1F77A

Staphylococcal enterotoxin h determined to 2.4 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISNISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords ENTEROTOXIN H
total genus 66
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f77A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f77A02
2ICIA 1FNUA 4OHJA 4RHRA 1LTID 3OWEB 1CT1D 1F77A 2XNAC 2Z8LA 4RGNA 1I4RA 2QILA 4BWGB 1D5ZC 1HQRD 1QILA 1JCKB 2AQ3B 4ZYSA 1LT3D 1DJRD 1BCPC 4L6TB 4NZLB 1S5CD 1EU3A 1RF2D 1BCPF 2NTTA 2XRQD 4RCOA 1I4PA 3CHBD 1FD7D 2R61A 3BVMA 5ELEA 1KLUD 1PRTC 4DXFA 1BCPB 2XN9C 5D3DA 1JR0D 1EEFD 4Z9CB 1LT6D 1PRTF 1CK1A 4RGTA 1L0XB 1SXTA 1YN4A 3BZDB 3DWAA 1D5MC 1JQYD 1ENFA 1FNVA 1CHQD 1LTAD 3EA6A 1SE2A 5ELFA 1S5BD 3GP7A 1XXGA 1SE4A 4RH6A 1KLGD 1SE3A 1LTTD 1D6EC 1TS3A 3TSSA 1LLRD 1LTRD 4O1NA 1D5XC 1RCVD 2IPKD 1PZJD 1I4QA 1PTOC 1UNSA 1YN3A 1S5FD 5FK9C 1JWUD 1PZKD 5ELCA 1S5DD 5TSSA 1I4HA 1RDPD 1EFID 1YN5A 1M4VA 2O2LD 1FGBD 1JWMD 2SEBD 1I4XA 2RDGA 1CHPD 1TS2A 1BXTA 1LT5D 1XTCD 3R2TA 2G9HD 4RFBA 2WV6D 4RGOS 4K6LA 1TY0A 3BYYB 1PZID 1ET6A 1PRTB 3DWQA 1RD9D 3BVGA 1EWCA 1V1PA 2XRSD 1G8ZD 1CQVA 2AQ2B 1HA5A 1PTOF 1LTSD 1V1PB 1AW7A 1HTLD 1GOZA 3KLSX 4RHSA 3R8BA 5I4DA 2AQ1B 1PYWD 3V05A 1PTOB 1LTBD 5D3IB 1ESFA 1AN8A 3EFXD 1HXYD 1PTOD 3R2IA 1MD2D 1PTOH 4RGMA 5FKAC 3W2DA 2NTSA 1TS4A 1TY2A 2CHBD 5ELDA 5ELBA 2IJ0A 1DYQA 1EU4A 3URYA 1V1OA 1FNWA 1LTGD 1T5XD 1I4GA 1TS5A 2J4XA 1LO5D 1SBBB 3DWPA 2TSSA 1SJED 4UDUC 2QEJC 4DXGA 1STEA 1JWSD 3BVZA 3MFGA 1S5ED 4TSSA 1SEBD 1KTKA 2RDHA 3O13A 1PRTD 3SEBA 1B44D 1LT4D 1B1ZA 3MC0B 4C56C 1EEID 1UUPA 1SJHD 1BCPD 3BYTB 4L63B 1ET9A 1L0YB
chains in the Genus database with same CATH superfamily
3SE0A 3VTUA 3AXCA 1ZUD2 3HOXB 4WWMA 4LK0M 4YHHL 1PUTA 2NWGA 2L0FA 3CIRB 3V3XA 5FLMH 3CWIA 3EBEA 4ZYSA 4HJ8A 3C46A 4ODGA 1TKYA 3AE9B 4FJZA 2EJFC 1PHJA 1GB1A 4RMFA 1WF9A 3M4QA 4LF9L 3HOYB 2LJ5A 1QUQA 1S5CD 1W6KA 3K5OA 1RF2D 1BCPF 1EO6A 3JC66 3IFWB 2JZPA 2XRQD 4PG3A 4JBWA 4JI2Q 4DHZB 1T5EA 1AH9A 5IYDH 3MAQA 4WURA 3N32A 4KDLB 3AEGB 2FFKB 1LV9A 4ZAIA 4FADA 2WXGA 3KUZA 1F2MA 4KTAA 1AYFA 1DXMA 1ENAA 1XTDA 4KK7A 3UE0A 4A3FB 3LNNA 4BS9A 4DHZE 2Z4HA 3D6WA 2UXCQ 3X3NA 4A3IH 4IOIE 2F4IA 3R7RA 3STBD 1GB4A 3E3XA 2NVQH 4DV4L 4NXML 4BKTA 1LABA 1CI3M 3KBGA 4YIJA 1Y8NB 2L1BA 2R92B 1FRRA 2INCC 3GZNI 1PZJD 5AJ3Q 5D14A 2KYWA 2ZM6Q 1SMYD 1JWUD 4BXXH 2BS3B 3OLMD 1EL0A 5IGGA 1NVID 2JWZA 3X23A 4FJVB 3OAWA 4KGRA 1V43A 3CCVA 3NVZA 2O2LD 4DV7Q 3NZUA 2HIXA 3K5LA 2RSOA 3J81i 1UGMA 1LT5D 2F0QA 4DAMA 1E7UA 4JI8Q 3C19A 4ZOHC 2PTLA 3SDLC 4B9XA 3NQIA 3AE1B 1PRTB 4HJ5A 3MEFA 4MGKE 2LS01 1VQJA 1D7QA 5EPJA 2EYOA 5HY6A 4JBJA 1WOCA 3RZDH 3OTOQ 5I6WA 4DQOC 1BT0A 1DOMA 1WXSA 1V1PB 3F2UA 2KMCA 4J1MA 5M5WH 4K7UA 3RPFC 1AW7A 1TIID 3NHHA 2EMTA 3MXPA 1GVPA 1GKHA 4N9PA 2AQ1B 2K33A 3CKIB 5H8YE 3E9IA 4KD4A 1IBKQ 4LNFA 1FCCC 4FP5D 3MP9A 2REXA 1QJOA 4J15A 4WQOB 4MNOA 1I5FA 1WY8A 3I56A 5GADC 3I91A 4YWMA 2Q2HA 1FFVA 2IGGA 1AFPA 1DYQA 2PPBC 4K6DA 4RCNA 3PSEB 2WACA 4M8NA 5BMHA 2AX5A 1FPYA 2UXBQ 3P63A 3H3VI 2CHXA 1I42A 1E1OA 2H89B 2A68C 2GBNA 1V8QA 4GN4B 3N6RA 1MSHA 1V9JA 3ZKJC 5M3MH 1OXTA 1IKLA 3HKZB 2HIVA 4DR7L 4H7BA 5JXVA 2DZMA 4LJZC 1VMPA 4XQQA 3SU8X 4CO7A 1L1OB 2WXHA 5C3WA 3L54A 1RJTA 1WRDB 2RDFA 4A3GH 3BYTB 3HOXH 3IKJA 1JRPA 2AYOB 2E8GA 2O4XA 1EOTA 2Z59B 2LVOA 3RNCC 3K7UC 3NZSA 1WIAA 3D32A 1JROA 4MSMB 2MHVA 1W2BA 1WYDA 1HQRD 2PW5A 5IT9c 1NR4A 1QWYA 3M7NA 3KUCB 1EFWA 2GOWA 3Q3OC 1YHAA 3FKIH 5CTRC 1PFDA 4LF6L 2JSVX 2AWNA 1EF1A 3D4WA 4AJWA 2NB0A 5JVG3 1OTCA 3ZRFA 3HKSA 2LKVA 1KLUD 1WXQA 1UH6A 3KDFA 4F8MA 3M4OB 1Z9FA 2KQ3A 4DAYA 2LXJA 1Z6HA 2JRHA 2WX0A 5TR5A 3ZDMC 2C7NB 4Z9CB 2E2JH 4L5TA 2KVRA 4GOPC 3A8JE 3J7A5 2G4DB 2HD5B 2JUOA 4ITKA 3ZW3A 3RZWC 1XNRQ 4C2MB 1F9JA 2KZRA 5AEKB 3NZ3A 5L95C 4BY1G 1S5BD 3NRZA 3VTVA 1XXGA 2CH4A 2F3WA 4ME5A 1BMLC 3E5SA 3E0JA 2EYFA 4YWKA 4CDEC 5A2QE 2L76A 4ZKCB 1QZEA 2E76C 1YJ9A 2JJQA 1JE5A 2Z6KA 4ZLTF 1I4QA 3HKZG 1XLOA 1S5FD 4BY7G 4NMZA 4FVMA 4R8NA 1PZKD 4DV0Q 1N36L 4DV1Q 4A3EH 2LFIA 1KH0A 4FYDA 2K52A 1K0SA 2ZVNA 3GS2A 3WCQA 1UWMA 1GUGA 1UE1A 4HTHA 4EZLA 2K7VA 1F2YA 2F0PA 4JIOU 1LQBA 4DNIA 3DXJC 3HEJA 1N5XA 5J39A 1B3QA 4N9F4 4ZUJA 1IGCA 2M00A 2O2VA 1HRJA 3HK0A 4PNYA 3GTJH 3CCRA 1G291 2BKFA 2XK5A 2VQEL 2KLGA 2ZPNA 2RPQA 3AH7A 4JYAL 3RZFA 3ITPA 1S1QB 1EWCA 4DK3C 2G4SA 2YEPF 1M8AA 2NBVB 1GG3A 4CHTB 2LSSA 2GN5A 3A5UA 3OPOA 1ZXIA 3LYYA 5HG2A 2FXQA 1UBQA 3FMCA 5A2QL 2VZKD 1AP0A 3ZNGC 3VR2A 1VCIA 2D07B 2LASA 1K50A 4JCVE 4PMBA 5DNFA 3HOWG 1ZPSA 3T56B 4A3DH 3ETRA 4HCSA 3S2HH 4DR3L 1CTMA 1O80A 1STBA 1MJDA 1E3PA 1T9HA 5ELDA 4IQZA 1PLFA 2VW9A 1CKNA 4X65L 4OO1H 4KN7C 2WQYB 1FEHA 3DHIC 4IUQA 1BQQT 1XPRA 2BB5A 2NPTB 2OOBB 1T5XD 2UUCQ 2CWPA 1QG7A 3B1LX 4C7YA 3L7ZC 2KXJA 3KDFB 4HSPA 3QX1A 1SYEA 3ERQA 1FXTB 1SGHA 1YX6B 5JZEB 3QOJA 3OSOA 1FR3A 2A8VA 4W9HA 2KUMA 4CHKA 5L83A 2BVCA 1Z47A 3N20C 4C80A 2WXMA 1EZ6A 2R2OA 3PRMB 3PV0A 1HUMA 2E2HH 2IY5B 2JZ3B 2JSOA 1ZKHA 5LMUL 2MHJA 2R93G 3TEWA 3NPPA 4XWWA 3CC7A 2WX1A 1LTID 3IBEA 2MA9B 1J0GA 1BBUA 2VUMH 4YCVA 4TUUA 