1F77A

Staphylococcal enterotoxin h determined to 2.4 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
212
Chain Sequence
b'DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISNISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN H
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 66
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f77A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1f77A02
2XNAC 1S5BD 1PTOD 4RGNA 2CHBD 1AW7A 1D6EC 1CK1A 1DYQA 1PTOH 1FNWA 1STEA 4RH6A 1G8ZD 2QILA 4O1NA 1BCPC 1JQYD 2AQ1B 1YN4A 1TY2A 4RHRA 1JWSD 1B44D 1JCKB 1LO5D 1LT3D 3BVZA 1EU3A 1PRTC 1B1ZA 1PZJD 2XRQD 3BZDB 3R2IA 3R2TA 1S5ED 1LT5D 1DJRD 1JWUD 1RDPD 2NTTA 3CHBD 1LTSD 1I4HA 2O2LD 1D5ZC 2RDHA 4TSSA 1YN3A 1SE4A 5ELEA 1CHPD 1RF2D 3R8BA 3KLSX 5D3IB 3DWPA 2IPKD 1PTOC 2QEJC 1I4GA 2WV6D 2SEBD 1SBBB 1D5XC 5ELFA 1F77A 1EWCA 1KLUD 1SE3A 4ZYSA 1LT4D 1QILA 5ELBA 5TSSA 1YN5A 1BCPB 1HA5A 1PYWD 3BVMA 4Z9CB 1XXGA 5ELCA 1V1PA 2XRSD 2R61A 3O13A 5D3DA 4C56C 1ESFA 2AQ3B 5FKAC 1PRTB 1HQRD 3OWEB 1I4XA 1EEFD 4NZLB 1SXTA 4DXGA 1JWMD 4RGTA 1SJED 3BYYB 1GOZA 4L6TB 5I4DA 2J4XA 1AN8A 1KTKA 2RDGA 2IJ0A 3DWAA 1PTOB 1FGBD 3MFGA 4L63B 1EEID 3DWQA 1CQVA 1LTGD 2AQ2B 1V1PB 3GP7A 1HTLD 1HXYD 1TY0A 5FK9C 1RD9D 1PRTD 3BVGA 1SE2A 1RCVD 1LLRD 3EA6A 3TSSA 1PZID 5ELDA 1EU4A 1ET9A 4BWGB 1I4QA 2Z8LA 1BCPF 4RFBA 1FNUA 3W2DA 1MD2D 1V1OA 1S5FD 1LTID 1CT1D 1ET6A 1S5DD 1JR0D 1SEBD 4K6LA 1I4RA 1S5CD 1BXTA 3URYA 2NTSA 2XN9C 1LTBD 1PRTF 1FNVA 3MC0B 4RHSA 1BCPD 1LTRD 1TS5A 3V05A 4DXFA 1LTTD 1M4VA 1EFID 1LTAD 1TS4A 1UUPA 4OHJA 1KLGD 1FD7D 1PZKD 4UDUC 1L0XB 1D5MC 1L0YB 3BYTB 4RGOS 1PTOF 2ICIA 3SEBA 3EFXD 1SJHD 1TS3A 1XTCD 2TSSA 1LT6D 2G9HD 1CHQD 4RCOA 1T5XD 1I4PA 4RGMA 1TS2A 1ENFA 1UNSA
chains in the Genus database with same CATH superfamily
3KVFB 4GU2A 4FF2A 2Q8IB 2UUBQ 3ZNHB 3J80c 4EQ5A 4C00A 3QJYA 4P16A 1YX6B 1I5FA 1CK1A 3GTKB 1DYQA 2BQQA 4RH6A 3U52E 3I4OA 2FJ2A 3AQQA 3UI2A 3ZKJC 3QAQA 3K5OA 3A1QA 4IPGA 4ZK9B 1Y1VG 2AQ1B 1F9JA 4FP5D 3CCQA 2K03A 4ANUA 5EJWA 2LUEA 4KK7A 1JCKB 1G51A 4JV5Q 1DGSA 4IDIA 4PMWA 5IWAQ 5M5XH 3HOYB 4OO1G 2YTXA 3S2HH 2EQSA 3S16H 2HIXA 3CHBD 4FJZA 4W9HA 5M5WB 5T8IA 2F4VQ 1D5ZC 1NBWA 3OAWA 2NPTA 3ZJYC 5M5YH 1B70B 3QA8A 2P5ZX 2JX5A 4FXGC 2N1WA 4YWGG 2C5CA 2KHSA 1HNWQ 3SK8A 5JHBA 4BY7B 1OTCA 4ZRPA 2BKFA 4K5XA 2AWTA 4G11A 1I35A 3IKJA 3P4QB 1VR9A 3SU8X 1K8RB 1Y8RC 1N60A 1IBXB 1PH7A 3J7A5 3RZOH 4JVZA 2R61A 1FD6A 2YU9B 1ESFA 2MQJA 3CCJA 3OMCA 2CU3A 2Z9HA 4JWUC 4DV3L 3TJPA 3UIPB 3RI7C 1U4MA 1ZXHA 2CR5A 2N9LA 3L54A 2EDGA 4RKLA 2WU5B 3JW0X 2FCNA 2JPHA 1XD3B 3MFGA 5M3FH 4C3HB 4LF8L 2L8JA 4A93B 1LTGD 4AYBB 3PIPA 2I0QA 1AEXA 1H4RA 4GKJQ 2Z59B 1J0GA 4R8NA 4KGRA 2BF8B 1PFNA 4HJ7A 4K8JA 2HCIA 1KC8C 3MP9A 3SFEB 2PMVA 4CDFC 3CCVA 3NJTA 1RAXA 2L32A 4PK1A 5JPNC 3CC7A 5LMUL 1EY8A 4IFDH 1E2WA 2L76A 2JA6B 1E22A 5C3EB 2C60A 4NJ7A 2H4OA 4LAAA 3AI5A 4KSLC 3MXNA 4UP8A 3S1RB 1Y8NB 2GMIC 1WF9A 3AU5A 2JY6A 4C4VB 1VQ9A 4KHVA 1STNA 2DBYA 5IT9c 1FFUA 1WXVA 1YIJA 1LTTD 4ALPA 4DAYB 5JPMC 2F0JA 1L0VB 1WE6A 1YHAA 1IZ6A 2PW9A 1EY7A 4KV6A 1UWXA 2JZ3B 4CDEC 3MXUA 4A3FG 1ISNA 4LNIA 3RYTA 2KX3A 4LFAQ 4KKUA 3MWYW 3DPDA 5HKHA 4EUTA 4PQXA 3SEBA 3TREA 2DZIA 2FCQA 1SGHA 3TQYA 3L0WB 1NSNS 5NUCA 4LNOA 4WIPA 2WAQB 4IFDG 2G9HD 3AU4A 2NYZD 1MPEA 2WAQE 4RGMA 2K75A 4JW0A 1LFDA 1ENFA 2DHZA 1V9JA 2ZPNA 3M62B 3D8GA 2E2JB 3OLMD 4M1UB 4IM3A 1YJ9A 1QOBA 5J39A 4C80A 5H92C 5CX3A 3RFZB 4MGKE 2ID0A 3MXGA 1V80A 3ZUNA 1OTRB 1ZW7A 2K5PA 3RMHA 3DM1A 1QG7A 4A3JG 2LXCA 2Q2TA 1Z2MA 3I4LA 2A68D 1XNRL 1WFQA 4O42A 2L0TA 1LV9A 4UHVA 1VQ8A 1AWDA 2N9EB 4J1MA 1TGZB 3S15H 3VTVA 3GTQH 1JWSD 4ARIA 1O78A 1MFWA 2L7RA 2JRHA 4EEWA 1IBXA 4KTAA 4PV1C 1V43A 3BZDB 1IP9A 1C9FA 3UIOB 4DV7L 3VA7A 1KRHA 1T6BX 1KDAA 1GHKA 1WR1A 2B63B 3DMUA 4X64L 1EYGA 1WGHA 4KV2A 5C4ZA 1I4HA 2O2LD 2D2QA 3AB5A 4N58A 3V3XA 5ELEA 3EN2A 3M4YA 3G71A 2K33A 4B08A 1D2BA 3IFWB 3NXWA 3KLSX 5IAAC 1Y8OB 3JAME 4RF1A 4C3JB 2IPKD 3SFDB 4JI7Q 5AJ3Q 1P0RA 1WYGA 4ZYSA 2ZTEA 1BCPB 1HA5A 1XWEA 2F0FA 4P74A 3T53B 1HNXQ 2IX1A 1K3BC 1QZHA 2XRSD 1QOGA 1GAQB 1FJGQ 1TWGB 2BDOA 4US8A 3VRAB 2JZZA 3TS0A 4B9KA 4POGA 4DK0A 5EPKA 2EOTA 3Q2AC 4HK2A 1SMYC 3VDYA 1MSHA 4L6TB 5J3BA 5I4DA 1J9OA 1K8GA 1WRDB 2L55A 2Z0DB 4W9LA 4ICUA 4R4IA 3DWAA 3SK4A 1YNJC 1LM8B 3DWMA 1JRPA 4QAYA 4C4VA 1SRUA 4RA8A 2HE7A 3A4RA 3BDCA 5I2YA 4ZYNA 3K0YA 4DAYA 3PUYA 2WYQA 5C4JB 5EE9A 2MJDA 1A2TA 4MHEA 2WWZA 3P2BA 5E4XA 4A3EH 1U4RA 1P98A 4HJGE 1UWVA 2UWQA 2A68C 5M9OA 3GTGH 3M3JA 2CQOA 1VQGA 2IT1A 1OXSC 3P20A 1MHXA 1Q12A 3F2DA 4F7ZA 1U9RA 1PA6A 3K57A 4CJ1B 1SNOA 5CV9A 3AE1B 3RLNA 2JXMB 1CMXB 4BBRG 4A3IB 5BR8Q 5BMHA 3PS6A 2JA7B 4J8QA 4JI6L 1ZKOA 2QW7A 4K81A 2AEHA 2J0KA 4ILWA 4HN7A 3HVDA 4GSWA 1PFBA 3ZNID 2VZKB 1EYCA 2GRIA 2BA0A 2F0QA 4UDUC 1L6UA 1D5MC 2WB1B 3I4MH 2Z0EB 2JVCA 2KCCA 1E9MA 2KJ6A 1EOTA 2VQEQ 4W9DA 4MN3A 4EQOA 3J81j 3R7RA 5IGFA 2YTVA 3MA2B 3QOLA 1SLJA 1HFGA 1T5XD 4YCUA 4IOCA 2MWSB 3N1XC 3PTFC 2A69D 4NPNA 1PGXA 2OHFA 3C3LA 2K7VA 2G1EA 4B3TQ 3RNBC 3W3AA 5EQ0A 5DEHA 2E74C 1E7VA 2D2CC 4G0NB 2EYOA 5KRUA 