3UIPB 4K2KA 3AB5A 2JA5G 2OOBB 2DNFA 1TKEA 3ZNHB 1KRSA 2PW7A 2JF5A 2YTVA 4QCLA 2NBUA 4L5SA 1HZ6A 1E1TA 1ILPA 4KHVA 1PGBA 2PE9A 1Q5WB 5EAYA 1RAXA 2KYWA 4KJOA 1XYIA 2MNAA 1FXIA 2BQQA 4IPGA 4IG7B 4LFCL 4WJPA 4YXDB 1XEEA 4C3HB 4IOAA 3IL8A 1G291 4GNXB 3DMUA 2F0QA 2JZPA 2WAQE 3A54A 4JI2Q 4KTAA 4KY5A 5CBAE 3QA8A 1UWMA 3FILA 4GN3B 5FLMH 2R2QA 2ZXOA 3H3VI 4WJOA 1FD7D 1EQTA 2AQ1B 3VRBB 4A20A 5JAVA 2CHXA 4MNOA 1EY0A 4ZUIA 4YSYB 2PE6B 2KVMA 3TDQA 1EEID 3KDFA 1EZ8A 3AU7A 1IYUA 4HMIA 4W9JA 2KCMA 5E4WC 2TMPA 3J80L 3AFPA 1QOBA 2XTIA 1TIID 4H2AA 2E2IB 3N3KB 3VTWA 5IWAQ 3GTLH 4OIKA 4OEMB 2K39A 1VQDA 4GZYC 5JJIA 2KWDA 3PVLA 4WWMA 2MH7A 3EC8A 2RHSB 3PRZA 1JOKA 3WAOA 1QF6A 2EELA 4PV1C 5JPMC 2L11A 2KO3A 4X57B 2EJFC 4WFN3 4OX9L 1SNQA 2QGQA 1M94A 4BWGB 2B2UA 1PRTF 3ALBA 2DENB 1X3PA 3DBSA 2OQKA 4HIDA 2ZXRA 1HR0W 3KWLA 1HR0L 1XO3A 3LX0A 3I4NG 4IQZA 4JI2L 1SIJA 2K5NA 3NUHB 1HNXQ 1J19A 1RF2D 4FP5D 4LF4Q 2DLBA 2E3TA 3APDA 5C4JH 3D3RA 4DK6C 1TQOA 1YQ4B 5T8IA 1ZXTA 1EO6A 1O80A 4XDCA 4NXMQ 1ZP0B 2R92H 1A5RA 4DR2L 2D10A 2KENA 4GIVA 2PQAB 2ZPNA 3K0XA 2Z8LA 2YYZA 3MFGA 2KOXA 4MACA 2IWHA 3W1GA 1VD2A 4DR1L 1I7HA 3IBEA 1A2TA 4RGMA 2E2HB 1O78A 4R8IA 3QK0A 2F0WA 1Q46A 3PUWA 4RGNA 3CC2A 4BY7G 2PYKA 1M90C 4IUMB 1OEYJ 5LLIA 4EVOA 2WXMA 1PH7A 2QHOA 1CM9A 1EOVA 3SD5A 3SHQA 2ZZPB 4C3HH 4BBNC 3HOXH 2WQYB 4GOPC 2CKHB 3CPFA 5IYDG 3I4LA 1RFAA 2ZTDA 1HQRD 1SR3A 5LHY1 1QZGA 1QZEA 4DHZE 4HVBA 2WXNA 3Q2AC 1RDPD 5J1ZA 1J7CA 4L1BA 2LXAA 1LTAD 1RWSA 2O4XA 2DY8A 3KBXA 1Y8RC 3VYSA 2LUMA 1F2RC 4LF8Q 3A8IE 5AZGA 1TBEA 3DLLA 1IPGA 4NMZA 2A6ED 3NBHA 1I4RA 4UDUC 4RM8A 2E5LQ 4HXDA 3HOZG 3C0RB 1I6HB 3HOYG 3G7LA 3PLVA 4OW0A 1QNUA 1PGAA 4KZCA 1FCLA 2PW9A 2OTLA 3FP9A 4WJQA 4DHZB 4LF7Q 4JW0A 4XTCS 1PTOD 2DZIA 3U30A 2DZJA 2VW9A 1VQJA 1DOKA 4P73A 4Q0FA 5M3MB 3GTLB 2ZJQA 2N7JA 2NVTH 2PPHA 4GLXA 1Y8NB 2B63H 3PUVA 4DR4L 1II3A 5DLQE 1B7YB 1W6KA 5CHFA 4BY1H 4YCVA 2R6GA 1NENB 3PO3B 5ELOA 4RAUC 4KLKA 1HTQA 3PGEA 3SK4A 5IIFA 3I3CA 4DUYL 2E2JB 4PYUA 3VR9B 3PMFA 2VZAA 1A3TA 3PQIA 2IO3B 4K7SA 1EU4A 1FNWA 1X65A 2K0PA 2B29A 1E8WA 3L7ZC 4A3JH 3ZYYX 2V3NA 3ZUNA 3HOXG 3R2IA 4B9XA 1Y69U 2MO0A 2E5LL 1K50A 2LGDA 2GN5A 2JZZA 1IKMA 1B9MA 2LUEA 2V4LA 4NJ6A 2CH4W 5ISRA 3SXHA 3D4DA 4LNNA 4XQJA 2REXA 4REZA 4KGTA 5AJ3Q 3H3VH 1YNXA 1L7YA 3NVZA 1LLRD 4LF7L 2H4OA 1HNWQ 1R4PB 1QOHA 2IW3A 3P1HA 4JC0A 5IY0A 3MC8A 2MO1A 1N61A 3VAWA 1VZ8A 3ZTCA 3P1MA 3W1YA 4BBNF 1GVPA 2RDBC 3LWEA 2NMQA 3CF6E 4JOIA 4P72A 4BY1G 1EYCA 1G6ZA 1I3QH 4ME5A 1WGRA 5DCNA 2R3ZA 5EBDA 1CKOA 1UE6A 1CKNB 3K5OA 2IZVB 3GOEA 1F2MA 4IUVA 1PV4A 2OCEA 5E6JA 2YU9B 5CV9A 5D65A 5G3LD 1GUTA 1FPYA 3TRZA 1SGHA 1TWCB 4OIJA 4DV4L 2RPQA 2QDFA 4CJ2C 1C79A 5HHDG 4O2DA 2KCNA 4AWJA 4RKBA 1N32L 3KH0A 4LF5L 1N5XA 4CHTB 3CMMB 4C3IB 1OXVA 2N55A 5BYQA 1YNND 4HCEA 3HOWH 2INCC 2LHEA 4X62Q 3A9JB 4F8CB 1Q12A 2W9NA 3IAYA 3PZDA 1JR0D 1DGJA 1K8AC 1LT3D 2RDFA 1YQBA 2WB1E 4BBSH 2VQEL 5EPJA 1I5FA 4A4IA 3HRZC 2R92B 1PH8A 2HDEA 4FHKA 2G9HD 4OVUA 2D5GA 3MC0B 4C2MH 1GJXA 4LFAL 4UAIA 3I4MH 2FCNA 3MHSD 1LTRD 2NZHA 4W9LA 3C8YA 1WZ3A 2M00A 4ID6A 1RHPA 2M9VA 4HR7B 4RFBA 4FF1A 4BA2I 2GB1A 3AU5A 3NSWA 5FLMG 1QKZA 2F3WA 4N8FA 3KF8B 2WHIA 4LNKA 4G57A 3GTKB 3AXCA 2FINB 4KKSA 1K83B 1PH4A 4K3CA 2K25A 2LVOA 1YHBA 2XNAC 3IAM1 3SEBA 5EPLA 1CI3M 4ABNA 1ILQA 2NN6I 2M4NA 2V4IB 3UDFA 1SYGA 4GN1A 2A19A 1EQQA 3NZ3A 2CFMA 2MPMA 4IOCA 5JEAG 4FYDA 2BBCA 2ZVOA 2AQ3B 2NN6H 1PH2A 3CCEA 1P7EA 1I4HA 1NMGA 1E10A 3B2FA 4BBSB 4HMJA 4PS3A 3DM1A 4QGUA 2VL6A 4A3KG 1WFYA 1AFPA 4E74A 4WIPA 4B95A 3QWNA 4N9PA 4LFBQ 1RFKA 5IOIA 2F0OA 1QWYA 4KY7A 3NWTA 3J81j 1B2TA 1VQHA 3A8JE 1I4GA 2FE8A 1BCPF 2AHOB 3VUYA 1LM0A 3PSEB 4DV0Q 3U4EG 5GAHC 2Z1CA 4RCOA 3HVZA 4CGYB 2A8VA 1OQYA 4X65Q 2ZVNA 1WCMG 2WAQB 4HJ5A 3AFQA 3EJIA 3L2PA 3NTIA 5H8YE 5JJKA 1YJ9A 1FFUA 4IFDG 1MGSA 1TKWB 3V05A 2KD0A 3PRMB 3PCOB 3M4QA 1PUTA 3Q3NC 5ELBA 3VDZA 2NZOA 2LXCA 2F0GA 2CJOA 3HKSA 1AP0A 1D4BA 3CC7A 3GV3A 4K5VA 1LTGD 3OSOA 4P71A 1BNZA 3S15H 4HEA1 3RNCC 4PYZA 5IGCA 3I9V1 3A1QB 4JBMA 