2EYMA 3ZGZA 4QL5A 1ZP0B 2MP2A 3M4PA 3PUWA 4GLAC 4GNXA 1WCMB 3W5OA 2B8FA 2EY2A 2GBKA 4JGHB 3DEPA 4U673 1K51A 4BY1H 3NVWA 2VB3X 1ZE3D 2CR5A 1U4AA 2EE1A 4XYCA 3S2AA 4HN7A 5GROA 2JEAI 4JV5L 5CORA 2B2UA 4BKSD 4F7XA 2Q8RE 2GA4B 1EY7A 3S1RH 1FJGL 2JX5A 1FNVA 3DVNV 1CHQD 1U5KA 4URKA 3ZQ4A 1KM7A 2L52A 2KX0A 3RZDB 1HZ9A 1HR0W 1CKNB 1QF6A 4O1NA 1LTRD 2VUMB 3CC4A 3ZJVA 2JA5B 2QCZA 5E4XA 2BYEA 5JVH3 3I4MH 2K4KA 3PZDA 4XDCA 1KNAA 2DY7A 1NYQA 1QOAA 1TBEA 1X55A 1E2ZA 1NNXA 4JE3B 4UAIA 2QC8A 3ZDTA 4ZUIA 2K04A 4GKJL 1EFID 3VVWB 2IGDA 1FGBD 2CWAA 1I4XA 2N9LA 2O5JC 4FF3A 4JI1Q 3FVQA 2MBEA 2B2TC 1FGUA 4NJ7A 5G5GA 4K6LA 3GTMH 1XMOL 2WU5B 1QUQB 5EBCA 4DR2Q 4GN3B 3S1QB 1JT8A 3AQQA 4KLKA 2AQ2B 2K8CA 5HURA 2MX2A 4W9FA 4M02A 2JYTA 1HNZL 1JORA 1A3VA 1IGDA 4M8MA 5KGUA 1XX8A 5H92C 1QE6A 1VQOA 4DR7Q 2K39A 4REZA 1N8RC 1QB5D 4R9WA 3CCUA 4GNXB 4IFDJ 4A4IA 1X3QA 2Y0SB 1K8MA 3GTKB 3VR6A 1JWAD 4KGSA 1NEKB 5E6JA 4HWIB 1MD2D 4LLGM 2MUYA 1LM8B 1BBXC 5T1GA 3D3RA 2CHBD 2I46A 2VY3A 2MBOA 4NP5A 3A9JA 2KJ6A 1B7YB 3HGBA 1IUEA 2EKIA 3NE5B 2VH2A 2Q2UA 2Z6BA 2ZPYA 3P7JA 3DWPA 3VA5A 2Z0EB 4I6LB 1WGRA 1PH5A 1WGHA 1JWSD 5KEEA 2F0FA 3CU7A 2LRUA 3BDCA 3OIQA 4TSSA 3O13A 2C7MB 5FLXL 2E3TA 4H02A 3UGBB 3KBXA 4IWPA 1IBML 3HOVH 2JP1A 1V49A 4XE0A 1SJHD 2LD9A 1Q10A 4WJWA 1X3EA 1UD7A 1N34Q 1TGZB 4IM2A 1FCLA 1L0YB 2PZTA 3G7LA 1QZGA 1UAPA 3D4RA 3S15H 4IPGA 2KKCA 3DWMA 1QCBD 4HMIA 1HTOA 2Z8LA 5EJWA 4K5XA 1MI0A 1JCKB 4G7HC 1IBMQ 4W9DA 4LAAA 5CYUA 1YJNA 2VB2X 1PH9A 1Q8IA 3MXNB 4DNTB 4A3BH 4MH8A 3NEMA 2UUAL 1VQKA 3ABVB 3DUZA 1OEYA 3AEDB 1UE7A 3DLLA 2ZXPA 1FL0A 4YT0B 1I50B 3CHBD 1C79A 1MHHE 2B2YC 2SOBA 3P20A 3QG1A 2GB1A 3N9YC 1JOKA 1B9MA 5JJIA 1OXUA 3FAHA 4K2KA 3CAMA 3G71A 4LF7L 3PUXA 4O2DA 2JA6G 1LT6D 3A55A 4IFDH 3DHQA 3JSVB 2WDVB 3ZJTA 1HZBA 3BWUD 2WDRB 3K81C 4JWSC 1JQYD 1VF7A 1QOFA 4N58A 2XTIA 1FO4A 1C9OA 1HTPA 2KJXA 1M1KC 4HSVA 4LNOA 4RA8A 3I2ZA 1QOBA 1F9QA 4M0WA 4ARIA 5EPLA 1JMCA 4AOFA 2UXDL 2ON8A 1HZ6A 1ZW7A 3Q6BA 5E7NA 2DBYA 4II3B 4KSKC 2B63H 4DF7A 4F87A 1K8OA 1F1HA 4EX5A 3PREA 1HUNA 1IYJB 3RULA 4ZRQA 2V3NA 3N30A 4F7ZA 3SHLA 1A70A 1L7YA 2W3RA 1CA6A 4W9IA 2SEBD 2K25A 2Q2TA 4B3MQ 2JY6A 3J80E 2WKCA 3SHQA 1FMAD 2BF8B 4DFAA 3TREA 2FMMA 2JA7H 3U7ZA 2R2QA 3I4LA 2D11A 3N52A 3Q6SA 4JVZA 1JJ2A 2YEPB 4PT5A 4LNIA 3H0GG 1PH2A 5D6JB 3ML8A 1MKHA 1GHJA 2KENA 1RD9D 5KHQA 3FKIG 3ND8A 3HZXA 4CDDC 4TQ1A 2IWHA 4DAVA 2CW0D 2GBMA 1UE5A 3FP9A 1HTLD 2EYLA 1J8CA 5D94A 3RLOA 1Q0WB 4HIDA 2MEKA 3TUOA 5JEAG 4BBSB 2FJ2A 1X56A 3R2IA 3W2DA 1AWDA 2QDBA 2J52A 1B8AA 2C35B 2PVGC 2ASBA 4HPLB 3HOXG 4NAWB 4ZRZA 1PV4A 1MI2A 1PH6A 4ANUA 4H2AA 2KDBA 3AEVA 5IKCM 4ZRJA 2DJGC 5C3EB 1WGDA 1ZEQX 1EQRA 2KHJA 2VXWA 4UP8A 3VR8B 1QOGA 3ONSA 5FR3A 1Y14B 3KVFB 1ASZA 2K28A 3SK5A 3K7AB 4RAUC 3L0WB 1PQSA 5EE0A 3K9OB 4ASWC 1B3AA 1EM7A 2KQ7A 3IFDA 1IYVA 1DONA 4HKQA 3PO3H 1IL8A 1ZXHA 5M3FG 3VHTC 2JA6B 3GTLH 1WX9A 3KOJA 3CCEA 4EQ5A 4US8A 4NJ6A 2FCMA 3H3VC 2INDC 3HIZA 4HR7B 4ZKBB 5BR8Q 1E5WA 1B53A 2ICIA 4HCEA 4OHJA 2DZKA 1YIWA 1WX8A 5IP7H 2NVYH 3QWNA 3EJIA 1VD2A 1F9PA 1XT9B 3BK1A 1HZ5A 3F2BA 5LL6X 4C4VB 2KEDA 4B3ML 1I50H 2ZEQA 3CF6E 2NUCA 3DM1A 4LNQA 2NTTA 2E5LL 4YCUA 5C0XH 1E24A 4HJAA 1HNZQ 1ASYA 2WLBA 2BCOA 2J7ZA 3BVMA 4CKCA 2RA4A 2B63B 4C3IH 1ML0D 4DXFA 1YJIA 1BCPB 4IALA 4P1CC 5JJLA 3PIO3 1XO3A 2UXDQ 3UDGA 3S15B 2V3PA 5C3JB 2QIEB 1CQFA 5C6AA 1BDOA 3ENEA 5LXIB 2MP2B 1SYCA 1ENFA 1X3PA 1X6OA 3AEEB 3DBRI 5IO9A 5DPWA 3ULJA 1K8RB 2FCQA 4YCWA 4JI8L 3I4NB 4OX9Q 5DPTA 3HM3A 4XDXA 2JT4B 2F0WA 2BPSA 2C9OA 2E6XA 4H13C 2OEDA 2NVYB 1CFMA 1L6VA 3RNEC 4HLEA 2C7HA 3L10B 2PW7A 3A54A 5M5XH 3RZOB 1NBFC 3F8TA 2D5DA 2EYJA 4JLCA 4B3TL 5AZFA 2PW9A 1C4AA 3GTLB 2PMVA 4FHJA 4R4CA 3KWVA 5G5HA 4JI7L 2I1JA 5CHVC 2L12A 1Q86C 3PTFC 4HJ7A 1JWMD 2AMCB 4WWPA 3Q3FA 3CP0A 3E9HA 4C3HG 3C1EA 3PZ8A 5JPNC 1U9RA 1DD2A 1NCVA 3OMGA 3I4MG 3HM6X 1XPOA 1K73C 4AYBG 2F0EA 1TKGA 5JAVA 3S2HB 4GU2A 3BYYB 3DDCB 2QJLA 4P2CB 2A6HD 4N9TA 4LFAL 3EVQA 4QY7A 3RN5A 5IGBA 3L4PA 4YTMB 2WAQE 1XMQQ 3M62B 4FN2A 3SFDB 3F2CA 1XLNA 1C8CA 2N9EB 2NVQB 2KJHB 3RNBC 4DBGA 2L4NA 1C9FA 1QOHA 1DOLA 1EOVA 1WH3A 4IPCA 2DENB 1GAQB 3EHVA 5CHWA 3PUYA 4RNAA 1V8CA 2DUDA 2E74C 1VF5C 2VL6A 2WXIA 3T16A 3W9CB 3T53B 1UBIA 5FKAC 4G7OC 4DV7L 2EQSA 4GB9A 1F2LA 3RD4A 1WGGA 3WALA 2A19A 2NZOA 3ND9A 3Q8AA 4GSWA 3URYA 2OF1A 2B2VA 2RF4A 1LTGD 4MN3A 3J7AF 4XQNA 1EYDA 2KCMA 3MC8A 5CV8A 2OT2A 1VQ4A 5AJ3L 3HG9A 1D3ZA 2ES2A 2Q5WD 1EIFA 3PHXB 4ZRPA 3Q3MC 4XXEA 5I2XA 3I55A 3RNUA 2PNRC 3KF8B 1F9RA 2J53A 3FEWX 2KFKB 4L23A 1TTNA 2HDMA 3U50C 3TN2A 3H7PB 1TWFB 4IUNA 1E2WA 5C44H 1E8YA 2FHTA 4C56C 3MC9A 3E9SA 3B6YA 3J80c 4A3GG 3EECA 4LF7Q 2MJ3A 4G3XB 1BCPD 5DM73 4GOPA 2HDEA 4YSXB 4QIWB 2WXOA 3S14B 4KIKA 2JWUA 1FNUA 2JXXA 1HNWL 3V6EB 1PDQA 2FUG1 4RGNA 2F1MA 1KJTA 2IZVB 2PLPA 2V9HA 3AEBB 3EFCA 4LF8Q 4GN1A 3J81L 2R7ZB 4I7AA 1LT3D 2MBQA 1RODA 3N1XC 4HCPB 2MJEA 4MDKE 4JI1L 3M3YB 2KWVB 3P2BA 1ZKOA 3VRAB 5JHBA 3ALBA 1TQOA 2HT1A 3Q14C 5IP4D 4I6PA 4A3KG 4OVZA 4GKJQ 2EZVA 4BBNF 2UUCL 3OG5A 5BO4B 4AS1A 1SSNA 2NVUI 3L17A 3N1ZC 1C77A 1R4QB 3KH0A 