1X56A 3PIP3 3MHSD 3BDLA 3H15A 2W3RA 5JOBA 1X54A 4A3OA 1VQCA 2SNMA 4OIKA 1UGMA 2FCMA 3WAPA 3OYYA 1F9PA 2O5IC 3I57A 4RMAA 4XWWA 3SGIA 5IYDG 3H3VC 1EY9A 3DLLA 2FCSA 5C5MA 1CKNB 2LHDA 4ID6A 4N8X1 2QC8A 1FYCA 4X3KA 1OEYA 3CQZH 1C7YA 3PO2B 1I6HH 1OGWA 3BVZA 2C35B 2ACZB 4K6DA 3H1UA 2F0GA 4RCNA 3N32A 4XWTA 5BYSA 3FVQA 3M4QA 2INCC 4R4TA 1EIFA 1E8WA 4IWOA 3ZRFA 4KSKC 2QDBA 1HUNA 3HKZB 1X3FA 2MQHA 2PNHA 1FO4A 4V190 4ULLA 5T1IA 2QSDA 1K28A 1SR3A 2EYLA 2LFNA 4DN4M 2WP9B 4KMUC 2DJFC 1YZ6A 4IUTA 4TKOB 2ZM6Q 3AYHB 3DWPA 4B3ML 1B9MA 1FMAD 4M8MA 4AJYB 2D3AA 3OHXC 1SIJA 2DNFA 4CJ0B 3KUCB 3P75A 5ELBA 3N20C 5E6PA 1ZYRD 3I90A 2HCCA 5G5HA 4LF5L 2PIAA 5IKCM 2ZCBA 5ELCA 2E2IB 1C4PA 1YQ3B 4A3GH 3W9CB 1RODA 3SR1A 4F88A 1R4MB 1ZE3D 4AOFA 1QLBB 1IW7C 3NVVA 3BS1A 2O5JC 4G50A 3RPFC 4DV0L 5KHQA 3AEAB 4OX9L 1JE4A 5M5YB 4LF6L 2JYEA 3B2FA 2B2TA 5EE0A 5IO9A 3WOEA 4C3IG 2KDMA 5CV7A 3ZNZB 1A3TA 1XNQQ 1WM2A 2A69C 1V8QA 3E0JA 3V62A 3FMCA 3IL8A 2FUHB 5FR3A 4TVAB 3IG3A 3Q3MC 2B2VC 2M9VA 2QMTA 2CH4A 3AH7A 3A74A 1K51A 2KMMA 4QL5A 3KH0A 3NHEB 3MFYA 4JI2Q 4W9CA 5IYBH 1QJOA 3GV3A 5EE1A 1IL2A 1YOVB 3TSSA 1PZID 2NVXB 2F0UA 1LABA 4N9PA 1YX5B 3AE2B 2HDMA 2NB0A 4A3DH 3ND8A 1HTQA 4JYAQ 1XJVA 3PUXA 1JR0D 2EIFA 1WXAA 4LUVA 3PIOA 2AYOB 2BPSA 4LW1A 2ZZPB 3U7ZA 4XTCS 4OEMB 2QEXA 4JI3L 4FN2A 4HKZE 4PNYA 5AUKA 1I50B 5CHVC 4GGQA 4DV1L 3BJUA 1A8VA 3V05A 3NENA 3V6CB 4K2KA 1LTAD 3K8AA 2Y0SB 2MPMA 3L08A 2AKWB 4IFDI 2JF5A 3TEZA 2N78A 2FIFA 2I07B 2Y0SE 2RGFA 1PZKD 5IYBG 3DQVA 4I6NB 3IXSA 5FR6A 2CVRA 1N5WA 1PTOF 1L2NA 3H3VH 2UXCQ 1IYUA 4YSXB 4AS1A 1CKNA 1SE8A 4JBWA 5KYIA 1LT6D 2UXBQ 1IXRA 1JB3A 2X38A 2KC1A 1W6JA 4A76A 2LVQA 5JJKA 1JMCA 3KF8B 3CF6E 2XNAC 4HPPA 4LUOA 4XE0A 3OJ3A 4DR1L 4DR3Q 2ASQA 3U7DA 4L23A 2JEAI 4K7SA 2E8GA 3PCOB 5K5PA 5BN4A 4GN5A 1Y1WG 3UE1A 1XMOL 2A6HC 3TMEA 1BO0A 1KRSA 5JEAG 1PH4A 3WAMA 4J6HA 4MIUA 1VS0A 3L10B 5J17A 1B9RA 2BYFA 2LMCB 3PQIA 2UUBL 4ANXA 5I2XA 3ERQA 2XSCA 1WX7A 2KJRA 1YBYA 3ETRA 5GMVA 1HFNA 4FDBA 3KF6B 3AFQA 1YNND 4IWPA 2ZJRA 4CO7A 4QB4A 3PLUA 1B44D 3W5UB 1S3OA 2JYOA 4GKKQ 4BY1B 2PYKA 1BUVT 2K01A 3Q3JA 4P6VF 1HR0L 1QWYA 3L9AX 3MEHA 2IGDA 2IX0A 5AFWA 1WTWA 1FFVA 3U58A 3OIPA 3GTJB 3R8BA 4B6WA 4GOPB 3A9JB 4YT0B 1PTOC 1Y8PB 3RLOA 3Q69A 3A7LA 1D1KA 4R3DA 5ELFA 3DEOA 2F4VL 1XPUA 1BBWA 3BVMA 1H9RA 3V61A 1XXGA 3W1GA 3JAMc 3PHXB 2KCTA 1OQQA 4HWIB 4UAIA 4JPBW 4YCWA 5CMDA 1N33Q 1HNWL 4KD4A 3I72A 3NBIA 3KK7A 1UF0A 2BS3B 1F9SA 3PZ8A 2LS01 1F0ZA 1GUWA 3HOXB 4LF7Q 2B8GA 1AH9A 1WXSA 1UE5A 1WOCA 2RCNA 1VQNA 1TJEA 3PF5A 1KH0A 2K25A 1SXTA 2KCNA 1J5EQ 1ZPSA 2ZW1A 3PRMB 3HP3A 1VD2A 1RRBA 3VR4A 2B2WA 1DXMA 3F2BA 1N34Q 2F3IA 5HURA 4HPLB 4A3PA 3OG5A 4M00A 4DPGA 3K9OB 5KNDA 4IPHA 1CQVA 3K6OA 3QOJA 5KNBA 2ZXRA 4MSQB 1JICA 5FK9C 4C7ZA 3G48A 3HOUB 4CDDC 5ISRA 3R93A 3ECIA 3S24A 1RKNA 1Q82C 2KN5A 3A33B 1PFSA 3HFZB 3TDQA 1ZGUB 2R2QA 3PUVA 5C6AA 4OW0A 4FLHA 4L5TA 4WAFA 4GKJL 2EKEC 4EQNA 3AXCA 4A3MB 2NVTB 1K8AC 4ZOHC 1I4RA 5M3MH 2H89B 4GXBA 2GBJA 2QGQA 3KF8A 2XN9C 2L00B 1YVCA 4A3KB 3MC0B 2L05A 1WGDA 2FINB 4WWMA 2N49A 2Z6KC 4YWLA 3U4ZA 4AQ7A 4BY7G 2WXLA 2F0IA 4KI0A 4X3UA 4XDXA 4W9GA 1OXVA 3RD2A 2L11A 2L3ZA 1X55A 4OHJA 5C5LA 3HS0C 4R8IA 3J7AV 4C2MB 2K5HA 4NQKE 3H7SA 4Q0FA 4DU9A 2NBUA 3KLSA 4ZAIA 2LMCA 4AUQC 1HJPA 2ZJQA 2WKDA 5FLXL 5CV4A 5CV5A 1WTPA 1R9TB 3KF6A 1KFYB 2OT2A 4MT5A 4KD3A 3T3NA 4NP5A 4A6QA 4IM0A 3VR5A 3D4DA 4JI1Q 2KUMA 2PNRC 1Q8IA 3V2TA 1DONA 1IUEA 3TUOA 3VYSA 2IO3B 2MP1A 5IY0A 3W5VB 1LUZA 3GE3C 1DOLA 4JLCA 3GTMH 1BNZA 1TR5A 2G9DA 1SFOB 4KJOA 5FJ8H 2I1JA 4BOZB 4X57B 1D6EC 2RDFA 3CXCA 4MH8A 4YCVA 3WIMA 4GOPA 4CKCA 3A9JA 1PTOH 4A93G 2DLBA 2VXWA 3A55A 3IT6B 2ZJDA 2KMAA 2HD3A 3NVWA 1VJKA 1ILQA 4QF4A 5EBCA 2A1AA 2W82A 4DK5A 4BBSH 1D3ZA 1LT3D 2E2HH 4WJOA 3S2DB 1VQ6A 1WJNA 3TL5A 2OOBB 3I7FA 1EU3A 1G2SA 3ML8A 2EMSA 2JA8B 3PIO3 2EJGC 2Q2IA 5C3EG 4OXPA 1RYJA 3Q8CA 2I38A 1K0RA 4DNIA 2RCFA 5HFYA 4TSSA 3EFUA 3BG3A 3PO0A 1UE7A 3TBIB 2J52A 4IJLA 1R4NI 3I2ZA 2L4NA 1UBIA 2CJNA 2Y5BB 1VCIA 3KUPA 3NUCA 1L1OA 2G3QB 1UE1A 2KT7A 3GZNB 4WQMA 3QX1A 4EE2A 2R7DA 2J7ZA 3ONSA 5EPLA 1Q90A 3T8MA 4OZAA 3RNEC 4RWSC 1PYSB 1Z7TA 1PH1A 3A5ZB 1PH2A 1HNZQ 4JI7L 2BGFA 2XBBC 1D1IA 5AJ3L 3JYUA 4REZA 3N52A 2C9WB 3C8YA 2KDEB 4C56C 2B2UA 3NS8A 2WAQG 2RA4A 3PRZA 3UQAA 1PRTB 2BYVE 1TKWB 1HQRD 3S1QB 1HNXL 1K8MA 2HDLA 4FNFA 1B3AA 2PJHA 1FJGL 1VF5C 5E6NA 2J4XA 3FILB 1HHVA 3DUZA 3C1FA 5C3WA 1QCBD 2I2YA 2C9OA 1F2ZA 1SYCA 4JBJA 1H95A 1YIWA 3CU7A 3DBHI 5AEKB 2QDLA 2R93H 3NE5B 3FKIB 2MBBB 1HTLD 1I7HA 3GV6A 2DWQA 2RPQA 2MFIA 3H0GH 2EELA 1TIID 3KUDB 1V81A 4XZ4A 1A15A 2KDBA 3Q6BA 5I9OA 1E8XA 4DR5Q 3MC8A 2HQLA 2KK8A 2BH2A 2NVYB 1N61A 3BWUD 2ZXPA 1GJZA 3CKIB 3NPPA 4KGTA 4KJNA 2IDYA 3A7AB 1SYGA 3S17B 4M0WB 4E71A 2F0WA 2ASBA 1V1OA 5JEAJ 2B63G 3BDOA 4DR2Q 4LF4Q 2C7NB 2IGGA 3C19A 2GBNA 2PI2A 3K9PB 1FNVA 3MHBA 2MUYA 4C3JG 2QDFA 1TS5A 2R92H 1UZXB 5K36G 3GTLH 5C4XH 4A3CG 3MAQA 3X0WA 1ZUD2 1K53A 3PLVA 3C46A 3CP0A 4HJ8A 1G6JA 1UBQA 4XC2A 2X6GA 5BR8L 4FXKC 5HG2A 3Q8DA 4FXCA 4I6PA 5IGGA 2GOWA 4A3DB 2N7EA 2HD5B 1KF6B 2VZAA 2WACA 3S2AA 3L17A 