1G8ZD 1YI2A 3B08A 1EY7A 1SMYC 2KMCA 3RMHA 2KTFA 1A3UA 3D32A 4XWTA 5D2MB 4IPCA 2D2CC 1XNRL 3P4PB 1UE5A 4JGHB 4ANXA 4GS3A 4ZYSA 2WP8J 3ICEA 3K5LA 4DV6L 4RKLA 3VR6A 3V61A 3PO3G 2D5DA 4JYAQ 5COYA 3A56A 3BVMA 3CMAA 4GLAC 2YEPF 3NS8A 4RA8A 2ZW1A 3SE0A 4POGA 2DAFA 1YX5B 3Q3FA 2AKWB 4DK1A 4HCNB 4YWGG 4HKQA 4DR3L 2DHZA 1V80A 2Z0EB 2K5WA 4X66L 4A3DB 1EY4A 4GDLA 5D94A 4N8X1 4JI1L 1NDDA 5T1IA 3FAHA 5AZHA 1WF9A 1V1QA 2W3SA 5IWAL 1MJEA 5C2TB 4RWSC 4ZRKA 4W9KA 5LMUQ 1TVXA 3W2DA 5IN7A 2BE5D 3L16A 1B9NA 1EFWA 3X0WA 1KLVA 2K5PA 1MKHA 3EGRA 2E75C 2ZJPA 3PGZA 1NSNS 5M3MH 2IO2B 5FO9B 1HZCA 3U9OA 4R8NA 2HUGA 4GDLB 1SFOH 4XYCA 3PUYA 3BZDB 4KV2A 3ULJA 1VCBA 1PYBA 2PMZE 4QF4A 2KDIA 1H4RA 3S14H 1OGWA 1L2FA 2N7DA 1E1OA 2KTRA 3BK1A 1X1MA 1WTXA 5K36G 4ULLA 1MHHE 2JA8H 4E71A 5ELNA 3RLOA 2JK8A 3DEOA 3TZDA 5KRUA 2LVQA 2WXQA 2PCFB 1ENCA 3MJWA 2INDC 2R93H 2PJHA 4A3LH 3T1YL 3TEXA 2UU7A 3RNFC 3BJUA 3Q22A 4HPMB 5C4ZA 1XWEA 3KFUA 1BBXC 1MSHA 2XRQD 4GDKA 4JBKA 3NWSA 5LMNQ 1PH9A 4HJGE 3E9SA 1ESRA 3WAMA 3TP6A 3S1RH 3G71A 5KHOA 5FJ8H 1HUNA 4DK3C 1U4PA 3NVYA 2B2VC 5D3IB 3HOXB 2XGTA 4ILWA 4J6IA 2N0SB 5M5YH 1ZXIA 3NPPA 2B2YA 4IJLA 2G9DA 1JWUD 2N88A 2JUOA 2J7QB 4M01A 4HJKA 1QVGA 3Q24A 3UE1A 4DHJB 1FYCA 4R4TA 4PZ8A 1Q8KA 4LUVA 1CHPD 4MEMA 2WWZA 3OPOA 2KOLA 4EQ5A 4DBGA 4DN4M 1GUSA 4C00A 4OO1G 4YCWA 1JWSD 2K5HA 4DV7L 4IDIA 2A69D 1CKMA 1F77A 2MBEA 2JQOA 4C4VB 1TYGB 4JI1Q 4I7AA 5HURA 1HNZQ 3S16H 3GS2A 2LWPA 4PK1A 1TKYA 1UGJA 3ZGZA 3HEJA 4NZLB 1CFMA 3MFYA 4I7ZC 4BS9A 3J80c 1KD1C 2HTME 5C4JB 3DVNU 1FL0A 2IX0A 3GV6A 2EYOA 1DXMA 2GVAA 4PMBA 5A2QE 2KHWB 3K7AB 4TKOB 1GC6A 2K6DB 2KT7A 3ZLZA 1NNXA 4I65A 3TREA 1YN3A 3ETRA 3BDCA 4B3TL 5IP4D 4ZRJA 4LUOA 4A3DG 1WY8A 3UQAA 4FADA 5CV7A 4KSKC 4JBJA 3CF5A 3TP7A 3MVVA 1E2VA 1ZPSA 1EY9A 4QUCA 1P7FA 3R66C 2J0JA 2EY6A 4KK7A 3CRLC 1PA6A 1QVFA 1PH1A 3HOWG 1WIAA 4M0WB 1R4QB 2WXLA 4C7YA 3ZJVA 3ULLA 3DXJC 4JI4Q 3ZW3A 1ZDXA 3CC4A 3RNGC 1WGDA 2L0FA 2ONQA 3KBGA 2PLPA 3EFCA 4US8A 3BZKA 1XPUA 1YNJC 3PF4A 3K9PB 3UIOB 1U4LA 5FO8B 3HGBA 3CCQA 2JSVX 3GZNB 4TQ0A 4BY1B 4NXNQ 4WJNA 3TMPB 3BYTB 1LTTD 5BMIA 3UI3A 3KK7A 4ZRPA 2JA6G 3S1MH 3E5SA 2QILA 2D9UA 4QIWE 4XIGS 2AL3A 4L5TA 3LYYA 3X23A 4G7ZC 2K32A 2UUAL 3PO0A 3WALA 4EX5A 1KC8C 4Y52H 3IAS1 1WJJA 3IT6B 2UXCQ 3DBRB 2O5IC 1WRIA 2FNJB 2ZTCA 1DOIA 2DZKA 2JA5H 2WGSA 4WJWA 2WXIA 1X55A 1ISNA 1JB7A 2KWUB 2KFJA 1PHJA 3HKZB 2EY5A 1EY6A 3KF8A 1VQPA 2IYDB 3ZIMA 3QARA 1EU3A 2MHVA 4S17A 3L0OA 2WXFA 1R7SA 4OWTB 3D4RA 5IT9L 4JI4L 1XMQQ 3HVDA 3HS0C 3UDGA 1I4XA 1YD8U 2PVGC 4GB9A 1V86A 4RGOS 3URYA 3P42A 5C6AA 4KKTA 3Q3MC 3Q6SA 3Q8DA 4LJPB 3J80i 1F9QA 1YIJA 1YMHE 3AQQA 1EUVB 5C4XG 5BN5A 1JICA 5I2YA 2KLCA 2ZM6L 1YX6B 5HY6A 1WSPA 2G4DB 2I2YA 4G4KA 2ATWA 4NAMA 2IX1A 1P16A 5LNK1 2LHDA 3APCA 2L3ZA 4FN2A 3TP8A 4ZRQA 5AUKA 1PRTC 1C48A 2F4VL 4M1UB 4IWQA 4XWWA 1P3QU 3ER0A 1G6PA 5E7NA 3S1QH 1BOSA 4DV2Q 1IYFA 1J5EL 4DA2A 4JLCA 3TS2A 5BMGA 2EYMA 4ANVA 1KAWA 2L12A 2UUBL 3T56B 2CH4A 4OVVA 3RLFA 4EGVA 2PI2A 2NUCA 3VR2A 5KHQA 4L5RC 1ZXHA 3VRAB 1HTPA 3AE6B 4DNTB 4OZBA 1BBWA 2PZWA 5JJZA 2BH2A 3QG1A 4XQNA 1ENFA 2DJGC 1WM3A 1ET6A 4MHEA 4P2CB 2K01A 3FRPB 1N5WA 3E3XA 3L9AX 1B70B 4XGAB 4Q5VA 3GO5A 1XTDA 4DXFA 3H0GG 3Q8EA 1HTOA 4I6PA 1F2RI 5GROA 3FDTA 2WXGA 4IUNA 5IODA 2EOTA 2K5DA 1Y1VH 3BDLA 1K73C 1FXAA 1JC7A 2F3VA 1N8RC 4TQUS 2KCTA 4MGYE 4CO7A 1GJZA 3DBHI 1WX7A 3R8BA 1QOFA 1L0XB 2B39A 1UBQA 2WKDA 1LABA 4WURA 2XRSD 1KRTA 4DV0L 1QOGA 2F0TA 4H7BA 4AYBB 1UELA 3M3JA 5GMVA 5JXVA 4EQPA 2E2IH 1CZWA 4CBVA 5IP7H 1PGXA 1V5OA 5D14A 4KIKB 3KOJA 2WV6D 2MP2A 3PV1A 5DPWA 3RZDH 4XE0A 1JQ4A 1IKLA 4JI6L 2JEAI 4FJYA 1E0BA 5GADC 1J9OA 4DNIA 2IX3A 3ZO5B 3K8AA 1LTID 3MHZA 3NRZA 3D31A 2A6HC 2NVXH 4NB3A 2HIVA 2SNMA 2ICIA 2RDGA 3U58A 3TBLD 3ZQ4A 3NP8A 3ZNZB 5IYDH 3C3LA 2WACA 2WS3B 4D2KA 4NPSA 1L1OC 5JOBA 1TWAH 2R7DA 2HD5B 1SNMA 3X3MA 3AH7A 4NPNA 2ZJRA 2YLMA 2J53A 1VF7A 3SK6A 3TEYA 2M56B 1OXXK 1MBYA 3N52A 1ZUD2 3WCQA 5C23A 3NS1A 2L4NA 2QMTA 4ZHOA 2RMMA 4NKLA 2F0LA 1TWGH 5CV5A 1MI0A 2DY7A 4CKEA 