3HKZE 2L55A 2UU9L 2CU1A 2G45B 5IOIA 4G4KA 2W3SA 4OVVA 3AB5A 1KQSA 2KK8A 2N8NA 4MIUA 3IVFA 4ME3A 2FCNA 4IPDA 2GLSA 2R7DA 4RH6A 2ZCBA 1K3BC 2KDEB 1D6EC 4GMVA 3T9LA 2KD0A 2UWQA 3DOWA 1TWCH 4F88A 3JAME 1Q7YC 2JA8G 2K1BA 3CF5A 4WJPA 2VS1A 1GUTA 3MTSA 1I6HB 2BW2A 3PGZA 3P4RB 4OVUA 5ISRA 1HCZA 4G0NB 4M00A 4C3IB 2Q8IB 4L2YA 3STBC 4KHPQ 1BF4A 2BDOA 5IT9E 3KJOA 3UQAA 3HVDA 3VAWA 2WNMA 3NWSA 4KV2A 3MZ5A 3ZXVA 1LTLA 1H9JA 3S9WA 4ICUA 4JI3L 2OXPA 4MT5A 2IGHA 2SNSA 2K01A 2NMQA 4D2KA 4LFBQ 4EOYA 2LUMA 3A7LA 1KFYB 2A4ZA 2LJIA 3EROA 4DN4M 2JEBI 3FILA 2C9WB 5HGQA 2VQFL 5LHY1 4AQYQ 4LF5L 1T0SC 1II3A 1YQBA 4A55A 1G6PA 2FBWB 4FBJB 1OEYJ 4K7SA 1GXDC 1TZOA 5M5WB 1AEXA 3AB9A 3GTOH 3VFKA 1R9TH 2ZM6L 1E0BA 3VR3A 1WMHA 2A5UA 4LCDE 2F0TA 2K03A 3V05A 3WDNA 1EWHA 2MJDA 5FLMG 1P0RA 4DV4Q 3J80L 4NXMQ 1CM9A 1VQFA 4OX9L 1Y1VB 2N7JA 3NS1A 3NWTA 5G3LF 2F0KA 2PI2A 1G91A 3HOVB 4F8CB 1ZYRC 5BR8L 2NPTA 1XNRL 3RLFA 2HHHL 4ALPA 2HJ1A 1KDCA 1VQAA 2G5DA 3PIOA 2AWTA 1SFOH 5E6NA 3J7ZC 1XWEA 1WTWA 1IBLL 2JQRB 3ZLZA 2RHSB 1WM2A 2LI5A 4LUVA 2Q8TA 3UI3A 1SBBB 3R3OA 3RUZA 4AUQC 3TEXA 3EQLC 5JJZA 1ICFB 3H9DA 3VUYA 4EUTA 2EVBA 4A3MB 3AN1A 5LMNQ 3AE6B 1TT2A 2LY7A 3A56A 1X32A 4HAEA 1WXVA 1XF5L 3CC2A 3P42A 3MA2B 4CJ2C 4LNNA 3TMPB 4NDXA 3B08A 4OONA 1JWBD 3AE7B 3UE1A 2PI2E 4A3FG 3I4NG 5C3XA 4HIMA 4MZ9A 3CRLC 3EFUA 3K5NA 4JV5Q 4IUTA 4RWSC 2N0SB 4W9CA 4RF0A 2WXKA 4G57A 3GTQH 4P6VF 4ZCKA 2J0TD 1CT1D 2EYPA 2G9DA 2QSDA 1GHKA 1MBYA 2L9HA 2AHOB 1H9MA 1VQ7A 2JA5H 3Q2AC 2UUAQ 1WJNA 2RR9A 4WWNA 3GDEA 4ABNA 2QW7A 4KY6A 3QO2A 4FDBA 3RUIB 5GXGB 2IBIB 1SNDA 3AV8A 2R61A 4LFBL 3PLVA 4OO1I 2KVMA 1C4QA 3TL5A 1AE3A 1J9OA 4DV2L 1E8WA 4F1SA 3B2GA 4NAWA 1DOYA 3TQYA 5GAEC 3ERSX 2KDMA 4EE2A 2MO0A 1YNND 1PDXA 1HH2P 3TDQA 5A35A 1OGWA 3HUIA 1GO3E 4JBKA 1WM3A 4A3JG 3QARA 3DM3A 4MJSA 1SNPA 3M4YA 2XVSA 1CZGA 2RSNA 2IO3B 2LFNA 3W1BA 1OXVA 1GNUA 1NDDA 1KLGD 1L6UA 1OFFA 1VR9A 3BG3A 3HS0C 2HD3A 2E75C 2XGTA 2F4VL 1AZQA 1VQ6A 1P3QU 1GUOA 1ACCA 4DAYB 1BOSA 4A3DG 3P4SB 1VQ9A 2LVPA 3DHGC 3H1UA 3W1SA 5G2NA 3TEYA 4X3KA 1TIFA 3VR9B 1D1IA 2HHHQ 4IUMB 2JA8B 1FYCA 4KKUA 1VQMA 1KRTA 1V81A 4GDKA 4S3SA 4CJ0B 1MHXA 1TKEA 1WE7A 2CW0C 1TS2A 1BXTA 2BA0A 1L0WA 2C5CA 1KRSA 3L9AX 1LM0A 1EIGA 1P16A 5EE1A 5C2TB 3RNGC 2EMSA 1AE2A 1HFGA 1V5TA 4BA1I 1WD0A 1PGAA 3ZNZB 2E2IH 3PMFA 3SVMA 2V1YA 2WINB 1T0QC 3NVYA 4XWTA 3DBRB 1A2TA 3J81c 1YJWA 1RYJA 1CQVA 4MGYE 1KRHA 2BYTA 2MNAA 3ER0A 4HPPA 5EKKA 2DY8A 2WIIB 5CBEE 1FRDA 4JPSA 3NOBA 3KK7A 3LB8C 1KAWA 1FVIA 3I4MB 5G55A 4IN3A 2NR2A 4K8JA 1KOTA 2R93B 1L2NA 1EY6A 1Y1VH 1PYWD 1NUCA 2MWSB 2EELA 4X6AH 1V1QA 1HXYD 2JXTA 3EGRA 3LX0A 1N33L 1EY9A 4IURA 5EGTA 2XBBC 1GD7A 5K5PA 1P98A 3M63B 1ESRA 2XWJB 2SDFA 3SK6A 4YY3Q 1B9NA 1KC8C 1EU4A 4KHPL 1J7CA 2KACA 1PYBA 3GTGB 1I4GA 1TS5A 2QDLA 5IT9L 4USAA 4A20A 1GUAB 2JF5A 2CKZB 4DWFA 2D10A 1GC6A 3HHMA 1O7LA 4BAXA 2YTYA 1JB7A 1MFWA 5KYIA 1WRIA 3IAS1 2LXKA 5C0XI 1NMGA 1CSQA 4EZJA 2L1AA 3VYTA 2I07B 4I65A 3J81j 2CCZA 4LJPB 1A2UA 3RMHA 2KCCA 2DWQA 2KQ4X 4KI0A 1NTGA 3AMUA 3G6EA 4C3JB 2K9XA 4G50A 1CUKA 1VQDA 2RD0A 3ZXRA 1HE8A 3I7FA 4KZ0A 4BBNC 3PPAA 1I3QB 2RCNA 2EKEC 5HFYA 1E2VA 1FXAA 2JA7B 3OWEB 3HOUG 4IDIA 1L0VB 4W9KA 3A8KE 2JN4A 4BWGB 4I7ZC 1TWCB 1VMCA 2VRRB 1UGJA 5HGTA 2ZZPB 4K81A 2B3AA 3U4EG 1BNZA 2M4NA 5IY0A 3QJZA 1AARA 4P7IA 2UU7A 1XYIA 2XK5B 4GDKB 1PGBA 2EPBA 2ZW0A 4M1UB 2LGSA 4IFDI 1MG4A 4K5WA 5D2MB 3BS1A 2PKOA 1RLFA 1QZHA 3NUHB 1HNWQ 2XEWA 4OWWB 3APFA 1A6XA 2DGYA 2QEXA 5D65A 2KWCA 1JR0D 3I5JC 3IHPC 4JW0A 2KMAA 5GQOA 4ZK9B 1MJEA 1KD1C 2DYMA 5DCNA 2Y5BB 3BZDB 1WE6A 4AYBB 4MELA 2Z4IA 5IODA 5JJKA 3UQBA 4DGZA 1U4RA 5GAGC 5FOBB 4UP7A 4N6EB 5IAAC 3SFEB 1Q1EA 4HDQA 3CRKC 3M85A 1LTTD 2Z6KC 2JYEA 3GD7A 2LXAA 1NENB 2WFWA 1F2RI 3UDFA 1R9TB 2PE9A 4M8AA 3A5ZB 4AQ7A 4K1RB 3G4SA 1SROA 4BY1B 4OXPA 5KIXA 2D3CA 1VRAB 4QUCA 3NG0A 4NXNQ 1UE6A 3F2DA 1V2YA 1WX7A 4B0EA 2ZT9C 4J6HA 2HQLA 1LUZA 2YU9B 3CSTA 4LF9Q 2O6VB 4P75A 3ULPA 2K05A 2WXLA 4XC2A 1XMOQ 5IA7A 3K80C 2KHIA 3H6MA 2LZ6A 1XCTL 3A33B 1TY0A 4OO1G 1RKNA 1EWYC 2OHFA 4B95A 3I3CA 5AUIA 4KKTA 1FM0D 2N1WA 1R4MB 4XT3B 1R4NI 3APDA 4WIPA 4W9LA 4X64Q 3D31A 5BYQA 2K0PA 3ZYYX 2MW5A 1A15A 2P5ZX 1EF5A 2KWDA 4NKLA 4R4TA 1E22A 3B2FA 1JICA 1JOOA 1XNQL 5DPRA 1Q90A 4O0AA 3RYTA 2BDNA 1K8AC 1SNOA 3R8BA 1A8VA 1MSGA 4GS3A 4MTKA 1Q5WB 4YTPB 3KF8A 2D0OA 2RMMA 4RGMA 2BE5D 3H3VH 2DZJA 1XNQQ 4A93B 4DHJD 2NVXB 5FO9B 3AEAB 2L00B 3DCGA 3S1MB 3JW0X 1HJPA 2KNBA 2XIWA 3L16A 5HI1A 3K59A 4NPSA 5M3FB 1WJ6A 1WCMH 3RR5A 3K9PB 2A73B 5KYLA 4QAYA 4WJQA 4X3SA 4K8IA 1YHBA 2K5WA 4HRSA 4JQWC 4R3DA 2PPHA 3APCA 2ZW1A 4KHVA 3GV6A 4PMCA 4K2LA 2R3ZA 4I6NB 2MH7A 4JWUC 2GMIC 4B9KA 4WJ3M 2G1EA 3H7SA 3QOLA 3EIVA 1TWHB 2D3GA 2K6DB 4PS7A 4BBSH 4C1NI 4W9GA 1WFQA 4EQNA 2E2JB 2HE7A 1U4MA 1IBLQ 2LMCA 1IBXB 2RBMA 4BVUC 1I94L 1I4RA 2JK8A 4IOCA 5E6PA 2KA7A 5CGKA 1SFOB 4ZRIA 4IJHA 5E1FA 1K53A 2KDIA 4IM3A 5M3MB 3VA7A 1EU3A 2ENBA 4LF6Q 3BK2A 2ZNVC 3RT3B 3S2DB 3B0AA 2JA7G 2IX0A 5ELEA 4YHHQ 1JMLA 1RL2A 2OWOA 1SAPA 1EQTA 3AM9A 4FO2A 5CV5A 3I9V1 4LF5Q 2BYFA 1MIUA 3S17B 1RM6C 