1F7MA

The first egf-like domain from human blood coagulation fvii, nmr, minimized average structure
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
46
structure length
46
Chain Sequence
SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDGSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The effect of O-fucosylation on the first EGF-like domain from human blood coagulation factor VII.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords PROTEIN (Blood Coagulation Factor VII)
total genus 3
structure length 46
sequence length 46
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 1999-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1f7mA00
1XKAL 4M10A 2VH6B 2PR3B 3HO3A 3IJEB 2BO2A 2VWMK 5JVZA 4BTUA 3ZYIB 1CVWL 4Y7BB 4NA9L 2J38B 4X8UL 2Y81B 1ADXA 6COXA 5L2ZL 1APOA 2WPKE 2YGOA 2J94B 2Y80B 1N7DA 1F0RB 1L5GB 1HCGB 2WG4B 5CKMA 2BZ6L 2JKHL 4BXWA 2P3UA 1JL9A 1TLEA 3HO4A 2BQ6A 2F9BL 1G1QA 2BOKL 2VWLL 2XBVL 2M74A 5L30L 2W2ME 1V3XB 1IQEL 3TGFA 2UWPB 3NTBA 4NGAL 2K2SB 2W3IB 3M37L 3KL6B 1W8BL 1JV2B 4RUTA 2WYJB 2Y82B 1CVUA 1IQJL 3M36L 1HAFA 3SOQA 4BXSA 2EI6B 1NQLB 1LQDA 1ATEA 1RFNB 1EZQB 2Q1JB 3GCWE 1QFKL 1YO8A 4RRWA 2BOXA 1NFXB 2WFTA 4RRZA 1YUKB 3H5CB 4ZXXL 1F7MA 2WPME 4Z0LA 1EPIA 3P5BL 3TK6B 1XFEA 1FAXL 2BMGA 1W7XL 1FFMA 2VVCK 5JW1A 1YUFA 4MMZB 1U8CB 3TZIA 1COUA 4XBMA 1G2MB 2RNLA 3KCGL 2B7DL 4X8TL 4Y79B 3KQCL 3IITB 2FD6A 5E8DA 1KIGL 2TGFA 2J95B 5JB9E 3N8YB 1NPEB 2J34B 3KQBL 4O02B 1U67A 4Z6AL 2J4IB 2WG3C 1A3PA 1XKBA 1EGFA 3LC3B 1JBUL 3KRKA 1Z6CA 3HPTA 2WPJE 2W26B 4YT6L 2P26A 3KQDL 2DDUA 3EGFA 4BTTA 3LN0A 1F0SB 3ENSA 2VVVL 3LTGD 5I46L 1P9JA 5IKRA 2P95L 3QH0A 5JBAE 4Y7AB 3POYA 3KQEL 2VJ3A 2W2QE 4AQTA 2P28B 4D0EA 4ISHL 3SW2A 1L3YA 4LMFA 3LC5B 1HT8A 1N1IA 4RRYA 4CUFA 1MOXC 1IQFL 1CEJA 2P3TA 1WHFA 3PGHA 1HX2A 2FZZL 1FSBA 2NPRA 4BTIA 4RS0A 1BF9A 4ZHAB 1KLOA 2W2NE 3SOBB 4Y71B 2WPIE 5F1AA 5KIRA 1O5DL 1IGXA 1LPKA 1EPJA 1ZAQA 3N8XA 2CJIB 2P3FN 2KL7A 4CUEA 1MQ6L 2FLGA 1PTHA 2WFXB 3F1SB 4OTJA 3NTGA 3HO5A 2UWLB 1UZPA 2PUQL 1APQA 4YT7L 4G1MB 4PH9A 1DVAL 5IKQA 2Y5FL 3N8ZA 1UZQA 2OYUP 1SZBA 1IQKL 2RA0L 3FBYA 1X7AL 1IGZA 2XC0L 2BOHA 3HS5A 4O1ZA 2I9AA 2YGPA 3LTFB 5FDQA 1EBVA 1UZKA 1URKA 1IQHL 2XBXL 4ISIL 1PGEA 3V64C 3LIWB 4CSYA 2W86A 2XC5L 1DQBA 2W2PE 1IJQA 1CX2A 4D0FA 1G1TA 2KB9A 2XC4L 2XBWL 2K2TA 4OTYA 4C16A 1LMJA 3TBDA 3N8VA 1MQ5L 4JZFL 1EQGA 1TOZA 1KSNB 5IKTA 5JBCE 1IQGL 5JB8E 3C9AC 1XDTR 3NT1A 4XL1A 3RR3A 1GK5A 1TPGA 2P3FL 1G1SA 1OB1C 1WHEA 3BPSE 2D1JB 5CISA 5JBBE 2UWOB 1J9CL 1EMNA 1YGCL 3CA7A 1HT5A 4Y6DB 2BQWA 4A7IA 4MMYB 1DDXA 4TGFA 3CS7L 1C5MF 5CKQA 1DIYA 1IOEL 1F7EA 3OLTA 3HS7A 4JZDL 3MDLA 1ATDA 4JYUL 5EGMB 2G00L 3GISX 4XLWA 1P0SL 1Q4GA 1G2LB 2Y7XB 5F19A 4MMXB 2FLBL 3OLUA 5JVYA 1G1RA 3N8WB 1ATBA 5K0HB 3F6UL 2OYEP 1FF7A 2P94L 2WPHE 1CCVA 1NFYB 1Z6EL 1EPHA 3U73A 1LPGA 1I0UA 4JYVL 1PRHA 4X8VL 1IVOC 3R05A 2FLRL 4ZXYL 2VH0B 3TH3L 1HZ8A 1KLIL 2EI8B 1PXXA 4LORA 2Y38A 2MGRA 1CQEA 2BOUA 