1VZ7A 1EIHA 4DNRB 4WJ3M 2K6QA 3ZNID 4OZCA 3S2HB 2V3SA 1LTLA 3VUXA 3W5OA 4OWWB 2K8HA 2LI5A 3M95A 3CCMA 3W3AA 3LDZE 4ZUJA 5L83A 1S40A 3RN2A 4B3RL 3JSVA 1YHAA 3GD7A 4LFBL 4PZ7A 4JI7Q 2FUHB 1EUJA 3AB9A 2KHIA 3MHBA 1WE7A 1Y14B 3KF6B 5C44H 2OEOA 5M5WB 4YHHL 4XXEA 1HFGA 2KJXA 4CDEC 3H8HA 3MZ5A 3RZOB 1H95A 1KRHA 1M4VA 1QE6A 5CHWA 3RT3B 5HKHA 1ASYA 1YBYA 1WE6A 3RZFA 4RMAA 3I4NH 3T9LA 4KI0A 4X64L 5IGDA 4FXKC 2TSSA 4XQQA 1R4MB 3GTMH 2ZJDA 4PS7A 3HP3A 1T0SC 2JXXA 3AE8B 2UU9Q 5AFWA 3QX1A 1Q1BA 2DYOA 4I6LB 5D7GA 3DBLI 3E0JA 1PZJD 4P6VF 2ZEQA 5JEAJ 3R7QA 1E8XA 3AE5B 3T51B 3PPAA 4AS1A 5CYUA 1X3FA 2AWTA 1EWHA 1O7IA 4O42A 2D3AA 1NTGA 2KQ7A 3ND8A 4KZ0A 2IGHA 4MGZE 3RMKC 4DU9A 4CDCC 1SNPA 1UGMA 1ZE3D 4IM0A 3S17H 3Q3JA 1MI2A 2EDGA 4C7ZA 2N8NA 5M5XH 1G2SA 5IYCH 4BXXG 1UH6A 4ZDVA 3UDIA 1GHKA 2ZXPA 1WYGA 1UD7A 2NPTA 1Q8IA 3A33B 1P8LA 5BN4A 1SBBB 3R2TA 2OJRA 5G5GA 5G55A 2J7ZA 2LFIA 1I94Q 2PEAA 1TS2A 3D4WA 1XD3B 4JYAL 1U4RA 4X66Q 1K8MA 1XNQQ 1WI5A 2EMSA 1QOAA 3PZ7A 2AUJD 3CQZH 3MXUA 1BT0A 2JA6H 1J7BA 3ZJUA 1I4PA 2EJMA 4C80A 4A55A 2NVYH 2WDRB 1A70A 2MJEA 1LYLA 4GNXC 3A0JA 2XK5B 5JVG3 1NUCA 3JAMc 5C3EH 1GAQB 2KMAA 2N1VA 1I50B 2DNCA 2L0TA 4HPLB 1EQRA 3A7AB 3ERSX 2CHWA 3WOEA 3S2DB 5JPNC 1PZID 3NBHB 1WMHA 4YWLA 3S16B 4GKJQ 5I6YA 3V62A 3QIAA 3W9CB 2FJ2A 1T6BX 3AE7B 3HOVH 1NAPA 5JEAH 2QIEB 4YTPB 5E1FA 2VUMG 2MBOA 4KN7C 2QDLA 2VRRB 1UE7A 1CT1D 5KEEA 4GMVA 1EWIA 1XLQA 1YJJA 5HG2A 4BAXA 1JJ2A 1B53A 4R4QA 1NBFC 2EMTA 2AUKA 2JP1A 3IHPC 3E9HA 1CK1A 4A3GB 2MCNB 4GNXA 3HKZG 1R4NB 4DHJD 3KJPA 1STGA 4A3JG 4A3LG 2MBHA 4LCDE 2N78A 1WRDB 2A68D 4JI5Q 4EKUA 5D3DA 3AE3B 2H5XA 1E24A 3K5NA 3P63A 1P0RA 2XBBC 4CHKA 4CJ1B 2GI9A 4JI3L 3DBHB 1PYSB 1EF1A 1I3QB 1Y1WH 1KQSA 4DK5A 3UI2A 3J7AF 1JJCB 1KNEA 1E7ZA 4A93G 2KBNA 4MM3B 4B3MQ 5EE0A 2BYFA 2VH2A 2Q8IB 1FGBD 1C4PA 2EY1A 4A3BB 1G51A 1WMHB 3EQLC 2XEWA 4BZAA 1C0AA 5C3XA 4NQKE 5C1ZA 4NXML 3P2BA 3TCAA 1YZ6A 3V60A 1I94L 3Q0AA 3L54A 1JWMD 1KH0A 4ZRIA 2WDVB 4JI8Q 4PG3A 1YQ3B 3H7PA 4MM3A 2K28A 2OT2A 5FLXc 2X8XX 1SN8A 4EZLA 2KC1A 3H7PB 3NJTA 1BVSA 1V49A 1SMYD 4DV5Q 4ASWC 1L1OB 1PLFA 1VQBA 2CQOA 3T4AC 3P4RB 4IJHA 3N6RA 3FEWX 2XVSA 3PUZA 3A1QA 1WCMB 2PKOA 1CQFA 4FJVB 1QZHA 1K0RA 1TU2B 4AP4C 3PO3H 4QQBX 4A3IG 2KWVB 1X3GA 2E2DC 3CP0A 3QIJA 4XC2A 2A5HA 2WXKA 3BG3A 1SSNA 2KQSA 2E76C 4TRDA 5LXHA 5J3BA 1J6QA 2IL8A 1MG8A 2N9LA 5EPKA 4EQNA 2B63B 4HIOA 2NVTB 1N33Q 2AMCB 3MA2B 1HR0Q 1VQLA 2C5CA 2XWBB 4J1MA 3W5VB 4A93H 4WORA 1GB1A 4GN4B 2VH1A 3BYYB 3D6CA 4KD3A 2JYEA 3R3OA 3A9KA 2A6EC 1HXYD 2IDYA 1TZ1A 3K81C 3GTOB 3N20C 1VS0A 1ESFA 1WJNA 4YSZB 4KKIA 3J80E 4IKGA 1FD6A 4MTNA 2V4DA 1WX8A 4DR5Q 1PFBA 2B8FA 1HA5A 4A3PA 1XMOQ 2HHHL 3PF5A 1F9PA 1FJGQ 1WI0A 4XT3B 2KC2A 2X38A 2KACA 2Z4HA 4LJZC 2MQJA 2ASQA 4LTUA 3IFTA 4NXNL 1GC7A 2K5QA 3BVZA 3EROA 1D7QA 4LF6Q 4BBSG 4YL8A 2KEEA 2ZT9C 2F0VA 5EKKA 5KNDA 4DR4Q 1SNCA 5E6NA 3I90A 1E22A 1BCPC 1NEKB 4RF0A 3N1XC 1I50H 4JI3Q 1SXTA 4JPBW 5C3EB 3WOFA 4F88A 3S1NB 2LMCB 4KHZA 2VNUD 1HPCA 4HWIB 5L37A 1N33L 3H3VC 2LRUA 4DWFA 4OO1I 3I2ZA 2RSNA 3U4ZA 4KHPL 3EUB2 1R9TB 2Q5WD 5JH5C 1V81A 2KDFB 2PTLA 5NUCA 1VDZA 3RNEC 3LXFA 2CCZA 1D5XC 1Z9FA 3K57A 1ZGUB 4USAA 2SEBD 3I57A 5F2DA 3AE4B 1JRUA 2B2UC 1IUEA 3KYHC 3VVWB 5E3FA 2F52A 3M4OH 4S0RA 2WXOA 1IBLQ 3AEBB 3RNBC 3F2UA 1IL2A 3VR8B 4IPDA 1A15A 4NY0A 1PYWD 2J42A 1T3QA 3KLRA 2ON8A 2G5DA 1VQ8A 1FJGL 3P75A 2BYVE 2DBYA 3OLMD 1WGHA 1UAPA 2FMCA 3OTOL 2PMVA 4PT5A 2D3CA 3EVQA 2Z4IA 1X3EA 1SAPA 2N9PC 4NQLB 4ITKA 1FO4A 2KWCA 3LJ3A 4OXPA 1YITA 1WXQA 4XYOA 2RF4A 3E0EA 4A3FG 2GBRA 4JL9A 2F4VQ 3U52E 2V9HA 1GHJA 4F8MA 3GTJH 2L52A 3K59A 4LF5Q 3CCSA 5K5PA 3U2SC 5A35A 2D11A 3TL5A 1EWCA 3DHHC 2QW7A 3Q3OC 3H9DA 3J81i 2I07B 1KNAA 4C1NI 2OTJA 4BOSC 1S5FD 1FVIA 1IBLL 3TBIB 3K58A 1KM7A 1IHZA 2E8GA 1C4CA 1BR9A 1NBWA 2L55A 4IUPA 4DUZQ 2LJ5A 3KYDD 3NVVA 1S72A 2VY3A 1K52A 4FA6A 4A3CG 2YTXA 4TVAB 4X3TA 1SE8A 4H02A 1OXUA 3QQ8B 2QSDA 1D1KA 4EQOA 2JWZA 1TZOA 3M4PA 1X32A 4EFOA 1EIYB 2A69C 1UBIA 3OYYA 2IY0B 2I46A 2F0PA 3V2TA 2E6XA 