1F7ZA

Rat trypsinogen k15a complexed with bovine pancreatic trypsin inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
213
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN II, ANIONIC
publication title The energetic cost of induced fit catalysis: Crystal structures of trypsinogen mutants with enhanced activity and inhibitor affinity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 213
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f7zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f7zA02
4RKOB 1YF4A 2VGCB 3TK5A 1TABE 3TIUA 3SV8A 5CE1A 2F9UA 3A84A 2VH6A 1O5BB 2Y5FA 6GCHG 3SGQE 2THFB 3VXEH 4X1SU 4YLQH 3NXPA 1N8OC 2BDBA 2JH5D 1GBKA 5J4SA 2G00A 2UUKB 1GG6C 3QGNB 1ZOMA 3HPTB 1GVKB 1D6RA 2WPMS 3QLPH 2ZU4A 3SNEA 2EA3A 1LMWB 1FDPA 1VZQH 1ZGVA 1C1OA 4WXIA 1WQVH 2GP9B 1UTNA 1ZLRA 1O3IA 2GVFA 3BSQA 3SUFA 1ANEA 2BXTH 3E16B 2O8UA 1W11U 8ESTE 1AUJA 1P10A 5AFYH 3GCNA 1FIWA 1LVMA 4WVPE 4DIIH 1ETTH 1A61H 1PPGE 1YC0A 3SORA 1EPTA 3RU4D 5LPRA 1SLXB 3KN2A 3MO6A 3DD2H 2ZU5A 4FUHA 1TMUH 5T6DA 1UTJA 2Y80A 1TA6A 3K6YA 2I6SA 1F92A 3A87A 4GCHG 3ZZ3A 3MOCA 1YPMH 1G2LA 3LGVA 4LOYH 2B9LA 1G32B 1CT4E 3K65B 1ELEE 1CBWC 2OCVB 3SU1A 1TRYA 3SU3A 1Y3XA 3MO3A 1O2YA 5EXLA 5K0HA 1J15A 4WF8A 1XUKA 1ZZZA 2ZTZA 3ZVFA 1TX7A 1FMGA 2BDYA 4UFDH 1L2EA 1PQAA 1SMFE 3U9AH 1GJ4H 3ZV8A 4ZKOU 1O2WA 2P3FH 3UR6A 1XXDA 1QBNA 1BBRH 3FP6E 2EI6A 4K69A 3AAUA 3FZDA 1YPGH 4Y76A 1GJCB 2FO9A 2ZWLH 1EB1H 3GCHC 4NZLA 4TY6A 3OSYA 2WV5A 2OC0A 4CRDA 3LOXA 3RXKA 1CVWH 1SI5H 1NROH 3AW1A 1L4DA 2ZCHP 2B8OH 4ZKSU 5JBCS 3RXRA 3HATH 1NN6A 2XBVA 1O3AA 5C1YA 2VWLA 1HAXB 5EG4A 1P2JA 1OWHA 1O2KA 1IHSH 1SGCA 1MD7A 2Y7ZA 4THNH 4AZ2B 4CBOA 1TONA 1O2GH 2PGBB 2QN5T 1QJ1B 5AHGH 3S69A 3O8BA 2IPHA 1DXWA 4TPYA 3M3TA 1GBLA 4UONA 3QX5H 2A4QA 3UPEA 5F8TA 2R2MB 1IOEA 3RXPA 1PPZA 3MYWA 1FUJA 2J94A 1AFQC 1BMAA 1HFDA 2SGEE 3MMGA 3UY9A 2ALVA 3A7TA 1HXFH 3BTKE 1O34A 1VCPA 1ZHPA 1D4PB 1EQ9A 4A1TA 4ZHLU 1DS2E 1BMLA 4DIHH 1FPHH 3BEIB 3GCTG 3RXMA 1HRTH 4WMEA 1SLWB 5EXMA 1ETSH 1AVGH 4DG4A 1OP8A 1KXAA 2OC8A 1HIAA 1SQTA 3U8RH 2HOBA 5EW2H 2P93A 1F5KU 3BTME 5EODA 2BD7A 1DITH 3RC6A 1ZHMA 3H7TA 3STIA 1SGFA 1UK3A 1Z8IB 1EKBB 3SU4A 1CT2E 1EAWA 1EXFA 1E34B 1EB2A 2AEIH 2YNBA 3U1IB 3E0NB 1CSOE 1XKBC 2ILNA 1P06A 1XKAC 4OS4A 1ZR0A 5ESBA 2PKAA 5FCKA 3ZZAA 1O3CA 3T5FH 4AGKA 2FYRA 2AGEX 4ZXXH 2EI7A 3T29A 4IMZA 4MPVA 5J4QA 2Z94A 3RXQA 3K6ZA 1SQAA 2FDAA 4JK6A 4HI3A 4FU9A 1W2KH 1UTQA 2XBWA 2CHAB 1GBMA 3CENA 3GICB 2BVRH 3A8DA 5JYIA 2BZAA 2DE9A 4ABFA 1FN6A 2P94A 1RD3B 3M5MA 2A4GA 4X8SH 3C27B 1Z8JB 3SU2A 3D23A 2BDIA 1BRAA 2VNTA 3M36A 2TGAA 1NS3A 4X1QU 1YYY1 4D9RA 1Z8GA 3AAVA 1WV7H 1V2WT 1MBQA 4ABEA 1AB9B 1BTPA 4UD9H 3ATIA 1W7XH 1MZAA 1V2TT 2SGQE 2PGQB 4Q80A 1UTOA 4B74A 5HXFA 4IS5A 3SU0A 1K1LA 4AFQA 3FFGA 5F8ZA 2VIWA 1O2JA 1OXGA 4X6MA 2WINI 3S7KB 4D76A 1GI6A 2O8TA 2OUAA 4I8JA 3MTYA 3P8NA 4AORA 1XUHA 4FUEA 1O31A 4HTCH 5EU8A 2BLQA 3VXFH 1C2EA 1A5GH 4I8KA 3UNSA 1P2QA 4XBBA 5A8ZA 3SUGA 3RM0H 2P8OC 2QXHA 1G3DA 3JZ2B 1S5SA 2ZP0H 1JIRA 1KSNA 3MU1A 4H6SB 1O3GA 1TBQH 3GDUA 2F9OA 4RSPA 3T62A 1K9OE 4ABAA 1QNJA 1PJPA 2GV7A 3SGAE 1HAYB 2W26A 1Y5AT 4XBCA 5A0AE 2QA9E 4X8TH 2Z3DA 1XUJA 1A46H 1GI3A 1AO5A 1HAZB 3R3GB 2RDLA 3RXBA 3ITIA 1VCQA 1G36A 1LHDH 2ANWA 2XRCA 2C3SA 1T8LA 1W0YH 3RC4A 1GHAF 1ANDA 1S0QA 4YT6H 4FUGA 1LQDB 1ESBA 1ZRKA 3NPSA 4AOQA 1C5MD 2PSYA 1V2MT 2J38A 4INKA 4BAOB 1PPEE 1J8AA 3F9FA 4E7RG 5GXPA 1MKWK 2VJ1A 1P57B 3BTEE 4ABDA 1TMBH 4JMYA 1GI7B 1O5GH 4HGCA 3SUDA 1DY8A 4BANB 3TPIZ 1O5CB 4SGAE 4FUCA 2ZTYA 4Y7BA 1O2LA 3S9AA 2GX4A 2VWOA 2ZHWH 4MPUA 4ZH8A 1DLEA 1JXPA 1BJUA 2OBQA 1QL9A 4GSOA 1RIWB 1C1RA 3LH3A 4AG1A 4TY7A 1ACBE 3AVZA 2BDHA 1J17T 1JMOH 4Q7ZA 4AYVB 3ZYDA 1C1PA 2BY8X 3MU4A 1SGDE 4X8UH 2PKSB 3PO1C 1GHBF 5HM2A 2QCYA 1GL1A 1Q31A 2ZDLA 1TNKA 1WOFA 4TYDA 1HJ8A 1NFYA 1QY6A 4NA7A 1L1NA 1J14A 3ZYEA 1O33A 1GVZA 5IYTA 3RC5A 1GBEA 4F49A 1TGNA 1PYTC 1GCTB 2R2WU 4ESTE 1ZSLA 1FIZA 1CA0C 4NIWA 4ZHMU 3GISB 2HRVA 1INCA 3L6PA 4CBNA 1A7SA 2AS9A 3NCLA 4B76A 4GUXA 2W7SA 1NT1A 1GGDC 2G52A 4I7YH 3P6ZB 2HLCA 1C5QA 1MQ6A 1YPHC 2OQUA 1BZXE 3LONA 1BRUP 1ZSKA 