2EI7B 3KK6A 3GCXE 5KN5C 2BQ7A 1UZJA 1NT0A 4JZEL 5IKVA 3CFWA 1EAIC 1EQHA 2RHPA 4M11A 2Y5GL 1LPZA 3FFGL 4FM5A 4Y76B 3QMOA 1FJSL 3LN1A 5L2YL 4E1GA 3SOVA 3BT2A 2VVUL 2Y7ZB 1IQLL 4COXA 1FE2A 3LAQA 1ATAA 1NZIA 2AYLA 1IQNL 2P16L 3MQEA 3HS6A 4D90A 2XBYL 1K37A 1EMOA 4X8SL 2WPLE 3N8WA 3K9XA 4ZAEB 1AUTL 1NFWB 2I9BA 4CUDA 2W2OE 3Q3KB 3V65B 1HREA 1IP0A 4RRXA 1HJ7A 1M1XB 3TK5B 2J2UB 2WYGB 2H9EL 2ADXA 3NJPC 3ELAL 4Z0KB 3CENL 4YZUB 3ZYJB 1PFXL 1HRFA 2P93L 1IQIL 1YUGA 5CKNA 1FAKL 1KLJL 1WU1B 4BDXA 1B9WA 4BDWA 3QCWA 3BT1A 3DEMA 2PHBB 1EPGA 3Q7DA 4ZH8B 1IOXA 2GD4A 2MHPA 3N8YA 4NG9L 2Y5HL 1DX5I 1CCFA 3U7UG 3FCSB 2VWOL 1K36A 3ZYGA 2KV4A 1IQML 1NFUB 2MGPA 2VWNL 1HAEA 3ASIA 5COXA 2W3KB
chains in the Genus database with same CATH superfamily
1XKAL 4M10A 2VH6B 2PR3B 3HO3A 3IJEB 2BO2A 2VWMK 5JVZA 4BTUA 3ZYIB 1CVWL 4Y7BB 4NA9L 2J38B 4X8UL 2Y81B 1ADXA 6COXA 5L2ZL 1APOA 2WPKE 2YGOA 2J94B 2Y80B 1N7DA 1F0RB 1L5GB 1HCGB 2WG4B 5CKMA 2BZ6L 2JKHL 4BXWA 2P3UA 1JL9A 1TLEA 3HO4A 2BQ6A 2F9BL 1G1QA 2VRSA 2BOKL 2VWLL 2XBVL 2M74A 5L30L 2W2ME 1V3XB 1IQEL 3TGFA 2UWPB 3NTBA 4NGAL 2K2SB 2W3IB 3M37L 3KL6B 1W8BL 1JV2B 4RUTA 2WYJB 2Y82B 1CVUA 1IQJL 3M36L 1HAFA 3SOQA 4BXSA 2EI6B 1NQLB 1LQDA 1ATEA 1RFNB 1EZQB 2Q1JB 3GCWE 1QFKL 2HOXA 1YO8A 4RRWA 2BOXA 1NFXB 2WFTA 4RRZA 1QIUA 1YUKB 3H5CB 4ZXXL 1F7MA 2WPME 4Z0LA 1EPIA 3P5BL 3TK6B 1XFEA 1FAXL 2BMGA 1W7XL 1FFMA 2VVCK 5JW1A 1YUFA 4MMZB 1U8CB 3TZIA 1COUA 4XBMA 1G2MB 2RNLA 4A94C 3KCGL 2B7DL 2YGQA 4X8TL 2JJLA 4Y79B 3KQCL 3IITB 2FD6A 5E8DA 1KIGL 2BT8A 2TGFA 2J95B 5JB9E 3N8YB 1NPEB 2J34B 3KQBL 4O02B 1U67A 4Z6AL 2J4IB 2WG3C 1A3PA 1XKBA 1EGFA 3LC3B 1JBUL 3KRKA 1Z6CA 3HPTA 2WPJE 2W26B 4YT6L 2P26A 3KQDL 2DDUA 3EGFA 4BTTA 3LN0A 1F0SB 3ENSA 2VVVL 3LTGD 5I46L 1P9JA 5IKRA 2P95L 3QH0A 5JBAE 4Y7AB 3POYA 3KQEL 2VJ3A 2W2QE 4AQTA 2P28B 4D0EA 4ISHL 3SW2A 1L3YA 4LMFA 3LC5B 1HT8A 1N1IA 4RRYA 4CUFA 1MOXC 1IQFL 1CEJA 2P3TA 1WHFA 3PGHA 1HX2A 2FZZL 1FSBA 2NPRA 4BTIA 4RS0A 1BF9A 4ZHAB 1KLOA 2W2NE 3SOBB 4Y71B 2WPIE 5F1AA 5KIRA 1O5DL 1IGXA 1LPKA 1EPJA 1ZAQA 3N8XA 2CJIB 2P3FN 2KL7A 4CUEA 1MQ6L 2FLGA 1PTHA 2WFXB 3F1SB 4OTJA 3NTGA 3HO5A 2UWLB 1UZPA 3S6XA 2PUQL 1APQA 4YT7L 4G1MB 4PH9A 1DVAL 5IKQA 2Y5FL 3N8ZA 1UZQA 2OYUP 1SZBA 1IQKL 2RA0L 3FBYA 1X7AL 1IGZA 2XC0L 2BOHA 3HS5A 4O1ZA 2I9AA 2YGPA 3LTFB 5FDQA 1EBVA 1UZKA 1URKA 1IQHL 2XBXL 4ISIL 1PGEA 3V64C 3LIWB 4CSYA 2W86A 2XC5L 1DQBA 2W2PE 1IJQA 1CX2A 4D0FA 1G1TA 2BSFA 2KB9A 2XC4L 2XBWL 2HORA 2K2TA 4OTYA 4C16A 1LMJA 3TBDA 3N8VA 1MQ5L 4JZFL 2H9EC 2KNIA 1EQGA 1TOZA 1KSNB 5IKTA 5JBCE 1IQGL 5JB8E 3C9AC 1XDTR 3NT1A 1V1HA 4XL1A 3RR3A 1GK5A 1TPGA 2P3FL 1G1SA 1OB1C 1WHEA 3BPSE 2D1JB 5CISA 5JBBE 2UWOB 1J9CL 1EMNA 1YGCL 3CA7A 1HT5A 4Y6DB 2BQWA 4A7IA 4MMYB 1DDXA 4TGFA 3CS7L 1C5MF 5CKQA 1DIYA 1IOEL 1F7EA 3OLTA 3HS7A 4JZDL 3MDLA 1ATDA 4JYUL 5EGMB 2G00L 3GISX 4XLWA 1P0SL 1Q4GA 1G2LB 2Y7XB 5F19A 4MMXB 2FLBL 3OLUA 5JVYA 1G1RA 3N8WB 4GU3A 1ATBA 5K0HB 3F6UL 2OYEP 1FF7A 2P94L 2WPHE 1KKEA 1CCVA 