1XLNA 4ZAIA 3PIP3 1WX9A 5G5HA 3AI5A 5I9PA 5H1SE 1YIWA 2Z0SA 4R4OA 3H6NA 3BS1A 1U4MA 2K1BA 1ZKHA 4G0NB 5FR6A 4ZQ3A 3M63B 1QUQB 2F1MA 1N32Q 1SMXA 4LNOA 3GB1A 3PIPA 2JU6X 3DBRI 3HOUB 4KSLC 4K0KQ 2MQHA 3CSTA 1YEZA 2LGXA 3O13A 4LF9Q 2VUMB 4CKBA 1FMAD 3OJ3A 1WXSA 1SNDA 1RL2A 4DAMA 5KNCA 2V1YA 3NXWA 3L10B 1JW9D 3SFDB 2Q2UA 3ONSA 2B2WA 4A3EG 2RGFA 3OWFA 1SRUA 4IFDI 5FLXL 2M8SA 3VXWA 1FNUA 3S9WA 2D0OA 2LGYA 4TUUA 2V3PA 2LY7A 1NR4A 4K5WA 2HD3A 3N1YC 4HCSA 4A3JB 2JJQA 3HFZB 4WQMA 1V5TA 2FFKB 2BTEA 1SE9A 2R7FA 5IGFA 1NYRA 2LRWA 4OL7A 3QJZA 2GVBA 3K9OB 3EBEA 3QJYA 5C4HA 3HG9A 1PH5A 3CMEA 1HTLD 3ENEA 3AV8A 4IUTA 4LW1A 1BO0A 1D3ZA 1WXMA 1GOZA 5EQ0A 3HOVG 2K50A 3DOWA 4TV3A 5IA7A 2RD0A 3NTKA 1YJ1A 2W82A 1TY0A 4JV5Q 4NNJB 3AMUA 3M85A 1UF0A 1V97A 1STHA 3MXGA 4B0MA 3RLNA 1C9OA 3RUIB 2BF8B 2SAKA 4W9GA 5CGKA 3GTQH 1F2ZA 4ZK9B 2Z6BA 3JC66 1KLGD 4OVZA 2OWOA 4DV6Q 2L76A 1K28A 4K14A 2ID0A 5C3WA 3HOYB 2G3QB 3B1LX 3KUDB 4G3XB 1O7YA 3I3TB 3AM9A 4ODGA 4N9F4 3KJOA 3T1HL 1IYVA 3K6OA 5KNBA 4FF3A 2VQFL 4LNQA 1SYCA 2K7VA 3QB3A 3M3YB 2VZKB 4JPSA 1AZPA 4AYBE 1VQ6A 2PQAA 3H6MA 4DAVA 1PVOA 4B0EA 1DM0B 1N34L 2JY6A 4DR1Q 4CQNA 4HJ8A 2K9XA 2EYFA 2LS01 1U9RA 2MEKA 2BB6A 1KIXA 3K7UC 3VDYA 4C3JG 1E5WA 1WYWB 4ZOHC 1STAA 4DR2Q 5L95C 1CZPA 2K03A 1MG4A 2LKVA 1RRBA 4JK1C 3S2DH 1TJEA 4BBRG 5IGGA 2J0TD 1JWBD 1AH9A 4DF7A 2IHFA 2FIFA 4C4VA 4K2LA 4HTHA 3JAML 1GNUA 4HLEA 4A3MH 2NVQB 3RD4A 2NVYB 4A3BG 5JZEB 2BYTA 2OEDA 2KN4A 4K5XA 2EKIA 3CSFA 1BBUA 3HOYH 2J0KA 4C1NK 4OZAA 2JA5B 2CR5A 4F7ZA 1C8CA 4GKKL 1WM2A 2N9XA 2E2HH 2Z6KC 2BKFA 3AE9B 3B2GA 4ARIA 2K75A 1ENAA 2JYTA 1D8LA 4HSPA 2DN8A 3T13A 4DAYB 2Y5BB 4CDDC 1PZKD 2M2LA 1XLPA 4FDBA 3J7YW 3GQBA 1WTWA 1WR1A 2MHJA 3NEMA 3S24A 3LGJA 3QC8B 4W9IA 2FIDA 4KGRA 1EF5A 1S3OA 4RF1A 1U5KA 1E7VA 3A4RA 4JI0Q 3L08A 3ZRCA 1GUOA 3FKIB 3MXPA 2ZNVC 4CDFC 2L7RA 3AE2B 5AZFA 3L4PA 4DXAB 4BXXH 1TWFB 1V8QA 1TXYA 3I7FA 1EY8A 4CKCA 2KX3A 2WDTB 3IFWB 4Y7NH 4AOFA 4BY7H 1HEZE 2EQSA 4YT0B 3TSSA 4KKJA 4EUTA 2PPBC 3OAWA 2B2WC 3MP9A 4FF2A 5C4XB 4WRDA 2QCZA 1K8GA 5AEKB 1XTCD 3DVGY 2BA0A 1J5EQ 1RM6C 2I38A 5C4XH 4QJFA 2WB1G 1D1IA 1N36L 5IE8A 3EN2A 2FBWB 2MLBA 2Y0SG 4A3FB 1OQQA 4N58A 2B8GA 3C1FA 3T53B 5GAEC 4IWPA 3F2CA 5IYCG 3Q8AA 2ZTEA 3I91A 4ICVA 3STBD 1IL8A 2MX2A 1Q1EA 4HDOA 3BY4B 3FMCA 1VMCA 2JN4A 3OMGA 4B9WA 5CORA 5J22A 1VQ7A 3I5JC 3P4QB 1KL9A 4DFAA 2KQ3A 3GTGH 4EEWA 3LB8C 3DWPA 2WX1A 2A73B 1S5DD 3IKJA 3K5MA 2KJRA 4M0WA 5FOBB 1LQBA 1JT8A 3B0AA 1ZYRC 4JI8L 1EOTA 2F03A 4KY6A 3OMCA 2NCNA 3C46A 3I4MG 4KN4C 1XMOL 2HHHQ 1HH2P 2PMZB 3H91A 5IKCM 4NJCA 5FR3A 3IT4B 1C4QA 5IYBG 3MTNB 4MJSB 5C0XH 2NVXB 5C3JB 3OW7A 1CKNA 2WKCA 2IPKD 4B3TQ 2JXMB 5I4DA 1Q10A 2IBIB 2O6VA 4IWOA 5C0XI 1WTHA 1B3AA 4GSWA 2QC8A 2AWOA 4FF4A 2HDMA 1RCVD 3ONAB 5CHVC 1WJ4A 1WXVA 4P75A 1LV9A 2NS5A 3PLUA 4PMWA 4RGTA 5HI1A 1Q81C 4W9HA 1A3VA 4OHJA 2CKZB 4C56C 4A3MG 4A3KB 3EFXD 3J81c 1QUQA 1TR5A 2Q2IA 4IUUA 1SIFA 2CU3A 3ZTDA 3TUOA 2WX0A 3RZWC 3BIID 3WIMA 2F0MA 1FEHA 1VDVA 1ZDVA 4HEDA 4FULA 2WFWA 3NENA 3AMZA 4FLHA 1D6EC 3MWYW 1UZXB 1HZBA 2EJGC 1ONLA 3S14B 3U7DA 4DV3L 3DQVA 3TEHB 5J39A 1LGRA 4BY7B 4RHSA 4DQOC 1VZ6A 3H15A 4YSXB 4Z9CB 1L0WA 4US9A 3GE3C 1SYFA 1I42A 2JT4B 3Q23A 2Y5PA 1F9JA 1A8VA 3I72A 2HIXA 5M5XB 3QOLA 3AULA 5TR5A 1ZOYB 4LMQD 3NTHA 4QAYA 4GDKB 1SJED 4AQYL 2MW5A 1R4NI 4YY3L 1J7AA 2Z9HA 3ULPA 4KHPQ 4XYQA 4DGZA 1XCQL 4II3B 1BKBA 1NE3A 4GN5A 2ZCCA 2R61A 1WJUA 4N6EB 5J17A 1HHVA 4X3SA 2KDBA 3S1QB 3ZRFA 1L6UA 1GD7A 1XMQL 5BR8Q 2MBBB 1HFNA 1UWXA 2C7NB 1IYJB 3QO2A 1HZ9A 1BDOA 3HOZB 2HCIA 2DGYA 2XWJB 4A76A 4DR7L 4FXGC 4K8JA 3FILB 2D3GA 2RCFA 2Y5CA 2ASBA 3CD6A 4DV1L 2F0FA 2RKSA 2LSSA 2LEKA 5FKAC 1B9RA 4DV3Q 3VQIA 3RFZB 3MC9A 3RUZA 2NZ1D 3N32A 1LUZA 1C1YB 1Y1WG 3OOCA 2DNEA 4A3CH 3L13A 1C3TA 1ICWA 5IYBH 1SF0A 2BB5A 3HHMA 2IGDA 2HQLA 3NELA 3Q6BA 3ZXRA 3PO2H 3OTOQ 1RKNA 3DWQA 5LL6X 4MZ9A 4DXGA 3S15B 2IY1B 2KLGA 5IAAC 3DM3A 2AWNA 1F1HA 5HGTA 2KK8A 4FNFA 2ENBA 1LACA 4F7XA 1FRRA 4JOIC 3AEFB 1YJIA 2C9OA 2N3SA 2KMMA 2NB0A 1U4AA 