1EEFD 4A3CH 1D2BA 3PIPA 4BY7B 3PRPB 1SXTA 2Z1CA 3CCQA 5C1ZA 4WH4A 1SNMA 3Q8DA 4IC7B 2B39A 2KJRA 2ZVOA 2KBNA 1SE4A 4RMAA 4A3BB 1I35A 2F0HA 1L4ZB 1PYSB 2F0MA 1YEZA 3A9JB 1Y56A 4XQJA 4O42A 4A3MG 4H44C 3NP8A 1JRUA 2KANA 2Y5PA 1PTOC 5BMIA 1X65A 4LDTB 4B08A 3FILB 1PVOA 2W9NA 5ELCA 5K36H 5CV7A 2F03A 3DMUA 3GE8C 1EY5A 1STHA 3PZ7A 4DV2Q 5KHOA 2OJRA 4HJGE 1IW7D 4CKBA 2IDYA 4P1BC 2EXDA 2G9HD 2WV6D 4DUZL 1B2TA 3Q8EA 1HZAA 4KZCA 3U8ZA 1SN8A 4CQNA 4MHEA 4LF4Q 4FNFA 3JYUA 1MVKA 1Z2MA 2PYKA 2KFKA 3V61A 4P16A 2ZJQA 3H6NA 4MM3A 1C76A 1KNEA 1HA5A 2OQKA 4DK1A 1LTSD 4E74A 4YWLA 5AZGA 1J8IA 3GV3A 3RZOH 1GOZA 5IWAL 2LGIA 1PTOB 2NS5A 5D3IB 1ESFA 3PV1A 4JK1C 1N62A 2BB6A 1C7YA 4X66L 4A93H 4MH0E 4GOCA 3UIOB 1YNTE 3CMMB 2LUEA 2DNEA 1UWXA 2F0IA 1WD1A 3DBHI 2R7ZH 2SAKA 4NXNL 2HCCA 3VYSA 1S40A 2VUMG 3PRZA 2FAZA 4BZAA 1GM5A 1LO5D 1TYGB 1ZGUB 2ZJDA 4KY7A 3D8GA 4XGAB 1R4PB 5DPSA 3TCAA 1PH4A 1C1YB 4GIVA 1YNNC 4AYBE 5J22A 2YYZA 2A6EC 3TS2A 1E7PB 1VZ8A 2X38A 4BKSA 4V0BA 2QA4A 2WAQB 2KC1A 4A3KH 2UXCL 4FF4A 3QIAA 4XYOA 1AZPA 5HKHA 1H9SA 1STAA 4BOZB 2F0DA 3H7PA 4KKSA 4L5RC 1WCMG 2A1AA 2YU9H 2EY6A 1PH8A 4BBSG 1RRBA 1YITA 2H88B 4JI2L 3CW2C 3AU4A 4GOPB 4IOAA 3CPFA 3C1FA 2OEOA 1NSNS 2MP1A 5J17A 1PH7A 4JX1C 3E6ZX 4OIJA 1Q82C 1OXSC 1BCPC 4L6TB 1V97A 2LRWA 2RQXA 2K8BA 4IJLA 4RF1A 4MTNA 3GE3C 5C4HA 2R7ZG 2A6HC 1BKBA 2AEHA 1O7ZA 5J2RA 4TKOB 3S2DH 3MEHA 4YSZB 2K1FA 2WHIA 1OXXK 5C5MA 2M19A 5CR3A 4GN5A 4UPAA 3TRZA 3TP6A 3C8YA 2EYHA 5BN5A 1N60A 1OQQA 1PRTF 1U4LA 2L5TA 1Q81C 1RHPA 3ML9A 2F0LA 1HFNA 1ILQA 2EIFA 4A3GB 4A3PA 2E2DC 4JI0L 1R4MI 3T3NA 2CKHB 1JC7A 2Y3AA 5JHAA 1E8XA 3LWEA 1A63A 2F0JA 3IFTA 5LLIA 4GKKQ 1EY0A 5M5YH 1Q1BA 2NVXH 2RKSA 3UIPB 4A9AA 4XTCS 3ONAB 5FK9C 5KNCA 3EN2A 2ZJRA 4EFOA 3DVNU 1PXUA 5D7GA 2PMZE 5TSSA 2JA5G 3HOWB 2IO0B 4W9JA 1RDPD 4C00A 3WOFA 4DV3Q 2PZWA 1WGYA 2IW3A 1I3QH 5IYCH 1KABA 1ENCA 1EIYB 1NI3A 3NBHA 4IKGA 3VTWA 3SK8A 3HOUH 2IO1B 4KKJA 5EE3A 1YNJC 4P73A 1J5EQ 2DX5B 3NS8A 4FLHA 1QT9A 2B2YA 1SYGA 2L8JA 4HPMB 4DV6Q 4WAAA 1V1PA 1JB3A 4ID6A 1G8ZD 2IYDB 5JEAJ 4PS8A 1DOKA 1YHQA 3VDZA 3K0XA 1YOVB 3KW5B 4IW0A 1S4ZA 5IP9H 2DHZA 4RM8A 3U9SA 3U9OA 2R93H 1DOIA 3VXWA 3KUDB 4OWXB 1LGRA 1Y8RC 4BKGA 5KRUA 1WTPA 3E0EA 5FJ8H 2AL6A 1LTBD 2KN5A 1UELA 1F2ZA 2KT7A 2N1VA 5EDSA 1Z7TA 3V62A 1B4OA 5IOCA 4DHJB 5KNDA 1TZ1A 2Y5CA 1S3OA 1RTNA 1W6JA 2DAFA 2NYZD 1NE3A 3CQZB 4POGA 1N32L 3PS6A 2DZIA 3A4SC 1HTQA 2L11A 4BBRG 1SR3A 2K32A 5M9OA 1K0RA 4YY3L 1N9WA 4Y7NH 1SB3C 1MHWC 4DR5L 3TEZA 2GBRA 1C4PA 2GBJA 5IYCG 4OZCA 5BYRA 3K5MA 1SYDA 2TSSA 3OOCA 4XYQA 5DAUA 1STEA 2JU6X 1EY4A 4OWTB 4MGZE 4X65Q 2F4VQ 3T3OA 3Q23A 2K5PA 3AYHB 4LW1A 2FIDA 4DR3Q 1KTKA 3T1HL 5C44B 3A7AB 1H9RA 2KQSA 1SMYC 4EVOA 1B1ZA 1WYGA 3JVZX 4C4VA 1XEEA 1CMXB 2M17A 4ACFA 3I70A 1O78A 2EJMA 3KFUA 3M4OH 2LHDA 1B9RA 4KMUC 1EZ8A 4A3FH 2WXQA 4FF1A 5C4ZA 2J0JA 3AE8B 1RFAA 2EDGA 1CKMA 2F0OA 2QILA 3ZTDA 4XDDA 4LFAQ 1WTRA 2RPVA 5C4XH 3KQ4A 3ECIA 2N3SA 2V3SA 1TR5A 4IUUA 2Y0SE 3DBHB 1XPUA 2KMMA 1UZXB 4X57B 1I4PA 4XIGS 4PZ7A 2N55A 2V4DA 3IL8A 5AUKA 4ZDVA 2XWBB 1L1OC 2ZXOA 3CCSA 3T8MA 3IT4B 3M7GA 2FIFA 1E0ZA 2F3IA 2WAQG 4HK2A 4HXDA 4GKKL 4ICVA 2B2TA 5E6OA 4KHZA 2MQJA 4JI5Q 3C3LA 3RCZA 3DEOA 4A76A 3HOZB 5C0XG 5J18A 2WB1B 1MGSA 3MWYW 4TVAB 5C5LA 1TWGH 4Y7NB 3W1SC 4HVBA 1IXRA 3QQ8B 4NQKE 3GTQB 1IP9A 1Y1WG 3DBSA 4LF8L 4UP9A 1GUSA 1HPCA 1TS3A 3CPWA 1I94Q 1HNXL 4AIMA 3J80i 4KJNA 4KN4C 3ZJYC 2OTLA 1HA6A 1OTRB 4PZ8A 1U0LA 2CHWA 3BJUA 5LMNW 4LDTD 4PYZA 4FXGC 1VS0A 1HQMC 2D2QA 4TKNA 2KOLA 1SSOA 1VQCA 2PQAB 1QNKA 3MFYA 3BU2A 3TS0A 2KCTA 1VQ8A 4OW0A 2QDFA 2UYZB 2QF7A 2ZTDA 1S72A 4Q0FA 4R4IA 2E2HB 1L4DB 1S3SG 1WYWB 1YJJA 2BGFA 2N7DA 1E10A 1BUVT 1WJJA 3IT6B 1QVGA 2N7EA 2A74C 1R4NB 1R7SA 3NY5A 3ZJUA 1A62A 1YZ6A 3PSIA 2DYBA 4HKZE 2B76B 4BY7H 3EC8A 3WIMA 4FA6A 2NZ1D 2IHEA 2NBUA 3CD6A 2WXFA 3UDIA 3JSVA 2A69D 4PZ6A 3PUVA 1F9SA 2Z0SA 2DYOA 2BTEA 2K5NA 4GDLB 3DBLB 4Y52H 2J0MA 3UF8A 1PFSA 3KLSX 1BR9A 4RHSA 5IYDG 1C78A 3H0GB 3OWFA 4ZRKA 1AN8A 4C3HB 3GOEA 4A3OA 4V190 1E1TA 2GRIA 4IUPA 1X54A 2UUBL 3NTIA 3AE3B 1EUJA 1V80A 1WWTA 2R6GA 1PGXA 4DV1L 2O5IC 1MG8A 2KVZA 2C5LC 5C44G 3MXUA 2R92H 2J4XA 3S1MH 5JEAH 3GTOB 2IX1A 3CCJA 2QEJC 1HR0Q 5GAHC 1XD3B 2HTME 2FCSA 1CZPA 2LXCA 1CSPA 2D2CC 5IIFA 3C2PA 2MRPA 5I9OA 5K36G 4B6WA 1H9KA 5CX3A 5HHDG 3J7YW 1PRTD 4KY5A 3SEBA 5IGCA 3ZO5B 2K22A 1K83H 3SR6A 3PF4A 4NAMA 5KNBA 2BE5C 4B0MA 3WAMA 1NY4A 5GMVA 5COYA 4DV5Q 1VCBA 2LVQA 1EQVA 2X6GA 1WI5A 2PZUA 5EBDA 5DEHA 4CGYB 3DQVA 1QVFA 2B63G 5M3MG 3HOYG 4HIKA 2JPHA 2J7QB 4R8IA 3HVZA 3IXSA 1DOXA 1GJXA 3HRZC 3MXGA 2H1EA 4CYEA 3D4DA 4B3SL 3ZRCA 1ONLA 2NCNA 3T1YQ 2KN4A 2H4OA 5FR6A 2KECA 4K0KL 2I2YA 4NNJB 3U2SC 1LXDA 1GC7A 4FULA 1QVCA 3BDLA 3CSFA 4GLSC 3GTKH 3FKYA 2X6LA 3R3MA 3VUXA 2N49A 1G51A 3TZDA 1YMHE 3NTHA 2JA8H 3KUPA 1PH3A 4LFCL 1UWVA 1CK1A 1VQEA 3A9KB 2LEKA 2E5LQ 1YN4A 3AECB 3DVGY 4A3DB 5IGDA 1QQRA 1VDZA 2CQAA 2BH8A 4OELB 2BYVE 2NVTH 4C3IG 1D4BA 3FC4A 5CHFA 4LTUA 4TQUS 2IPKD 2AWOA 3ZTCA 4TMAB 3Q8BA 4JI3Q 3UI2A 2I38A 4DK5A 1YN3A 1GUWA 1YJ1A 3Q69A 3L2PA 1C0AA 2ALYB 