1NFYB 1Z6EL 1EPHA 3U73A 1LPGA 1I0UA 4JYVL 1PRHA 4X8VL 1IVOC 3R05A 2FLRL 4ZXYL 2VH0B 3TH3L 1HZ8A 1KLIL 2EI8B 1PXXA 2MGRA 2Y38A 1CQEA 2BOUA 2EI7B 3KK6A 4LORA 3GCXE 5KN5C 2BQ7A 1UZJA 1NT0A 4JZEL 5IKVA 3CFWA 1EAIC 1EQHA 2RHPA 4M11A 2Y5GL 1LPZA 3FFGL 4FM5A 4Y76B 3QMOA 1FJSL 3LN1A 5L2YL 4E1GA 3SOVA 3BT2A 2VVUL 2Y7ZB 1IQLL 4COXA 1FE2A 3LAQA 1ATAA 1NZIA 2AYLA 1IQNL 2P16L 3MQEA 3HS6A 4D90A 2XBYL 1K37A 1EMOA 4X8SL 2WPLE 1LMMA 1LK9A 3N8WA 3K9XA 4ZAEB 1AUTL 1NFWB 2I9BA 4CUDA 2W2OE 3Q3KB 3V65B 1HREA 1IP0A 4RRXA 1HJ7A 1M1XB 3TK5B 2J2UB 2WYGB 2H9EL 2ADXA 3NJPC 3ELAL 4Z0KB 3CENL 4YZUB 3ZYJB 1PFXL 1HRFA 2P93L 1IQIL 1YUGA 5CKNA 1V1IA 4GU4A 1FAKL 1KLJL 1WU1B 4BDXA 1B9WA 4BDWA 3QCWA 2WZPP 3BT1A 3DEMA 2PHBB 1EPGA 3Q7DA 4ZH8B 1IOXA 2GD4A 2MHPA 3N8YA 4NG9L 2BT7A 2Y5HL 1DX5I 1CCFA 3U7UG 3FCSB 2VWOL 1K36A 3ZYGA 2KV4A 1IQML 1NFUB 2MGPA 2VWNL 1HAEA 3ASIA 5COXA 2W3KB
chains in the Genus database with same CATH topology
1XKAL 4M10A 2VH6B 2PR3B 3HO3A 3IJEB 2BO2A 2VWMK 5JVZA 4BTUA 3ZYIB 1CVWL 4Y7BB 4NA9L 2J38B 4X8UL 2Y81B 1ADXA 6COXA 5L2ZL 1APOA 2WPKE 2YGOA 2J94B 2Y80B 1N7DA 1F0RB 1L5GB 1HCGB 2WG4B 5CKMA 2BZ6L 2JKHL 4BXWA 2P3UA 1JL9A 1TLEA 3HO4A 2BQ6A 2F9BL 1G1QA 2BOKL 2VWLL 2XBVL 2M74A 5L30L 2W2ME 1V3XB 1IQEL 3TGFA 2UWPB 3NTBA 4NGAL 2K2SB 2W3IB 3M37L 3KL6B 1W8BL 1JV2B 4RUTA 2WYJB 2Y82B 1CVUA 1IQJL 3M36L 1HAFA 3SOQA 4BXSA 2EI6B 1NQLB 1LQDA 1ATEA 1RFNB 1EZQB 2Q1JB 3GCWE 1QFKL 1YO8A 4RRWA 2BOXA 1NFXB 2WFTA 4RRZA 1YUKB 3H5CB 4ZXXL 1F7MA 2WPME 4Z0LA 1EPIA 3P5BL 3TK6B 1XFEA 1FAXL 2BMGA 1W7XL 1FFMA 2VVCK 5JW1A 1YUFA 4MMZB 1U8CB 3TZIA 1COUA 4XBMA 1G2MB 2RNLA 4A94C 3KCGL 2B7DL 2YGQA 4X8TL 4Y79B 3KQCL 3IITB 2FD6A 5E8DA 1KIGL 2TGFA 2J95B 5JB9E 3N8YB 1NPEB 2J34B 3KQBL 4O02B 1U67A 4Z6AL 2J4IB 2WG3C 1A3PA 1XKBA 1EGFA 3LC3B 1JBUL 3KRKA 1Z6CA 3HPTA 2WPJE 2W26B 4YT6L 2P26A 3KQDL 2DDUA 3EGFA 4BTTA 3LN0A 1F0SB 3ENSA 2VVVL 3LTGD 5I46L 1P9JA 5IKRA 2P95L 3QH0A 5JBAE 4Y7AB 3POYA 3KQEL 2VJ3A 2W2QE 4AQTA 2P28B 4D0EA 4ISHL 3SW2A 1L3YA 4LMFA 3LC5B 1HT8A 1N1IA 4RRYA 4CUFA 1MOXC 1IQFL 1CEJA 2P3TA 1WHFA 3PGHA 1HX2A 2FZZL 1FSBA 2NPRA 4BTIA 4RS0A 1BF9A 4ZHAB 1KLOA 2W2NE 3SOBB 4Y71B 2WPIE 5F1AA 5KIRA 1O5DL 1IGXA 1LPKA 1EPJA 1ZAQA 3N8XA 2CJIB 2P3FN 2KL7A 4CUEA 1MQ6L 2FLGA 1PTHA 2WFXB 3F1SB 4OTJA 3NTGA 3HO5A 2UWLB 1UZPA 3S6XA 2PUQL 1APQA 4YT7L 4G1MB 4PH9A 1DVAL 5IKQA 2Y5FL 3N8ZA 1UZQA 2OYUP 1SZBA 1IQKL 2RA0L 3FBYA 1X7AL 1IGZA 2XC0L 2BOHA 3HS5A 4O1ZA 2I9AA 2YGPA 3LTFB 5FDQA 1EBVA 1UZKA 1URKA 1IQHL 2XBXL 4ISIL 1PGEA 3V64C 3LIWB 4CSYA 2W86A 2XC5L 1DQBA 2W2PE 1IJQA 1CX2A 4D0FA 1G1TA 2KB9A 2XC4L 2XBWL 2K2TA 4OTYA 4C16A 1LMJA 3TBDA 3N8VA 1MQ5L 4JZFL 2H9EC 2KNIA 1EQGA 1TOZA 1KSNB 5IKTA 5JBCE 1IQGL 5JB8E 3C9AC 1XDTR 3NT1A 4XL1A 3RR3A 1GK5A 1TPGA 2P3FL 1G1SA 1OB1C 1WHEA 3BPSE 2D1JB 5CISA 5JBBE 2UWOB 1J9CL 1EMNA 1YGCL 3CA7A 1HT5A 4Y6DB 2BQWA 4A7IA 4MMYB 1DDXA 4TGFA 3CS7L 1C5MF 5CKQA 1DIYA 1IOEL 1F7EA 3OLTA 3HS7A 4JZDL 3MDLA 1ATDA 4JYUL 5EGMB 2G00L 3GISX 