4MIUA 4A3EB 2OJWA 3ERQA 2Q2TA 4KJNA 4MH8A 2Z0DB 5DM73 2JA9A 1WTQA 2MJ8A 1Q82C 5C0XG 4RCNA 4TKNA 4B08A 4WAFA 1TS5A 1TIFA 1HCZA 1WOCA 3C19A 3TEWA 1RTOA 1N63A 2OXPA 3AEGB 2NTSA 2MRPA 4R4IA 3CCRA 2UXDQ 3ZVVA 4KDIC 3APFA 5C5LA 1IZ6A 1H9SB 2AYOB 3Q8CA 4IZ8A 1C7YA 1FXTB 2B2TA 2EE1A 1UNSA 3O65B 4AQYQ 1LM8B 1RIPA 2B3AA 2K1FA 3JW0X 4NAWB 1KOTA 2DYBA 3UF8A 2DUDA 3GP7A 3NVWA 3GE8C 4IN3A 2DJFC 3QR8A 4UP8A 3K80C 1GUWA 2YV5A 2M0XA 2J0MA 4DDID 1EWYC 2W3RA 3ZDMC 4V190 3SK8A 3MEFA 2GBNA 2NYZD 5M3FB 4K0KL 4L5QA 1YN4A 2KFKB 3VTVA 4NJ7A 1H8CA 2K3UA 1MPEA 2RCNA 4QMGA 4DR3Q 1K3RA 2EIFA 5LMUL 4AUQC 4RM9A 4BVUC 4DKAC 4NAWA 2DYMA 4R3DA 1TY2A 1SYBA 3L0WB 1T5XD 3EHVA 1K51A 3ZDTA 3UDXA 1TWHH 2LFNA 3CXCA 1XPOA 4DR7Q 3VYUA 1PFNA 1WJ6A 1HRJA 2C5LC 5CX3A 1F0ZA 2BH8A 2ZCBA 5KIXA 4C3JB 2HQEA 1JQYD 2KX0A 1Q86C 1O7ZA 2L9HA 1H9MA 3H09A 3KUCB 4H0LC 5BYSA 2FXQA 1AW7A 2NBWB 3OG5A 2QEXA 3T1YQ 4B3RQ 1AZQA 5EE3A 2WIIB 3A74A 1GXDC 2RHQB 1FCCC 4DV5L 4ICUA 3VUWA 1GM5A 1PTOB 1GKHA 3I56A 4NP5A 5M5YB 5IP9H 1NCVA 5LMNL 3S1NH 1IW7D 2L83A 4MSMB 1TS4A 3QHTA 4DK0A 2KEDA 2I0QA 5EGTA 2JA7B 1DONA 1AARA 4LDTB 1S4ZA 1B1ZA 2P5ZX 5CV8A 4FJZA 4OGQC 3A5ZB 1B50A 3S2AA 1GUGA 3FPUB 1GUNA 4EOYA 3DCGA 4N59A 1CUKA 3N1ZC 2N1WA 1IBML 2F0NA 1NYQA 1HZ5A 4MH0E 4X3UA 2R93B 3AEAB 2B2YC 1KFYB 4EE2A 2DWQA 2JSOA 4I6NB 2WYQA 2XSCA 2L1AA 3SDLC 3LNNA 2EYPA 2FUG1 4LUZA 4R1JA 1QB5D 5GXGB 1V9JA 2G4SA 4PS8A 2DZMA 4IC7B 1EIGA 3MTSA 3PUXA 1JJGA 3J7A5 3EA6A 1L4ZB 1LXDA 2I1KA 3PREA 1H9KA 5E4XA 3ZXVA 1EQVA 1SB3C 1JWAD 1N6ZA 2GOWA 2M19A 1G6JA 5FJ8G 4X64Q 1QT9A 3S17B 3F8TA 4A90A 1X3QA 1H9SA 4LFCQ 4JE3B 4NW2A 4JBWA 2MSED 3BU2A 2DX5B 4WAAA 1WYDA 3M4OB 1VQFA 1A62A 1T0QC 2KNBA 5D6JB 3QOJA 3GTPH 1DD2A 1VCIA 5LXIB 5G3LF 4DUZL 1XPRA 3AECB 4HJ9A 5M3FH 3RYTA 3AEVA 2JA8G 3Q8BA 5GQOA 1R9TH 2UXBQ 3CU7A 2MJ3A 3D8GA 2O6VD 3VA5A 5E6PA 4A6QA 4RH6A 1E2WA 2E74C 3NHHA 4C3HG 5IO9A 3X3NA 3B6YA 2KQ4X 1VJKA 4ALPA 3NHEB 1ZEQX 1V6EA 2JXTA 3ABVB 2H88B 2BT6A 1G91A 4A3IB 1NJIC 2PZTA 3M9BA 4F87A 1DOYA 1PFDA 1VLBA 3R7RA 5I2XA 3NG0A 2KUMA 2K52A 1KHIA 4OELB 2Y3AA 1GG3A 3LWUA 4JI0L 3HOUH 1KJTA 2KDEB 3JAME 2EYJA 1MD2D 1Q3LA 4OX9Q 3HM6X 1VQGA 4L63B 5EBCA 5BN3A 2JX5A 3Q14C 5DPTA 4YCUA 1PRTB 2UUAQ 1J8IA 1S5CD 1L4DB 1C77A 1WWTA 2LGIA 3D0FA 2VB3X 1GPXA 1EYGA 3MXNA 3VR5A 5C3EG 2F0JA 2KJ6A 1EL0A 1K9MC 1SROA 1IBMQ 1VQ4A 4JWSC 1Y8OB 5T1GA 3TN2A 4A93B 2X6LA 4IURA 1VQOA 1BUIC 2W55A 4FXCA 1PTOC 1WGYA 4YWKA 2MGSA 3SK5A 1TWAB 2QJLA 2LXJA 3GZNI 2BWFA 1Z2MA 1CA6A 1FM0D 2F0KA 2ZW0A 3HUIA 1CSQA 1FNVA 4H44C 3EECA 2LD9A 1A2UA 1CSPA 2CVRA 2CWAA 3J81E 1Y56A 4LJOB 3IFDA 1S5BD 1CMXB 2L15A 2C7MB 3CCJA 2LVPA 3DBLB 1AYFA 2SDFA 2B63G 2LGSA 1YNNC 3RNUA 1STEA 5J2RA 1EM7A 1OEYA 2FAZA 1F52A 4IM3A 2N9EB 3CWIA 1OTCA 2NR2A 3NBIA 3UE0A 4DAPA 4QUFA 1YNJD 2WDQB 1JOOA 2RDHA 4MTKA 5DEHA 3GDEA 2JA8B 4B6WA 2FCMA 4X3KA 1AWDA 4K81A 1TT2A 1VQEA 4K6DA 2BS3B 2KANA 3OWEB 4DV2L 1Z5SB 1X6OA 4M00A 4MT5A 1C9FA 4PMCA 1WTVA 1BUVT 1NY4A 1D5ZC 4TSSA 3R93A 3PTFC 4P1CC 3W1SA 4A3OA 3QCAA 4B3ML 5EKIA 1QLBB 3ZKJC 2VQFQ 2JZ3B 4DR6L 4ZKBB 2ACZB 2IGGA 1L5PA 1EZ6A 1FFVA 1T0YA 4WWNA 4HDQA 4LAAA 3L3OC 3SR6A 1VQIA 3KUPA 3JVZX 5E6OA 1WFQA 4HPPA 2WXHA 2EYLA 2Z6KA 4ZRZA 2KDMA 3CAMA 2I1JA 5ELFA 4APVA 3FC4A 4HRSA 4W9CA 5KGUA 1KDCA 3VHTC 4RMFA 4XDXA 3KUZA 2KECA 1PH6A 4AIMA 5AJ3L 5BO4B 2QA4A 2JEBI 1JALA 1YNTE 4C3IH 1HNWL 1I4QA 2KAJA 4K7WA 2NVUI 2K14A 4KX6B 3WANA 3N9YC 2PVOD 4LF6L 4LK1C 1NVID 2KZRA 3SHLA 5BYRA
chains in the Genus database with same CATH topology