4EQOA 5F2DA 1H8CA 4MM3B 1LACA 4A3BG 5C0XJ 2OQ0A 4JI4Q 1MPEA 1IBKL 4PMWA 4HEA1 2WP9B 4QUFA 1L2FA 1XTCD 1CZWA 3NELA 1J7AA 4AWJA 3VYRA 2KTRB 4OIKA 4G7ZC 1SIFA 1VQLA 2ZJPA 2M8SA 1NAPA 3RLNA 2XRSD 3FDTA 3V2TA 3OTOL 3ICEA 1JJGA 2KFJA 3S1QH 3L0OA 3S1NH 4EQPA 3CMAA 1H4RA 4PQXA 2QMTA 4ZYNA 1V6EA 4XX5A 4WJNA 2CH4W 1QKZA 1CA5A 2RVLA 1WXMA 3U30A 1FIQA 3T51B 2VZKB 4JI6L 2LMCB 1EYGA 2W82A 1D8LA 1EYCA 4R4OA 1JJCB 1DM0B 3RFZB 2WP8J 5FO7B 3D6CA 2CJNA 5ELBA 5IE8A 3A1QA 4JI7Q 2V4IB 2D3AA 2CJOA 4RKLA 4B3TQ 4X3UA 4E71A 1WGKA 1A0IA 2KDFB 1K9MC 4UDUC 3NVVA 2KCNA 4WRDA 1Y8OB 2K5VA 4GGQA 2F0UA 3I73A 2M0AA 4HROA 4XZ4A 3U4VA 1SEBD 2N9PC 2F0VA 1B44D 1Q1OA 3R7QA 2R7FA 1QLBB 2D9UA 2VH1A 1EEID 1UUPA 4LMQD 1ET9A 1XMQL 3NK9A 1KHIA 3B9JA 1T6BX 3WWVA 4POFA 5DM63 4A3JB 2L7RA 2WWZA 4NPNA 4US9A 4P74A 5BYSA 4C2MH 2RSUA 2B8GA 4OL7A 5JPMC 3RN2A 3LXFA 4MGIE 3Q3NC 3BINA 2E2IB 1Z5SB 3N3KB 4A3LG 3HP3A 1DZ1A 5M5XB 2CU3A 4MEMA 2DNFA 3PO0A 4E6IA 2NZHA 3SGIA 4BA2I 4NB3A 3SDZA 1VQ5A 4NZLB 4L1BA 4RCOA 1FD7D 2YLMA 3OIPA 3Q24A 2BT6A 1G6JA 4P72A 1PRTC 1N6ZA 1JOQA 4Q5VA 2F52A 1WSPA 1KDBA 4JYAQ 1KAAA 3I8ZA 1ICWA 4X62Q 1SE9A 3AFQA 1STYA 2KTRA 4P71A 2IY0B 4RM9A 2B29A 2D3BA 3OMCA 4K5VA 3V96A 2MCNB 4L8JA 3ZIMA 2ZTCA 5LXHA 2K5QA 4KX6B 2CFMA 3DWAA 3FPUB 2I5MX 4LF4L 3LDZE 1LTAD 1SE2A 4FXDA 4HMJA 2K6QA 1N63A 1UF0A 1STGA 1HHVA 3OJ4B 4OEMB 3TSSA 2KLCA 1WZ0A 1WFYA 4CDFC 1YI2A 2JVCA 2BOSA 5EPKA 2ZTEA 1UNSA 4X3TA 1FJGQ 2ZCCA 4EGVA 2SNMA 3JAMc 2I5LX 1KF6B 1TU2B 3H0GH 1N5WA 2JE6I 2PNHA 4MACA 1S5DD 1WTOA 2Z9HA 1FXIA 4DV0L 1I4HA 5FLXc 1Y1WH 4DUYQ 3GTPB 4BBRB 4DK0A 1L5PA 4KIKB 4A3KB 4GLXA 1ZXTA 3Q8CA 1ZDVA 4X66Q 2AL3A 2KX3A 1SNCA 4A6QA 3AE2B 1SE8A 5LMNL 2DJFC 4C3JH 3O65B 4RGOS 2I5HA 1G6ZA 2IHFA 3MHZA 4JI5L 4NY0A 4E3CA 1TXYA 3PVLA 4FJYA 2BS2B 3U52E 2HTHA 3OW7A 5DLQE 1K52A 1A3UA 2GVBA 3DWQA 1NI2A 1NR2A 3P4QB 4NJCA 4B3RL 3IG3A 3H91A 2H5XA 2JQOA 2L0CA 2RCFA 5IGEA 2GI9A 1B50A 5EKLA 1T3QA 1K8GA 4TQ0A 2JRIB 4PS3A 3RD2A 5BMGA 1E7ZA 2O6VA 4FXKC 3TBIB 1XCQL 1ROEA 2JYOA 3H09A 5I4DA 3I4OA 5IP7G 1YIJA 3PO3B 1STNA 2BA1A 2A69C 2NTSA 3HOUB 3W5VB 3RI7C 1XQQA 1KIXA 1IKMA 3DVGX 1LFDA 2D0PA 2K5DA 2IJ0A 3K0YA 2AUJD 4HEDA 3ULLA 2WXNA 1PFBA 1FNWA 5M3FH 4DKAC 1RWSA 3A8IE 3W3AA 5C3EH 3M3YH 1I7HA 3KLSA 1IYFA 4ILWA 3CXCA 3WANA 1SJED 1F2RC 1SNQA 5H1SE 1Q46A 1DGSA 1NYRA 2J42A 3BVZA 3HOYH 3R66C 4N8X1 2F0SA 2NN6H 2RDHA 1IL2A 3MJ5A 1O7IA 3QHTA 2B2UC 3PO3G 1ZYRD 3MC0B 4HJKA 3KYDD 3F1ZA 2HJ8A 2M9VA 2PEAA 3K57A 4WWOA 4DDGD 1L1OA 2MJ8A 1KL9A 2JA9A 3H94A 2JZZA 5G3LD 2XSCA 4IWQA 4LJOB 4DXAB 2LWPA 5ELNA 5T1IA 1NJIC 4GNXC 5FJ8G 5EQ0A 4GDLA 2FUHB 1QILA 2AQ3B 2KHSA 4S17A 1WR1A 2VQEQ 1PMRA 1RTOA 1WR6E 4N59A 2K6AA 1DJRD 5I6YA 3TIXA 2GVAA 5I9PA 4A3LH 2L32A 4OGQC 1EUVB 2UU9Q 4LNKA 4CJ1B 4A3EG 5BN3A 1WTVA 4W9EA 1YNJD 4PV1C 1PFNA 4L5SA 3S17H 4B3RQ 1TT5B 1BBWA 3KJPA 1YNXA 2K8HA 2KOXA 2D62A 5D3DA 4ZQ3A 2W55A 1WVLA 2ID0A 2BS4B 2KC2A 3VH4B 1N34L 1W3SA 1IW7C 3T13A 4A3JH 3BY4B 3E56A 1SMXA 2WS3B 1L0XB 1Y69U 1J7BA 3NTKA 3W5UB 3MXNA 1U4PA 3NXWA 3GTGH 4R1JA 5ELFA 1RIPA 3GP7A 5T8IA 4QJFA 2ONQA 4WJ4A 4DNRB 1VQBA 2L15A 4AH6A 1LLRD 2DN8A 4DR1Q 1VZ7A 3JAMi 3J81E 3I4NH 4EEWA 4LUOA 1GPXA 4KDIC 2IY1B 1P7FA 4IZ8A 4HJ9A 3GB1A 4HDOA 4IUVA 3X0WA 5LMUQ 2YVCA 2MSED 1Q8KA 4YXDB 2V0GA 1C48A 2TMPA 2IL8A 1E9MA 3A9KA 1WTHA 4JOIC 1F52A 4DR1L 1C3TA 3LWUA 1YN5A 2KTFA 1JE4A 1V9PA 2ZXRA 3GO5A 5CV6A 4QGUA 2VQFQ 1CHPD 4AQYL 3LGJA 3PO2H 3S14H 2ASQA 2BKRB 2BWES 2MLBA 2ACZB 1M90C 4JI0Q 1E90A 5I2YA 1TWGB 3QA8A 3RNAC 1VQGA 2HQEA 4KV6A 2D5GA 3K8AA 4K7WA 4H0LC 5CMDA 1CJEA 2ZNVB 3QIJA 4YWGG 4RG1A 2MQHA 1WZ3A 2O2VB 5L37A 4A3MH 5FO8B 4DR6L 3EUB2 2KO3A 1XLQA 3H8HA 1N61A 1SLJA 2N4FA 2WB1E 1PTOF 2B2WA 2DNCA 1WTXA 2M1MA 3CCLA 4UHVA 3JAML 1SIJA 1WXAA 2L05A 2WDTB 1V5OA 1HZCA 3NENA 3PF5A 2X8XX 2WDQB 2KWUB 3L08A 4FF2A 4WQMA 2RHQB 2VZAA 4N8FA 1M94A 4EZKA 1TKWB 2EJGC 1X9NA 1DGJA 1OQYA 2RGFA 4NW2A 3AI5A 1TS4A 2ATWA 2MBHA 4KD3A 3A74A 4IFDG 2YTVA 3S24A 3AU5A 2C60A 2F0GA 3DWGC 2UXBL 4WORA 1EY8A 1X3GA 5NUCA 1T0YA 2LGXA 3RMKC 4KVGB 2IT1A 4ZHPA 3OYYA 2HCIA 2Q2IA 5C3EG 3OJ3A 1N33Q 1P1AA 2K50A 2QCPX 1HNXQ 2Z0DB 4QIWE 3WAOA 4TV3A 1JW9D 2BWFA 1EQQA 3VH3B 1FD6A 1NBWA 1UEBA 4LUZA 3U7DA 4BFRA 2WXPA 3A1QB 1TWAH 2LGDA 3A0JA 3MHBA 2M56B 2N9KA 5EKIA 1P9DU 2Y0SG 4LFCQ 4IPHA 2PMZB 1YQ4B 1X1MA 1T0RC 2BQQA 3AULA 3TMEA 3J7AV 3QJYA 4RHRA 2ICEC 3CQZH 3KF6B 1SF0A 2XNAC 3UDXA 2DAJA 3GZNB 1Y1VG 4MSQB 3FKIB 5CBAE 4DV6L 4CKEA 1PA6A 3VYUA 1BUIC 1VQIA 3NQTA 2OCEA 3I63C 2CS4A 4B3SQ 1IYUA 2NN6I 4G11A 4PYUA 1TVXA 1I6VC 4M0WB 4KJOA 4LWCA 4EKUA 4YTNB 4QCLA 2PQEA 4KKIA 2N78A 4DV3L 2XN9C 3MJWA 2A6ED 1SDFA 1KDAA 3WAPA 2B3GA 2A68D 3QR8A 1IZ6A 4K3CA 4DV5L 2QHOA 3KLRA 5IYBH 3TZUA 3GTMB 5CC4A 3NUCA 2AUKA 4RGTA 3SXHA 3H15A 3PO2B 3NHEB 2NVTB 2INPE 3V60A 2OTJA 1TWHH 2X69A 3VR5A 5C4JH 3FRPB 5IP9G 3EA6A 3PT2B 4QF4A 3TBLD 1VLBA 2MGSA 2FMCA 1SE3A 3S16B 3C0RB 4LK1C 1P7EA 4C1NK 1D5XC 2EY1A 2PQAA 3L3OC 2FE8A 1GJZA 1HR0L 3G48A 3M95A 4QB4A 4K3BA 2QGQA 2N88A 5AZHA 1VQNA 2LHEA 1I6HH 3U58A 2A5HA 3QK0A 1V86A 3FPPA 2RDBC 3UINB 3TP5A 