4XLWA 1P0SL 1Q4GA 1G2LB 2Y7XB 5F19A 4MMXB 2FLBL 3OLUA 5JVYA 1G1RA 3N8WB 1ATBA 5K0HB 3F6UL 2OYEP 1FF7A 2P94L 2WPHE 1CCVA 1NFYB 1Z6EL 1EPHA 3U73A 1LPGA 1I0UA 4JYVL 1PRHA 4X8VL 1IVOC 3R05A 2FLRL 4ZXYL 2VH0B 3TH3L 1HZ8A 1KLIL 2EI8B 1PXXA 4LORA 2Y38A 2MGRA 1CQEA 2BOUA 2EI7B 3KK6A 3GCXE 5KN5C 2BQ7A 1UZJA 1NT0A 4JZEL 5IKVA 3CFWA 1EAIC 1EQHA 2RHPA 4M11A 2Y5GL 1LPZA 3FFGL 4FM5A 4Y76B 3QMOA 1FJSL 3LN1A 5L2YL 4E1GA 3SOVA 3BT2A 2VVUL 2Y7ZB 1IQLL 4COXA 1FE2A 3LAQA 1ATAA 1NZIA 2AYLA 1IQNL 2P16L 3MQEA 3HS6A 4D90A 2XBYL 1K37A 1EMOA 4X8SL 2WPLE 1LMMA 3N8WA 3K9XA 4ZAEB 1AUTL 1NFWB 2I9BA 4CUDA 2W2OE 3Q3KB 3V65B 1HREA 1IP0A 4RRXA 1HJ7A 1M1XB 3TK5B 2J2UB 2WYGB 2H9EL 2ADXA 3NJPC 3ELAL 4Z0KB 3CENL 4YZUB 3ZYJB 1PFXL 1HRFA 2P93L 1IQIL 1YUGA 5CKNA 1FAKL 1KLJL 1WU1B 4BDXA 1B9WA 4BDWA 3QCWA 2WZPP 3BT1A 3DEMA 2PHBB 1EPGA 3Q7DA 4ZH8B 1IOXA 2GD4A 2MHPA 3N8YA 4NG9L 2Y5HL 1DX5I 1CCFA 3U7UG 3FCSB 2VWOL 1K36A 3ZYGA 2KV4A 1IQML 1NFUB 2MGPA 2VWNL 1HAEA 3ASIA 5COXA 2W3KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKA L;  4M10 A;  2VH6 B;  2PR3 B;  3HO3 A;  3IJE B;  2BO2 A;  2VWM K;  5JVZ A;  4BTU A;  3ZYI B;  1CVW L;  4Y7B B;  4NA9 L;  2J38 B;  4X8U L;  2Y81 B;  1ADX A;  6COX A;  5L2Z L;  1APO A;  2WPK E;  2YGO A;  2J94 B;  2Y80 B;  1N7D A;  1F0R B;  1L5G B;  1HCG B;  2WG4 B;  5CKM A;  2BZ6 L;  2JKH L;  4BXW A;  2P3U A;  1JL9 A;  1TLE A;  3HO4 A;  2BQ6 A;  2F9B L;  1G1Q A;  2BOK L;  2VWL L;  2XBV L;  2M74 A;  5L30 L;  2W2M E;  1V3X B;  1IQE L;  3TGF A;  2UWP B;  3NTB A;  4NGA L;  2K2S B;  2W3I B;  3M37 L;  3KL6 B;  1W8B L;  1JV2 B;  4RUT A;  2WYJ B;  2Y82 B;  1CVU A;  1IQJ L;  3M36 L;  1HAF A;  3SOQ A;  4BXS A;  2EI6 B;  1NQL B;  1LQD A;  1ATE A;  1RFN B;  1EZQ B;  2Q1J B;  3GCW E;  1QFK L;  1YO8 A;  4RRW A;  2BOX A;  1NFX B;  2WFT A;  4RRZ A;  1YUK B;  3H5C B;  4ZXX L;  1F7M A;  2WPM E;  4Z0L A;  1EPI A;  3P5B L;  3TK6 B;  1XFE A;  1FAX L;  2BMG A;  1W7X L;  1FFM A;  2VVC K;  5JW1 A;  1YUF A;  4MMZ B;  1U8C B;  3TZI A;  1COU A;  4XBM A;  1G2M B;  2RNL A;  3KCG L;  2B7D L;  4X8T L;  4Y79 B;  3KQC L;  3IIT B;  2FD6 A;  5E8D A;  1KIG L;  2TGF A;  2J95 B;  5JB9 E;  3N8Y B;  1NPE B;  2J34 B;  3KQB L;  4O02 B;  1U67 A;  4Z6A L;  2J4I B;  2WG3 C;  1A3P A;  1XKB A;  1EGF A;  3LC3 B;  1JBU L;  3KRK A;  1Z6C A;  3HPT A;  2WPJ E;  2W26 B;  4YT6 L;  2P26 A;  3KQD L;  2DDU A;  3EGF A;  4BTT A;  3LN0 A;  1F0S B;  3ENS A;  2VVV L;  3LTG D;  5I46 L;  1P9J A;  5IKR A;  2P95 L;  3QH0 A;  5JBA E;  4Y7A B;  3POY A;  3KQE L;  2VJ3 A;  2W2Q E;  4AQT A;  2P28 B;  4D0E A;  4ISH L;  3SW2 A;  1L3Y A;  4LMF A;  3LC5 B;  1HT8 A;  1N1I A;  4RRY A;  4CUF A;  1MOX C;  1IQF L;  1CEJ A;  2P3T A;  1WHF A;  3PGH A;  1HX2 A;  2FZZ L;  1FSB A;  2NPR A;  4BTI A;  4RS0 A;  1BF9 A;  4ZHA B;  1KLO A;  2W2N E;  3SOB B;  4Y71 B;  2WPI E;  5F1A A;  5KIR A;  1O5D L;  1IGX A;  1LPK A;  1EPJ A;  1ZAQ A;  3N8X A;  2CJI B;  2P3F N;  2KL7 A;  4CUE A;  1MQ6 