2AIQA 2GCHG 3ATLA 3M3SA 1AE8H 3A85A 3MO9A 3O8RA 3GY8A 4ZMAH 1AHTH 5JB8S 1S6FA 1Y3YA 3ZVGA 1ELDE 5HMAA 1MU6B 2QXGA 1UJ1A 4AFZA 3V13A 2ZU2A 4BXWA 1AVWA 1A2CH 2LNCA 3BG4C 1QQUA 2CMYA 3M5LA 1NRPH 1PFXC 1PQ7A 1BMNH 3MNCA 3F1SB 3O8CA 1AGJA 2BTCE 1PQ8A 1YCPK 3LDXH 3FANA 5JBAS 1QBOA 2VWNA 3FVFB 4I8HA 3JZ1B 3MWIU 3KQBA 3SHCH 3SNDA 4DY7B 3DA9B 4NCYA 1HGTH 3TK9A 1O3NA 2BD4A 1WTGH 7GCHG 1TBZH 2R0LA 2R3UA 3KQCA 1HAIH 1O3DA 2RCEA 1VGCB 1UK2A 3LJJA 1C2JA 1HIAB 1GHXH 4NA8A 1QBVH 2ZC9H 1Z1IA 5DP4A 2WPJS 3TVJB 2GMTB 3B23B 2SGAA 1HV7A 2RG3A 3RXCA 3PM3A 4Y71A 4BAHB 3KF2A 2OTVA 2TIOA 1AKSA 2ZFRH 1CGHA 1LHCH 1GI5A 2A1DB 1IAUA 3UIRA 3KEEA 5JPMH 1BB0B 1V2PT 1OSSA 5EQSA 2HPQH 9ESTA 1IHTH 3G01A 2OD3B 1HBTH 1O2OA 1ELCA 1JRSA 4CREA 1A3BH 1WUNH 1C1UH 2J4IA 1O5AB 4AYYB 2GD4B 2ZA5A 1GJ9B 1T31A 1T8OA 1IQFA 3UNQA 2FI5E 2J9NA 1QGFA 1UTPA 1N6XA 3RMOH 5E0JA 1EZSC 4B2BA 1P3CA 3PLPA 1QB1A 1EAIA 4A92A 4DT7B 2IJOB 4BTUB 1T4VH 3PMBB 3UFAA 3BIVH 4HFPB 3A89A 4DW2U 1N6YA 3FP7E 2F9VA 3TGJE 1BTZA 5TJXA 4F4OC 1IQLA 5TCAA 4NGAH 5DKMA 1D6WA 3CS0A 4E05H 2BD3A 1ELAA 2PTCE 2XNIA 1Y5BT 1TMTH 1THRH 2AGGX 2ALPA 1UVPA 2C8XB 3GDSA 3GY2A 2ZQ1A 1XVOA 1MD8A 1F7ZA 1GBHA 2JH6D 1GHWH 2ZPSA 1DUAA 1O37A 1J9CH 2A5KA 3MNSA 1GHYH 1QRXA 7ESTE 1D9IA 1E36B 1KXFA 3I29A 2GGVB 1TOMH 1THPB 1ZYOA 1UK4A 2BVXH 2WV4A 2ZU3A 4E7NA 2BZ6H 4JK5A 5EPNA 2W3IA 1NM6A 4JZDH 3T27A 4FUBA 1GHVH 1V2NT 5G4BA 4TWYA 1RRKA 1AFQB 3MH4A 1SR5C 4Y0ZE 4DCDA 1Y3UA 1IQGA 4K2YA 2P3UB 4ISLA 2WPKS 2VIQA 5FBIA 8KME2 3FZZA 2XWBI 2ZDNA 4NSYA 1DXPA 1RXPA 2Z9IA 3RXTA 3SQEE 2PUQH 1YCPM 1ELTA 1HAHH 1VR1H 1H9HE 1RTLA 2B5TB 2TGPZ 3OYPA 1P0SH 2Z9JA 2FOGA 3TK6A 1GMHG 2ZEBA 1BHXB 1EJMA 2H5DA 5HYOA 1NFXA 1V2UT 1SVPA 2ZPQA 3R0FA 1L0ZA 2BDGA 1UMAH 1BT7A 3RXLA 2STAE 3GY4A 3PMAB 1SOZA 1C2FA 1ESAA 2P95A 2ZCLP 4NWKA 5EW1H 3BEFB 1CGIE 1J16A 3EDXB 2QGRA 4U30A 4Y11E 2FODA 4KP0A 2ZG0H 4D7GA 4B1TA 3ODFA 4JZFH 4R8TB 3RXHA 3VGCC 1PYTD 2PHBA 2Z7FE 1C5YB 1LHFH 1P02A 1AMHA 2D1JA 1C2MA 2CGAA 5CHAC 1EOLA 2H5CA 2ZTXA 3E8LA 1O5EH 2FOEA 1TB6H 2VWMA 3K2UA 1BHXF 1T7CA 4ZKRU 1LDTT 1GL0E 1MKXH 1C9TA 4J1YA 1GHZA 4DJZB 3PMHB 1OYQA 2BM2A 4NFEA 1HCGA 2ODYB 3DFJA 4CR5A 1ZRBA 4YTAA 2Z9KA 3ZZCA 2ZPRA 2HALA 4H4FA 3Q3YA 4NIVA 1LCYA 3BTQE 1YPKH 4JZEH 3RMMH 1UTMA 1S0RA 2IOTA 4YESB 2NU1E 2FMJA 1ID5H 5E8EH 1MUEB 1TLDA 1O3HA 5FPTA 1PPHE 2EI8A 1HAPH 1B7XB 1C5PA 2VH0A 1QB6A 3Q3KA 1F0RA 1EAUA 3SHAH 1P3EA 1T8MA 3BTDE 1ZPBA 3LH1A 2NU4E 5C1UA 3PB1E 1EZUC 1MCTA 4X6OA 3RXEA 1C4U2 1C2LA 5A09A 1DM4B 1G3CA 1TYNA 2BLOA 1IQEA 3LKWA 3TGIE 1BRBE 3RP2A 3SU6A 2HPPH 3TJVA 1YKTA 3PWCA 2XBYA 3RXJA 3BTHE 2TPIZ 2ZFTA 1P2MA 4GVUA 3GY5A 2OBOA 1LKBA 4NWLA 1AWHB 1K1PA 2J95A 4X1PU 2J2UA 2A2QH 3A8BA 2BQ6B 5EOKA 2XBXA 1EP6A 5A0BA 4FU8A 5E0GA 1O39A 4X6NA 5FX5A 2QF0A 4CR9A 3F9HA 1MAYA 1F2SE 1BIOA 3DT0H 2C8WB 3ENSB 4XBDA 1EZXC 4BOHA 3A7ZA 4FXGH 1NU7B 2P59A 4BNRA 4B2AA 2XC5A 3T26A 1DFPA 1W7GH 1JOUB 1UVUH 1BDAA 4Y79A 4K5ZA 4X2XA 5DP5A 2C8YB 1LVYA 4K8BA 4ABHA 1BJVA 3SOSA 1MMJN 4ISIH 1YGCH 1TGTA 3L3TA 2R0KA 2FESH 2TGDA 2AMPA 1LVBA 2O8LA 2P16A 2VGCC 3PLBA 1QR3E 1FAKH 1KTTB 4I8LA 4U2WA 1OKXA 4WY3A 2V6NA 4NA9H 1SHHB 1P09A 3TH2H 5LPFA 3TITA 3M7TA 2BDAA 4X0WU 1EOJA 3SUEA 1IQMA 1NESE 4K60A 1AKSB 2WPHS 4WXVA 1Q2WA 1O3PB 2ZFFH 3PWBA 2HNTE 3WY8A 4AB8A 5FXLA 4PROA 4TWWA 9LPRA 3MHWU 1SGTA 5EQRA 1HLTH 1ZHRA 2BY9X 5I46H 3MNXA 4K1EA 3BF6H 2FS9A 1M9UA 1A0HB 2FZZA 1JIMA 4NFFA 1O3EA 1LHGH 2M5TA 2A32A 3TH3H 4CHAC 3PO1B 3IG6B 4B71A 4ISOA 4B2CA 3P95A 4NIXA 3UNRA 5DJ7A 3MFJA 5PTPA 4X1RU 1H9LB 1OP2A 2ZGCA 1IQHA 2WUCA 3V7TA 1CA0B 4O03A 1TPOA 2F9NA 2KAIA 1YLDA 2C4FH 2J92A 1GI0A 5L2ZH 1C5VA 1GWAA 2A5AA 3HGPA 1GGDB 1GI9B 3SI4H 1B5GH 4UE7H 1CT0E 4UFFH 1KYNA 2DE8A 4KGAA 2FOCA 3RXAA 4BTTB 4Q7XA 1LTOA 2WUBA 3VB6A 3ATWA 1O2VA 1FY3A 1SG8B 2A2XH 5JDUB 3VB4A 2ZGXH 3MI4A 4OGXA 5F6MA 1ZJDA 1FZZA 2NU0E 3SV7A 2F9PA 2Y5GA 1T8NA 2BHGA 1SFQB 2ZU1A 3BG4B 4X2VA 1QJ7B 5DG6A 4BAMB 3KHVA 1LPKB 2BX3A 2FX6A 3RXGA 1MTNB 2VIOA 2Y82A 4K1TA 2G5VA 2QY0B 4CRCA 1CHOG 1FJSA 1Y8TA 2FOAA 1NU9A 3F9EA 1GMDG 4IW4E 5T3HA 2EC9H 3GYLB 1VITF 3P8OA 1LO6A 4E06H 2PV9B 1V2LT 3BG8A 4Y8ZA 1GJ7B 2BY5X 