2Z6BA 1WD1A 5DCNA 2H5XA 1R4PB 4XYOA 2JXXA 4WRDA 3HOZB 2A5UA 2MCNB 5BYQA 5IP7H 2LWPA 1GVPA 4DK1A 2VQEL 5IODA 4XQQA 1C76A 3VYTA 2DGYA 4A75A 2IY5B 1FL0A 1P16A 3TN2A 2MHVA 2OEDA 3B9JA 3ONAB 2XK5B 1XLNA 4IG7B 2LVPA 5D2MB 4PMBA 2E5LQ 2K3UA 2WXPA 4B3TL 3RZDB 3W1YA 4F8CB 1QZGA 2ZTCA 4TQ1A 3MC9A 2I5MX 5CYUA 3G4SA 2D62A 2JK8A 3Q3OC 1Z5SB 1Q86C 3DHIC 3NBHB 3EC8A 5DPRA 2KHIA 3GOEA 1Y1VH 2FBWB 2Q8RE 3VDZA 1XMQL 2XRQD 2B2YA 2VRRB 4GLVB 1EWHA 4KN7C 4BKSA 3ZJTA 1FCCC 2NTTA 3J7AF 3CMEA 4OO1H 3E9SA 3NSWA 3HOWH 4KDLB 5BO4B 1JOOA 1LYLA 2KOLA 1CHPD 4K3CA 3N6RA 4A3IG 4I65A 1Z6HA 4KHPQ 3AEEB 1STGA 4WJ4A 2M4NA 2JA7G 3FILA 3P42A 4OGQC 4QY7A 1X9NA 1S1QB 3AE7B 1KLUD 4DV4Q 1LT4D 4NJ6A 1YN5A 3CMAA 2D9UA 4LK1C 1J7BA 1FRRA 2ZM6L 3M4OH 1N62A 5CR3A 1M90C 3DBRI 2WB1G 3Q0AA 1B9NA 3NK9A 3NZUA 4BVUC 3K5NA 4PS7A 4A9AA 3DBLB 3A4SC 3MJ5A 4IWQA 2WHIA 2JWUA 2NVQB 2FUG1 2CU1A 1IBLQ 2BWFA 1I4XA 2AWOA 4XT1B 3APCA 3SDLC 3HOWG 2H1EA 1MHHE 4DXGA 4EFOA 2BE5C 4C7YA 1WSPA 4M0WA 3BYYB 3N3KB 2JUOA 3VR2A 2D10A 1AN8A 5DPSA 1IKLA 2IJ0A 2KLGA 2O2VB 3ND9A 3KJOA 1O7LA 3EECA 2GVAA 2LRUA 1WTHA 5E1FA 2R7ZB 2JA5B 4JWSC 1V1PB 3NOBA 1RD9D 4JI4Q 3BVGA 4HIOA 1AYFA 2BKRB 2J42A 3NQTA 2V1YA 3EA6A 1CZGA 2LXAA 3M9BA 3S1NH 5L95C 4NPSA 2K52A 3PO2G 1IYJB 1NY4A 1NBFC 4A55A 1CM9A 3E9IA 3J81L 4JI2L 1S5DD 3K7AB 3QK0A 4KDIC 3HKZG 3DDCB 4KIKB 2MP2A 1II3A 1YJWA 3W1SA 4MACA 2K6AA 2PW7A 2RD0A 3S1MB 4JYAL 3EIVA 5C44B 2IX3A 4X66L 3NZ3A 4IW0A 1J7AA 2XK5A 4NW2A 3PSEB 2LXJA 4II2B 4ACFA 1PDXA 1STBA 4AYBE 1X3GA 2A5HA 5CGKA 2VW9A 1K83B 2RQXA 1I3QB 4A3FH 1X1MA 3H94A 3EFXD 3SHQA 2KJHB 3TMPB 1SN8A 2KQ3A 2B39A 1JQ4A 1FXAA 3RMKC 3M3YB 2DJGC 4K2LA 1G91A 1TZ1A 1WE7A 1UNSA 4RM9A 2LEKA 1L1OC 2UXCL 2YEPB 2IY1B 3K5MA 1NAPA 1QZEA 3MVVA 3I4NB 3Q24A 1RFAA 2YLMA 1EIHA 2BCOA 2B8FA 4ZUJA 1KHIA 4GNXB 3ICEA 2UXBL 3NRZA 4OVUA 4ANWA 4LF9L 3M7GA 1MJDA 3B0AA 3S9WA 4J6IA 4BOSC 2EY6A 4EZKA 4HJ9A 3BK2A 1V9PA 4A3JH 2FIDA 1I6VC 2K5VA 2RMMA 4NXNQ 2K5NA 2IZVB 2ON8A 3UF8A 4FA6A 4RHRA 1V8CA 2NVUI 4HJ5A 3Q8FA 2FXQA 4ZHOA 4AP4C 2MEKA 3G6JB 2F4IA 1WMHB 1SMYD 2EPBA 1F2MA 1ML0D 4K8IA 2I1KA 2ENBA 3AMUA 1S5ED 4APVA 1EM7A 3UDXA 1MIUA 2UUCQ 1CTMA 3D6WA 3DM3A 3L0OA 2N9PC 2NN6G 4K14A 3U4EG 1YNJD 4POFA 3F1ZA 3EUB2 4GKKL 4NNJB 3TCAA 1E7UA 4DR6L 3I73A 4UPAA 5CV6A 2ZNVC 4HCPB 2EVBA 2L9HA 3OMGA 1WTRA 2KDFB 3ZW3A 1EWCA 4YIJA 3I3CA 4G7ZC 2Y0SG 1GNUA 2O2VA 1WTXA 3HOVG 1BR9A 3GTOH 1EF5A 1HZ6A 2N88A 2LASA 4BKTA 1X6OA 4DHJD 5JZEB 4WURA 2KACA 1V1PA 3KWVA 1Y56A 2MA9B 1E2ZA 1NNXA 3O13A 2WDTB 2K9XA 4K1RB 1HTOA 1JJCB 1BBXC 2BS4B 2KHWB 1OXUA 3AE9B 1HPCA 2SOBA 3VXWA 3IHPC 2GB1A 1B8AA 1OEYJ 4LF7L 3N30A 4KIKA 4HXDA 1HCZA 4JBKA 1J5EL 1NUCA 3KDFB 4Y7NH 1TWAB 4PS3A 1RM6C 1N34L 5AZFA 1SNMA 2DAFA 4E3CA 4I7AA 1VZ7A 1IYFA 2EYFA 2LGYA 1H9KA 4IOAA 4YY3Q 3AEDB 3Q14C 4R1JA 3CCLA 5COYA 4AH6A 4BWGB 3L13A 4BY1G 1CJEA 2IO2B 2F3VA 2JE6I 2MBOA 2RR9A 4DNTB 1NE3A 5BMGA 2KKCA 1ZP0B 1MD2D 1JB7A 1TWFB 3A8IE 1ILPA 1CA6A 1YNTE 3U8ZA 1NI2A 2WXHA 5IGEA 3PO3H 3TEHB 1T9HA 2DY8A 2YVCA 4DDGD 4BBRH 2MX2A 2RBMA 2MH7A 3KUZA 1RTOA 4GNXA 1Q1EA 4WWPA 1DGJA 3MXPA 3S14B 4MEMA 3CPWA 4P73A 2LFIA 3D4RA 2A6EC 1N36Q 2ICIA 4KN4C 5IOIA 2KCMA 4DFAA 3DHGC 2R3ZA 2NBWB 4MGZE 2WFWA 1PH3A 2TSSA 2CHXA 4IC7B 4W9JA 1ASZA 5LL6X 1WI0A 1K8OA 1WMHA 1ZDVA 2YV5A 5E4WC 1N63A 2UXDQ 2NR2A 3PO3G 3O65B 3T13A 4OIJA 2OTLA 2JSVX 4ABNA 1KABA 2INDC 4LMQD 3M4PA 4LUZA 1C4QA 4P75A 4JI1L 2VUMB 1AE3A 5FLXE 1WGKA 1TU2B 5C0XJ 2KC2A 2AL3A 1NMGA 2B3GA 1M8AA 3J7ZC 1NDDA 2KFJA 3HOUG 2VH1A 5IYDH 2EZVA 1E1TA 1IW7D 4LTUA 2WB1E 1TWCH 3LGJA 4DUYQ 1STHA 3AEFB 1B1ZA 4R4CA 1SNQA 5DNFA 3WDNA 1IBMQ 3R2TA 2KZRA 1V5TA 3HHMA 4GLSC 4ZKCB 4A3MG 3VYRA 3ABVB 1WWTA 2KVZA 1TWHH 1GUAB 2AUJD 2WP8J 1A3VA 1WCMB 2D5DA 2FFKB 1NENB 5E6JA 4LCDE 5L83A 4A3BH 4G3XB 1G6PA 3PT2B 1F77A 1IGCA 1F2LA 1SE3A 1QILA 1DM0B 4WAAA 3VUWA 3ZTCA 3RZFA 1XTDA 5I6YA 5EE3A 2W9NA 4OO1I 3KDFA 3J81i 3PMFA 4KLKA 3UINB 4DF7A 5CBAE 3U50C 4JQWC 1OXTA 4DR4Q 1NTGA 1HZ5A 4ITKA 3ZNGC 3HM3A 4ICVA 3OWEB 1RL2A 4URKA 2R6GA 3W1SC 3WAOA 3T4AC 3QIJA 1HNZL 4FXDA 4LFBQ 3MEFA 4E6IA 1YQ4B 2KX0A 3EROA 3HKZE 4C3IH 1M94A 2K50A 2RDGA 1PUTA 2UU7A 2V3PA 1A70A 3H09A 4DUZQ 4YSYB 3AEGB 1BQQT 4A3BG 5AZHA 4GS3A 4CQNA 1DCZA 3PREA 3N1YC 5EKLA 1AP0A 3LDZE 2PQEA 4O0AA 4PZ7A 3R66C 4HROA 4KHZA 5IGDA 3AE6B 1JWBD 1XEEA 5LL6S 4NAWB 1C9OA 5M5XB 3FC4A 4II3B 1ENAA 1NCVA 3S2HB 1TKGA 2J0TD 3S16B 2XWBB 1A6XA 2BW2A 3FKYA 2JA8G 1VQIA 3TZUA 3F2UA 4NMZA 3DWGC 1LTID 3AE5B 1CZWA 4WJPA 4DR5L 2KQ4X 1EQRA 1RIPA 2M0AA 3GD7A 1E0BA 2A6HD 1FR3A 5G3LF 3EBEA 4DV6Q 3URYA 1PH9A 1JWAD 1I94Q 2WKCA 5C1ZA 3TP6A 3BZCA 1SDFA 4HSPA 2KO3A 2PPHA 4P72A 5EGTA 4DR7Q 1N5XA 3H9DA 1JJ2A 2MO0A 2CQAA 1EYAA 1S4ZA 5A2QL 4DR2L 1R4MI 2WQYB 2KWUB 3NZSA 4PYUA 1ZXIA 4BXXG 1N32Q 1JE5A 1BMLC 2KWDA 4OVVA 1WX9A 3RZOB 1F9RA 2PQAB 5KEEA 3GE8C 4BA1I 2M00A 4S0RA 3K58A 2F0LA 1OFFA 1PFDA 2KQ7A 1B3QA 1TS2A 2K8BA 1EQVA 1HQMC 4GZYC 4WJ3M 2CWPA 3HZXA 2CKZB 1EFWA 4YWKA 2ZXOA 2OWOA 4NXMQ 1PTOD 1ICFB 1DOIA 1XYIA 4US9A 4RM8A 1QVGA 1XLQA 2MO1A 1UAPA 5M3FB 1OXXK 1E8YA 2XIWA 4CDCC 3P7JA 2REXA 1Y1WH 