L;  2FLG A;  1PTH A;  2WFX B;  3F1S B;  4OTJ A;  3NTG A;  3HO5 A;  2UWL B;  1UZP A;  2PUQ L;  1APQ A;  4YT7 L;  4G1M B;  4PH9 A;  1DVA L;  5IKQ A;  2Y5F L;  3N8Z A;  1UZQ A;  2OYU P;  1SZB A;  1IQK L;  2RA0 L;  3FBY A;  1X7A L;  1IGZ A;  2XC0 L;  2BOH A;  3HS5 A;  4O1Z A;  2I9A A;  2YGP A;  3LTF B;  5FDQ A;  1EBV A;  1UZK A;  1URK A;  1IQH L;  2XBX L;  4ISI L;  1PGE A;  3V64 C;  3LIW B;  4CSY A;  2W86 A;  2XC5 L;  1DQB A;  2W2P E;  1IJQ A;  1CX2 A;  4D0F A;  1G1T A;  2KB9 A;  2XC4 L;  2XBW L;  2K2T A;  4OTY A;  4C16 A;  1LMJ A;  3TBD A;  3N8V A;  1MQ5 L;  4JZF L;  1EQG A;  1TOZ A;  1KSN B;  5IKT A;  5JBC E;  1IQG L;  5JB8 E;  3C9A C;  1XDT R;  3NT1 A;  4XL1 A;  3RR3 A;  1GK5 A;  1TPG A;  2P3F L;  1G1S A;  1OB1 C;  1WHE A;  3BPS E;  2D1J B;  5CIS A;  5JBB E;  2UWO B;  1J9C L;  1EMN A;  1YGC L;  3CA7 A;  1HT5 A;  4Y6D B;  2BQW A;  4A7I A;  4MMY B;  1DDX A;  4TGF A;  3CS7 L;  1C5M F;  5CKQ A;  1DIY A;  1IOE L;  1F7E A;  3OLT A;  3HS7 A;  4JZD L;  3MDL A;  1ATD A;  4JYU L;  5EGM B;  2G00 L;  3GIS X;  4XLW A;  1P0S L;  1Q4G A;  1G2L B;  2Y7X B;  5F19 A;  4MMX B;  2FLB L;  3OLU A;  5JVY A;  1G1R A;  3N8W B;  1ATB A;  5K0H B;  3F6U L;  2OYE P;  1FF7 A;  2P94 L;  2WPH E;  1CCV A;  1NFY B;  1Z6E L;  1EPH A;  3U73 A;  1LPG A;  1I0U A;  4JYV L;  1PRH A;  4X8V L;  1IVO C;  3R05 A;  2FLR L;  4ZXY L;  2VH0 B;  3TH3 L;  1HZ8 A;  1KLI L;  2EI8 B;  1PXX A;  4LOR A;  2Y38 A;  2MGR A;  1CQE A;  2BOU A;  2EI7 B;  3KK6 A;  3GCX E;  5KN5 C;  2BQ7 A;  1UZJ A;  1NT0 A;  4JZE L;  5IKV A;  3CFW A;  1EAI C;  1EQH A;  2RHP A;  4M11 A;  2Y5G L;  1LPZ A;  3FFG L;  4FM5 A;  4Y76 B;  3QMO A;  1FJS L;  3LN1 A;  5L2Y L;  4E1G A;  3SOV A;  3BT2 A;  2VVU L;  2Y7Z B;  1IQL L;  4COX A;  1FE2 A;  3LAQ A;  1ATA A;  1NZI A;  2AYL A;  1IQN L;  2P16 L;  3MQE A;  3HS6 A;  4D90 A;  2XBY L;  1K37 A;  1EMO A;  4X8S L;  2WPL E;  3N8W A;  3K9X A;  4ZAE B;  1AUT L;  1NFW B;  2I9B A;  4CUD A;  2W2O E;  3Q3K B;  3V65 B;  1HRE A;  1IP0 A;  4RRX A;  1HJ7 A;  1M1X B;  3TK5 B;  2J2U B;  2WYG B;  2H9E L;  2ADX A;  3NJP C;  3ELA L;  4Z0K B;  3CEN L;  4YZU B;  3ZYJ B;  1PFX L;  1HRF A;  2P93 L;  1IQI L;  1YUG A;  5CKN A;  1FAK L;  1KLJ L;  1WU1 B;  4BDX A;  1B9W A;  4BDW A;  3QCW A;  3BT1 A;  3DEM A;  2PHB B;  1EPG A;  3Q7D A;  4ZH8 B;  1IOX A;  2GD4 A;  2MHP A;  3N8Y A;  4NG9 L;  2Y5H L;  1DX5 I;  1CCF A;  3U7U G;  3FCS B;  2VWO L;  1K36 A;  3ZYG A;  2KV4 A;  1IQM L;  1NFU B;  2MGP A;  2VWN L;  1HAE A;  3ASI A;  5COX A;  2W3K B; 
#chains in the Genus database with same CATH topology