1UEAB 2BS4B 2EYHA 4IUQA 2JE6I 1RODA 1PTOF 1KF6B 1N62A 3FPPA 3KWVA 1V1PB 1PRTD 1SJHD 2MJDA 4LLGM 3OIPA 2A74C 1Z47A 4OO1H 1F2YA 3NUCA 1AN8A 3T16A 2O5JC 1JROA 1PTOH 1KABA 3HZXA 4HROA 1QNKA 2WNMA 2JA6B 1L6VA 3H94A 1XXGA 3TZUA 1WVLA 1UUPA 3E6ZX 5CC4A 1SNOA 2RA4A 4FO2A 3S1MB 1ML0D 1DOLA 1TKGA 2JQRB 2F0EA 2RSOA 1HQMC 1HA6A 5EE1A 3P4SB 1VR9A 2R7ZB 4K8IA 5ELEA 2VXWA 3BWUD 3MAQA 1BCPD 1DYQA 3MEHA 3VR3A 1AEXA 1K8OA 1E6EB 5FK9C 4TQ1A 2HDLA 1DCZA 3KLSX 2WINB 3VA7A 2CW0C 5A2QL 4Y7NB 2BE5C 3V3XA 4E6IA 5ELDA 4C3IG 1VRAB 3GTPB 4YTNB 1SYEA 1WD0A 1EFID 4IALA 2F0UA 3U7ZA 1YN5A 1PDQA 1ZKOA 5CBEE 1ET9A 2NBFA 1TWGB 1JOQA 2BA1A 2XIWA 4ZKCB 1A6XA 4S3SA 2D62A 2PW5A 3KLSA 2VZKD 1KDBA 2B2VA 3IXSA 1WTPA 4R9WA 4A3MB 1EY5A 1SDFA 1C4AA 2SOBA 3J9CA 2F0SA 3TP5A 1L0VB 5CR3A 3HOVB 2INPE 2YEPB 1Z6HA 5M9OA 1Y8PB 3M7NA 3RZDB 3ITPA 1B44D 1PXUA 2CJNA 4KKUA 4HKZE 3W5UB 1IW7C 2QEJC 3T3NA 1CJEA 1JE4A 5IT9E 4K6LA 3GTJB 3CQZB 4ZLTF 1LT6D 1OQRA 2WU5B 3GTQB 2EPBA 3DHQA 2BDOA 1KLUD 3AE1B 5AUIA 1PMRA 3SFEB 5IOCA 2L1BA 3I8ZA 2G1EA 4FXDA 4KGSA 2A68C 2F0IA 5KYLA 1T5EA 1SYDA 4IFDH 4P16A 1JORA 4A9AA 3ZJTA 1CTMA 4U673 1TWHB 1EEFD 2A6HD 1JB3A 5EKLA 5EJWA 4JX1C 1WTOA 1KDAA 3NK9A 2LMCA 4V0BA 2NTTA 4N9TA 1ROEA 4KD4A 4IFDJ 5TSSA 1NR2A 2Q8RE 5C44B 1RD9D 5KYIA 1GB4A 3M7GA 2RVLA 1C76A 1OXSC 1SE2A 3Q69A 3NQTA 1SE3A 2F0DA 3BVGA 4KMUC 2EZVA 5HFYA 1I6VC 2PZUA 1D2BA 3BDOA 2J52A 1DOXA 2K22A 3C1EA 1CA5A 1Z7TA 2B2TC 3DWMA 3DWAA 1NI3A 5IGBA 3I73A 2HCCA 5K36H 2H1EA 3A7LA 2Y0SB 3NE5B 3CRKC 5FO7B 1RJTA 3GTGB 5BMHA 3CHBD 1DZ1A 2PNRC 5C5MA 3VR4A 2X69A 1STNA 2QF7A 2GRIA 2Q8TA 4CJ0B 2RPVA 3S1RB 3PO2B 2EXZA 2CW0D 1E2ZA 2WB1B 2CQAA 2BOSA 1QJOA 4QB4A 1BMLC 2F0HA 2L32A 2QKIC 1LT4D 3BK2A 2EY2A 1EYDA 1FR3A 2EVBA 2WLBA 1MHXA 4TMAB 5DNFA 2O2LD 1E0ZA 2N9KA 4M8AA 3PIO3 2WP9B 2JYOA 1WTRA 2PIAA 4KV6A 3I4MB 1O7LA 1Y1WB 4ZHPA 3TMEA 3VYTA 4QIWB 1IBXA 2BCOA 5CMDA 3HRDD 4U68A 1BQQT 1IGCA 5IGEA 3HOWB 1XX8A 1WGKA 2ICEC 3NQIA 4G7OC 1K53A 2BW2A 2X6GA 5MPOA 1QILA 3G6JB 1KTKA 3ND9A 3AEEB 2K33A 1SE4A 3J81L 2NWGA 1IGDA 4XT1B 1CQVA 3OHXC 2B76B 3Q8FA 1S5ED 2RQXA 1QCBD 4LK0M 2WXPA 1V1PA 1CHQD 1MSGA 2QCPX 4J3OD 2OF1A 3AEDB 1XF5L 3B9JA 1ZYRD 5LL6S 1F9SA 5ELCA 3CIRB 4JWUC 2K6AA 2W54A 1SEBD 1DJRD 1SFOB 4J6HA 1E9MA 4RNAA 1JMLA 1OXTA 4HAEA 1B4OA 5CV6A 3SDZA 1STBA 2PQEA 4HSVA 1XLOA 3U9SA 2JWUA 1TS3A 1QG7A 1PDXA 4L8JA 2NN6G 2J4XA 4WH4A 1LO5D 1DOMA 3C2PA 3VYRA 2WXRA 1V43A 5C0XJ 4DAYA 3DUZA 2VB2X 4Q2JA 1LT5D 3SR1A 1G2TA 4BBRB 1VMPA 1M8AA 1QQRA 2L0CA 3K0YA 2KCCA 1JRPA 2CHBD 4L6TB 1RYJA 1JCKB 2MP1A 2LJIA 1D5MC 4YTMB 3SVMA 4BA1I 2INNE 5FLXE 1SSOA 4C2MB 5CV4A 1BCPB 2BS2B 1PFMA 1W6JA 4J8QA 5JVH3 3OIQA 4XDDA 5H92C 4ARCA 1H9JA 1ACCA 1N60A 1LTSD 1OO9B 2QDBA 2KHSA 2GA4B 4A8XC 2V0GA 1HUMA 4G7HC 3DEPA 3E56A 3MJ5A 3I70A 2IJ0A 1WD1A 1STYA 1E7PB 1FIQA 3CKIB 2L5TA 1VF5C 4H13C 4L23A 1LTBD 4YIJA 4P6VF 4FVMA 2K04A 3PZ8A 2F4IA 1EYAA 2FMMA 3A55A 1XCTL 5I9OA 3T3OA 3TEZA 4MN3A 1BXTA 2AQ2B 1OFFA 4PNYA 4O1NA 4NDXA 3PV0A 3WDNA 4AQ7A 1FRDA 4L2YA 1V1OA 2WU2B 1RTNA 1Y1VB 4HN7A 4PQXA 1MVKA 1F2LA 3J7AV 3H0GB 3A8KE 1F9RA 1L0YB 1CZGA 3AN1A 2IT1A 1C78A 1IBXB 4RHRA 1Q90A 2MUYA 3KQ4A 3DWGC 2BDNA 4IOIE 3FVQA 1KAAA 1BF4A 3P20A 1V8CA 3D6WA 2WXJA 2PO4A 2M0AA 3GTMB 2FHTA 2XN9C 2KA7A 5DM63 2SNSA 2H89B 5EE9A 2AX5A 3V96A 5DAUA 2K05A 3M4YA 3RPFC 1H9RA 3I4NB 2RBMA 3P7JA 2OHFA 5I6WA 4GLSC 4K2KA 3AB5A 1TKEA 2PW7A 4QCLA 1HZ6A 1ILPA 4KHVA 1PGBA 4KJOA 1XYIA 1FXIA 4YXDB 1XEEA 4C3HB 3IL8A 1G291 3DMUA 2F0QA 2JZPA 3A54A 4KTAA 4KY5A 5CBAE 1UWMA 3FILA 2ZXOA 1FD7D 1EQTA 2AQ1B 3VRBB 5JAVA 4ZUIA 1EY0A 4YSYB 2KVMA 3TDQA 1EEID 1EZ8A 3AU7A 1IYUA 4HMIA 5E4WC 2TMPA 3J80L 1QOBA 1TIID 4H2AA 2E2IB 4OIKA 4GZYC 2KWDA 4WWMA 2MH7A 1JOKA 1QF6A 2EELA 4PV1C 5JPMC 2L11A 2EJFC 4WFN3 1SNQA 4BWGB 2B2UA 1PRTF 1X3PA 3KWLA 2ZXRA 1XO3A 3LX0A 1SIJA 4IQZA 3NUHB 1RF2D 4FP5D 2DLBA 2E3TA 3D3RA 1TQOA 1YQ4B 5T8IA 1ZXTA 1O80A 4XDCA 1ZP0B 2Z8LA 2YYZA 3MFGA 4MACA 2IWHA 1I7HA 1A2TA 4RGMA 2E2HB 1O78A 4R8IA 2F0WA 3PUWA 4RGNA 2PYKA 4EVOA 2WXMA 1CM9A 2WQYB 3I4LA 1HQRD 5LHY1 2WXNA 1RDPD 5J1ZA 1J7CA 4L1BA 1LTAD 1RWSA 2O4XA 2DY8A 3KBXA 3VYSA 2LUMA 1F2RC 3A8IE 4NMZA 2A6ED 3NBHA 1I4RA 4UDUC 1I6HB 3G7LA 4OW0A 1QNUA 1PGAA 1FCLA 2PW9A 4XTCS 1PTOD 3GTLB 1DOKA 4Q0FA 5M3MB 2N7JA 1Y8NB 3PUVA 1II3A 1W6KA 2R6GA 1NENB 3PO3B 4RAUC 3SK4A 5IIFA 3I3CA 2E2JB 3VR9B 3PMFA 1A3TA 1EU4A 1FNWA 2K0PA 3L7ZC 3ZYYX 2V3NA 3R2IA 4B9XA 1Y69U 1K50A 1IKMA 1B9MA 5ISRA 3SXHA 3D4DA 4XQJA 4REZA 4KGTA 3NVZA 1LLRD 2H4OA 1R4PB 1QOHA 2IW3A 3P1HA 1N61A 1VZ8A 3P1MA 