2L0FA 1DOYA 5H1SE 5LMNW 4WFN3 5JEAH 2KYWA 4QCLA 1STEA 4GN4B 1FNWA 2L83A 2WXMA 3FKIG 1G8ZD 4O1NA 3D0FA 4M02A 3TP5A 3D4WA 3UGBB 3RN9C 1TY2A 3RN5A 1TKYA 1VQHA 3B6YA 1VQBA 2E5LL 3VYUA 2GBKA 3CWIA 1WYDA 2PVGC 1YHBA 2KDIA 4FF1A 3R2IA 4K5VA 5GXGB 4RMFA 1EY4A 1DJRD 2LGIA 2O6VD 4JI0Q 3G7LA 1VLBA 1X32A 3RZWC 3JSVB 1CA5A 2RDHA 4O2DA 4ZKBB 2BB5A 5LMNQ 4CJ2C 3C1EA 5CTRC 1U5KA 3GDEA 2BYEA 2RPVA 4TUUA 1KOTA 2X6LA 3I3TB 4WJWA 1K73C 3GTPH 3ZXRA 1B4OA 1K50A 3IAS1 1P1AA 3OTOQ 3KLRA 2M1MA 4X65Q 2PZWA 1VQJA 1K52A 1ENCA 3ZXVA 4ZUIA 5D3DA 2K8HA 2KENA 4B0EA 4DV4L 2LRWA 4NAWA 1PHJA 3DCGA 3ZVVA 1L4ZB 5FKAC 1E8ZA 1YI2A 1FEHA 4FO2A 4G7OC 3NTKA 2J0MA 4DKAC 4K0KQ 4KY7A 4IO9A 1SMXA 3HOZG 2BDNA 5GROA 4ASWC 1SJED 4GNXC 2PPBC 1J19A 5J18A 1YJ1A 4JV5L 2F03A 5G2NA 1D7QA 5IWAL 1IBLL 3ZGZA 4X6AH 4J3OD 2CW0C 3WOFA 4L63B 4CGYB 3HG9A 3CCMA 1VQLA 2D11A 3PZDA 4WH4A 1A0IA 1O7IA 3M95A 1CSQA 1WJ6A 3S15B 3GTKH 3LWUA 1B2TA 3GTQB 2INPE 4IM2A 3K81C 5DPTA 3RNAC 1MHWC 1D8LA 1SYBA 3HIZA 2PQAA 2XWJB 3Q6SA 5HHDG 3B1LX 1BCPF 3RNFC 4DWFA 4JI4L 3HOYH 3CCRA 2K8CA 4YTMB 2WXGA 4GIVA 5M5WH 5ELNA 2MBEA 1TT5B 2NTSA 1BF4A 1LTBD 1LGRA 3VTWA 3TEYA 1QOHA 1T0YA 1LTRD 4BBNF 2MJ8A 5KIXA 2EE1A 4BY7H 2K05A 1E1OA 4FADA 4HTHA 3J81E 1G291 3VVWB 1JOQA 1FD7D 2EYPA 4X64Q 1ESRA 1L0XB 2PMZB 1S72A 3LYYA 4JCVE 4WQOB 2XEWA 2K5DA 4JE3B 2PMZE 2CCZA 4USAA 1UEAB 1EF1A 5JJZA 4NAMA 1CHQD 3MTSA 5DM63 2UUAQ 3UI3A 5IN7A 2IO1B 2YU9H 4OL7A 3HOYG 1CSPA 1HZAA 2LGDA 3RUZA 4IUMB 3VUXA 2BA1A 1KAWA 4HVBA 4L5SA 2LVOA 5I6WA 3AECB 1QOFA 1WD0A 4HPMB 2TMPA 3JSVA 1GUNA 4Y52H 5CBEE 1LACA 2D0PA 3SK6A 4LK0M 3HGBA 2F0MA 1HH2P 1GB1A 3F8TA 2G5DA 2JT4B 1EY5A 2R7ZG 2JA5G 1BCPC 4C3HH 2HIVA 2I5LX 4A3EB 4A93H 1SYFA 1HZ9A 4YTNB 2GN5A 2IHFA 4OWXB 3GTGB 1AARA 3CIRB 2RSOA 1LTLA 3R3MA 2LXKA 5FLXc 4C1NI 3I63C 2VH2A 3OJ4B 5IOCA 1PZJD 2DYBA 2WS3B 5FO9B 2WXFA 2LD9A 3AEBB 2MHJA 4OELB 4NJCA 4W9IA 4BBNC 1T0SC 1OQYA 4NXNL 2JA6H 3QB3A 1BUIC 5C3EH 4LFAL 2X8XX 2X69A 2WGSA 3DVGX 4FHJA 3TS2A 3RUIB 1WJJA 2PI2E 4KKSA 1SIFA 1XLPA 3S1RH 2RHQB 5D3IB 3DHHC 1H8CA 2QEJC 3OIQA 2IY0B 1NJIC 3L4PA 4HIDA 2UUCL 4JX1C 4XXEA 5C44G 5C2TB 3RCZA 3PRPB 3W1BA 3RLFA 2Q2HA 3VR3A 4C3HG 1VQOA 2CHWA 4AYBG 3HRDD 3VFKA 3SE0A 3AFPA 3I4MB 4B0MA 4CHKA 1SB3C 1V49A 1ROEA 4ZCKA 1IKMA 2WXOA 2M8SA 3MHZA 2B2TC 1GC6A 2V3SA 2L1AA 1FVIA 2NCNA 2JA6G 2NMQA 1ZXTA 3V60A 1EY0A 4JK1C 1QE6A 2DN8A 1WGGA 1JWMD 1YJJA 1DOKA 2KFKB 2FE8A 2E2JH 2DYOA 3I4NG 2N9KA 2V3NA 1C4CA 1XO3A 2IGHA 1C0AA 3J9CA 1Q10A 2AQ2B 3RNGC 2SNSA 1EIGA 3GP7A 1TQOA 3PPAA 4XQJA 3CQZB 1WY8A 1SE2A 4QUFA 1I6HB 2ALYB 5EKKA 2FNJB 4ME3A 1LLRD 1J7CA 2KEDA 4IUVA 2Z8LA 1ZOYB 2K5QA 3AU7A 2K28A 4JI8Q 3K80C 4F7XA 5L37A 2KEEA 4HEDA 3GZNI 3AEVA 3CD6A 4YY3L 2D5GA 2B63H 4XDCA 4B95A 3IAM1 3SHLA 4AIMA 2PW5A 3PV0A 3ERSX 2Q5WD 4DXFA 2N1VA 4E74A 4C3JH 3QHTA 3RULA 3QG1A 3T51B 4ODGA 3UE0A 2JP1A 4HCEA 5K36H 1IYVA 4TV3A 5FLMG 4A3CH 3TEWA 1MJCA 1KLGD 1QB5D 1UELA 3EQLC 4P1CC 4MJSB 4A3GB 5IYCH 3TRZA 4HAEA 2B29A 4TMAB 3DHQA 1ONLA 1TTNA 3FP9A 1KAAA 1AFPA 1WIAA 4NY0A 2EY1A 4AJWA 4B3RQ 1BOSA 2VB3X 1TWGH 4DHJB 2MBQA 4DHZB 2EKIA 4R4OA 1AZPA 4DHZE 1VRAB 1WXQA 2WDQB 4KKIA 1N36L 4LDTD 1PQSA 4G7HC 4GDLB 1WZ0A 1SNDA 2CHBD 3NVYA 1RTNA 4LJZC 4OWWB 2M19A 3M63B 2N4FA 2PZTA 2UXDL 1GB4A 1KNAA 2VL6A 5C3XA 2QILA 1J8CA 1OQRA 4LNKA 3NY5A 4CBVA 5IYCG 4PS8A 1NI3A 4B9WA 4U673 2INNE 5CV8A 5C4JH 1CFMA 2IO0B 4IN3A 4BZAA 4N8FA 3Q3NC 2Y5PA 2L12A 3CAMA 3PSIA 5HY6A 1FXIA 1UWMA 2DZMA 2BE5D 3KOJA 2JRIB 5LHY1 4HCSA 4IUNA 4TRDA 2E6XA 3TIXA 2KMCA 5IP9G 1C78A 1PXUA 2K39A 1YN3A 3A9KB 5CC4A 4HMJA 1Q5WB 5DAUA 2FAZA 2EJMA 1JORA 4QJFA 4Q5VA 4K5WA 1U4AA 1GUOA 2KFKA 3ZTDA 4A3IH 2WV6D 4MGYE 2SEBD 3E9HA 5IIFA 4DV5Q 1D5XC 4DA2A 4S3SA 2IWHA 2JA7H 1PVOA 4QUCA 1DD2A 5TSSA 1WGRA 1T0QC 2ICEC 3IRBA 3WWVA 3C2PA 1FXTB 1C4AA 3NTIA 2RSUA 1C8CA 3WCQA 4JI3Q 2M0XA 5H8YE 4YSZB 4A90A 4DV1Q 5C0XH 2F1MA 1YJNA 2B2WC 3STBC 3DVNU 4ZHPA 4N9F4 2OCEA 4ANVA 4FBJB 3ER0A 3AE3B 2V0GA 4DR4L 4PZ6A 5JVG3 1V86A 1XCQL 1VQMA 2PE6B 3I55A 2YTYA 2F0EA 1TXYA 3JAMi 4F1SA 1EUVB 5KYLA 1KDCA 2VUMG 1GG3A 3UDFA 4BKGA 4LFBL 4PZ8A 5C3JB 3APDA 1TVXA 1TY0A 1QQRA 3OWFA 3DEPA 4MJSA 2MGSA 4FF3A 1E6EB 4IQZA 5ELDA 1EU4A 1HZBA 4OWTB 1HR0W 5C0XG 4L5QA 4F87A 3PO2H 1SF0A 1Q81C 3K0XA 2PVOD 5BN3A 3DBRB 1B53A 3U2SC 3JC66 1SSNA 1VZ8A 1CT1D 1ET6A 2DY7A 4CKBA 3WALA 4DAVA 2BWES 2J7QB 3RNUA 1B7YB 3J80L 2NUCA 1WCMG 1J6QA 2EXDA 1EQTA 1IBKQ 1PH5A 1XCTL 1YMHE 3AMZA 2L15A 1AE2A 3EFCA 3KWLA 4GDLA 2D3GA 4HJKA 3ZDMC 2V1CC 4JG2A 1UUPA 4DV6L 3DBLI 1TYGB 1L5PA 1I94L 2KN4A 5AUIA 1HR0Q 4ZRIA 1XNQL 2FHTA 2UU9Q 2DNEA 4HEA1 4DR7L 4BS9A 1R7SA 2E2IH 1SJHD 2CJOA 3I9V1 2WDRB 2HDEA 1XTCD 2CHZA 1UEBA 2M56B 3Q3FA 4U68A 1N32L 1GHJA 2PE9A 3J81c 2WX0A 1T5EA 4AQYQ 1U0LA 1LM0A 1KXLA 5A2QE 5JJLA 3NG0A 1TIFA 4EX5A 4GOPC 4UY8C 4M01A 3A9KA 3D3RA 1BVSA 2K04A 1WM3A 5E6OA 2A74C 2WXJA 1CKOA 3KLWA 4NXML 2K1FA 4M8AA 1XF5L 4G4KA 1A5RA 2UYZB 2EYHA 3IFDA 3PF4A 1TBEA 1E24A 4D2KA 3T56B 2KD0A 3CCSA 2V9HA 2V4LA 4RNAA 1BDOA 4ME5A 1WVLA 2PKOA 4ZQ3A 3NBHA 2NVXH 2DX5B 1WJ4A 5M3MB 1JALA 1U4PA 2GBMA 1NYQA 1ZEQX 1WZ3A 