 1XKA L;  4M10 A;  2VH6 B;  2PR3 B;  3HO3 A;  3IJE B;  2BO2 A;  2VWM K;  5JVZ A;  4BTU A;  3ZYI B;  1CVW L;  4Y7B B;  4NA9 L;  2J38 B;  4X8U L;  2Y81 B;  1ADX A;  6COX A;  5L2Z L;  1APO A;  2WPK E;  2YGO A;  2J94 B;  2Y80 B;  1N7D A;  1F0R B;  1L5G B;  1HCG B;  2WG4 B;  5CKM A;  2BZ6 L;  2JKH L;  4BXW A;  2P3U A;  1JL9 A;  1TLE A;  3HO4 A;  2BQ6 A;  2F9B L;  1G1Q A;  2VRS A;  2BOK L;  2VWL L;  2XBV L;  2M74 A;  5L30 L;  2W2M E;  1V3X B;  1IQE L;  3TGF A;  2UWP B;  3NTB A;  4NGA L;  2K2S B;  2W3I B;  3M37 L;  3KL6 B;  1W8B L;  1JV2 B;  4RUT A;  2WYJ B;  2Y82 B;  1CVU A;  1IQJ L;  3M36 L;  1HAF A;  3SOQ A;  4BXS A;  2EI6 B;  1NQL B;  1LQD A;  1ATE A;  1RFN B;  1EZQ B;  2Q1J B;  3GCW E;  1QFK L;  2HOX A;  1YO8 A;  4RRW A;  2BOX A;  1NFX B;  2WFT A;  4RRZ A;  1QIU A;  1YUK B;  3H5C B;  4ZXX L;  1F7M A;  2WPM E;  4Z0L A;  1EPI A;  3P5B L;  3TK6 B;  1XFE A;  1FAX L;  2BMG A;  1W7X L;  1FFM A;  2VVC K;  5JW1 A;  1YUF A;  4MMZ B;  1U8C B;  3TZI A;  1COU A;  4XBM A;  1G2M B;  2RNL A;  4A94 C;  3KCG L;  2B7D L;  2YGQ A;  4X8T L;  2JJL A;  4Y79 B;  3KQC L;  3IIT B;  2FD6 A;  5E8D A;  1KIG L;  2BT8 A;  2TGF A;  2J95 B;  5JB9 E;  3N8Y B;  1NPE B;  2J34 B;  3KQB L;  4O02 B;  1U67 A;  4Z6A L;  2J4I B;  2WG3 C;  1A3P A;  1XKB A;  1EGF A;  3LC3 B;  1JBU L;  3KRK A;  1Z6C A;  3HPT A;  2WPJ E;  2W26 B;  4YT6 L;  2P26 A;  3KQD L;  2DDU A;  3EGF A;  4BTT A;  3LN0 A;  1F0S B;  3ENS A;  2VVV L;  3LTG D;  5I46 L;  1P9J A;  5IKR A;  2P95 L;  3QH0 A;  5JBA E;  4Y7A B;  3POY A;  3KQE L;  2VJ3 A;  2W2Q E;  4AQT A;  2P28 B;  4D0E A;  4ISH L;  3SW2 A;  1L3Y A;  4LMF A;  3LC5 B;  1HT8 A;  1N1I A;  4RRY A;  4CUF A;  1MOX C;  1IQF L;  1CEJ A;  2P3T A;  1WHF A;  3PGH A;  1HX2 A;  2FZZ L;  1FSB A;  2NPR A;  4BTI A;  4RS0 A;  1BF9 A;  4ZHA B;  1KLO A;  2W2N E;  3SOB B;  4Y71 B;  2WPI E;  5F1A A;  5KIR A;  1O5D L;  1IGX A;  1LPK A;  1EPJ A;  1ZAQ A;  3N8X A;  2CJI B;  2P3F N;  2KL7 A;  4CUE A;  1MQ6 L;  2FLG A;  1PTH A;  2WFX B;  3F1S B;  4OTJ A;  3NTG A;  3HO5 A;  2UWL B;  1UZP A;  3S6X A;  2PUQ L;  1APQ A;  4YT7 L;  4G1M B;  4PH9 A;  1DVA L;  5IKQ A;  2Y5F L;  3N8Z A;  1UZQ A;  2OYU P;  1SZB A;  1IQK L;  2RA0 L;  3FBY A;  1X7A L;  1IGZ A;  2XC0 L;  2BOH A;  3HS5 A;  4O1Z A;  2I9A A;  2YGP A;  3LTF B;  5FDQ A;  1EBV A;  1UZK A;  1URK A;  1IQH L;  2XBX L;  4ISI L;  1PGE A;  3V64 C;  3LIW B;  4CSY A;  2W86 A;  2XC5 L;  1DQB A;  2W2P E;  1IJQ A;  1CX2 A;  4D0F A;  1G1T A;  2BSF A;  2KB9 A;  2XC4 L;  2XBW L;  2HOR A;  2K2T A;  4OTY A;  4C16 A;  1LMJ A;  3TBD A;  3N8V A;  1MQ5 L;  4JZF L;  2H9E C;  2KNI A;  1EQG A;  1TOZ A;  1KSN B;  5IKT A;  5JBC E;  1IQG L;  5JB8 E;  3C9A C;  1XDT R;  3NT1 A;  1V1H A;  4XL1 A;  3RR3 A;  1GK5 A;  1TPG A;  2P3F L;  1G1S A;  1OB1 C;  1WHE A;  3BPS E;  2D1J B;  5CIS A;  5JBB E;  2UWO B;  1J9C L;  1EMN A;  1YGC L;  3CA7 A;  1HT5 A;  4Y6D B;  2BQW A;  4A7I A;  4MMY B;  1DDX A;  4TGF A;  3CS7 L;  1C5M F;  5CKQ A;  1DIY A;  1IOE L;  1F7E A;  3OLT A;  3HS7 A;  4JZD L;  3MDL A;  1ATD A;  4JYU L;  5EGM B;  2G00 L;  3GIS X;  4XLW A;  1P0S L;  1Q4G A;  1G2L B;  2Y7X B;  5F19 A;  4MMX B;  2FLB L;  3OLU A;  5JVY A;  1G1R A;  3N8W B;  4GU3 A;  1ATB A;  5K0H B;  3F6U L;  2OYE P;  1FF7 A;  2P94 L;  2WPH E;  1KKE A;  1CCV A;  1NFY B;  1Z6E L;  1EPH A;  3U73 