1O5DH 3GCOA 1KLIH 4YOGA 1HUTH 2ZFPH 1SGPE 1EASA 2ZGJA 2JH0D 2OP9A 5GPIB 5C5OA 2OINA 3EAJA 2ZF0H 2XW9A 4YZUA 1HJAC 4X1NU 1WSSH 4ZHAA 1S84A 2XCNA 4MLFB 3LC5A 4OGYA 4Y10E 1TBRH 2BLVA 3SGBE 1AFEH 1ANCA 1P9SA 2ANKH 1K1OA 3A7XA 3OX7U 1FQ3A 3UWIA 1O3LA 2GCTB 1TAWA 2AIPA 2Z3EA 4D9QA 3HK3B 3T2NA 1C5ZB 1FPCH 1O2QA 5DP7A 3LIWA 4YLUA 4A5TS 2VIDA 4Y0YE 1O3FA 2GTBA 3GY3A 1NC6A 2ZDAH 3SNCA 1DICA 1L4ZA 5FX6A 1W14U 1GBTA 1QL7A 2ZCKP 1TNJA 4X2YA 2FLBH 4FUJA 1Z71A 3UQVA 2OQ5A 5FPSA 1ELFA 2LPRA 1QRZA 1Z7KA 3RXFA 4AG2A 3HKJB 1SC8U 4Y7AA 4OS5A 3M37A 1GBIA 1TOCB 1O2PA 1E35B 2AFQB 3I77A 3KQDA 1CHGA 1O3KA 1UO6A 4YT7H 4UFGH 1F5RA 1H4WA 3SJ9A 1K2I1 2BMGB 5CMXH 1C5NH 3KL6A 1AIXH 1GMCG 3LT3A 2BY7X 1GBCA 3OY5U 3URCA 3KCGH 1C1SA 4WH6A 1HB0B 1TPSA 1EATA 5C5NA 3U1JB 3ODDA 2XWAA 3ATMA 1GJBB 1TX6A 4B73A 2O8MA 3RXOA 3MU5A 4JYVH 4R0IA 1X7AC 1K21H 1ZPCA 5L6NH 1HDTH 2CHAC 1D3QB 3P70B 2BD9A 1RGQA 3M7UA 1V2QT 1RFNA 1WYKA 1ZTJA 2HNTF 3P92A 2FM2A 2A5IA 4I33A 2FXRA 6LPRA 3VFEA 3F68H 1QB9A 1MAXA 2QF3A 5GDSH 3EA7A 1Q3XA 1OOKB 4J2YB 2Y5HA 1C5OH 1CU1A 4MPXA 1GJ8B 4FUIA 3NUMA 2TBSA 2TGTA 3UQOA 1GBAA 4ZXYH 3B8JA 1OYTH 3ZVBA 2O9QA 2GCHF 1A5HA 1TNLA 1C2DA 1E37B 4NG9H 1WCZA 3RU4T 1OWJA 3LGTA 3SNBA 2BY6X 2UWOA 2ZGBH 3E91A 1MH0A 1GJ6A 2A4RA 3S9BA 1G30B 4O3TA 2BD2A 1RTKA 3D49H 1QA7A 3ZVCA 4I32A 1DY9A 2V35A 2A7CA 1AE5A 2HWLB 2ZDMA 1DOJA 2Q1JA 1TIOA 1MTSA 3DHKH 4CRFA 1TALA 4BAQB 3GY6A 4IBLH 6CHAC 1YCPH 3UTUH 4IMQA 4HZHA 1N8OB 2VVVA 2CF8H 3ELAH 2CV3A 7GCHF 2G4TA 1GG6B 2Z9LA 1UCYK 1C1MA 4IN1A 1YPJH 1OWEA 1Y3VA 2ODQA 4A7IB 2BOKA 5GWZA 3U8OH 1TGSZ 1TGCA 1H8DH 1DT2A 1LPZB 2ZFQH 1EJAA 2AMQA 1XXFA 3E0PB 2BD8A 1MCVA 1O32A 1TPPA 4WH8A 2Y81A 2ESTE 4BAKB 1UVOA 3QUMP 3ZVAA 1TA2A 1OPHB 3RXUA 1QURH 1EP5A 2ZECA 3EGKH 4LK4A 2A0QB 3QZQA 2BLWA 5CHAB 2C8ZB 2A4OA 4NZQA 1XM1A 2SNVA 4XDEA 1QRWA 5FPYA 5L2YH 5EGMA 2ANMH 1LPGB 1WAYB 3M7QA 5C3NA 3SZNA 8GCHF 4JCNA 2NWNA 1IQNA 4A1XA 5FAHA 2V0BA 3M35A 1SB1H 2ZKSA 3TGKE 3ZV9A 1O2XA 1CBWB 1F5LA 4WWYA 3ZZ5A 3BIUH 3EA8A 1DSTA 1O2IA 1ZTLA 2WYJA 4AN7A 1W13U 2VVUA 1P04A 4D7FA 1EZQA 3W94A 3NKKA 3P17H 5DP3A 4AGJA 1GBBA 4Z0KA 5EPYA 3LC3A 1EPTC 4GHTA 3A80A 1YPEH 4LXBH 1AZ8A 1UTLM 1C5TA 1YPLH 2UUFB 1P12E 1C4V2 1DX5M 2BYAX 1XX9A 2XC0A 2ODPA 2UUYA 4MG3A 4XFQA 2KAIB 5EXNA 1VJ9U 4MNVA 3GCHB 1UVSH 1W12U 4GPGA 4RKJB 3SV9A 3QN7A 1SGFG 1FN8A 1XUGA 1SGQE 4ISNA 1FNIA 1ZMNA 3LGWA 2FI3E 5C1XA 4XE4A 1DDJA 1GDNA 2FEQH 5A0CA 1DE7H 5GCHF 1BITA 1KXEA 2Q6DA 2BOHB 1ORFA 4AX9H 4UEHH 5FCRA 4KKDA 1DWBH 2FPZA 4JYTA 1Y3WA 1Z1JA 3KQEA 3MH5A 2QV1A 1QFKH 3IITA 3TNSA 3VB5A 1FAXA 1T32A 4VGCC 5DPAA 7LPRA 1PPFE 5DP9A 1SGNE 1Z6EA 1W10U 2WYGA 6GCHF 3CP7A 4MTBA 1U6QA 1GMHF 1BRCE 1GI4A 4MNYA 1K22H 3SJOA 2FOFA 3A82A 1C2KA 3PV4A 4MNXA 1BOQA 3Q3XA 3V0XA 1G2MA 2ASUB 1P11E 1MTUA 1RTFB 3I78A 4KTCA 4X6PA 3OU0A 4I31A 2GZ8A 2B7DH 3ZZ7A 1H1BA 5T6GA 2PSXA 2A31A 3QDZB 1BA8B 4IC6A 2PWXA 3TJOA 1CO7E 1BQYA 2J34A 5ABWA 1O2RA 1TFXA 1SGYE 5HGGA 2V3OH 3OTJE 3M5OA 1V2JT 2FOHA 2Z3CA 4CH8B 1NRQH 1VGCC 3M61U 1ANBA 1D3DB 3MU8A 3UR9A 1ABIH 2FTLE 1A3EH 5JBBS 3NK8A 4O3UA 4B75A 4GCHF 1H8IH 5FHTA 3SO3A 5C67A 3A86A 2GMTC 4CHAB 3FP8E 2BQWB 4IN2A 2OLGA 3SU5A 1V2ST 2D8WA 1OS8A 2H9TH 4Q7YA 1KXDA 1ELGA 2VVCA 3LU9B 3TJNA 5IDKA 3RXIA 2H9EH 1KDQA 1GI2A 3SV6A 3M5NA 3RMNH 3MNBA 4X2WA 3A81A 1MKXK 1ELVA 1D3PB 1OWIA 1DWCH 3GOVB 5F8XA 3S7HB 1KLTA 2I6QA 3RM2H 1C2IA 2CXVA 3RU4E 3SN8A 4KELA 3TLOA 2ZDVH 1SQOA 1P9UA 1V6DA 1OX1A 2ZHQH 2ZHEH 4Y8XA 1HPGA 1TNGA 4JZ1A 3BEUA 3ZZBA 5LPEA 5A8XA 1YPHE 3LGYA 2BQ7B 1HYLA 1RJXB 3RDZA 1P8VC 2QAAA 5AFZH 1HAOH 4Y6DA 2A45B 3PTBA 3TU7H 2R3YA 3ZZDA 3BV9B 2G51A 2H6MA 3MH6A 4INLA 1BBRK 3PMJA 3BTWE 1G3BA 1S81A 3VPKA 3UOPA 1SGIB 1BTWA 4WMDA 1TRMA 1FY1A 2P8OB 1DANH 5I25A 3PYHA 3F6UH 3RUOA 4U01A 3V12A 1C9PA 5E0HA 1GBFA 2VIVA 2FP7B 5C20A 2FS8A 1EJNA 2SGDE 2SNWA 3VB3A 3GY7A 1PQ5A 1PPBH 1HJAB 1GI1A 3M3VA 2UUJB 2OC7A 1ARCA 2JETC 3QGJA 1SSXA 3GCTF 1DSUA 2AYWA 4TPIZ 4CH2B 1BTHH 1MU8B 1LHEH 3TH4H 1HJ9A 3NWUA 3P8GA 3E6PH 4U32A 1RS0A 1UHBA 2GKVE 1YLCA 2GDDA 2D2DA 3STJA 3LJOA 3SQHE 3CS7A 3HKIB 3AW0A 5HM9A 1O3MA 3N7OA 2XC4A 1FV9A 2GT8A 2BX4A 4MVNA 1Y59T 