3H8HA 3T1YQ 1K3RA 2I5HA 1SE4A 4X3TA 1ACCA 2JU6X 1Y14B 1XPOA 2NN6H 2OF1A 1A2UA 2QHOA 1SNPA 2GA4B 4FVMA 1I50H 4JI0L 3A54A 3H6MA 3TZDA 4X62Q 4HIMA 1R4QB 2W55A 4LFCQ 5LMNL 4DR3L 4DDID 4MTNA 2OQKA 2J0JA 1MSGA 4JGHB 4BFRA 4EOYA 1ICWA 4H13C 2B2UC 3HOVH 3KW5B 4LLGM 3TEXA 2CH4W 2JN4A 1MBYA 3V96A 1S3SG 4FJVB 2PCFB 3AV8A 1QNUA 3OTOL 4X65L 3M7NA 4L5RC 2CKHB 3AE4B 3P4PB 1EEFD 2Z4IA 1KL9A 2MJ3A 2N9XA 3I91A 2LKVA 4HRSA 2HTME 1VQEA 4GDKB 3IBEA 1GUSA 4RAUC 4RGTA 1KM7A 3GTMB 1WX8A 3AM9A 1V1QA 2N3SA 3VH3B 1KTKA 3L2PA 4DAPA 5IT9L 3D31A 1CI3M 5M3FG 1EZ8A 1UD7A 1PTOB 4MZ9A 1FGBD 5EBDA 4K0KL 1ZDXA 4HR7B 2N0SB 2BTEA 2G4SA 4XDDA 1FGUA 5T1GA 1X3QA 3LB8C 4FULA 2A6ED 4BKSD 4ZDVA 1XPRA 2EXZA 1GXDC 1WGYA 1PRTD 2B2VA 4IUPA 4BBSB 3NTHA 1E5WA 2C5LC 2E2HB 1RCVD 2BT6A 4XIGS 1KQSA 5BMIA 1YNXA 2R7FA 1ET9A 4UP9A 1S40A 3T1HQ 3CRKC 1V2YA 3BINA 3EHVA 1O7YA 3CSFA 4BY1H 2OTJA 1WH3A 5FO8B 2HTHA 4MELA 4YXDB 5IGBA 1SEBD 3CC2A 1F1HA 1LQBA 5ELOA 1VCBA 2OJWA 2ZT9C 4ZLTF 4MH0E 4LNQA 1YHQA 1N33L 5J1ZA 1WR6E 1SNCA 2K14A 3T16A 1LXDA 2O6VB 2I46A 4LJPB 3GTJH 4PYZA 4ZRKA 1PRTF 1WI5A 2F3WA 2ZTDA 3PGEA 4K7UA 3RT3B 2F0SA 3QIAA 4MTKA 1M4VA 1GJXA 2L0CA 1W3SA 5J22A 1TS4A 5DM73 2PTLA 4LJOB 2WINB 2CFMA 1Q46A 2GLSA 2G4DB 2QIEB 3PV1A 4C1NK 2DENB 5F2DA 1GM5A 2HT1A 2MJEA 2NZOA 2LGXA 3CPFA 1TS3A 3MJWA 4WWOA 3K7UC 1Z47A 3DBSA 4HLEA 1FPYA 1JOKA 3I70A 3NEMA 2RF4A 4NKLA 4CKEA 1C79A 1P3QU 3CW2C 4I6LB 3VUYA 1W2BA 3FPPA 3HOXH 2L52A 2ZCCA 1DZ1A 2Y3AA 1B50A 4QMGA 1A62A 1VMCA 3NELA 3FRPB 4RGNA 4JOIA 3R3OA 4LWCA 3Q8EA 4YL8A 2UUAL 3VH4B 3BIID 3VR6A 4KVGB 4MDKE 2R93B 4B9XA 1M1KC 3T9LA 1I42A 2IL8A 3EVQA 4JI5Q 2C7HA 3B2GA 3L3OC 1QT9A 2WXRA 3CMMB 3H0GB 2BB6A 5BYRA 1WRIA 2QCZA 5G5GA 2F0HA 3RNCC 1UGJA 2Z0SA 1CKMA 2B2YC 2MBHA 3HOUH 2A19A 2F52A 2IW3A 2A8VA 2WU2B 2JA9A 3QC8B 1PRTC 2IYDB 3GQBA 3AE8B 2VQFQ 3HOXG 1A3UA 4DV2Q 1FRDA 1NEKB 4A3MH 2V4IB 2NVTH 5KNCA 3N9YC 2R92B 3B08A 4DK6C 4GDKA 5JH5C 3TP7A 3GTLB 3I5JC 5C4XB 3P1MA 3R7QA 1IL8A 1PYBA 4MGIE 4A3KH 3H6NA 5KHOA 3UDIA 1O80A 5EKIA 1PYWD 5J2RA 2ZVNA 3HVZA 4MM3B 1DOMA 3U9SA 2K4KA 3E3XA 2RSNA 4C2MH 1QKZA 2KHJA 3ZJUA 4DXAB 4GMVA 1BT0A 2VY3A 3A8JE 2LI5A 1L4DB 3J80i 1R9TH 3RR5A 3CRLC 2G45B 1F9QA 3N1ZC 2HHHQ 1GC7A 2WDVB 4NZLB 1BKBA 4A8XC 2B3AA 4G57A 3ULJA 1F52A 1GOZA 5GAHC 3ZRCA 2K1BA 1WYWB 1KRTA 4A3KG 2K5WA 2AL6A 2DZKA 2O6VA 2WIIB 1SFOH 3VTUA 4J15A 4HMIA 5D65A 2QA4A 2EMTA 5C0XI 1HTPA 4GLXA 2J53A 1QNKA 4KZCA 4A3EG 1MKHA 2MW5A 1Y1VB 3QQ8B 3SDZA 4FF4A 3APFA 4B3SQ 1U4LA 3Q22A 2N7JA 3WANA 3S2DH 5GAEC 3HOWB 1NR2A 3L16A 4L2YA 2JA8H 2JXTA 3TP8A 3LJ3A 4WWNA 2F0VA 1S5CD 3OSOA 1HEZE 1VZ6A 3DOWA 3CC4A 3P4SB 4X3SA 4BAXA 3X3MA 1FCLA 4PT5A 4RHSA 1EO6A 2KWCA 2F0TA 4JI8L 4TQ0A 1HE8A 2XGTA 1FM0D 3MTNB 4V0BA 3VQIA 1EFID 1XMQQ 3BZKA 1Z9FA 1QOAA 4BA2I 3IT4B 3IVFA 4FJYA 2PZUA 2Z6KA 3M4OB 5G3LD 3H7PB 3SR6A 1MJEA 1EYDA 3I4MG 4BXXH 4YHHQ 4M8NA 4RGOS 3BYTB 2N8NA 1H9MA 1PMRA 3PUZA 4MNOA 1VQKA 2Q2UA 4LNFA 1MG4A 1V6EA 2AX5A 2LZ6A 4H02A 3ML9A 4WJQA 5LNK1 1DOXA 2JQOA 2BVCA 1V97A 3Q23A 3S1QH 2JJQA 1S5BD 3E6ZX 2BS2B 1F2RI 3BK1A 4B3RL 3HUIA 1AW7A 1F2YA 2Z4HA 1SYDA 3FHWA 4OONA 4GN1A 2D07B 4NB3A 3KYCD 3X23A 1STAA 3KBXA 4ZRQA 1RFKA 3QO2A 3OW2A 1JQYD 4LF4L 3QCAA 2WXIA 3FKIH 4N6EB 3PGZA 3K5LA 3S1NB 1YEZA 1YN4A 3DVNV 1KIXA 1Q1OA 3BU2A 4MM3A 3PUWA 1PFMA 2K6QA 4NQLB 4HKQA 4TKNA 2EYMA 5I9PA 2NVYH 1SROA 3KYHC 1WJUA 3ZIMA 3KJPA 5TR5A 2CWAA 3D6CA 4ZRJA 1VDZA 3S17H 4A3LH 3L7ZC 1EWYC 4P1BC 4RG1A 1NR4A 2CW0D 4KY6A 4UP7A 2QF7A 1E7PB 5IE8A 1H9SB 1MI2A 1G6ZA 1KLVA 2NZ1D 1H9JA 3X3NA 2QJLA 3IFTA 1XQQA 5HI1A 4DBGA 3ZQ4A 2DAJA 4IFDJ 2YEPF 2CS4A 4LNNA 1T0RC 4A3FB 1VQ4A 3HKSA 1YD8U 4A3GG 3QWZB 2A73B 4DV3Q 3SVMA 1XT9B 4DV5L 3VAWA 2NN6I 1T3QA 2AQ3B 5JHAA 2BH8A 4NDXA 5CORA 4A3LG 4X66Q 1JROA 3NHHA 4LF8Q 3U9OA 2KWVB 2XVSA 3HOZH 3P63A 2H88B 5GQOA 2GI9A 1EL0A 1MGSA 2ATWA 1PH6A 4LDTB 1SSOA 3K59A 3F2CA 3SK5A 4A3JB 3NVZA 4GOCA 2K0PA 4Q2JA 3CCUA 5FOBB 2ES2A 2HJ8A 3GB1A 5LMUQ 3HOVB 2ZW0A 1WTVA 1HXYD 3SXHA 4ARCA 3U30A 3RZDH 1GUTA 1PGAA 2IHEA 3H7PA 4EVOA 4KHPL 1ZYRC 2GVBA 3ZJVA 2BBCA 3V6EB 4A3DG 2EYJA 4LF9Q 4RFBA 4P7IA 3W2DA 2JQRB 2DNCA 4JOIC 4K6LA 1S5FD 4KKTA 5DLQE 4R9WA 5EAYA 1J8IA 2MNAA 5KGUA 4EQPA 4N59A 5IA7A 2NWGA 5AZGA 4KKJA 4PMCA 1KD1C 2WNMA 1Q7YC 4K7WA 1E7ZA 1Y69U 3A8KE 1BCPD 1WTOA 1P9DU 2KA7A 1WFYA 3VHTC 2NBFA 1KJTA 2K22A 1O7ZA 2JYTA 1GPXA 3GTOB 5JXVA 4YWMA 1VQDA 3PZ7A 3NQIA 1IBKL 5CHFA 5IGCA 1E2VA 2WXNA 1L0YB 4R4QA 1RWSA 3NUHB 5EDSA 1SYEA 4OVZA 3J80E 4W9KA 1P7EA 2KANA 2BYTA 2DYMA 3P1HA 1MI0A 5HGQA 2KXJA 4DR6Q 1EZ6A 2LJIA 3ZO5B 2Q8TA 3GO5A 4JIOU 1L7YA 3Q8BA 1OO9B 3IAYA 2NVQH 2UU9L 5C23A 3T3OA 2PO4A 5JJIA 4DGZA 4XYQA 1XNRQ 4DK3C 2LHEA 4WJNA 3VRBB 3ITPA 2KNBA 3GS2A 2KBNA 2KTRB 4IOIE 1Q3LA 2KJXA 4AQYL 2W3SA 1PDQA 4Y7NB 4KGSA 4PG3A 1H9SA 4F8MA 1GD7A 1K9MC 2JEBI 1JC7A 4DV7Q 2KQSA 5EPJA 2JA5H 2FMMA 2R7ZH 3DVGY 2JWZA 3JAML 3AB9A 3FDTA 3ALBA 4S17A 2AUKA 5BN5A 1QF6A 3NWSA 5C4HA 2E75C 5D7GA 2KECA 2M2LA 3CSTA 2OXPA 4XX5A 3J7YW 1LT5D 1JWUD 1MVKA 4QIWB 3PO3B 5GADC 2E2DC 1VDVA 1JJGA 2NS5A 1L1OB 4QIWE 4JPSA 3K7AH 3P4RB 4BBRB 1JRUA 