2IO2B 1KLVA 4IO9A 1G2TA 1M4VA 1OO9B 4ANVA 4DPGA 1K83B 3VDYA 3NJTA 4A93G 3PO2G 2M2LA 1MJCA 4RFBA 2INNE 3VQIA 2L3ZA 1H9SB 1Y8PB 1ILPA 4DA2A 1XJVA 1ET6A 3TP7A 3L13A 4DDID 1JALA 4A3IB 1B70B 3TP8A 5C23A 3MVVA 3U4ZA 4CDCC 4A75A 1IHZA 4DR6Q 2OJWA 3I57A 4WAFA 3OHXC 4A3EB 4K0KQ 2YTXA 3S1NB 3T1YL 1D1KA 3AEFB 4PK1A 2L83A 3IAYA 3CCMA 2O6VD 4J8QA 1YBYA 4DU9A 3W1YA 4JPBW 1F0ZA 2PO4A 4KSLC 2WXRA 2QKIC 3KF6A 2CVRA 1PTOD 3GTPH 4QMGA 3HOZH 2V4LA 1TWAB 5EAYA 2NN6G 1VJKA 4DR4Q 1TY2A 1P8LA 4ANXA 5BN4A 1WTQA 1TJEA 3KLWA 3P75A 4GLVB 2PIAA 3DHHC 5CV9A 5LNK1 3AFPA 4JL9A 4XT1B 4GZYC 1CKOA 2N9XA 3PUZA 2M0XA 5E3FA 5IGFA 1WJUA 2R92G 2WXJA 4DXGA 2HDLA 3QCAA 1RFKA 3A4RA 3K6OA 3SR1A 3MFGA 3I72A 1LYLA 1S5ED 3D0FA 1ISNA 2J0KA 2IX3A 1PFMA 1O7YA 1ZDXA 4DUYL 4QQBX 2VNUD 3MTNB 4MJSB 3N1YC 2F0NA 2CQOA 3QB3A 3HOWH 1J6QA 4ULLA 4JC0A 1Q3LA 2JA6H 2EY5A 3HOVG 4L63B 5JOBA 4C3HH 3AE4B 4S0RA 4YSYB 3FHWA 3AU7A 5JH5C 2K75A 2UUBQ 2WYQA 1NMFA 3HRDD 3NBIA 3S1RB 1F77A 5C4JB 3NBHB 2WGSA 1EYAA 1D5ZC 1G2SA 3K7AH 3W1GA 3GTJB 4JI6Q 4OZBA 2B2WC 1VQPA 1WJ4A 1WI0A 4OZAA 1RAXA 4DUZQ 3SD5A 3DBLI 4HIOA 4JG2A 1E6EB 4R4QA 1VZ6A 1ZOYB 3MHSD 3WA0A 3QAQA 4X62L 3PIP3 1N36Q 4JI4L 2W54A 2AKWB 1YX5B 3TJPA 3P1HA 3Q3JA 1VDVA 1BO0A 4UY8C 4ARCA 4BXXG 5IYBG 4C3JG 5M5YB 1HEZE 3M3JA 3RN9C 1D5MC 2F3VA 1UEAB 3PCOB 3T1HQ 1OQRA 3PHWB 3X3MA 4JOIA 4U68A 3R93A 2DLBA 2I0QA 3KYCD 4ANWA 1XLPA 4II2B 4CBVA 1E7VA 3OW2A 4J6IA 3VUWA 1JQ4A 2BH2A 1RCVD 2HUGA 4FHKA 1A5RA 3Q0AA 4IM0A 1IBXA 3V6CB 3HOZG 3BZKA 2NBWB 4WFN3 3PQIA 1J19A 1X3FA 1C4CA 4IG7B 2PCFB 4APVA 3QWZB 5EE9A 4BBRH 3ZNID 5E4WC 4K14A 1QNUA 3Q22A 4X64L 3BZCA 1K3RA 1SRUA 3AE5B 2KEEA 2RDGA 3IRBA 1KXLA 2EXZA 1YD8U 1A3TA 4ZHOA 2I1KA 3G6JB 3BDOA 3I90A 5FLXE 2K5HA 1YVCA 3R2TA 3ZUNA 5AFWA 1VQHA 1FFUA 4DAPA 5IN7A 5IWAQ 3PLUA 1PZID 3TEHB 1DCZA 2K3UA 5J3BA 2MBBB 3K58A 5C4XG 4JBMA 2WU2B 3BVGA 4HCNB 4A90A 2LGYA 4FXCA 3AMZA 4GXBA 2JXMB 2PE6B 3GQBA 3P4PB 1GUNA 2MO1A 1EIHA 4YL8A 5C4XB 4IWOA 1SYBA 2MFIA 4NQLB 1H95A 4B9WA 4A3IG 1J5EL 3IAM1 3QC8B 3T4AC 2KAJA 2PJHA 3EFXD 2YV5A 4L5QA 1TWFH 5LL6S 1PH1A 2PVOD 1PTOH 3KWLA 4Q2JA 1SYFA 3ZVVA 1EWIA 4RKBA 2CHZA 3J9CA 3RNFC 2MPMA 2FNJB 4KGTA 4J3OD 3M9BA 1V1OA 4M01A 3ZNHB 1BVSA 1YQ3B 4DR2L 3WOEA 3VRBB 4C7ZA 3HFZB 3KYHC 2FINB 1WMHB 3SK4A 3S16H 5J1ZA 3PGEA 2G3QB 3Q8FA 4AP4C 2NBFA 3NSWA 5MPOA 1E8ZA 4A3CG 4AJYB 2BBCA 4DR4L 2L0TA 1K28A 5CV4A 2K14A 2KHWB 1LT4D 2B2VC 3CMEA 3LJ3A 4DR5Q 5ELOA 4TRDA 3BIID 2EOTA 1IPGA 3P1MA 4A8XC 1Y1WB 4BOSC 1Q12A 2V1CC 4DK6C 3DPDA 4WJOA 3I3TB 2WB1G 2WKDA 1N32Q 3VR4A
chains in the Genus database with same CATH topology
3SE0A 1ZUD2 3HOXB 4LK0M 1PUTA 2NWGA 3CIRB 3V3XA 3CWIA 1TKYA 4ZYSA 3C46A 3AE9B 4ODGA 2EJFC 1GB1A 3HOYB 3K5OA 1S5CD 1W6KA 1RF2D 1BCPF 2JZPA 2XRQD 4JBWA 1T5EA 3MAQA 4WURA 3AEGB 2FFKB 1LV9A 4ZAIA 2WXGA 1F2MA 4KTAA 1AYFA 1DXMA 1ENAA 4KK7A 4A3FB 3LNNA 4BS9A 2Z4HA 3D6WA 3X3NA 4IOIE 2F4IA 1GB4A 1LABA 1CI3M 3KBGA 4YIJA 1Y8NB 2L1BA 2R92B 1FRRA 1PZJD 5D14A 2BS3B 1SMYD 1JWUD 1EL0A 5IGGA 1NVID 4KGRA 1V43A 3NVZA 2O2LD 3K5LA 2RSOA 1LT5D 2F0QA 4ZOHC 2PTLA 4B9XA 3NQIA 3AE1B 1PRTB 2LS01 5EPJA 2EYOA 4DQOC 5I6WA 1DOMA 1V1PB 3F2UA 4J1MA 3RPFC 1AW7A 1TIID 3NHHA 3MXPA 4N9PA 2AQ1B 2K33A 3CKIB 5H8YE 4KD4A 1FCCC 4FP5D 3MP9A 1QJOA 3I91A 2IGGA 1FFVA 1AFPA 1DYQA 2PPBC 4K6DA 4RCNA 2WACA 5BMHA 2AX5A 3P63A 2H89B 2A68C 1V8QA 3N6RA 1MSHA 1OXTA 1IKLA 3HKZB 4H7BA 5JXVA 4LJZC 1VMPA 4XQQA 2WXHA 5C3WA 1RJTA 2RDFA 3BYTB 3IKJA 1JRPA 2O4XA 1EOTA 1JROA 2MHVA 3M7NA 1HQRD 2PW5A 1NR4A 1QWYA 1PFDA 2JSVX 2AWNA 3D4WA 2NB0A 5JVG3 2LKVA 1KLUD 1WXQA 4F8MA 3M4OB 2KQ3A 4DAYA 1Z6HA 4Z9CB 4ITKA 3A8JE 4C2MB 3NZ3A 1S5BD 3NRZA 1XXGA 2F3WA 4ME5A 1BMLC 3E5SA 3E0JA 2EYFA 5A2QE 4ZKCB 2E76C 4ZLTF 1I4QA 1XLOA 1S5FD 4NMZA 4FVMA 4R8NA 1PZKD 2LFIA 1KH0A 4FYDA 3GS2A 3WCQA 1UWMA 1GUGA 4HTHA 2K7VA 1F2YA 2F0PA 3DXJC 3HEJA 1N5XA 5J39A 4ZUJA 1IGCA 2M00A 1HRJA 4PNYA 1G291 3AH7A 3ITPA 1EWCA 2YEPF 1M8AA 4CHTB 3OPOA 1ZXIA 3LYYA 5HG2A 3FMCA 5A2QL 2VZKD 1AP0A 3VR2A 1VCIA 1K50A 4PMBA 5DNFA 1ZPSA 3T56B 3ETRA 4HCSA 1CTMA 1O80A 1STBA 5ELDA 4IQZA 1PLFA 4OO1H 4KN7C 2WQYB 1FEHA 4IUQA 1BQQT 2BB5A 1T5XD 1QG7A 4C7YA 3L7ZC 4HSPA 1SYEA 3ERQA 3QOJA 3OSOA 1FR3A 2KUMA 1Z47A 4C80A 2WXMA 1EZ6A 3PV0A 1HUMA 2JSOA 3TEWA 3NPPA 4XWWA 1LTID 2EYMA 3ZGZA 1ZP0B 3PUWA 1WCMB 2B8FA 2EY2A 3DEPA 4U673 1K51A 3NVWA 2VB3X 1ZE3D 2EE1A 4HN7A 2JEAI 5CORA 2B2UA 4F7XA 2Q8RE 2GA4B 1EY7A 2JX5A 1FNVA 1CHQD 3ZQ4A 2L52A 3RZDB 1QF6A 1LTRD 4O1NA 2VUMB 3ZJVA 2JA5B 5E4XA 5JVH3 4XDCA 1KNAA 2DY7A 1NYQA 1QOAA 1E2ZA 4JE3B 4UAIA 4ZUIA 2K04A 1EFID 2IGDA 1FGBD 1I4XA 2N9LA 2O5JC 4FF3A 3FVQA 2B2TC 5G5GA 4K6LA 5EBCA 3S1QB 2AQ2B 5HURA 2JYTA 1JORA 1A3VA 1IGDA 5KGUA 1XX8A 5H92C 1QE6A 4REZA 1QB5D 4R9WA 4IFDJ 1X3QA 2Y0SB 1K8MA 3GTKB 3VR6A 1JWAD 4KGSA 1NEKB 5E6JA 1MD2D 4LLGM 2MUYA 1BBXC 5T1GA 2CHBD 2I46A 3D3RA 4NP5A 3HGBA 1IUEA 2EKIA 3NE5B 3P7JA 3DWPA 3VA5A 1JWSD 5KEEA 2F0FA 3CU7A 3BDCA 3OIQA 4TSSA 3O13A 2E3TA 5FLXL 3KBXA 2JP1A 4XE0A 1SJHD 1Q10A 4WJWA 1FCLA 1L0YB 2PZTA 3G7LA 1UAPA 3D4RA 3DWMA 1QCBD 4HMIA 2Z8LA 5EJWA 4K5XA 