3A7VA 3S9CA 3RMLH 2ZI2H 2CJIA 1BTYA 1ZPZA 2HGTH 2OXSA 1BTUA 1C5XB 2Z6BD 4CRAA 2C93B 2DUCA 4YO9A 1F0SA 5T6FA 4XSKU 1ABJH 3D65E 1K1JA 2YOLA 4ZAEA 3ZVEA 4YOIA 1TNHA 3SI3H 1VITH 2WPLS 4AFUA 4Z6AH 1C2HA 1W8BH 4Y8YA 1HAVA 3EYDA 1AI8H 1S85A 4OS7A 5DP6A 1YM0A 5GIBA 1FY8E 2SGPE 1ELBA 3RXVA 1TQ7B 3BTTE 2BVSH 1S83A 1AN1E 3UWJH 2GDEH 3LGUA 3V3MA 3PTNA 1SLUB 1FY5A 1C4Y2 4RN6A 1JBUH 1B0FA 1O3OA 5A2MH 5A8YA 4ASHA 4ISHH 4OS2A 3H7OA 1XUFA 3E3TA 1AQ7A 3T25A 2Q6GA 4ZKNU 1NFWA 2ZHDA 4YOJA 2ZFSA 5JB9S 1AU8A 2FX4A 3KIDU 1BCUH 5BPEA 1C1VH 1QL8A 2FIRH 3SBKA 1AVXA 3KNXA 5EQQA 1AWFH 2Q6FA 3SJIA 1ZMLA 1NRRH 4A6LA 2G8TA 2AERH 1O5FH 2XYAA 2F91A 1FONA 1C2GA 4ABJA 1MZDA 1GVLA 7KMEH 1V3XA 2GZ7A 4BXSA 2ZNKH 2CN0H 2GT7A 3QK1A 4Q2KA 1FLEE 1LVOA 3BN9A 2ULLA 2SFAA 1MBMA 3BTFE 4KTSA 1WTHD 1P2NA 2W3KA 3SJKA 3SV2H 4FUDA 1N1LA 1JRTA 1CHOF 1C1NA 1O36A 1VJAU 1C5SA 4A1VA 1C5WB 1G9IE 1GMDF 1SPJA 4MQAA 4DURA 3Q76A 2H2ZA 1Z6JH 2QC2A 1K1NA 2WPIS 6CHAB 2ZZUH 1SHYA 2PW8H 2ZIQH 3A7YA 5H4IB 1HNEE 1TQ0B 2ZHFH 5FBEA 3U98H 1C5UA 2G81E 1GJDB 4OS1A 3A8AA 4NIYA 1FXYA 3PROA 1AD8H 2ZDKA 1KIGH 1P2IA 2AGIX 3O8DA 1L1GA 1GBJA 1G37A 2Z9GA 2ANYA 2BB4A 1VITG 1MTWA 2G4UA 1YBWA 4CRGA 2ZO3H 1OWKA 2XTTB 3U69H 1L1JA 3ZZ8A 1SBWA 3NZIA 1A0JA 1NY22 1NFUA 3SJ8A 4X8VH 1ZGIA 2F9BH 1GDUA 1O2MA 1BTXA 2Y6TA 4DGJA 1K28D 2NU2E 1AZZA 1QIXB 1W3CA 4INHA 1Z8RA 4SGBE 1MKWH 4MPWA 1CE5A 1DPOA 3A88A 2YNAA 4FUFA 1GHAG 2A7HA 3HK6B 1A0LA 1AY6H 5DK1A 1V2VT 1ETRH 1KY9A 1UCYE 2AH4X 1NRNH 3E90B 1O2SA 1O2UA 1P03A 1DLKB 2IN2A 1O30A 1TPAE 2ZGHA 1TNIA 4IC5A 1TE0A 1G3EA 1GMCF 1QQ4A 1UTKA 1P05A 3HGNA 4I8GA 1SFIA 1EPTB 4JYUH 1KDQB 4M7GA 3A83A 4YM9A 5DGJA 5TCCA 4O97A 3MH7A 4QT8C 3S0NA 1HXEH 1HAGE 1C1TA 2OC1A 2FOMB 5LGOA 1TRNA 4NSVA 2BD5A 3SW2B 4ABIA 2HVXA 1DWEH 2G55A 1MTVA 5AVDA 2STBE 3ZZ4A 3H5CB 2VIPA 4GAWA 1ARBA 1DWDH 1ZJKA 3LPRA 5E2PA 2FYQA 1TX8A 3EE0B 2F83A 1EX3A 1MQ5A 1QTFA 1SGEE 3A8CA 1D3TB 1O3JA 3GDVA 1GHBG 1FY4A 2EEKA 4K8YA 1K1IA 3E1XB 2VINA 1K1MA 4H6TA 1IQJA 3Q00A 2TRMA 1CQQA 1V2OT 1KTSB 1SGRE 1XUIA 1AB9C 2UWLA 1C5LH 2BDCA 5LH8A 4OS6A 4AB9A 1C1WH 2V3HH 1ESTA 5K7RA 3LGIA 2FTMA 3RXSA 2D26C 1E38B 1ZTKA 4KTUA 1O38A 3C1KA 4VGCB 2F3CE 3UOUA 5C2ZA 2RA0A 1WU1A 4K3JA 4DOQA 1DUEA 1TWXB 4D8NA 1A4WH 3KGPA 4FU7A 3ZZ9A 2ZQ2A 3UUZA 3RLYH 1LKAA 2PFEA 1QCPA 3W95A 1F0UA 3OY6U 4MDSA 5SGAE 3ZVDA 1E0FD 2NU3E 1GJAB 4GHQA 4LZ1H 1O0DH 1O2NA 3ESTA 1SL3A 1IQIA 1EAXA 2P3TB 1XVMA 4UFEH 3B9FH 4ZUHA 3RLWH 1H9IE 1GDQA 3L33A 2UWPA 1MTNC 1O2TA 1UCYH 3K9XB 3IWMA 1A5IA 1CA8B 2QXJA 3DFLA 1UHBB 1GJ5H 5L30H 1GBDA 4BTIB 1IQKA 4JZIA 1ZSJA 1V2RT 3T28A 2H1UA 1GCDA 4K1SA 1C5RA 6ESTA 2W7UA 1NTPA 1NZQH 3VGCB 5BRRE 2QYIA 1DVAH 4O9VA 1B0EA 2CF9H 3EQ0H 2QIQA 3GYMA 3QTOH 1UVTH 1GI8B 1CGJE 1SOTA 3QZRA 1OP0A 2GCTC 1O2ZA 2GZ9A 1WBGB 2XXLA 3EA9A 1VCWA 3ZZ6A 4WMFA 2FWWA 3TJUA 1C1QA 5DP8A 1HAVB 2W5EA 2A7JA 1W0ZU 1V2KT 1S82A 3VEQB 1PPCE 3UREA 1EUFA 1TGBA 2PR3A 3QWCH 3RXDA 2PKAB 4UDWH 2SGFE 2FOBA 2G5NA 1WQSA 1QHRB 4MNWA 2BXUH 1KXCA 1YP9A 3BTGE 3QTVH 5E2OA 3FAOA 8GCHG 2HNTC 3A7WA 5AF9H 1KLJH 1JWTA 1ZMJA 3DUXH 1LQEA 2B0FA 1O2HA 1RIWC 4CRBA 1AUTC 2XCFA 4ZROA 1BUIA 2RA3A 3F9GA 1OWDA 4ABBA 2QXIA 3MU0A 4AFSA 5B6OA 3Q77A 1S6HA 1QA0A 1KXBA 1P2KA 2PKSC 1A1RA 1SLVB 3QO6A 2VB0A 4LZ4B 1Y5UT 4H42U 4GLYA 3TNTA 1BMMH 4FVBA 4WJG2 2PUXB 1XMNB 1GCTC 2PTNA 1P2OA 2FI4E 1QJ6B 5F03A 1O3BA 2K1QA 2VU8E 3VB7A 1NO9H 5DO4H 2H9HA 2O8WA 4FVDA 1P01A 1NPMA 2Y7XA 2C90B 5GJ4B 3AASA 3SNAA 4IGDA 1GPZA 1T4UH 2JKHA 5JBTA 2JETB 3P8FA 5GCHG 5ETXA 3D62A 4ABGA 1THSH 1FI8A 3U8TH 1F0TA 1BBRE 2AMDA 2R9PA 1O35A 2PLXA 3PLKA 4XOJA 1NRSH 3ATKA 2GV6A 8LPRA 5ESTE 2FLRH 4DVAU 3URDA
chains in the Genus database with same CATH superfamily