1RF2D 5LXIB 1SAPA 2ZPYA 2VZKD 1I4GA 1SBBB 5D6JB 3S1MH 1JT8A 1TZOA 3T1YL 5C44H 1D4BA 1UE6A 4IJHA 1PH8A 3FPUB 3VR9B 3BY4B 4DNRB 2F0DA 1VQPA 3I56A 4A20A 3OOCA 4H2AA 1X3PA 1C1YB 1K83H 2EY2A 1I3QH 4X62L 3G6EA 3HM6X 3A5UA 3EGRA 4CYEA 4LFCL 3A0JA 1YNNC 3FEWX 4FYDA 3AULA 1E0ZA 2NBVB 1E3PA 1ASYA 2D0OA 4IPCA 1NMFA 1VQ5A 1RJTA 3M3YH 1MG8A 1YQBA 3QARA 4TQUS 5IP4D 1KDBA 2HUGA 3SD5A 2AMCB 1EY6A 4EGVA 3I4NH 4P71A 1JMLA 2K6DB 4W9FA 1YJIA 3DXJC 2ZNVB 1VQFA 4QQBX 1L6VA 1EEID 3DWQA 4CHTB 1Q8KA 4JBMA 4IUUA 2GBRA 2HJ1A 2SAKA 2DZJA 3HK0A 4OZBA 3KFUA 1VQ7A 1TWCB 4H44C 1VF7A 4GB9A 1EQQA 1TKEA 1I4QA 4HDQA 5CHWA 1GUGA 5IT9E 2MLBA 2JZPA 5LXHA 4DAMA 3LX0A 4H0LC 1TWHB 2N55A 5M3MG 4JI6Q 5E3FA 1P8LA 1BXTA 3NWTA 3AN1A 2E3TA 1CQFA 2OEOA 3T1HL 4A3BB 3CCEA 1RHPA 1G2TA 3QJZA 4ZRZA 1NVID 5G55A 2F0PA 3HRZC 2KTRA 2KTFA 1L2FA 2MSED 2LSSA 4WORA 1PGBA 2W54A 2ZVOA 1R4NB 1Q0WB 3PHWB 1IPGA 5FLMH 4KX6B 4W9EA 3ZDTA 4HJAA 2LGSA 2DUDA 3H91A 1W6KA 5MPOA 5D14A 1EWIA 4RCOA 1STYA 2XTIA 3PVLA 1C48A 1GKHA 2KLCA 2JSOA 3WA0A 3RN2A 3Q8AA 2YYZA 4C3IB 2BOSA 4GLAC 4XYCA 4EKUA 5DPWA 1C3TA 5FJ8G 5FO7B 3E56A 4JC0A 4EZJA 2AHOB 4HCNB 4IZ8A 3OPOA 2R2OA 4QGUA 1GO3E 4HIKA 2RHSB 4GN3B 2O4XA 1EOVA 4XQNA 1YITA 3E0EA 2NZHA 2ONQA 2AWNA 4BBSG 1QUQB 1TWAH 4P2CB 1N8RC 1ZKHA 1Q1BA 3DBHB 4JI5L 1HUMA 1LO5D 1CUKA 2F0KA 2RVLA 2F0OA 2F0NA 2L5TA 3STBD 1HA6A 1K0SA 2RKSA 3KYDD 4B3MQ 4HDOA 2M17A 2LY7A 2OJRA 2IBIB 4L1BA 2ZEQA 1RDPD 1L0WA 1LTSD 1TT2A 2E76C 1VQAA 3EJIA 2PLPA 1EIYB 1NYRA 1TWFH 5IP9H 1FIQA 3C0RB 2ZJPA 4XGAB 4LF5Q 4HSVA 2VQFL 3I8ZA 1RLFA 1V5OA 2Z1CA 5LLIA 4L8JA 3LWEA 1P7FA 1F2RC 4DV2L 5GAGC 3A1QB 1E10A 3QWNA 4I7ZC 4IPDA 2PEAA 3ENEA 1PV4A 1XLOA 1HZCA 4Z9CB 3NP8A 4DV0Q 2OQ0A 4OX9Q 4K3BA 4IUQA 2VB2X 4LF6Q 1X65A 3S14H 4RF0A 3TBLD 3D32A 3ZYYX 1IHZA 5A35A 2KVRA 1QVCA 3W5OA 2WXQA 1A63A 4OZCA 2VNUD 3JVZX 4IKGA 2QKIC 2RDBC 3FAHA 2Y5CA 2NPTB 4KY5A 1BBUA 3ZLZA 2MRPA 1JW9D 3MZ5A 4H7BA 4IALA 2B76B 1N6ZA 3NS1A 5E7NA 2HQEA 4DUYL 1Y1WB 3ULPA 4XT3B 3OW7A 2D3BA 1XX8A 1IBML 1X3EA 3QR8A 3VA5A 1N9WA 2HHHL 2R93G 3LXFA 1KNEA 4EZLA 2EJFC 4AWJA 2VUMH 3UDGA 3H0GG 3HEJA 4N9TA 2N7DA 2C7MB 5D94A 1E90A 2L1BA 2SDFA 1QVFA 3ULLA 1SE9A 3RD4A 4FHKA 3KBGA 4JL9A 1AZQA 1C77A 1FNUA 1HRJA 2MP2B 2LUMA 4KZ0A 2EY5A 2A4ZA 4B3SL 1UH6A 2QCPX 4YTPB 2R92G 1CZPA 1EUJA 3U4VA 3GTPB 2WXKA 4MSMB 1WCMH 5C4XG 4IURA 4RKBA 3H3VI 2WX1A 3CF5A 5JVH3 3M85A 3VR8B 2WLBA 1IGDA 3A56A 3E5SA 2K32A 1PLFA 2VS1A 1WXMA 3UQBA 5JAVA 4DQOC 1VMPA 4A4IA 3KQ4A 2KOXA 5HGTA 4DUZL 4DR1Q 1QUQA 2KVMA 1WTQA 2LJ5A 2V4DA 2FMCA 1I4PA 2KAJA 1XMOQ 3MXNB 5IP7G 2D3CA 4YHHL 3LNNA
chains in the Genus database with same CATH topology
4FF2A 2Q8IB 3QJYA 4P16A 1CK1A 3GTKB 1DYQA 4RH6A 3U52E 3UI2A 2FJ2A 3K5OA 4ZK9B 2AQ1B 4FP5D 2K03A 5EJWA 4KK7A 1JCKB 4IDIA 4PMWA 3HOYB 4OO1G 3CHBD 5M5WB 5T8IA 1D5ZC 2JX5A 4FXGC 4YWGG 2C5CA 2KHSA 3SK8A 4BY7B 4ZRPA 4K5XA 3IKJA 3P4QB 1VR9A 1N60A 1IBXB 1FD6A 2R61A 2YU9B 1ESFA 2CU3A 3OMCA 4JWUC 1U4MA 1ZXHA 2N9LA 2EDGA 4RKLA 2WU5B 3MFGA 4C3HB 4A93B 1LTGD 4AYBB 1AEXA 4R8NA 4KGRA 1PFNA 4K8JA 2HCIA 3MP9A 3SFEB 2PMVA 2L32A 5JPNC 1EY8A 4IFDH 1E2WA 2JA6B 5C3EB 2H4OA 4LAAA 3MXNA 3S1RB 1Y8NB 4KHVA 1STNA 2DBYA 1FFUA 1LTTD 5JPMC 2F0JA 1L0VB 2PW9A 1EY7A 4KV6A 1UWXA 3MXUA 4KKUA 3MWYW 4PQXA 3SEBA 4WIPA 1NSNS 5NUCA 2WAQB 4IFDG 2G9HD 2NYZD 1MPEA 4RGMA 1ENFA 3D8GA 2E2JB 4M1UB 1QOBA 5J39A 4C80A 5H92C 3RFZB 2ID0A 3MXGA 2K5PA 3RMHA 3DM1A 1QG7A 3I4LA 2A68D 4O42A 1LV9A 1AWDA 4J1MA 1JWSD 4ARIA 1O78A 1IBXA 4KTAA 4PV1C 1V43A 3BZDB 1C9FA 3VA7A 1KRHA 1T6BX 1KDAA 1GHKA 2B63B 3DMUA 5C4ZA 1I4HA 2O2LD 3AB5A 4N58A 3V3XA 5ELEA 3M4YA 2K33A 4B08A 1D2BA 3NXWA 3KLSX 1Y8OB 3JAME 4RF1A 4C3JB 2IPKD 3SFDB 1WYGA 4ZYSA 1BCPB 1HA5A 1XWEA 2F0FA 3T53B 2IX1A 2XRSD 1QOGA 1GAQB 1TWGB 2BDOA 4US8A 3VRAB 4DK0A 5EPKA 2EOTA 1SMYC 1MSHA 4L6TB 5I4DA 1J9OA 2L55A 3DWAA 3SK4A 1YNJC 3DWMA 1JRPA 4RA8A 3BDCA 5I2YA 3K0YA 4DAYA 3PUYA 5C4JB 5EE9A 2MJDA 1A2TA 4MHEA 4HJGE 5E4XA 1U4RA 2A68C 5M9OA 2IT1A 1OXSC 3P20A 1MHXA 1Q12A 1U9RA 3K57A 4CJ1B 1SNOA 5CV9A 3AE1B 2JXMB 4A3IB 5BMHA 2JA7B 4J8QA 1ZKOA 4ILWA 4HN7A 3HVDA 1PFBA 2VZKB 1EYCA 2GRIA 2BA0A 2F0QA 4UDUC 1L6UA 1D5MC 2WB1B 2KCCA 1E9MA 1EOTA 4MN3A 4EQOA 5IGFA 3QOLA 3MA2B 1T5XD 1HFGA 2A69D 1PGXA 2OHFA 3C3LA 2K7VA 2G1EA 3W3AA 5EQ0A 5DEHA 2E74C 2D2CC 2EYOA 5KRUA 3PIP3 3BDLA 2W3RA 5JOBA 2SNMA 4OIKA 2O5IC 1F9PA 3I57A 4XWWA 3H3VC 1EY9A 2LHDA 5C5MA 4ID6A 1FYCA 4X3KA 3PO2B 3BVZA 2ACZB 4K6DA 5BYSA 2F0GA 4RCNA 4XWTA 3FVQA 2QDBA 1HUNA 3HKZB 1FO4A 4V190 4ULLA 5T1IA 2QSDA 2LFNA 2EYLA 4DN4M 2WP9B 4KMUC 4TKOB 4IUTA 1FMAD 3DWPA 1B9MA 3OHXC 1SIJA 4CJ0B 3P75A 5ELBA 1ZYRD 3I90A 2HCCA 5G5HA 2PIAA 5ELCA 2E2IB 1C4PA 1YQ3B 3W9CB 1RODA 3SR1A 4F88A 1ZE3D 1QLBB 1IW7C 3NVVA 3BS1A 2O5JC 3RPFC 3AEAB 1JE4A 5M5YB 2JYEA 3B2FA 2B2TA 5EE0A 3WOEA 4C3IG 2KDMA 5CV7A 1A3TA 2A69C 1V8QA 3E0JA 3FMCA 3IL8A 5FR3A 2B2VC 2M9VA 2QMTA 3AH7A 1K51A 2KMMA 3MFYA 1QJOA 3GV3A 5EE1A 3TSSA 1PZID 2NVXB 2F0UA 1LABA 4N9PA 3AE2B 2HDMA 2NB0A 3ND8A 3PUXA 1JR0D 3U7ZA 4XTCS 5AUKA 4HKZE 4PNYA 1I50B 3V05A 4K2KA 1LTAD 2Y0SB 2MPMA 4IFDI 3TEZA 