1MI0A 1JCKB 4G7HC 4LAAA 5CYUA 2VB2X 1Q8IA 4DNTB 4MH8A 3ABVB 3AEDB 3DUZA 2ZXPA 4YT0B 1I50B 3CHBD 1C79A 1MHHE 2B2YC 2SOBA 3P20A 3QG1A 2GB1A 3N9YC 1JOKA 1B9MA 1OXUA 3FAHA 4K2KA 3PUXA 1LT6D 3A55A 4IFDH 3DHQA 3ZJTA 2WDVB 3BWUD 2WDRB 4JWSC 4N58A 1JQYD 1VF7A 1QOFA 1FO4A 1HTPA 2KJXA 4HSVA 4RA8A 1QOBA 1F9QA 4M0WA 4ARIA 5EPLA 2ON8A 1HZ6A 2DBYA 4DF7A 4F87A 1K8OA 1HUNA 4ZRQA 2V3NA 3SHLA 1A70A 2W3RA 1CA6A 2SEBD 3J80E 2WKCA 1FMAD 4DFAA 2FMMA 3U7ZA 3I4LA 3N52A 3Q6SA 2YEPB 4PT5A 1GHJA 1RD9D 3ND8A 3HZXA 4TQ1A 2IWHA 4DAVA 2CW0D 1HTLD 2EYLA 2MEKA 3TUOA 5JEAG 4BBSB 2FJ2A 1AWDA 3R2IA 3W2DA 2QDBA 2J52A 2PVGC 4NAWB 4ZRZA 1MI2A 4H2AA 5C3EB 1ZEQX 2VXWA 3VR8B 1QOGA 5FR3A 2K28A 3SK5A 3K7AB 4RAUC 5EE0A 1B3AA 1EM7A 3IFDA 1IYVA 1DONA 4HKQA 1IL8A 1ZXHA 2JA6B 4US8A 3H3VC 4HR7B 4ZKBB 1B53A 2ICIA 4HCEA 4OHJA 3QWNA 3EJIA 1F9PA 3BK1A 1HZ5A 5LL6X 2KEDA 2NUCA 3DM1A 2NTTA 5C0XH 2WLBA 2BCOA 2J7ZA 3BVMA 4CKCA 2RA4A 2B63B 1ML0D 4DXFA 1YJIA 1BCPB 4IALA 3PIO3 1XO3A 3S15B 2V3PA 5C3JB 2QIEB 1CQFA 5C6AA 1BDOA 1SYCA 1ENFA 1X3PA 3AEEB 3I4NB 4XDXA 2F0WA 2C9OA 2E6XA 4H13C 2OEDA 2NVYB 1CFMA 1L6VA 2PW7A 3A54A 3RZOB 2D5DA 2EYJA 2PW9A 1C4AA 3GTLB 2PMVA 3KWVA 5G5HA 2L12A 1JWMD 4C3HG 3PZ8A 3C1EA 5JPNC 1U9RA 1DD2A 1NCVA 3OMGA 2F0EA 1TKGA 5JAVA 3S2HB 3BYYB 2QJLA 4P2CB 2A6HD 4N9TA 3EVQA 3L4PA 4YTMB 5IGBA 3SFDB 1XLNA 1C8CA 2NVQB 2L4NA 1C9FA 1QOHA 1DOLA 1GAQB 3PUYA 4RNAA 1V8CA 2E74C 1VF5C 2WXIA 3T16A 3W9CB 3T53B 5FKAC 4G7OC 1F2LA 3RD4A 3ND9A 3Q8AA 3URYA 2OF1A 2B2VA 4MN3A 1LTGD 3J7AF 4XQNA 1EYDA 5CV8A 2OT2A 3HG9A 2Q5WD 4ZRPA 4XXEA 5I2XA 2PNRC 1F9RA 2J53A 3FEWX 4L23A 2HDMA 3TN2A 1TWFB 4IUNA 1E2WA 2FHTA 4C56C 3E9SA 2MJ3A 1BCPD 5DM73 2HDEA 4YSXB 4QIWB 2WXOA 3S14B 2JWUA 1FNUA 1PDQA 2FUG1 4RGNA 2F1MA 2PLPA 3AEBB 3J81L 2R7ZB 1LT3D 1RODA 2MJEA 3M3YB 1ZKOA 3VRAB 1TQOA 4OVZA 2EZVA 4AS1A 1SSNA 1C77A 1R4QB 2L55A 4G4KA 2W3SA 3AB5A 4MIUA 4RH6A 1D6EC 3JAME 4F88A 2K1BA 3MTSA 1GUTA 1I6HB 2BW2A 3P4RB 5ISRA 1HCZA 4C3IB 2Q8IB 4L2YA 1BF4A 2BDOA 5IT9E 3HVDA 2WNMA 3NWSA 3MZ5A 1H9JA 3S9WA 2OXPA 4MT5A 2IGHA 2SNSA 2K01A 2NMQA 4D2KA 2LUMA 3A7LA 1KFYB 2LJIA 3EROA 4DN4M 2JEBI 3FILA 5LHY1 1II3A 4A55A 2FBWB 1GXDC 1TZOA 5M5WB 1AEXA 3AB9A 1E0BA 3VR3A 2F0TA 2K03A 3V05A 3WDNA 1EWHA 2MJDA 3J80L 1CM9A 1Y1VB 2N7JA 3NS1A 3NWTA 5G3LF 2F0KA 1G91A 3HOVB 1ZYRC 3RLFA 1KDCA 1WTWA 1XWEA 2JQRB 2Q8TA 3UI3A 1SBBB 3R3OA 3RUZA 3TEXA 3EQLC 5JJZA 2EVBA 4A3MB 3AN1A 3AE6B 1TT2A 2LY7A 3A56A 1X32A 4HAEA 1XF5L 3P42A 3MA2B 4CJ2C 4NDXA 1JWBD 3AE7B 5C3XA 3CRLC 3K5NA 4IUTA 4RWSC 2N0SB 4RF0A 2WXKA 4G57A 4P6VF 2J0TD 1CT1D 2EYPA 2G9DA 2QSDA 1GHKA 1MBYA 2L9HA 1H9MA 4ABNA 4KY6A 3QO2A 5GXGB 1SNDA 3AV8A 2R61A 4OO1I 2KVMA 1C4QA 1J9OA 3B2GA 1DOYA 2KDMA 4EE2A 1YNND 1PDXA 3TDQA 5A35A 3HUIA 1SNPA 3M4YA 2XVSA 1CZGA 2RSNA 2LFNA 1OXVA 1KLGD 1L6UA 1OFFA 1VR9A 3BG3A 3HS0C 2E75C 1AZQA 1GUOA 1ACCA 1BOSA 3P4SB 3W1SA 3TEYA 4X3KA 3VR9B 1D1IA 2JA8B 1FYCA 4KKUA 4S3SA 4CJ0B 1MHXA 1TKEA 2CW0C 1TS2A 1BXTA 2BA0A 2C5CA 3L9AX 5EE1A 1EIGA 5C2TB 1HFGA 4BA1I 1WD0A 1PGAA 3PMFA 3SVMA 2WINB 4XWTA 1A2TA 1RYJA 1CQVA 1KRHA 2BYTA 4JPSA 5EKKA 2DY8A 2WIIB 5CBEE 1FRDA 3KK7A 3LB8C 3I4MB 4IN3A 4K8JA 2R93B 1EY6A 1PYWD 1NUCA 2EELA 2JXTA 3EGRA 1HXYD 3LX0A 1EY9A 4IURA 5EGTA 5K5PA 1ESRA 2XWJB 2SDFA 3SK6A 1B9NA 1EU4A 1J7CA 2KACA 3GTGB 1I4GA 1TS5A 5IT9L 4USAA 1O7LA 5KYIA 1WRIA 3IAS1 5C0XI 2L1AA 3VYTA 2I07B 4I65A 1A2UA 3RMHA 2KCCA 2DWQA 2KQ4X 4KI0A 3AMUA 4C3JB 2K9XA 1I3QB 5HFYA 1E2VA 1FXAA 2JA7B 3OWEB 4IDIA 1L0VB 3A8KE 4BWGB 4I7ZC 1TWCB 1VMCA 1UGJA 5HGTA 3U4EG 1BNZA 1XYIA 4GDKB 1PGBA 2EPBA 2ZW0A 4M1UB 4IFDI 4K5WA 3BS1A 2PKOA 3NUHB 1A6XA 5D65A 1JR0D 4ZK9B 2DYMA 3BZDB 4AYBB 2Z4IA 5IODA 4DGZA 1U4RA 5FOBB 4N6EB 3SFEB 1Q1EA 3CRKC 3M85A 1LTTD 2JYEA 3GD7A 1NENB 1F2RI 1R9TB 4M8AA 4AQ7A 4BY1B 5KIXA 1VRAB 4QUCA 4B0EA 2ZT9C 4J6HA 2YU9B 2K05A 2WXLA 3H6MA 1XCTL 1TY0A 4OO1G 1RKNA 1EWYC 2OHFA 3I3CA 5AUIA 4KKTA 1FM0D 4XT3B 4WIPA 5BYQA 3D31A 2K0PA 3ZYYX 1A15A 2KWDA 4NKLA 3B2FA 1JICA 1JOOA 1Q90A 2BDNA 1SNOA 3R8BA 1MSGA 4YTPB 3KF8A 2RMMA 4RGMA 2BE5D 4A93B 5FO9B 3AEAB 3S1MB 2XIWA 5HI1A 3K59A 5M3FB 2A73B 5KYLA 4X3SA 4K8IA 2K5WA 4HRSA 4R3DA 2ZW1A 4KHVA 3GV6A 4PMCA 4K2LA 2R3ZA 2MH7A 4JWUC 2G1EA 3QOLA 1TWHB 4C1NI 4EQNA 2E2JB 1U4MA 1IBXB 2LMCA 2RBMA 1I4RA 2KA7A 5CGKA 1SFOB 5E1FA 1K53A 5M3MB 3VA7A 1EU3A 2ENBA 3BK2A 3S2DB 2IX0A 5ELEA 1JMLA 1SAPA 1EQTA 3AM9A 4FO2A 5CV5A 3I9V1 3S17B 1RM6C 1EEFD 1D2BA 4BY7B 1SXTA 2Z1CA 4WH4A 1SNMA 2B39A 1SE4A 4A3BB 2F0HA 1L4ZB 2F0MA 1Y56A 4XQJA 4O42A 2Y5PA 4H44C 3NP8A 1PTOC 5BMIA 4B08A 3FILB 5ELCA 5K36H 5CV7A 2F03A 3DMUA 1EY5A 1STHA 3PZ7A 4HJGE 1IW7D 4CKBA 2IDYA 2G9HD 2WV6D 1B2TA 3Q8EA 4CQNA 4MHEA 4FNFA 1MVKA 2PYKA 4P16A 1C76A 1KNEA 1HA5A 4DK1A 1LTSD 1J8IA 3GV3A 2LGIA 1GOZA 1PTOB 5D3IB 1ESFA 4JK1C 1N62A 2BB6A 1YNTE 2DNEA 1UWXA 2F0IA 1WD1A 2SAKA 2HCCA 3VYSA 1TYGB 1LO5D 4KY7A 3D8GA 1R4PB 1YNNC 5J22A 2YYZA 2A6EC 1E7PB 1VZ8A 2X38A 4V0BA 2WAQB 4FF4A 3QIAA 4XYOA 1AZPA 1H9SA 1STAA 2F0DA 4KKSA 2EY6A 2H88B 3C1FA 2OEOA 1NSNS 2MP1A 4JX1C 3E6ZX 4OIJA 1OXSC 1BCPC 4L6TB 1V97A 2RQXA 