A;  1LPG A;  1I0U A;  4JYV L;  1PRH A;  4X8V L;  1IVO C;  3R05 A;  2FLR L;  4ZXY L;  2VH0 B;  3TH3 L;  1HZ8 A;  1KLI L;  2EI8 B;  1PXX A;  2MGR A;  2Y38 A;  1CQE A;  2BOU A;  2EI7 B;  3KK6 A;  4LOR A;  3GCX E;  5KN5 C;  2BQ7 A;  1UZJ A;  1NT0 A;  4JZE L;  5IKV A;  3CFW A;  1EAI C;  1EQH A;  2RHP A;  4M11 A;  2Y5G L;  1LPZ A;  3FFG L;  4FM5 A;  4Y76 B;  3QMO A;  1FJS L;  3LN1 A;  5L2Y L;  4E1G A;  3SOV A;  3BT2 A;  2VVU L;  2Y7Z B;  1IQL L;  4COX A;  1FE2 A;  3LAQ A;  1ATA A;  1NZI A;  2AYL A;  1IQN L;  2P16 L;  3MQE A;  3HS6 A;  4D90 A;  2XBY L;  1K37 A;  1EMO A;  4X8S L;  2WPL E;  1LMM A;  1LK9 A;  3N8W A;  3K9X A;  4ZAE B;  1AUT L;  1NFW B;  2I9B A;  4CUD A;  2W2O E;  3Q3K B;  3V65 B;  1HRE A;  1IP0 A;  4RRX A;  1HJ7 A;  1M1X B;  3TK5 B;  2J2U B;  2WYG B;  2H9E L;  2ADX A;  3NJP C;  3ELA L;  4Z0K B;  3CEN L;  4YZU B;  3ZYJ B;  1PFX L;  1HRF A;  2P93 L;  1IQI L;  1YUG A;  5CKN A;  1V1I A;  4GU4 A;  1FAK L;  1KLJ L;  1WU1 B;  4BDX A;  1B9W A;  4BDW A;  3QCW A;  2WZP P;  3BT1 A;  3DEM A;  2PHB B;  1EPG A;  3Q7D A;  4ZH8 B;  1IOX A;  2GD4 A;  2MHP A;  3N8Y A;  4NG9 L;  2BT7 A;  2Y5H L;  1DX5 I;  1CCF A;  3U7U G;  3FCS B;  2VWO L;  1K36 A;  3ZYG A;  2KV4 A;  1IQM L;  1NFU B;  2MGP A;  2VWN L;  1HAE A;  3ASI A;  5COX A;  2W3K B; 
#chains in the Genus database with same CATH homology
 1XKA L;  4M10 A;  2VH6 B;  2PR3 B;  3HO3 A;  3IJE B;  2BO2 A;  2VWM K;  5JVZ A;  4BTU A;  3ZYI B;  1CVW L;  4Y7B B;  4NA9 L;  2J38 B;  4X8U L;  2Y81 B;  1ADX A;  6COX A;  5L2Z L;  1APO A;  2WPK E;  2YGO A;  2J94 B;  2Y80 B;  1N7D A;  1F0R B;  1L5G B;  1HCG B;  2WG4 B;  5CKM A;  2BZ6 L;  2JKH L;  4BXW A;  2P3U A;  1JL9 A;  1TLE A;  3HO4 A;  2BQ6 A;  2F9B L;  1G1Q A;  2BOK L;  2VWL L;  2XBV L;  2M74 A;  5L30 L;  2W2M E;  1V3X B;  1IQE L;  3TGF A;  2UWP B;  3NTB A;  4NGA L;  2K2S B;  2W3I B;  3M37 L;  3KL6 B;  1W8B L;  1JV2 B;  4RUT A;  2WYJ B;  2Y82 B;  1CVU A;  1IQJ L;  3M36 L;  1HAF A;  3SOQ A;  4BXS A;  2EI6 B;  1NQL B;  1LQD A;  1ATE A;  1RFN B;  1EZQ B;  2Q1J B;  3GCW E;  1QFK L;  1YO8 A;  4RRW A;  2BOX A;  1NFX B;  2WFT A;  4RRZ A;  1YUK B;  3H5C B;  4ZXX L;  1F7M A;  2WPM E;  4Z0L A;  1EPI A;  3P5B L;  3TK6 B;  1XFE A;  1FAX L;  2BMG A;  1W7X L;  1FFM A;  2VVC K;  5JW1 A;  1YUF A;  4MMZ B;  1U8C B;  3TZI A;  1COU A;  4XBM A;  1G2M B;  2RNL A;  4A94 C;  3KCG L;  2B7D L;  2YGQ A;  4X8T L;  4Y79 B;  3KQC L;  3IIT B;  2FD6 A;  5E8D A;  1KIG L;  2TGF A;  2J95 B;  5JB9 E;  3N8Y B;  1NPE B;  2J34 B;  3KQB L;  4O02 B;  1U67 A;  4Z6A L;  2J4I B;  2WG3 C;  1A3P A;  1XKB A;  1EGF A;  3LC3 B;  1JBU L;  3KRK A;  1Z6C A;  3HPT A;  2WPJ E;  2W26 B;  4YT6 L;  2P26 A;  3KQD L;  2DDU A;  3EGF A;  4BTT A;  3LN0 A;  1F0S B;  3ENS A;  2VVV L;  3LTG D;  5I46 L;  1P9J A;  5IKR A;  2P95 L;  3QH0 A;  5JBA E;  4Y7A B;  3POY A;  3KQE L;  2VJ3 A;  2W2Q E;  4AQT A;  2P28 B;  4D0E A;  4ISH L;  3SW2 A;  1L3Y A;  4LMF A;  3LC5 B;  