4RKOB 1YF4A 2VGCB 3TK5A 1TABE 3TIUA 3SV8A 5CE1A 2F9UA 3A84A 2VH6A 1O5BB 2Y5FA 6GCHG 3SGQE 2THFB 3VXEH 4X1SU 4B6FA 4YLQH 3NXPA 1N8OC 2BDBA 2JH5D 1GBKA 5J4SA 2G00A 2UUKB 1GG6C 3QGNB 1ZOMA 3HPTB 1GVKB 1D6RA 2WPMS 3QLPH 2ZU4A 3SNEA 2EA3A 1LMWB 1FDPA 1VZQH 1ZGVA 1C1OA 4WXIA 1WQVH 2GP9B 1UTNA 1ZLRA 1O3IA 2GVFA 3BSQA 3SUFA 1ANEA 2BXTH 3E16B 2O8UA 1W11U 8ESTE 1AUJA 1P10A 5AFYH 3GCNA 1FIWA 1LVMA 4WVPE 4DIIH 1ETTH 1A61H 1PPGE 1YC0A 3SORA 1EPTA 3RU4D 5LPRA 1SLXB 3KN2A 3MO6A 2LELA 3DD2H 2ZU5A 4FUHA 1TMUH 5T6DA 1UTJA 2Y80A 1TA6A 3K6YA 2I6SA 1F92A 3A87A 4GCHG 3ZZ3A 3MOCA 1YPMH 1G2LA 3LGVA 4LOYH 4RT1A 2B9LA 1G32B 1CT4E 3K65B 1ELEE 1CBWC 3OEHD 2OCVB 3SU1A 1TRYA 5C0TA 3SU3A 1Y3XA 3MO3A 1O2YA 5EXLA 5CHBA 5K0HA 1J15A 4WF8A 1XUKA 1ZZZA 2ZTZA 3ZVFA 1TX7A 2WHXA 1FMGA 2BDYA 3OEED 4UFDH 1L2EA 1PQAA 1SMFE 3U9AH 1GJ4H 3ZV8A 4ZKOU 1O2WA 2P3FH 3UR6A 1XXDA 1QBNA 1BBRH 3FP6E 4F55A 1E1RD 2EI6A 4K69A 3AAUA 3FZDA 1YPGH 4Y76A 1GJCB 2FO9A 2ZWLH 1EB1H 3GCHC 4NZLA 4TY6A 2V7QD 3OSYA 2WV5A 2OC0A 4CRDA 3WWFA 3LOXA 3RXKA 1CVWH 1SI5H 1NROH 3AW1A 1L4DA 2ZCHP 2B8OH 4ZKSU 5JBCS 3RXRA 3HATH 1NN6A 2XBVA 1O3AA 5C1YA 2VWLA 1HAXB 5EG4A 1P2JA 1OWHA 1O2KA 1YLNA 1IHSH 1SGCA 1MD7A 2Y7ZA 4THNH 4AZ2B 4CBOA 1TONA 1O2GH 2PGBB 2QN5T 1QJ1B 5AHGH 3S69A 3O8BA 2IPHA 1DXWA 4TPYA 3M3TA 1GBLA 4UONA 3QX5H 2A4QA 3UPEA 5F8TA 2R2MB 1IOEA 3RXPA 1PPZA 3MYWA 1FUJA 2J94A 3F3BA 1AFQC 1BMAA 1HFDA 2SGEE 3MMGA 3UY9A 2ALVA 3A7TA 1HXFH 5DN6D 3BTKE 1O34A 1VCPA 1ZHPA 1D4PB 1EQ9A 4A1TA 4ZHLU 1DS2E 1BMLA 4DIHH 1FPHH 3BEIB 3GCTG 3RXMA 1HRTH 4P02A 4WMEA 1SLWB 5EXMA 1ETSH 1AVGH 4DG4A 1OP8A 1KXAA 2OC8A 1HIAA 1SQTA 3U8RH 2HOBA 5EW2H 2P93A 1F5KU 3BTME 5EODA 2BD7A 1DITH 3RC6A 1ZHMA 3H7TA 3STIA 1SGFA 1UK3A 1Z8IB 1EKBB 3SU4A 1CT2E 1EAWA 1EXFA 1E34B 1EB2A 2AEIH 2YNBA 3U1IB 3E0NB 1CSOE 1XKBC 2ILNA 1P06A 1XKAC 3H09A 4OS4A 1ZR0A 5ESBA 2PKAA 5FCKA 3ZZAA 1O3CA 3T5FH 4AGKA 2FYRA 2AGEX 4ZXXH 2EI7A 3T29A 4IMZA 4MPVA 5J4QA 4RI0A 2Z94A 3RXQA 3K6ZA 1SQAA 2FDAA 4JK6A 4HI3A 4FU9A 1W2KH 1UTQA 2XBWA 2CHAB 2JJ2D 1GBMA 3CENA 3GICB 2BVRH 3A8DA 5JYIA 2BZAA 2DE9A 4ABFA 1FN6A 2P94A 1COWD 1RD3B 3M5MA 2A4GA 4X8SH 3C27B 1Z8JB 3N7DA 3SU2A 3SYJA 3D23A 2BDIA 1BRAA 2VNTA 3M36A 2TGAA 1NS3A 4X1QU 1YYY1 4D9RA 1Z8GA 3AAVA 1WV7H 5EJLA 1V2WT 1MBQA 4ABEA 1AB9B 1BTPA 4UD9H 3ATIA 1W7XH 1MZAA 1V2TT 2SGQE 3N7EA 2PGQB 4Q80A 1UTOA 4B74A 5HXFA 4IS5A 3SU0A 1K1LA 4AFQA 3FFGA 5F8ZA 3AK5A 2VIWA 1O2JA 1OXGA 4X6MA 1VKYA 2WINI 3S7KB 4D76A 1GI6A 2O8TA 2OUAA 4I8JA 3MTYA 3P8NA 4AORA 1XUHA 4FUEA 1O31A 4HTCH 5EU8A 2BLQA 3VXFH 1C2EA 1A5GH 4I8KA 3UNSA 1P2QA 4XBBA 5A8ZA 3SUGA 3RM0H 2P8OC 2QXHA 1G3DA 3JZ2B 1S5SA 2ZP0H 1JIRA 3VG8A 1KSNA 3MU1A 4H6SB 5F53A 1O3GA 1TBQH 3GDUA 2F9OA 4RSPA 3T62A 1K9OE 4ABAA 2YMSB 1QNJA 1PJPA 2GV7A 3SGAE 1HAYB 5C17A 2W26A 1Y5AT 4XBCA 5A0AE 2QA9E 4X8TH 2Z3DA 1XUJA 1A46H 1GI3A 1AO5A 1HAZB 3R3GB 2RDLA 3RXBA 3ITIA 1VCQA 2J5UA 1G36A 1LHDH 2L6OA 2ANWA 2XRCA 2WSSD 2C3SA 1T8LA 1W0YH 3RC4A 1GHAF 1ANDA 1S0QA 4YT6H 4FUGA 1LQDB 1ESBA 1ZRKA 5EIYA 3NPSA 4AOQA 1C5MD 2PSYA 1V2MT 2J38A 3OFND 4INKA 1PPEE 1J8AA 3F9FA 4BAOB 4E7RG 5GXPA 1MKWK 2VJ1A 1P57B 3BTEE 4ABDA 1TMBH 4JMYA 1GI7B 1WXRA 1O5GH 4HGCA 2JJ1D 3SUDA 1DY8A 4BANB 3TPIZ 1O5CB 4SGAE 4FUCA 2ZTYA 4Y7BA 1O2LA 3S9AA 2GX4A 1E1QD 2VWOA 2ZHWH 4MPUA 4ZH8A 1DLEA 1JXPA 1BJUA 2OBQA 1QL9A 4GSOA 1RIWB 3F2GA 1C1RA 3FO8D 3LH3A 4AG1A 4TY7A 1ACBE 3AVZA 2BDHA 1J17T 1JMOH 4Q7ZA 4AYVB 3ZYDA 1C1PA 2BY8X 3MU4A 1SGDE 4X8UH 2PKSB 3PO1C 1GHBF 5HM2A 2QCYA 1GL1A 1Q31A 2ZDLA 1TNKA 1WOFA 4TYDA 1HJ8A 4HG6A 1NFYA 1QY6A 4NA7A 1L1NA 1J14A 3ZYEA 2XNDD 1O33A 1GVZA 5IYTA 3RC5A 1GBEA 4F49A 1TGNA 1PYTC 1GCTB 2R2WU 4ESTE 1ZSLA 1FIZA 1CA0C 4NIWA 4ZHMU 3GISB 2HRVA 1INCA 3L6PA 4CBNA 1A7SA 2AS9A 3NCLA 4B76A 4GUXA 2XOKD 2W7SA 1NT1A 1GGDC 2G52A 4I7YH 3P6ZB 2HLCA 1C5QA 1MQ6A 1YPHC 2OQUA 1BZXE 3LONA 1BRUP 1ZSKA 2AIQA 2GCHG 3ATLA 3M3SA 4I86A 1AE8H 3A85A 3MO9A 3O8RA 2JDID 3GY8A 4ZMAH 1AHTH 5JB8S 4ACAA 1S6FA 1Y3YA 3ZVGA 1ELDE 5HMAA 1MU6B 2QXGA 1UJ1A 4AFZA 3V13A 2ZU2A 4BXWA 1AVWA 1A2CH 2LNCA 3BG4C 1QQUA 2CMYA 3M5LA 1NRPH 1PFXC 1PQ7A 1BMNH 3MNCA 3F1SB 1QZ8A 3O8CA 1AGJA 2BTCE 1PQ8A 1YCPK 3LDXH 4FETA 3FANA 5JBAS 1QBOA 2VWNA 3FVFB 4I8HA 3JZ1B 3MWIU 3KQBA 2K0QA 3SHCH 3SNDA 4DY7B 3DA9B 4NCYA 1HGTH 3TK9A 1O3NA 2BD4A 1WTGH 7GCHG 2OK5A 1TBZH 2R0LA 2R3UA 3KQCA 1HAIH 1O3DA 2RCEA 1VGCB 2QF5A 1UK2A 3LJJA 1H8HD 1C2JA 1HIAB 1GHXH 4NA8A 1QBVH 2ZC9H 1Z1IA 4Q63A 5FL7D 2QF4A 5DP4A 2WPJS 3TVJB 2GMTB 3B23B 2SGAA 1HV7A 2RG3A 3RXCA 3PM3A 4ACBA 4Y71A 4BAHB 3KF2A 2OTVA 2TIOA 1AKSA 2ZFRH 1CGHA 1LHCH 1GI5A 