2I07B 1PZKD 3IXSA 2CVRA 1N5WA 1PTOF 1IYUA 4YSXB 4AS1A 4JBWA 5KYIA 1LT6D 2X38A 1JB3A 1W6JA 2XNAC 4XE0A 4L23A 2JEAI 5K5PA 5BN4A 5JXVA 3TEWA 2A6HC 3TMEA 1BO0A 5JEAG 4J6HA 4MIUA 1B9RA 2LMCB 5I2XA 3ERQA 2XSCA 3ETRA 1HFNA 1YNND 4QB4A 1B44D 3W5UB 2JYOA 4BY1B 2PYKA 1BUVT 2K01A 4P6VF 1QWYA 3L9AX 3MEHA 2IGDA 2IX0A 5AFWA 1WTWA 1FFVA 3GTJB 3OIPA 3R8BA 4YT0B 1PTOC 1Y8PB 3Q69A 3A7LA 1D1KA 4R3DA 5ELFA 3DEOA 3BVMA 1H9RA 1XXGA 1OQQA 4UAIA 5CMDA 4KD4A 3I72A 3NBIA 3KK7A 2BS3B 1F9SA 3PZ8A 2LS01 1F0ZA 1GUWA 3HOXB 2B8GA 1TJEA 1KH0A 1SXTA 2KCNA 1ZPSA 2ZW1A 3HP3A 3VR4A 2B2WA 1DXMA 5HURA 5KNDA 1CQVA 3K6OA 3QOJA 5KNBA 2ZXRA 1JICA 5FK9C 4C7ZA 3HOUB 5ISRA 3R93A 1RKNA 3TDQA 3PUVA 5C6AA 4OW0A 4WAFA 4EQNA 4A3MB 2NVTB 4ZOHC 1I4RA 2H89B 3KF8A 2XN9C 4A3KB 3MC0B 2FINB 4WWMA 4AQ7A 2WXLA 4XDXA 2F0IA 4KI0A 4X3UA 1OXVA 2L11A 4R8IA 4OHJA 5C5LA 3HS0C 3J7AV 4C2MB 4Q0FA 4DU9A 3KLSA 4ZAIA 2LMCA 2WKDA 5FLXL 5CV4A 5CV5A 1WTPA 1R9TB 1KFYB 2OT2A 4MT5A 4KD3A 3T3NA 4NP5A 4A6QA 3VR5A 3D4DA 2KUMA 2PNRC 1Q8IA 3V2TA 1DONA 1IUEA 3TUOA 3VYSA 2MP1A 3W5VB 1DOLA 1BNZA 1TR5A 2G9DA 1SFOB 4KJOA 1D6EC 2RDFA 4MH8A 4CKCA 1PTOH 2DLBA 2VXWA 3A55A 3IT6B 3NVWA 1VJKA 1ILQA 4QF4A 5EBCA 2W82A 1LT3D 3S2DB 1EU3A 1G2SA 2JA8B 3PIO3 2EJGC 1RYJA 3Q8CA 2I38A 5HFYA 4TSSA 3BG3A 3PO0A 3TBIB 2J52A 2L4NA 2CJNA 1VCIA 3KUPA 3NUCA 4WQMA 2J7ZA 5EPLA 1Q90A 4OZAA 4RWSC 1Z7TA 1D1IA 4REZA 3N52A 3C8YA 4C56C 2B2UA 2RA4A 1PRTB 1TKWB 1HQRD 3S1QB 1K8MA 2HDLA 4FNFA 1B3AA 1VF5C 2J4XA 3FILB 1HHVA 3DUZA 3C1FA 5C3WA 1QCBD 2I2YA 2C9OA 1F2ZA 1SYCA 3CU7A 3NE5B 3FKIB 1HTLD 1I7HA 3GV6A 2DWQA 2EELA 1TIID 1A15A 5I9OA 1N61A 2NVYB 3BWUD 2ZXPA 3CKIB 3NPPA 4KGTA 4KJNA 2IDYA 3A7AB 1SYGA 3S17B 2F0WA 1V1OA 5JEAJ 3BDOA 2IGGA 1FNVA 3MHBA 2MUYA 4C3JG 1TS5A 5K36G 3MAQA 1ZUD2 1K53A 3C46A 2X6GA 4FXKC 5HG2A 4FXCA 5IGGA 4A3DB 1KF6B 2WACA 1WD1A 1R4PB 4XYOA 4WRDA 3HOZB 5BYQA 4DK1A 5IODA 4XQQA 1C76A 3VYTA 3TN2A 3B9JA 2OEDA 2MHVA 3ONAB 1XLNA 4PMBA 2K3UA 2WXPA 3RZDB 4TQ1A 5CYUA 2D62A 2FBWB 2Q8RE 2XRQD 2B2YA 1EWHA 4KN7C 3ZJTA 1FCCC 2NTTA 3J7AF 4OO1H 3E9SA 3NSWA 1JOOA 2KOLA 1CHPD 3N6RA 4I65A 1Z6HA 3AEEB 1STGA 3FILA 3P42A 4OGQC 3AE7B 1KLUD 1LT4D 1YN5A 2D9UA 4LK1C 1J7BA 1FRRA 1N62A 5CR3A 3Q0AA 1B9NA 3NK9A 3K5NA 4A9AA 3MJ5A 2JWUA 2NVQB 2FUG1 1I4XA 2AWOA 4XT1B 2H1EA 1MHHE 4DXGA 4C7YA 2BE5C 1WSPA 4M0WA 3BYYB 3VR2A 1AN8A 1IKLA 2IJ0A 3ND9A 1O7LA 5E1FA 2R7ZB 2JA5B 4JWSC 1V1PB 1RD9D 2J42A 3BVGA 1AYFA 3NQTA 3EA6A 1CZGA 4A55A 1CM9A 3J81L 1S5DD 3K7AB 1II3A 3W1SA 4MACA 2K6AA 2PW7A 3S1MB 5C44B 2IX3A 3NZ3A 1J7AA 4NW2A 1PDXA 1STBA 2A5HA 5CGKA 1K83B 2RQXA 1I3QB 3H94A 3EFXD 2KQ3A 2B39A 1JQ4A 1FXAA 3M3YB 4K2LA 1G91A 1UNSA 2LEKA 2YEPB 3K5MA 1NAPA 3MVVA 3I4NB 3Q24A 4EE2A 1EIHA 2BCOA 2B8FA 4ZUJA 3NRZA 3M7GA 3S9WA 2EY6A 3BK2A 1I6VC 2RMMA 2ON8A 4RHRA 1V8CA 3Q8FA 4ZHOA 2MEKA 3G6JB 2F4IA 1SMYD 2EPBA 4K8IA 1F2MA 1ML0D 2ENBA 3AMUA 1S5ED 1EM7A 1CTMA 3D6WA 2NN6G 4K14A 3U4EG 1YNJD 3EUB2 3I73A 5CV6A 2EVBA 2L9HA 3OMGA 1WTRA 1EWCA 4YIJA 3I3CA 4G7ZC 1WTXA 1BR9A 1HZ6A 2N88A 4WURA 2KACA 1V1PA 3KWVA 1Y56A 1E2ZA 3O13A 2K9XA 1BBXC 2BS4B 1OXUA 3AE9B 1HPCA 2SOBA 2GB1A 1HCZA 1NUCA 1TWAB 1RM6C 1SNMA 1VZ7A 2EYFA 1H9KA 3AEDB 5COYA 4BWGB 1CJEA 2F3VA 2JE6I 5BMGA 4DNTB 1ZP0B 1MD2D 1TWFB 3A8IE 1ILPA 1CA6A 1YNTE 2WXHA 5IGEA 2DY8A 2RBMA 2MH7A 1RTOA 1Q1EA 1DGJA 3MXPA 3S14B 2LFIA 3D4RA 2A6EC 2ICIA 4KN4C 4DFAA 2R3ZA 2TSSA 5LL6X 1K8OA 1ZDVA 5E4WC 1N63A 3T13A 4OIJA 2JSVX 4ABNA 1KABA 4LMQD 1C4QA 2VUMB 5FLXE 1WGKA 1TU2B 5C0XJ 1M8AA 2EZVA 1IW7D 4LTUA 1STHA 3AEFB 1B1ZA 3WDNA 1SNQA 5DNFA 4GLSC 3R2TA 4ZKCB 3VYRA 3ABVB 1WWTA 2AUJD 2WP8J 1A3VA 1WCMB 2D5DA 2FFKB 1NENB 5E6JA 1F77A 1IGCA 1F2LA 1SE3A 1QILA 1DM0B 5I6YA 5EE3A 4OO1I 3PMFA 4DF7A 5CBAE 1OXTA 1HZ5A 4ITKA 3OWEB 2R6GA 3T4AC 4FXDA 4E6IA 1YQ4B 3EROA 1PUTA 2V3PA 4YSYB 2RDGA 1A70A 3H09A 3AEGB 1BQQT 4CQNA 1DCZA 5EKLA 1AP0A 2PQEA 4HROA 4KHZA 5IGDA 3AE6B 1JWBD 1XEEA 5LL6S 4NAWB 5M5XB 3FC4A 1ENAA 1NCVA 3S2HB 1TKGA 2J0TD 3S16B 2XWBB 1A6XA 2BW2A 3TZUA 3F2UA 4NMZA 3DWGC 1LTID 3AE5B 1CZWA 2KQ4X 2M0AA 3GD7A 1E0BA 2A6HD 1FR3A 5G3LF 1JWAD 3URYA 2WKCA 3TP6A 1SDFA 4HSPA 5EGTA 1N5XA 2CQAA 1EYAA 1S4ZA 5A2QL 2WQYB 1ZXIA 1BMLC 2KWDA 3RZOB 1F9RA 5KEEA 4BA1I 2M00A 3K58A 2F0LA 1OFFA 1PFDA 1TS2A 1EQVA 1HQMC 4GZYC 3HZXA 2PVOD 2ZXOA 4US9A 1DOIA 1PTOD 1XYIA 1XLQA 1UAPA 5M3FB 1OXXK 2XIWA 3P7JA 1DOYA 4WFN3 5JEAH 2WXMA 4QCLA 1STEA 1FNWA 2L83A 1G8ZD 4O1NA 3TP5A 3D4WA 1TY2A 1TKYA 3VYUA 3CWIA 2PVGC 4FF1A 3R2IA 4K5VA 5GXGB 1EY4A 1DJRD 2LGIA 3G7LA 1VLBA 1X32A 1CA5A 2RDHA 2BB5A 4ZKBB 4CJ2C 3C1EA 2RPVA 2X6LA 4WJWA 1B4OA 1K50A 3IAS1 3KLRA 2PZWA 1K52A 1ENCA 4ZUIA 5D3DA 4B0EA 1L4ZB 5FKAC 1FEHA 4FO2A 4G7OC 3NTKA 4KY7A 2BDNA 1SJED 2PPBC 2F03A 3ZGZA 4J3OD 2CW0C 3WOFA 4L63B 4CGYB 3HG9A 4WH4A 2INPE 3S15B 1B2TA 3LWUA 3GTQB 1SYBA 2XWJB 3Q6SA 5HHDG 1BCPF 4YTMB 2WXGA 2NTSA 1BF4A 1LTBD 3TEYA 1QOHA 1LTRD 2MJ8A 5KIXA 2EE1A 2K05A 4HTHA 3J81E 1G291 1JOQA 1FD7D 2EYPA 3LYYA 1ESRA 1L0XB 2PMZB 2K5DA 4JE3B 4USAA 1UEAB 4NAMA 5JJZA 1CHQD 3MTSA 5DM63 3UI3A 4OL7A 3RUZA 2BA1A 5I6WA 3AECB 1QOFA 1WD0A 2TMPA 1GUNA 5CBEE 