1HT8 A;  1N1I A;  4RRY A;  4CUF A;  1MOX C;  1IQF L;  1CEJ A;  2P3T A;  1WHF A;  3PGH A;  1HX2 A;  2FZZ L;  1FSB A;  2NPR A;  4BTI A;  4RS0 A;  1BF9 A;  4ZHA B;  1KLO A;  2W2N E;  3SOB B;  4Y71 B;  2WPI E;  5F1A A;  5KIR A;  1O5D L;  1IGX A;  1LPK A;  1EPJ A;  1ZAQ A;  3N8X A;  2CJI B;  2P3F N;  2KL7 A;  4CUE A;  1MQ6 L;  2FLG A;  1PTH A;  2WFX B;  3F1S B;  4OTJ A;  3NTG A;  3HO5 A;  2UWL B;  1UZP A;  3S6X A;  2PUQ L;  1APQ A;  4YT7 L;  4G1M B;  4PH9 A;  1DVA L;  5IKQ A;  2Y5F L;  3N8Z A;  1UZQ A;  2OYU P;  1SZB A;  1IQK L;  2RA0 L;  3FBY A;  1X7A L;  1IGZ A;  2XC0 L;  2BOH A;  3HS5 A;  4O1Z A;  2I9A A;  2YGP A;  3LTF B;  5FDQ A;  1EBV A;  1UZK A;  1URK A;  1IQH L;  2XBX L;  4ISI L;  1PGE A;  3V64 C;  3LIW B;  4CSY A;  2W86 A;  2XC5 L;  1DQB A;  2W2P E;  1IJQ A;  1CX2 A;  4D0F A;  1G1T A;  2KB9 A;  2XC4 L;  2XBW L;  2K2T A;  4OTY A;  4C16 A;  1LMJ A;  3TBD A;  3N8V A;  1MQ5 L;  4JZF L;  2H9E C;  2KNI A;  1EQG A;  1TOZ A;  1KSN B;  5IKT A;  5JBC E;  1IQG L;  5JB8 E;  3C9A C;  1XDT R;  3NT1 A;  4XL1 A;  3RR3 A;  1GK5 A;  1TPG A;  2P3F L;  1G1S A;  1OB1 C;  1WHE A;  3BPS E;  2D1J B;  5CIS A;  5JBB E;  2UWO B;  1J9C L;  1EMN A;  1YGC L;  3CA7 A;  1HT5 A;  4Y6D B;  2BQW A;  4A7I A;  4MMY B;  1DDX A;  4TGF A;  3CS7 L;  1C5M F;  5CKQ A;  1DIY A;  1IOE L;  1F7E A;  3OLT A;  3HS7 A;  4JZD L;  3MDL A;  1ATD A;  4JYU L;  5EGM B;  2G00 L;  3GIS X;  4XLW A;  1P0S L;  1Q4G A;  1G2L B;  2Y7X B;  5F19 A;  4MMX B;  2FLB L;  3OLU A;  5JVY A;  1G1R A;  3N8W B;  1ATB A;  5K0H B;  3F6U L;  2OYE P;  1FF7 A;  2P94 L;  2WPH E;  1CCV A;  1NFY B;  1Z6E L;  1EPH A;  3U73 A;  1LPG A;  1I0U A;  4JYV L;  1PRH A;  4X8V L;  1IVO C;  3R05 A;  2FLR L;  4ZXY L;  2VH0 B;  3TH3 L;  1HZ8 A;  1KLI L;  2EI8 B;  1PXX A;  4LOR A;  2Y38 A;  2MGR A;  1CQE A;  2BOU A;  2EI7 B;  3KK6 A;  3GCX E;  5KN5 C;  2BQ7 A;  1UZJ A;  1NT0 A;  4JZE L;  5IKV A;  3CFW A;  1EAI C;  1EQH A;  2RHP A;  4M11 A;  2Y5G L;  1LPZ A;  3FFG L;  4FM5 A;  4Y76 B;  3QMO A;  1FJS L;  3LN1 A;  5L2Y L;  4E1G A;  3SOV A;  3BT2 A;  2VVU L;  2Y7Z B;  1IQL L;  4COX A;  1FE2 A;  3LAQ A;  1ATA A;  1NZI A;  2AYL A;  1IQN L;  2P16 L;  3MQE A;  3HS6 A;  4D90 A;  2XBY L;  1K37 A;  1EMO A;  4X8S L;  2WPL E;  1LMM A;  3N8W A;  3K9X A;  4ZAE B;  1AUT L;  1NFW B;  2I9B A;  4CUD A;  2W2O E;  3Q3K B;  3V65 B;  1HRE A;  1IP0 A;  4RRX A;  1HJ7 A;  1M1X B;  3TK5 B;  2J2U B;  2WYG B;  2H9E L;  2ADX A;  3NJP C;  3ELA L;  4Z0K B;  3CEN L;  4YZU B;  3ZYJ B;  1PFX L;  1HRF A;  2P93 L;  1IQI L;  1YUG A;  5CKN A;  1FAK L;  1KLJ L;  1WU1 B;  4BDX A;  1B9W A;  4BDW A;  3QCW A;  2WZP P;  3BT1 A;  3DEM A;  2PHB B;  1EPG A;  3Q7D A;  4ZH8 B;  1IOX A;  2GD4 A;  2MHP A;  3N8Y A;  4NG9 L;  2Y5H L;  1DX5 I;  1CCF A;  3U7U G;  3FCS B;  2VWO L;  1K36 A;  3ZYG A;  2KV4 A;  1IQM L;  1NFU B;  2MGP A;  2VWN L;  1HAE A;  3ASI A;  5COX A;  2W3K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...