2A1DB 1IAUA 3UIRA 3N99A 3KEEA 5JPMH 1BB0B 2WV9A 1V2PT 1OSSA 5EQSA 2HPQH 9ESTA 1IHTH 3G01A 2OD3B 1HBTH 1O2OA 1ELCA 1JRSA 4CREA 1A3BH 1WUNH 1C1UH 2J4IA 1O5AB 4AYYB 2GD4B 2ZA5A 1GJ9B 1T31A 1T8OA 1IQFA 3UNQA 2FI5E 2J9NA 1QGFA 1UTPA 1N6XA 3RMOH 3F2HA 5E0JA 1EZSC 4TT3D 4B2BA 1P3CA 3PLPA 1QB1A 1EAIA 4A92A 4DT7B 2IJOB 4BTUB 1T4VH 3CNRA 3PMBB 2J98A 3UFAA 3BIVH 4HFPB 3A89A 4DW2U 1N6YA 3FP7E 2F9VA 3TGJE 5HIYA 1BTZA 5TJXA 4F4OC 1IQLA 5TCAA 4NGAH 5DKMA 1D6WA 3CS0A 4E05H 2BD3A 1ELAA 2PTCE 2XNIA 1Y5BT 1TMTH 1THRH 2AGGX 2ALPA 1UVPA 2C8XB 3GDSA 3GY2A 3KYFA 2ZQ1A 1XVOA 1MD8A 1F7ZA 1GBHA 2JH6D 1GHWH 2ZPSA 3WWBA 1DUAA 1O37A 1J9CH 2A5KA 3MNSA 1GHYH 1QRXA 7ESTE 1D9IA 1E36B 1KXFA 3I29A 2GGVB 1TOMH 1THPB 1ZYOA 1UK4A 2BVXH 2WV4A 2ZU3A 4E7NA 2BZ6H 4JK5A 5EPNA 2W3IA 1NM6A 4JZDH 3T27A 4FUBA 1GHVH 1V2NT 5G4BA 4TWYA 1RRKA 1AFQB 3MH4A 1SR5C 4Y0ZE 4DCDA 1Y3UA 1IQGA 4K2YA 2P3UB 4ISLA 2WPKS 3PRDA 2VIQA 5FBIA 8KME2 3FZZA 2XWBI 2ZDNA 4NSYA 1DXPA 1RXPA 2Z9IA 3RXTA 3SQEE 2EY4C 2PUQH 1YCPM 1ELTA 1HAHH 1VR1H 1H9HE 1RTLA 2B5TB 2TGPZ 3OYPA 1P0SH 2Z9JA 2FOGA 3TK6A 1GMHG 2ZEBA 1BHXB 1EJMA 2H5DA 2WZQA 1S6LA 5HYOA 1NFXA 1V2UT 1SVPA 2ZPQA 3R0FA 1L0ZA 2BDGA 1UMAH 1BT7A 3RXLA 2STAE 3GY4A 3PMAB 1SOZA 1C2FA 1ESAA 2P95A 2ZCLP 4NWKA 5EW1H 3BEFB 1CGIE 1J16A 3EDXB 2QGRA 4U30A 4Y11E 2FODA 4KP0A 2ZG0H 4D7GA 4B1TA 3DSPA 3ODFA 4JZFH 4R8TB 3RXHA 3VGCC 1PYTD 2PHBA 2Z7FE 4B6EA 1C5YB 1LHFH 1P02A 1AMHA 2D1JA 1C2MA 2CGAA 5CHAC 1EOLA 2H5CA 2ZTXA 3E8LA 1O5EH 1YY3A 2FOEA 1TB6H 2VWMA 3K2UA 1BHXF 1T7CA 1SKYE 4ZKRU 1LDTT 1GL0E 1MKXH 1C9TA 4J1YA 3MQKC 1GHZA 4DJZB 3PMHB 1OYQA 2BM2A 4NFEA 1HCGA 2ODYB 3DFJA 4CR5A 1ZRBA 4YTAA 2Z9KA 3ZZCA 2ZPRA 2HALA 4H4FA 3Q3YA 4NIVA 1LCYA 3BTQE 1YPKH 4JZEH 3RMMH 1UTMA 1S0RA 2IOTA 4YESB 2NU1E 2FMJA 1ID5H 5E8EH 1MUEB 1TLDA 1O3HA 5FPTA 1PPHE 2EI8A 1HAPH 1K0HA 1B7XB 1C5PA 2VH0A 1QB6A 3Q3KA 1F0RA 1EAUA 3SHAH 1P3EA 1T8MA 3BTDE 1ZPBA 3LH1A 2NU4E 4RT0A 5C1UA 3PB1E 1EZUC 1MCTA 4X6OA 3RXEA 1C4U2 1C2LA 5A09A 1DM4B 1G3CA 1TYNA 2BLOA 1IQEA 3LKWA 3TGIE 1BRBE 3RP2A 3SU6A 2HPPH 3TJVA 1YKTA 3PWCA 2XBYA 3RXJA 3BTHE 2TPIZ 2ZFTA 1P2MA 4GVUA 3GY5A 2OBOA 2KCYA 1LKBA 4NWLA 1AWHB 1K1PA 2J95A 4X1PU 2J2UA 2A2QH 3A8BA 2BQ6B 5EOKA 2XBXA 1EP6A 5A0BA 4FU8A 5E0GA 1O39A 4X6NA 5FX5A 2QF0A 4CR9A 3F9HA 4XRNA 1MAYA 1F2SE 1BIOA 3DT0H 2C8WB 3ENSB 4XBDA 1EZXC 4BOHA 3A7ZA 4FXGH 1NU7B 2P59A 4BNRA 2W6ID 5B6LA 4B2AA 2XC5A 5DSFA 3T26A 1DFPA 1W7GH 1JOUB 5IK2D 1UVUH 1BDAA 4Y79A 4K5ZA 4X2XA 5DP5A 5C0UA 2C8YB 1LVYA 4K8BA 4ABHA 1BJVA 3SOSA 1MMJN 4ISIH 1YGCH 1TGTA 3L3TA 2R0KA 2FESH 2TGDA 2AMPA 1LVBA 2O8LA 2P16A 2VGCC 3PLBA 1QR3E 2KR7A 1FAKH 1KTTB 4I8LA 4U2WA 1OKXA 4WY3A 2V6NA 4NA9H 1SHHB 1P09A 3TH2H 5LPFA 3TITA 3M7TA 2BDAA 4X0WU 1EOJA 3SUEA 1IQMA 1NESE 3UAIC 4K60A 1AKSB 2WPHS 4WXVA 1Q2WA 1O3PB 2ZFFH 3PWBA 2HNTE 3WY8A 4AB8A 5FXLA 4PROA 4TWWA 9LPRA 3MHWU 1SGTA 5EQRA 1HLTH 1ZHRA 2BY9X 5I46H 3MNXA 4K1EA 3BF6H 2FS9A 1M9UA 1A0HB 2FZZA 1JIMA 4NFFA 1O3EA 1LHGH 2M5TA 2A32A 3TH3H 4CHAC 3PO1B 3IG6B 4B71A 4ISOA 4B2CA 3P95A 4NIXA 3UNRA 5DJ7A 3MFJA 5PTPA 4X1RU 1H9LB 1OP2A 5GNDA 2ZGCA 1IQHA 2WUCA 3V7TA 2J98B 1CA0B 4O03A 1E79D 1TPOA 2F9NA 2KAIA 1YLDA 2C4FH 2J92A 1GI0A 2F4LA 5L2ZH 1C5VA 1GWAA 2A5AA 3HGPA 1GGDB 3U28C 1GI9B 3SI4H 1B5GH 4UE7H 1CT0E 3OTPA 4UFFH 1KYNA 2DE8A 4KGAA 2FOCA 3RXAA 4BTTB 4Q7XA 1LTOA 2WUBA 3VB6A 3ATWA 1O2VA 1FY3A 1SG8B 2A2XH 5JDUB 3VB4A 2ZGXH 3MI4A 4OGXA 5F6MA 1ZJDA 1FZZA 2NU0E 3SV7A 2F9PA 2Y5GA 1T8NA 2BHGA 1SFQB 2ZU1A 3BG4B 4X2VA 4Q4LA 1QJ7B 5DG6A 4BAMB 3KHVA 1LPKB 2BX3A 2FX6A 3RXGA 1MTNB 2VIOA 2Y82A 4K1TA 2G5VA 2QY0B 4CRCA 1CHOG 1FJSA 1Y8TA 2FOAA 1NU9A 3F9EA 4Z1MD 5KEDA 1GMDG 4IW4E 5T3HA 2EC9H 3GYLB 1VITF 3P8OA 1LO6A 4E06H 2PV9B 1V2LT 3BG8A 4Y8ZA 1GJ7B 2BY5X 1O5DH 3GCOA 1KLIH 4YOGA 3F0PA 1HUTH 2ZFPH 1SGPE 1EASA 2ZGJA 2JH0D 2OP9A 5GPIB 5C5OA 2OINA 3EAJA 2ZF0H 2XW9A 4YZUA 1HJAC 4X1NU 1WSSH 4ZHAA 1S84A 2XCNA 4MLFB 3LC5A 4OGYA 4Y10E 1TBRH 2BLVA 3SGBE 1AFEH 1ANCA 1P9SA 2ANKH 1K1OA 3A7XA 3OX7U 1FQ3A 3UWIA 1O3LA 2GCTB 1TAWA 2AIPA 2Z3EA 4D9QA 3HK3B 3T2NA 1C5ZB 1FPCH 1O2QA 5DP7A 3LIWA 4YLUA 4A5TS 2VIDA 4Y0YE 1O3FA 2GTBA 3GY3A 1NC6A 