1LACA 3SK6A 4LK0M 3HGBA 2F0MA 1GB1A 1EY5A 1BCPC 4A3EB 1SYFA 4YTNB 3CIRB 3GTGB 2RSOA 4C1NI 5IOCA 1PZJD 2WS3B 3AEBB 5FO9B 2WXFA 4NJCA 3QB3A 1BUIC 2X69A 4KKSA 1XLPA 5D3IB 2QEJC 3OIQA 3L4PA 4JX1C 4XXEA 5C2TB 4C3HG 3RLFA 3VR3A 3HRDD 3SE0A 3I4MB 4B0MA 1SB3C 1ROEA 1IKMA 2WXOA 3MHZA 2B2TC 2L1AA 2NMQA 1ZXTA 1EY0A 4JK1C 1QE6A 2DN8A 1JWMD 1YJJA 1DOKA 2FE8A 2DYOA 2N9KA 2V3NA 1C4CA 1XO3A 2IGHA 3J9CA 1Q10A 2AQ2B 2SNSA 1EIGA 3GP7A 1TQOA 4XQJA 3CQZB 1SE2A 4QUFA 1I6HB 5EKKA 1LLRD 1J7CA 2KEDA 4IUVA 2Z8LA 1ZOYB 2K5QA 3AU7A 2K28A 4F7XA 2KEEA 4HEDA 2D5GA 4XDCA 3IAM1 3SHLA 2PW5A 3PV0A 2Q5WD 4DXFA 3QG1A 3T51B 4ODGA 5K36H 2JP1A 4HCEA 1IYVA 1KLGD 1QB5D 3EQLC 4A3GB 4HAEA 4TMAB 3DHQA 1ONLA 1AFPA 1KAAA 2EY1A 1BOSA 2VB3X 2EKIA 1AZPA 1VRAB 1WXQA 2WDQB 4KKIA 4G7HC 4GDLB 1SNDA 2CHBD 3NVYA 1RTNA 4LJZC 2M19A 2PZTA 1GB4A 1KNAA 5C3XA 2QILA 1OQRA 4CBVA 1NI3A 4B9WA 4U673 2INNE 5CV8A 1CFMA 4IN3A 2Y5PA 2L12A 1FXIA 1UWMA 2BE5D 5LHY1 4HCSA 4IUNA 4TRDA 2E6XA 1C78A 1PXUA 1YN3A 5CC4A 4HMJA 5DAUA 2EJMA 1JORA 4Q5VA 4K5WA 1GUOA 2WV6D 2SEBD 5IIFA 1D5XC 4DA2A 4S3SA 2IWHA 4QUCA 1DD2A 5TSSA 2ICEC 3C2PA 1C4AA 3NTIA 1C8CA 3WCQA 5H8YE 4YSZB 4A90A 5C0XH 2F1MA 2B2WC 4ZHPA 3AE3B 2V0GA 5JVG3 1XCQL 2F0EA 5KYLA 1KDCA 5C3JB 1TVXA 1TY0A 1QQRA 3OWFA 3DEPA 2MGSA 4FF3A 1E6EB 4IQZA 5ELDA 1EU4A 5C0XG 4F87A 1SF0A 5BN3A 1B53A 3U2SC 1SSNA 1VZ8A 1CT1D 1ET6A 2DY7A 4CKBA 4DAVA 3J80L 2NUCA 1EQTA 1XCTL 1YMHE 3AMZA 3KWLA 1UUPA 1TYGB 1L5PA 2KN4A 5AUIA 2FHTA 2DNEA 4HEA1 4BS9A 1R7SA 1SJHD 2CJOA 3I9V1 2WDRB 2HDEA 1XTCD 2M56B 4U68A 1GHJA 1T5EA 5A2QE 3D3RA 2K04A 2A74C 2WXJA 4M8AA 1XF5L 4G4KA 2EYHA 3IFDA 4D2KA 3T56B 4RNAA 1BDOA 4ME5A 1WVLA 2PKOA 4ZQ3A 3NBHA 5M3MB 1JALA 1U4PA 1NYQA 1ZEQX 3H8HA 1SE4A 4X3TA 1ACCA 2JU6X 2NN6H 2OF1A 1A2UA 1SNPA 2GA4B 4FVMA 3A54A 3H6MA 3TZDA 1R4QB 2W55A 1MSGA 1ICWA 4H13C 2B2UC 3TEXA 4LLGM 1MBYA 3V96A 2PCFB 3AV8A 1QNUA 3M7NA 3AE4B 3P4PB 1EEFD 2Z4IA 2MJ3A 3I91A 2LKVA 4HRSA 2HTME 4GDKB 1GUSA 4RAUC 4RGTA 3GTMB 3AM9A 1KTKA 4DAPA 5IT9L 3D31A 1CI3M 1EZ8A 1ZDXA 1PTOB 1FGBD 5EBDA 2BTEA 4HR7B 2N0SB 4XDDA 5T1GA 3LB8C 1X3QA 2A6ED 2EXZA 1GXDC 1PRTD 2B2VA 4IUPA 4BBSB 3NTHA 2E2HB 1RCVD 2BT6A 4XIGS 5BMIA 1ET9A 3CRKC 1O7YA 4YXDB 5FO8B 5IGBA 1SEBD 2ZT9C 4ZLTF 5J1ZA 1SNCA 3T16A 2I46A 1PRTF 2F3WA 2F0SA 3QIAA 1M4VA 1GJXA 2L0CA 5J22A 1TS4A 5DM73 2PTLA 2WINB 2QIEB 4C1NK 5F2DA 2MJEA 1TS3A 1Z47A 1JOKA 3I70A 1C79A 4NKLA 4CKEA 2L52A 3FPPA 1DZ1A 2Y3AA 1B50A 4QMGA 1VMCA 3FRPB 4RGNA 3R3OA 3Q8EA 3BIID 3VR6A 2R93B 4B9XA 2IL8A 3EVQA 3B2GA 3L3OC 1QT9A 2WXRA 3H0GB 2BB6A 5BYRA 1WRIA 5G5GA 2F0HA 1UGJA 2B2YC 2IW3A 2WU2B 1PRTC 3GQBA 3AE8B 1A3UA 1FRDA 1NEKB 2V4IB 5KNCA 3N9YC 2R92B 3TP7A 3GTLB 3P1MA 5C4XB 1IL8A 1O80A 5EKIA 1PYWD 3HVZA 4MM3B 1DOMA 3U9SA 1QKZA 2RSNA 3ZJUA 3A8JE 1L4DB 3CRLC 1F9QA 2WDVB 4NZLB 4A8XC 4G57A 1GOZA 2K1BA 2K5WA 2WIIB 5D65A 4HMIA 5C0XI 1HTPA 2J53A 1QNKA 1Y1VB 3SDZA 4FF4A 1U4LA 3Q22A 2N7JA 3HOWB 1NR2A 4L2YA 2JXTA 3TP8A 2F0VA 1S5CD 3OSOA 1HEZE 1VZ6A 3P4SB 4X3SA 3X3MA 1FCLA 4PT5A 4RHSA 2F0TA 4TQ0A 1FM0D 3VQIA 4V0BA 1EFID 1QOAA 4BA2I 3IT4B 2PZUA 3M4OB 5G3LD 3SR6A 1EYDA 4RGOS 3BYTB 3PUZA 1H9MA 1PMRA 2AX5A 5LNK1 1DOXA 1V97A 3Q23A 3E6ZX 1S5BD 2BS2B 1F2RI 3BK1A 3HUIA 1AW7A 1F2YA 2Z4HA 1SYDA 1STAA 3KBXA 4ZRQA 1RFKA 3QO2A 1JQYD 2WXIA 4N6EB 3K5LA 3S1NB 1YN4A 3PUWA 1PFMA 4HKQA 5I9PA 2EYMA 3D6CA 1VDZA 3L7ZC 1EWYC 1NR4A 2CW0D 4KY6A 2QF7A 1E7PB 1G6ZA 1H9SB 1MI2A 2NZ1D 1H9JA 3X3NA 2QJLA 3IFTA 5HI1A 3ZQ4A 2YEPF 4IFDJ 4A3FB 2A73B 3SVMA 2NN6I 1T3QA 2AQ3B 4NDXA 5CORA 1JROA 3NHHA 3U9OA 2XVSA 3P63A 2H88B 2GI9A 1EL0A 1MGSA 1SSOA 3K59A 3SK5A 4A3JB 3NVZA 2K0PA 4Q2JA 5FOBB 3GB1A 3HOVB 2ZW0A 1WTVA 1HXYD 3SXHA 4ARCA 1GUTA 1PGAA 4EVOA 1ZYRC 3ZJVA 2BBCA 2EYJA 4RFBA 3W2DA 2JQRB 2DNCA 4K6LA 1S5FD 4KKTA 4R9WA 1J8IA 4N59A 5KGUA 4EQPA 2NWGA 4KKJA 4PMCA 2WNMA 1Y69U 3A8KE 1BCPD 1WTOA 2KA7A 2NBFA 2K22A 1O7ZA 2JYTA 1GPXA 3GTOB 3PZ7A 3NQIA 5IGCA 1E2VA 2WXNA 1L0YB 1RWSA 3NUHB 1SYEA 4OVZA 3J80E 1P7EA 2BYTA 2DYMA 3P1HA 1MI0A 1EZ6A 2LJIA 2Q8TA 3GO5A 3Q8BA 1OO9B 3IAYA 3T3OA 2PO4A 4DGZA 4XYQA 2LHEA 3VRBB 3ITPA 3GS2A 4IOIE 1Q3LA 2KJXA 2W3SA 1PDQA 4Y7NB 4KGSA 1H9SA 4F8MA 2JEBI 1JC7A 5EPJA 2FMMA 3JAML 3AB9A 3FDTA 2AUKA 5BN5A 1QF6A 3NWSA 5C4HA 2E75C 5D7GA 2KECA 2M2LA 2OXPA 3J7YW 1LT5D 1JWUD 1MVKA 4QIWB 3PO3B 2E2DC 1VDVA 4JPSA 3P4RB 4BBRB 1RF2D 1SAPA 2VZKD 1I4GA 1SBBB 1TZOA 1D4BA 3FPUB 3VR9B 4DNRB 2F0DA 3OOCA 4H2AA 1X3PA 2EY2A 3EGRA 1YNNC 3FEWX 4FYDA 1E0ZA 1RJTA 4TQUS 1KDBA 2HUGA 4EGVA 1EY6A 1JMLA 1YJIA 3DXJC 1L6VA 1EEID 3DWQA 4CHTB 4IUUA 2SAKA 4OZBA 1TWCB 4H44C 1VF7A 1TKEA 1I4QA 1GUGA 5IT9E 2JZPA 3LX0A 4H0LC 1TWHB 2N55A 5E3FA 1BXTA 3NWTA 3AN1A 2E3TA 1CQFA 2OEOA 4A3BB 1RHPA 1G2TA 4ZRZA 1NVID 2F0PA 3HRZC 1PGBA 4WORA 2W54A 4KX6B 3H91A 5MPOA 1W6KA 5D14A 4RCOA 1STYA 1C48A 2JSOA 3Q8AA 2YYZA 4C3IB 2BOSA 5FO7B 3E56A 4IZ8A 3OPOA 2O4XA 4XQNA 2ONQA 2AWNA 4P2CB 1Q1BA 1HUMA 1LO5D 2F0KA 2F0OA 2RVLA 1HA6A 2F0NA 2L5TA 2RKSA 2LY7A 4L1BA 1RDPD 1LTSD 1TT2A 2E76C 3EJIA 2PLPA 1NYRA 1FIQA 4HSVA 3I8ZA 2Z1CA 4L8JA 3LWEA 1P7FA 1F2RC 1E10A 3QWNA 4I7ZC 1XLOA <