3LWEA 2NMQA 1EYCA 1G6ZA 4ME5A 2R3ZA 5EBDA 3K5OA 1F2MA 4IUVA 5E6JA 2YU9B 5CV9A 5D65A 5G3LD 1GUTA 1TWCB 4OIJA 4CJ2C 1C79A 5HHDG 2KCNA 4RKBA 1N5XA 4CHTB 4C3IB 1OXVA 2N55A 5BYQA 1YNND 4HCEA 2LHEA 1Q12A 3IAYA 1JR0D 1DGJA 1LT3D 2RDFA 5EPJA 3HRZC 2R92B 2HDEA 2G9HD 2D5GA 3MC0B 1GJXA 4UAIA 1LTRD 3C8YA 2M00A 4ID6A 1RHPA 2M9VA 4HR7B 4RFBA 4FF1A 4BA2I 2GB1A 3NSWA 1QKZA 2F3WA 4G57A 3GTKB 2FINB 4KKSA 1K83B 2XNAC 3IAM1 3SEBA 5EPLA 1CI3M 4ABNA 1ILQA 2NN6I 2V4IB 1SYGA 3NZ3A 2MPMA 5JEAG 4FYDA 2BBCA 2AQ3B 2NN6H 1P7EA 1I4HA 1E10A 3B2FA 4BBSB 4HMJA 3DM1A 1AFPA 4WIPA 3QWNA 4N9PA 1RFKA 2F0OA 1QWYA 4KY7A 3NWTA 2FE8A 1B2TA 3A8JE 3FAHA 1I4GA 1BCPF 3U4EG 2Z1CA 4RCOA 3HVZA 4CGYB 2WAQB 3EJIA 3NTIA 5H8YE 1FFUA 4IFDG 1MGSA 1TKWB 3V05A 1PUTA 5ELBA 2F0GA 2CJOA 1D4BA 1AP0A 3GV3A 4K5VA 1LTGD 3OSOA 1BNZA 4HEA1 5IGCA 3I9V1 1G8ZD 1EY7A 1SMYC 3RMHA 1A3UA 4XWTA 2D2CC 3P4PB 4ZYSA 2WP8J 3K5LA 4RKLA 3VR6A 2D5DA 5COYA 3A56A 3BVMA 2YEPF 4RA8A 2ZW1A 3SE0A 4DK1A 4YWGG 4HKQA 2K5WA 4A3DB 1EY4A 5T1IA 2W3SA 5C2TB 4RWSC 1TVXA 3W2DA 2BE5D 1B9NA 2K5PA 3EGRA 2E75C 1NSNS 5FO9B 3U9OA 4R8NA 2HUGA 4GDLB 3PUYA 3BZDB 4QF4A 3BK1A 1WTXA 5K36G 4ULLA 1MHHE 3DEOA 3TZDA 5KRUA 2WXQA 2PCFB 1ENCA 3TEXA 3Q22A 5C4ZA 1XWEA 1BBXC 1MSHA 2XRQD 3NWSA 4HJGE 3E9SA 1ESRA 3TP6A 1HUNA 3NVYA 1U4PA 2B2VC 5D3IB 3HOXB 4ILWA 2N0SB 1ZXIA 3NPPA 2B2YA 2G9DA 1JWUD 2N88A 3Q24A 1FYCA 1CHPD 3OPOA 2KOLA 4DN4M 1GUSA 4OO1G 1JWSD 4IDIA 2A69D 1F77A 1TYGB 5HURA 3GS2A 1TKYA 1UGJA 3ZGZA 3HEJA 4NZLB 1CFMA 3MFYA 4I7ZC 4BS9A 2HTME 5C4JB 2IX0A 3GV6A 2EYOA 1DXMA 4PMBA 5A2QE 3K7AB 4TKOB 3ETRA 4I65A 1YN3A 3BDCA 5CV7A 3TP7A 3MVVA 1E2VA 1ZPSA 1EY9A 4QUCA 1P7FA 2EY6A 4KK7A 3CRLC 4C7YA 1R4QB 2WXLA 3ZJVA 3DXJC 1ZDXA 2ONQA 3KBGA 2PLPA 4US8A 1YNJC 1U4LA 5FO8B 3HGBA 2JSVX 4TQ0A 4BY1B 3BYTB 1LTTD 5BMIA 3UI3A 3KK7A 4ZRPA 3E5SA 2QILA 2D9UA 4XIGS 3LYYA 4G7ZC 2K32A 3PO0A 3IAS1 3IT6B 2O5IC 1WRIA 1DOIA 4WJWA 2WXIA 3HKZB 2EY5A 1EY6A 3KF8A 1EU3A 2MHVA 2WXFA 1R7SA 3D4RA 5IT9L 3HVDA 3HS0C 1I4XA 2PVGC 3P42A 4RGOS 3URYA 5C6AA 4KKTA 3Q6SA 1F9QA 1YMHE 5BN5A 1JICA 5I2YA 1WSPA 2I2YA 4G4KA 4NAMA 2IX1A 5LNK1 2LHDA 4ZRQA 3TP8A 5AUKA 1PRTC 1C48A 4XWWA 4M1UB 1BOSA 4DA2A 5BMGA 2EYMA 2L12A 3T56B 3RLFA 4EGVA 2NUCA 3VR2A 1ZXHA 3VRAB 1HTPA 3AE6B 4DNTB 4OZBA 2PZWA 5JJZA 3QG1A 4XQNA 1ENFA 1ET6A 4MHEA 4P2CB 2K01A 3FRPB 1N5WA 3L9AX 4Q5VA 3GO5A 4DXFA 3Q8EA 1F2RI 3FDTA 2WXGA 4IUNA 5IODA 2EOTA 2K5DA 1FXAA 3BDLA 2Y5CA 1JC7A 2F3VA 4TQUS 3R8BA 1QOFA 1L0XB 2B39A 2WKDA 1LABA 4WURA 2XRSD 1QOGA 5JXVA 2F0TA 4H7BA 4AYBB 4EQPA 1CZWA 4CBVA 1PGXA 5D14A 2WV6D 1JQ4A 4XE0A 1IKLA 2JEAI 1E0BA 1J9OA 2IX3A 1LTID 3MHZA 3NRZA 3D31A 2A6HC 2SNMA 2ICIA 2RDGA 3ZQ4A 3NP8A 4D2KA 3C3LA 2WACA 2WS3B 5JOBA 1SNMA 3X3MA 3AH7A 2J53A 1VF7A 3SK6A 3TEYA 2M56B 1OXXK 1MBYA 3N52A 1ZUD2 3WCQA 3NS1A 2L4NA 2QMTA 4ZHOA 2RMMA 2F0LA 4NKLA 5CV5A 1MI0A 2DY7A 4CKEA 1VZ7A 1EIHA 4DNRB 4OZCA 3S2HB 3W3AA 4ZUJA 3GD7A 3AB9A 3MHBA 2OEOA 5M5WB 4XXEA 1HFGA 2KJXA 3H8HA 3MZ5A 3RZOB 1KRHA 1M4VA 1QE6A 4KI0A 5IGDA 4FXKC 2TSSA 4XQQA 3HP3A 3AE8B 5AFWA 1Q1BA 2DYOA 5D7GA 3E0JA 1PZJD 5JEAJ 3AE5B 3T51B 4AS1A 5CYUA 1EWHA 4O42A 3ND8A 2IGHA 4DU9A 1ZE3D 1SNPA 4C7ZA 1MI2A 2EDGA 1G2SA 1GHKA 2ZXPA 1WYGA 1Q8IA 5BN4A 1SBBB 3R2TA 5G5GA 2J7ZA 2LFIA 1TS2A 3D4WA 1U4RA 1K8MA 1QOAA 3PZ7A 2AUJD 3MXUA 1J7BA 3ZJUA 1I4PA 2EJMA 4C80A 4A55A 2WDRB 1A70A 2MJEA 5JVG3 1NUCA 1GAQB 1I50B 2DNCA 3A7AB 3WOEA 3S2DB 5JPNC 1PZID 3S16B 5I6YA 3QIAA 3W9CB 2FJ2A 1T6BX 3AE7B 1NAPA 5JEAH 2QIEB 4YTPB 5E1FA 4KN7C 1CT1D 5KEEA 1XLQA 1YJJA 5HG2A 1B53A 2AUKA 2JP1A 1CK1A 4A3GB 1STGA 2A68D 5D3DA 3AE3B 3K5NA 3P63A 4CJ1B 2GI9A 1I3QB 3UI2A 3J7AF 1KNEA 4MM3B 5EE0A 2Q8IB 1FGBD 1C4PA 2EY1A 4A3BB 3EQLC 5C3XA 3Q0AA 1JWMD 1KH0A 2WDVB 1YQ3B 2K28A 2OT2A 1SMYD 1PLFA 3T4AC 3P4RB 3N6RA 3FEWX 2XVSA 3PUZA 1WCMB 2PKOA 1CQFA 1TU2B 2E2DC 2A5HA 2WXKA 3BG3A 1SSNA 2E76C 4TRDA 2N9LA 2IL8A 5EPKA 4EQNA 2B63B 2NVTB 3MA2B 2C5CA 2XWBB 4J1MA 3W5VB 4WORA 1GB1A 3BYYB 3D6CA 4KD3A 2JYEA 3R3OA 2A6EC 1HXYD 2IDYA 3GTOB 1ESFA 4YSZB 