2ZDAH 3SNCA 1DICA 1L4ZA 5FX6A 1W14U 1GBTA 1QL7A 2ZCKP 1TNJA 3ZIAD 4X2YA 2FLBH 4FUJA 1Z71A 3UQVA 2OQ5A 5FPSA 1ELFA 2LPRA 2JIZD 1QRZA 1Z7KA 3RXFA 4AG2A 3HKJB 1SC8U 4Y7AA 4OS5A 3PRBA 3M37A 1GBIA 1KMHB 1TOCB 1O2PA 1E35B 2AFQB 3I77A 3KQDA 1CHGA 1O3KA 1UO6A 4YT7H 4UFGH 1F5RA 1H4WA 1OHHD 3SJ9A 3WW7A 1K2I1 2BMGB 5CMXH 1C5NH 3KL6A 1AIXH 1GMCG 3LT3A 2BY7X 1GBCA 3OY5U 3URCA 3KCGH 1C1SA 2EQNA 2QE7D 1HB0B 4WH6A 1TPSA 1EATA 5C5NA 3U1JB 3ODDA 2XWAA 3ATMA 1GJBB 1TX6A 4B73A 2O8MA 3RXOA 3MU5A 4JYVH 4R0IA 1X7AC 1FX0B 1K21H 1ZPCA 5L6NH 1HDTH 2CHAC 2VBCA 1D3QB 3P70B 2BD9A 1RGQA 3M7UA 1V2QT 1RFNA 1WYKA 1ZTJA 2HNTF 3P92A 2FM2A 2A5IA 4I33A 2FXRA 6LPRA 3VFEA 3F68H 3PV2A 1QB9A 1MAXA 2QF3A 5GDSH 3EA7A 1Q3XA 1OOKB 4J2YB 2Y5HA 1C5OH 1CU1A 4MPXA 1GJ8B 4FUIA 3NUMA 2TBSA 2TGTA 3UQOA 1GBAA 4ZXYH 3B8JA 1OYTH 3ZVBA 2O9QA 2GCHF 1A5HA 1TNLA 1C2DA 1E37B 4NG9H 1WCZA 3RU4T 1OWJA 3LGTA 3SNBA 5EJ1A 2BY6X 2UWOA 2HVYB 2ZGBH 3E91A 1MH0A 1GJ6A 2A4RA 3S9BA 1G30B 4O3TA 2BD2A 1RTKA 3D49H 1QA7A 1BMFD 3ZVCA 4I32A 1DY9A 2V35A 2A7CA 1AE5A 2HWLB 2ZDMA 1DOJA 2Q1JA 1TIOA 1MTSA 3DHKH 4CRFA 1TALA 4BAQB 3GY6A 4IBLH 6CHAC 1UW7A 1YCPH 3UTUH 4IMQA 4HZHA 1N8OB 2VVVA 2CF8H 3ELAH 2CV3A 7GCHF 2G4TA 5C94A 1GG6B 2Z9LA 1UCYK 1C1MA 4IN1A 1YPJH 1OWEA 1Y3VA 2ODQA 4ZCNA 4A7IB 2BOKA 5GWZA 3U8OH 1TGSZ 1TGCA 1H8DH 1DT2A 1LPZB 2ZFQH 1EJAA 2AMQA 1XXFA 2WPDD 1NBMD 3E0PB 2YMSC 2BD8A 1MCVA 1O32A 1TPPA 4WH8A 2Y81A 2ESTE 4BAKB 1UVOA 3DSGA 3QUMP 3ZVAA 1TA2A 1OPHB 3RXUA 1QURH 1EP5A 2HLDD 2ZECA 3EGKH 4LK4A 2A0QB 3QZQA 2BLWA 5CHAB 2C8ZB 2A4OA 2W6JD 4NZQA 1XM1A 2SNVA 4XDEA 1QRWA 5FPYA 5L2YH 5EGMA 2ANMH 1LPGB 1WAYB 3M7QA 4FOUC 5C3NA 2RDEA 3SZNA 8GCHF 4JCNA 2NWNA 1IQNA 4A1XA 5FAHA 2V0BA 3M35A 1SB1H 2ZKSA 3TGKE 3ZV9A 1O2XA 3FOAA 1CBWB 1F5LA 4WWYA 2KCPA 3ZZ5A 3BIUH 3EA8A 1DSTA 1O2IA 1ZTLA 2WYJA 4AN7A 1W13U 2VVUA 1P04A 4D7FA 1EZQA 3W94A 3NKKA 3P17H 5DP3A 4AGJA 1GBBA 4Z0KA 5EPYA 3LC3A 1EPTC 4GHTA 1SQRA 1YPEH 3A80A 1AZ8A 4LXBH 1UTLM 1C5TA 1YPLH 2UUFB 1P12E 1C4V2 1DX5M 2BYAX 1XX9A 2XC0A 2ODPA 2UUYA 4MG3A 4XFQA 2KAIB 5EXNA 1VJ9U 4MNVA 3GCHB 1UVSH 1W12U 4GPGA 4RKJB 3SV9A 3QN7A 1SGFG 2KZ4A 1FN8A 1XUGA 1SGQE 4ISNA 1FNIA 1ZMNA 3LGWA 2FI3E 5KECA 5C1XA 4XE4A 1DDJA 1GDNA 2FEQH 3EE7A 5A0CA 1DE7H 5GCHF 1BITA 1KXEA 2Q6DA 2BOHB 1ORFA 4AX9H 4UEHH 5FCRA 2KCOA 4KKDA 1DWBH 2FPZA 4JYTA 2IPQX 1Y3WA 1Z1JA 3KQEA 3MH5A 2QV1A 1QFKH 3IITA 3TNSA 3VB5A 1FAXA 1T32A 4VGCC 2KFWA 5DPAA 7LPRA 1PPFE 5DP9A 1SGNE 1Z6EA 1W10U 2WYGA 6GCHF 3CP7A 4MTBA 1U6QA 1GMHF 1BRCE 1GI4A 4MNYA 1K22H 3SJOA 2FOFA 3A82A 1C2KA 3PV4A 4MNXA 1BOQA 3Q3XA 3OE7D 3V0XA 1W0KD 1G2MA 2ASUB 1P11E 1MTUA 1RTFB 3I78A 4KTCA 4X6PA 3OU0A 4AC9A 4I31A 2GZ8A 2B7DH 3ZZ7A 1H1BA 5T6GA 2PSXA 2A31A 3QDZB 1BA8B 4IC6A 2PWXA 3TJOA 1CO7E 1BQYA 2J34A 5KGOA 5ABWA 1O2RA 1TFXA 1SGYE 5HGGA 2V3OH 3OTJE 3M5OA 1MABB 1V2JT 1EFRD 2FOHA 2Z3CA 4CH8B 1NRQH 1VGCC 3M61U 1ANBA 1D3DB 3MU8A 3UR9A 1YWUA 1ABIH 2FTLE 1A3EH 5JBBS 3NK8A 4O3UA 4B75A 4GCHF 1H8IH 5FHTA 3SO3A 5C67A 3A86A 2GMTC 4CHAB 3FP8E 2BQWB 4IN2A 2OLGA 3SU5A 1V2ST 2D8WA 1OS8A 2H9TH 4Q7YA 1KXDA 1ELGA 2VVCA 3LU9B 3TJNA 5IDKA 3RXIA 2H9EH 1KDQA 1GI2A 3SV6A 3M5NA 2J97A 3RMNH 3MNBA 4X2WA 3A81A 1MKXK 1ELVA 1D3PB 1OWIA 1DWCH 3GOVB 5F8XA 3S7HB 1KLTA 2I6QA 2PP6A 3RM2H 1C2IA 2CXVA 3RU4E 3SN8A 4KELA 3TLOA 2ZDVH 1SQOA 1P9UA 1V6DA 1OX1A 2ZHQH 2ZHEH 4Y8XA 1HPGA 1TNGA 4JZ1A 3BEUA 3DCLA 3ZZBA 5LPEA 4ASUD 5A8XA 1YPHE 3LGYA 2BQ7B 1HYLA 1RJXB 3RDZA 1P8VC 2QAAA 5AFZH 1HAOH 4Y6DA 2A45B 3PTBA 3TU7H 2R3YA 3ZZDA 3BV9B 2G51A 2H6MA 3MH6A 4INLA 1BBRK 3PMJA 3BTWE 1G3BA 1S81A 3VPKA 3UOPA 1SGIB 2YMSD 1BTWA 4WMDA 1TRMA 1FY1A 2P8OB 1DANH 5I25A 3PYHA 3F6UH 3RUOA 4U01A 3V12A 1C9PA 5E0HA 1GBFA 5T1VA 2VIVA 2FP7B 5C20A 2FS8A 1EJNA 2SGDE 2SNWA 5EJZA 3VB3A 3GY7A 1PQ5A 1PPBH 2IJD1 1HJAB 2RFKC 1GI1A 3M3VA 2UUJB 2OC7A 1ARCA 2JETC 3QGJA 1SSXA 3GCTF 1DSUA 2AYWA 4TPIZ 4CH2B 1BTHH 1MU8B 1LHEH 2L74A 3TH4H 1HJ9A 3NWUA 3P8GA 3E6PH 4U32A 1RS0A 1UHBA 2GKVE 1YLCA 2GDDA 2D2DA 3STJA 3LJOA 3SQHE 3CS7A 3HKIB 3AW0A 5HM9A 1O3MA 3N7OA 2XC4A 1FV9A 2GT8A 2BX4A 4MVNA 4F48B 1Y59T 3A7VA 3S9CA 3RMLH 2ZI2H 2CJIA 1BTYA 1ZPZA 5HKKD 2HGTH 