1F7WA

Solution structure of c-terminal domain zipa
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
144
structure length
144
Chain Sequence
MDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN ZIPA
publication title Solution structure of ZipA, a crucial component of Escherichia coli cell division.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04354 ZipA_C ZipA, C-terminal FtsZ-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1400.10 Alpha Beta 2-Layer Sandwich Cell Division Protein Zipa; Chain: A, ZipA, C-terminal FtsZ-binding domain 1f7wA00
1F7WA 1F7XA 1Y2FA 1F47B 1S1SA 1F46A 1S1JA 1Y2GA
chains in the Genus database with same CATH superfamily
1F7WA 1F7XA 1Y2FA 1F47B 1S1SA 1F46A 1S1JA 1Y2GA
chains in the Genus database with same CATH topology
1F7WA 1F7XA 1Y2FA 1F47B 1S1SA 1F46A 1S1JA 1Y2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7W A;  1F7X A;  1Y2F A;  1F47 B;  1S1S A;  1F46 A;  1S1J A;  1Y2G A; 
#chains in the Genus database with same CATH topology
 1F7W A;  1F7X A;  1Y2F A;  1F47 B;  1S1S A;  1F46 A;  1S1J A;  1Y2G A; 
#chains in the Genus database with same CATH homology
 1F7W A;  1F7X A;  1Y2F A;  1F47 B;  1S1S A;  1F46 A;  1S1J A;  1Y2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...