4KKIA 3J80E 4IKGA 1FD6A 2V4DA 1PFBA 2B8FA 1HA5A 1F9PA 4XT3B 4LTUA 2X38A 2KACA 2Z4HA 4LJZC 3IFTA 2K5QA 3BVZA 3EROA 2KEEA 2ZT9C 2F0VA 5EKKA 5KNDA 1SNCA 3I90A 1BCPC 1NEKB 4RF0A 1SXTA 5C3EB 3WOFA 4F88A 3S1NB 2LMCB 4KHZA 2VNUD 1HPCA 3H3VC 4OO1I 2RSNA 3EUB2 1R9TB 2Q5WD 2PTLA 5NUCA 1VDZA 3LXFA 1D5XC 3K57A 4USAA 2SEBD 3I57A 5F2DA 3AE4B 2B2UC 1IUEA 5E3FA 2WXOA 3AEBB 3F2UA 3VR8B 1A15A 1PYWD 2J42A 1T3QA 3KLRA 2ON8A 3P75A 2DBYA 1UAPA 2FMCA 2PMVA 4PT5A 3EVQA 2Z4IA 1SAPA 4ITKA 1FO4A 1WXQA 4XYOA 3U52E 1GHJA 4F8MA 2L52A 3K59A 5K5PA 3U2SC 5A35A 1EWCA 2I07B 1KNAA 4C1NI 1S5FD 3TBIB 3K58A 1IHZA 1C4CA 1BR9A 4IUPA 2L55A 3NVVA 1K52A 4X3TA 1OXUA 2QSDA 1D1KA 4EQOA 1TZOA 1X32A 2A69C 2I46A 2F0PA 3V2TA 2E6XA 1XLNA 4ZAIA 3PIP3 5G5HA 5I9PA 3BS1A 1U4MA 2K1BA 4ZQ3A 2F1MA 3GB1A 2JU6X 3HOUB 3O13A 2VUMB 4CKBA 1FMAD 1SNDA 5KNCA 3NXWA 1JW9D 3SFDB 2B2WA 3OWFA 4IFDI 5FLXL 1FNUA 3S9WA 2V3PA 2LY7A 1NR4A 4K5WA 4HCSA 4A3JB 4WQMA 2FFKB 2BTEA 5IGFA 1NYRA 4OL7A 3QJYA 5C4HA 3HG9A 1HTLD 3AV8A 4IUTA 1BO0A 1GOZA 5EQ0A 3NTKA 2W82A 1TY0A 3AMUA 3M85A 1V97A 1STHA 3MXGA 4B0MA 2SAKA 5CGKA 1F2ZA 4ZK9B 4OVZA 1KLGD 4K14A 2ID0A 5C3WA 3HOYB 1O7YA 3AM9A 4ODGA 1IYVA 3K6OA 5KNBA 4FF3A 1SYCA 2K7VA 3QB3A 3M3YB 2VZKB 4JPSA 1AZPA 3H6MA 4DAVA 4B0EA 1DM0B 4CQNA 2K9XA 2EYFA 2LS01 1U9RA 2MEKA 2BB6A 4C3JG 4ZOHC 1STAA 1CZPA 2K03A 2LKVA 4JK1C 1TJEA 5IGGA 2J0TD 1JWBD 4DF7A 4K2LA 4HTHA 3JAML 2NVQB 3RD4A 2NVYB 2BYTA 2OEDA 2KN4A 4K5XA 2EKIA 4C1NK 4OZAA 2JA5B 1C8CA 3AE9B 3B2GA 4ARIA 1ENAA 2JYTA 4HSPA 2DN8A 3T13A 1PZKD 2M2LA 1XLPA 3J7YW 3GQBA 1WTWA 4KGRA 4RF1A 1GUOA 3FKIB 3MXPA 3AE2B 3L4PA 1TWFB 1V8QA 4CKCA 1EY8A 1HEZE 4YT0B 3TSSA 4KKJA 2PPBC 2B2WC 3MP9A 4FF2A 5C4XB 4WRDA 1XTCD 2BA0A 2I38A 1RM6C 1D1IA 2FBWB 4A3FB 1OQQA 4N58A 2B8GA 3C1FA 3T53B 3Q8AA 3I91A 1IL8A 1Q1EA 3FMCA 1VMCA 3OMGA 4B9WA 5CORA 5J22A 3P4QB 4DFAA 2KQ3A 3LB8C 3DWPA 2A73B 1S5DD 3IKJA 3K5MA 4M0WA 5FOBB 1ZYRC 1EOTA 2F03A 4KY6A 3OMCA 3C46A 4KN4C 2PMZB 3H91A 4NJCA 5FR3A 3IT4B 1C4QA 5C0XH 2NVXB 5C3JB 3OW7A 2WKCA 2IPKD 2JXMB 5I4DA 1Q10A 5C0XI 1B3AA 2AWOA 4FF4A 2HDMA 1RCVD 3ONAB 1LV9A 4PMWA 4RGTA 5HI1A 1A3VA 4OHJA 4A3KB 4C56C 3EFXD 1TR5A 4IUUA 2CU3A 3TUOA 3BIID 2F0MA 1FEHA 1VDVA 1ZDVA 4HEDA 3AMZA 1D6EC 3MWYW 2EJGC 3S14B 1ONLA 5J39A 4BY7B 4RHSA 4DQOC 1VZ6A 4YSXB 4Z9CB 4US9A 1SYFA 2Y5PA 3Q23A 5M5XB 3I72A 3QOLA 1ZOYB 4LMQD 3NTHA 4GDKB 1SJED 1J7AA 1XCQL 4XYQA 4DGZA 2R61A 4N6EB 1HHVA 4X3SA 3S1QB 1L6UA 1HFNA 1UWXA 3QO2A 1BDOA 3HOZB 2HCIA 2XWJB 4FXGC 4K8JA 3FILB 2F0FA 2RKSA 2LEKA 5FKAC 1B9RA 3VQIA 3RFZB 3RUZA 2NZ1D 3OOCA 2DNEA 1ICWA 1SF0A 2BB5A 2IGDA 1RKNA 3DWQA 5LL6X 3S15B 4DXGA 2AWNA 5HGTA 4FNFA 2ENBA 1LACA 4F7XA 1FRRA 3AEFB 1YJIA 2C9OA 2KMMA 2NB0A 4MIUA 4A3EB 3ERQA 4KJNA 4MH8A 5DM73 1WTQA 2MJ8A 5C0XG 4RCNA 4B08A 4WAFA 1TS5A 3TEWA 1HCZA 1RTOA 1N63A 2OXPA 3AEGB 2NTSA 5C5LA 1H9SB 3Q8CA 4IZ8A 2B2TA 2EE1A 1UNSA 4NAWB 3GP7A 3NVWA 4IN3A 1GUWA 1EWYC 2W3RA 4V190 3SK8A 2NYZD 5M3FB 1YN4A 2K3UA 1MPEA 4QMGA 1F0ZA 2DYMA 4R3DA 1TY2A 1SYBA 1T5XD 1K51A 2LFNA 3VYUA 1PFNA 1HRJA 5KIXA 4C3JB 2HQEA 1JQYD 1O7ZA 2L9HA 1H9MA 3H09A 4H0LC 5BYSA 1AW7A 1AZQA 5EE3A 2WIIB 1GXDC 1FCCC 1PTOB 5M5YB 4NP5A 1NCVA 1IW7D 2L83A 1TS4A 4DK0A 2KEDA 5EGTA 2JA7B 1DONA 1S4ZA 5CV8A 1B1ZA 4OGQC 1B50A 1GUGA 3FPUB 1GUNA 4N59A 2F0NA 1NYQA 1HZ5A 4X3UA 2R93B 3AEAB 2B2YC 1KFYB 4EE2A 2DWQA 2JSOA 2XSCA 2L1AA 3LNNA 2EYPA 2FUG1 5GXGB 1QB5D 1EIGA 3MTSA 3PUXA 1L4ZB 3EA6A 1H9KA 5E4XA 1EQVA 1SB3C 1JWAD 2M19A 1QT9A 3S17B 4A90A 1X3QA 1H9SA 4JE3B 4NW2A 4JBWA 3M4OB 3QOJA 1DD2A 1VCIA 5G3LF 3AECB 3Q8BA 3CU7A 2MJ3A 3D8GA 4A6QA 3VA5A 4RH6A 1E2WA 2E74C 3NHHA 4C3HG 3X3NA 2KQ4X 1VJKA 1ZEQX 2JXTA 3ABVB 2H88B 2BT6A 1G91A 4A3IB 2PZTA 4F87A 1DOYA 1PFDA 1VLBA 5I2XA 2KUMA 2Y3AA 3LWUA 3JAME 2EYJA 1MD2D 1Q3LA 4L63B 5EBCA 5BN3A 2JX5A 1J8IA 1PRTB 1L4DB 1S5CD 1WWTA 1C77A 2LGIA 2VB3X 1GPXA 3MXNA 3VR5A 2F0JA 1EL0A 4JWSC 1Y8OB 5T1GA 3TN2A 4A93B 2X6LA 4IURA 2W55A 1BUIC 4FXCA 1PTOC 2MGSA 3SK5A 1TWAB 2QJLA 1CA6A 1FM0D 2F0KA 2ZW0A 3HUIA 1FNVA 4H44C 1A2UA