4RF1A 5C4HA 2A6HC 1O7ZA 4TKOB 4YSZB 3MEHA 1OXXK 5C5MA 2M19A 5CR3A 3C8YA 3TP6A 2EYHA 5BN5A 1N60A 1OQQA 1PRTF 1U4LA 2L5TA 1RHPA 2F0LA 1HFNA 1ILQA 4A3GB 2E2DC 3T3NA 1JC7A 2Y3AA 3LWEA 2F0JA 3IFTA 1EY0A 1Q1BA 2RKSA 4A9AA 4XTCS 3ONAB 5FK9C 5KNCA 1PXUA 5D7GA 5TSSA 3HOWB 1RDPD 3WOFA 2PZWA 2IW3A 1KABA 1ENCA 1NI3A 3NBHA 4IKGA 3SK8A 5EE3A 4KKJA 1YNJC 1QT9A 2B2YA 1SYGA 1V1PA 1JB3A 4ID6A 1G8ZD 5JEAJ 1DOKA 1S4ZA 3U9SA 3U9OA 1DOIA 5KRUA 1WTPA 1LTBD 1F2ZA 1Z7TA 1B4OA 5IOCA 5KNDA 2Y5CA 1RTNA 1W6JA 2NYZD 3CQZB 2L11A 2K32A 5M9OA 1SB3C 3TEZA 1C4PA 4OZCA 5BYRA 3K5MA 1SYDA 2TSSA 3OOCA 4XYQA 5DAUA 1STEA 2JU6X 1EY4A 3T3OA 3Q23A 2K5PA 1KTKA 5C44B 3A7AB 1H9RA 1SMYC 4EVOA 1B1ZA 1WYGA 1XEEA 3I70A 1O78A 2EJMA 2LHDA 1B9RA 4KMUC 1EZ8A 2WXQA 4FF1A 5C4ZA 3AE8B 2EDGA 2F0OA 2QILA 4XDDA 1WTRA 2RPVA 3KQ4A 1TR5A 4IUUA 2KMMA 1I4PA 4XIGS 2N55A 2V4DA 3IL8A 5AUKA 2XWBB 2ZXOA 3IT4B 3M7GA 1E0ZA 2B2TA 4KHZA 3C3LA 3DEOA 3HOZB 5C0XG 2WB1B 1MGSA 3MWYW 5C5LA 4Y7NB 3GTQB 1GUSA 1HPCA 1TS3A 1HA6A 4KJNA 4KN4C 4FXGC 1HQMC 2KOLA 1SSOA 2NVXB 5M5YB 1QNKA 3MFYA 4OW0A 2QF7A 1YJJA 2E2HB 4Q0FA 1L4DB 1E10A 1BUVT 3IT6B 2A74C 1R7SA 3ZJUA 4HKZE 2B76B 2NZ1D 2WXFA 2A69D 3PUVA 1F9SA 2DYOA 2BTEA 4GDLB 3KLSX 1BR9A 4RHSA 1C78A 3H0GB 3OWFA 1AN8A 4C3HB 4V190 2GRIA 4IUPA 3NTIA 3AE3B 1WWTA 2R6GA 1PGXA 2O5IC 3MXUA 2J4XA 5JEAH 3GTOB 2IX1A 2QEJC 2HTME 1CZPA 2D2CC 5IIFA 3C2PA 5I9OA 5K36G 1H9KA 5HHDG 3J7YW 1PRTD 4KY5A 3SEBA 5IGCA 2K22A 3SR6A 4NAMA 5KNBA 2BE5C 4B0MA 5COYA 1EQVA 2X6GA 2PZUA 5EBDA 5DEHA 4CGYB 4R8IA 3HVZA 3IXSA 1DOXA 1GJXA 3HRZC 3MXGA 2H1EA 3D4DA 1ONLA 2KN4A 2H4OA 2KECA 2I2YA 3U2SC 3BDLA 4GLSC 2X6LA 3TZDA 1YMHE 3NTHA 3KUPA 1CK1A 3AECB 4WWMA 2LEKA 1YN4A 4A3DB 5IGDA 1QQRA 1VDZA 2CQAA 4C3IG 1D4BA 3FC4A 4LTUA 4TQUS 2IPKD 2AWOA 4TMAB 3Q8BA 3UI2A 2I38A 1YN3A 1GUWA 3Q69A 4EQOA 5F2DA 4MM3B 1LACA 5C0XJ 1MPEA 4PMWA 4HEA1 2WP9B 4QUFA 1XTCD 1CZWA 1J7AA 3VYRA 4OIKA 4G7ZC 1NAPA 2XRSD 3FDTA 3V2TA 4EQPA 4PQXA 2QMTA 1QKZA 1CA5A 2RVLA 1FIQA 3T51B 2VZKB 2LMCB 2W82A 1EYCA 1DM0B 3RFZB 2WP8J 5FO7B 3D6CA 2CJNA 5ELBA 2V4IB 2CJOA 4RKLA 4X3UA 1WGKA 4UDUC 3NVVA 2KCNA 4WRDA 1Y8OB 2F0UA 3I73A 2M0AA 4HROA 1SEBD 2F0VA 1B44D 1QLBB 2D9UA 1EEID 1UUPA 4LMQD 1ET9A 3NK9A 3B9JA 1T6BX 5DM63 4A3JB 4US9A 5BYSA 2B8GA 4OL7A 5JPMC 3LXFA 2E2IB 1DZ1A 3HP3A 2CU3A 5M5XB 3PO0A 4NZLB 4E6IA 4ZHPA 4BA2I 3SDZA 4L1BA 4RCOA 1FD7D 3OIPA 3Q24A 2BT6A 1PRTC 1JOQA 4Q5VA 1WSPA 1KDBA 1KAAA 3I8ZA 1ICWA 1STYA 3OMCA 4K5VA 3V96A 4L8JA 2K5QA 4KX6B 3DWAA 3FPUB 1LTAD 1SE2A 4FXDA 4HMJA 1N63A 1STGA 1HHVA 3TSSA 2BOSA 5EPKA 1UNSA 4X3TA 4EGVA 2SNMA 1KF6B 1TU2B 1N5WA 2JE6I 4MACA 1S5DD 1WTOA 1FXIA 1I4HA 3GTPB 4BBRB 4DK0A 1L5PA 4A3KB 1ZXTA 3Q8CA 1ZDVA 4A6QA 1SNCA 3AE2B 4RGOS 1G6ZA 3MHZA 3U52E 2BS2B 3OW7A 1K52A 1A3UA 3DWQA 1NR2A 3P4QB 4NJCA 3H91A 2L0CA 5IGEA 2GI9A 1B50A 5EKLA 1T3QA 4TQ0A 5BMGA 4FXKC 3TBIB 1XCQL 1ROEA 2JYOA 3H09A 5I4DA 3PO3B 1STNA 2BA1A 2A69C 2NTSA 3HOUB 3W5VB 1IKMA 2K5DA 2IJ0A 3K0YA 2AUJD 4HEDA 2WXNA 1PFBA 1FNWA 1RWSA 3A8IE 3W3AA 1I7HA 3KLSA 4ILWA 1SJED 1F2RC 1SNQA 1NYRA 2J42A 3BVZA 2F0SA 2NN6H 2RDHA 3MJ5A 2B2UC 1ZYRD 3MC0B 2M9VA 3K57A 2MJ8A 3H94A 5G3LD 2XSCA 5T1IA 5EQ0A 1QILA 2AQ3B 2KHSA 1PMRA 1RTOA 4N59A 2K6AA 1DJRD 5I6YA 5I9PA 2L32A 4OGQC 4CJ1B 5BN3A 1WTVA 1YNJD 4PV1C 1PFNA 2D62A 5D3DA 4ZQ3A 2W55A 1WVLA 2ID0A 2BS4B 1IW7C 3T13A 3E56A 2WS3B 1L0XB 1Y69U 1J7BA 3NTKA 3W5UB 3MXNA 1U4PA 3NXWA 5ELFA 5T8IA 3GP7A 2ONQA 4DNRB 1LLRD 2DN8A 1VZ7A 1GPXA 3J81E 1P7FA 4IZ8A 3GB1A 4IUVA 4YXDB 2V0GA 1C48A 2TMPA 2IL8A 1E9MA 3LWUA 1YN5A 1JE4A 2ZXRA 3GO5A 5CV6A 1CHPD 2ACZB 5I2YA 1TWGB 2HQEA 4KV6A 2D5GA 4H0LC 5CMDA 1CJEA 4YWGG 5FO8B 3H8HA 3EUB2 1XLQA 1N61A 1PTOF 2B2WA 2DNCA 1WTXA 3JAML 1SIJA 2WDQB 4FF2A 4WQMA 1TKWB 2EJGC 1DGJA 4NW2A 1TS4A 4KD3A 4IFDG 2F0GA 3DWGC 4WORA 1EY8A 5NUCA 2IT1A 2HCIA 2QCPX 1JW9D 1FD6A 2WXPA 3MHBA 2M56B 2N9KA 5EKIA 2PMZB 1YQ4B 3TMEA 3J7AV 3QJYA 4RHRA 2ICEC 1SF0A 2XNAC 3FKIB 5CBAE 4CKEA 1BUIC 3VYUA 3NQTA 1IYUA 2NN6I 1TVXA 1I6VC 4KJOA 4YTNB 4QCLA 2PQEA 4KKIA 2XN9C 2A6ED 1SDFA 1KDAA 2A68D 2WU5B 3KLRA 3NVYA 3TZUA 3GTMB 5CC4A 3NUCA 2AUKA 4RGTA 3SXHA 3PO2B 2NVTB 2INPE 3VR5A 2X69A 3FRPB 3EA6A 4QF4A 1VLBA 2MGSA 2FMCA 1SE3A 3S16B 4LK1C 1P7EA 4C1NK 1D5XC 2EY1A 3L3OC 2FE8A 4QB4A 2N88A 2LHEA 2A5HA 3FPPA 3TP5A 1G2TA 1M4VA 1OO9B 1K83B 2M2LA 2INNE 4RFBA 3VQIA 1H9SB 1Y8PB 1ILPA 4DA2A 1ET6A 3TP7A 1JALA 4A3IB 3TP8A 3MVVA 4WAFA 1IHZA 3I57A 3OHXC 4A3EB 3S1NB 3AEFB 1D1KA 2L83A 3IAYA 4J8QA 4DU9A 1F0ZA 2PO4A 2WXRA 2QKIC 2CVRA 1PTOD 4QMGA 1TWAB 2NN6G 1VJKA 1TY2A 5BN4A 1WTQA 1TJEA 3P75A 2PIAA 5CV9A 5LNK1 4XT1B 4GZYC 3PUZA 5E3FA 5IGFA 2WXJA 4DXGA 2HDLA 1RFKA 3K6OA 3SR1A 3MFGA 3I72A 1S5ED 2IX3A 1PFMA 1O7YA 1ZDXA 2VNUD 2F0NA 3QB3A 4ULLA 1Q3LA 2EY5A 4L63B 5JOBA 4YSYB 3AE4B 3AU7A 3HRDD 3NBIA 3S1RB 1F77A 5C4JB 1EYAA 1D5ZC 1G2SA 3GTJB 4OZBA 2B2WC 4OZAA 1E6EB 1VZ6A 1ZOYB 3PIP3 2W54A 3P1HA 1VDVA 1BO0A 4ARCA 4C3JG 1HEZE 1D5MC 2F3VA 1UEAB 1OQRA 3X3MA 4U68A 3R93A 2DLBA 1JQ4A 1XLPA 4CBVA 1RCVD 2HUGA 3Q0AA 1IBXA 4WFN3 1C4CA 2PCFB 5EE9A 5E4WC 4K14A 1QNUA 3Q22A 3AE5B