2OXSA 1BTUA 1C5XB 2Z6BD 3FKSD 4CRAA 1H8ED 2C93B 3UB0A 2DUCA 4YO9A 1F0SA 5T6FA 4XSKU 1ABJH 3D65E 1K1JA 2YOLA 4ZAEA 3ZVEA 4YOIA 5HIZA 1TNHA 3SI3H 1VITH 2WPLS 4AFUA 4Z6AH 1C2HA 1W8BH 4Y8YA 1HAVA 3EYDA 1AI8H 1S85A 4OS7A 5DP6A 1YM0A 5GIBA 1FY8E 2SGPE 1ELBA 3RXVA 1TQ7B 3BTTE 2BVSH 1S83A 2KM0A 1AN1E 3UWJH 2GDEH 3LGUA 3V3MA 3PTNA 1SLUB 2AHME 1FY5A 1C4Y2 4RN6A 1JBUH 1B0FA 1O3OA 5A2MH 5A8YA 4ASHA 4ISHH 4OS2A 3H7OA 1XUFA 3E3TA 1AQ7A 3T25A 2Q6GA 4ZKNU 1NFWA 2ZHDA 4YOJA 2ZFSA 5JB9S 1AU8A 2FX4A 3KIDU 1BCUH 5BPEA 1C1VH 1QL8A 2FIRH 3SBKA 1AVXA 3KNXA 4XD7D 5EQQA 1AWFH 2Q6FA 3SJIA 1ZMLA 1NRRH 4A6LA 2G8TA 2AERH 1O5FH 2XYAA 2F91A 1FONA 1C2GA 4ABJA 1MZDA 1GVLA 7KMEH 1V3XA 2K8IA 2GZ7A 4BXSA 2ZNKH 2CN0H 2GT7A 3QK1A 4Q2KA 1FLEE 1LVOA 3BN9A 2ULLA 2SFAA 1MBMA 3BTFE 2F43B 4KTSA 1WTHD 1P2NA 2W3KA 3GS9A 3SJKA 3SV2H 4FUDA 1W0JD 1N1LA 1JRTA 1CHOF 1C1NA 1O36A 1VJAU 1C5SA 4A1VA 1C5WB 1G9IE 1GMDF 1SPJA 4MQAA 4DURA 3Q76A 4YXWD 2H2ZA 1Z6JH 2V3MA 2QC2A 2GJGA 1K1NA 2WPIS 6CHAB 2ZZUH 1SHYA 2PW8H 2ZIQH 3A7YA 5H4IB 1HNEE 1TQ0B 2ZHFH 5FBEA 3U98H 1C5UA 4M9FA 2G81E 1GJDB 4OS1A 3A8AA 4NIYA 1FXYA 3PROA 1AD8H 2ZDKA 1KIGH 1P2IA 2AGIX 3O8DA 1L1GA 1GBJA 1G37A 2Z9GA 2ANYA 2BB4A 1VITG 2LP6A 1MTWA 2G4UA 1YBWA 4CRGA 2ZO3H 1OWKA 2XTTB 3U69H 1L1JA 3ZZ8A 1SBWA 2M2AA 3NZIA 1A0JA 1NY22 1NFUA 3SJ8A 4X8VH 1ZGIA 2F9BH 1GDUA 1O2MA 1BTXA 2Y6TA 4DGJA 1K28D 2NU2E 1AZZA 1QIXB 1W3CA 4INHA 4P00A 1Z8RA 4SGBE 1MKWH 4MPWA 1CE5A 1DPOA 3A88A 2YNAA 4FUFA 1GHAG 2A7HA 3HK6B 1A0LA 1AY6H 5DK1A 1V2VT 1ETRH 1KY9A 1UCYE 2AH4X 2KCAA 1NRNH 3E90B 1O2SA 1O2UA 1P03A 1DLKB 2IN2A 1O30A 1TPAE 2ZGHA 3W1EA 1TNIA 4IC5A 1TE0A 1G3EA 1GMCF 1QQ4A 1UTKA 1P05A 4TSFD 3HGNA 4I8GA 1SFIA 1EPTB 4JYUH 1KDQB 4M7GA 3A83A 4YM9A 5DGJA 5TCCA 4O97A 3MH7A 4QT8C 3S0NA 4DT4A 1HXEH 1HAGE 1C1TA 2OC1A 2FOMB 5LGOA 1TRNA 4NSVA 2BD5A 3SW2B 4ABIA 2HVXA 1DWEH 2G55A 5CDFE 1MTVA 5AVDA 2STBE 3ZZ4A 3H5CB 2VIPA 4GAWA 1ARBA 1DWDH 1ZJKA 3LPRA 5E2PA 2FYQA 1TX8A 3EE0B 2F83A 1EX3A 1MQ5A 1QTFA 1SGEE 3A8CA 1D3TB 1O3JA 3GDVA 1GHBG 2KX4A 1FY4A 2EEKA 4K8YA 1K1IA 3E1XB 2VINA 1K1MA 4H6TA 1IQJA 3Q00A 2TRMA 1CQQA 1V2OT 1KTSB 1SGRE 1XUIA 1AB9C 2UWLA 1C5LH 3F2FA 2BDCA 5LH8A 4OS6A 4AB9A 1C1WH 2V3HH 1ESTA 5K7RA 3LGIA 2FTMA 3RXSA 2D26C 1E38B 1ZTKA 4KTUA 1O38A 3C1KA 4VGCB 2F3CE 3UOUA 5C2ZA 2RA0A 1WU1A 4K3JA 4DOQA 1DUEA 1TWXB 4D8NA 3DSOA 1A4WH 3KGPA 4FU7A 3F0OA 3ZZ9A 2ZQ2A 3UUZA 3RLYH 1LKAA 2PFEA 1QCPA 3W95A 1F0UA 3OY6U 4MDSA 5SGAE 3ZVDA 1E0FD 2NU3E 1GJAB 4GHQA 4LZ1H 1O0DH 1O2NA 3ESTA 1SL3A 1IQIA 1EAXA 2P3TB 1XVMA 4UFEH 3B9FH 4ZUHA 3KQ5A 3RLWH 1H9IE 1GDQA 3L33A 2UWPA 1MTNC 1O2TA 1UCYH 3K9XB 3FN8A 3IWMA 1A5IA 1CA8B 2QXJA 3DFLA 1UHBB 1GJ5H 5L30H 1GBDA 4BTIB 1IQKA 4JZIA 1ZSJA 1V2RT 3T28A 2H1UA 1GCDA 4K1SA 1C5RA 6ESTA 2W7UA 1NTPA 1NZQH 3VGCB 5BRRE 2QYIA 1DVAH 4O9VA 1B0EA 2CF9H 3EQ0H 2QIQA 3GYMA 3QTOH 1UVTH 1GI8B 1CGJE 1SOTA 3QZRA 1OP0A 2GCTC 1O2ZA 2GZ9A 1WBGB 2XXLA 3EA9A 1VCWA 3ZZ6A 4WMFA 2FWWA 1WDIA 3TJUA 1C1QA 5DP8A 1NBME 1HAVB 2W5EA 2A7JA 1W0ZU 1V2KT 1S82A 3VEQB 1PPCE 3OAAD 3UREA 1EUFA 1TGBA 2PR3A 3QWCH 3RXDA 2PKAB 4UDWH 2SGFE 2FOBA 2G5NA 1WQSA 1QHRB 4MNWA 2BXUH 1KXCA 1YP9A 3BTGE 3QTVH 5E2OA 3FAOA 8GCHG 2HNTC 3A7WA 5AF9H 1KLJH 1JWTA 1ZMJA 3DUXH 1LQEA 2B0FA 1O2HA 1RIWC 4CRBA 1AUTC 2XCFA 4ZROA 1BUIA 2RA3A 3F9GA 1OWDA 3NRLA 4ABBA 2QXIA 3MU0A 4AFSA 5B6OA 3Q77A 1S6HA 1QA0A 1KXBA 1P2KA 2PKSC 1A1RA 1SLVB 3QO6A 2VB0A 4LZ4B 1Y5UT 4H42U 4GLYA 3TNTA 1BMMH 4FVBA 4WJG2 2PUXB 1XMNB 1GCTC 2PTNA 1P2OA 2FI4E 1QJ6B 5F03A 1O3BA 2K1QA 2CK3D 2VU8E 3VB7A 1NO9H 5DO4H 2H9HA 2O8WA 4FVDA 1P01A 1NPMA 2Y7XA 2C90B 5GJ4B 3PV5A 3AASA 3SNAA 4IGDA 1GPZA 1T4UH 2JKHA 5JBTA 2JETB 3P8FA 5GCHG 5ETXA 3D62A 4ABGA 1THSH 1FI8A 4OM9A 3U8TH 3SZEA 1F0TA 1BBRE 2AMDA 2R9PA 1O35A 2PLXA 3PLKA 4XOJA 1NRSH 3ATKA 3KYGA 2GV6A 8LPRA 5ESTE 2FLRH 4DVAU 3URDA
chains in the Genus database with same CATH topology
4RKOB 1YF4A 2VGCB 3TK5A 1TABE 3TIUA 3SV8A 5CE1A 2F9UA 3A84A 2VH6A 1O5BB 2Y5FA 6GCHG 3SGQE 2THFB 3VXEH 4X1SU 4YLQH 3NXPA 1N8OC 2BDBA 2JH5D 1GBKA 5J4SA 2G00A 2UUKB 1GG6C 3QGNB 1ZOMA 3HPTB 1GVKB 1D6RA 2WPMS 3QLPH 2ZU4A 3SNEA 2EA3A 1LMWB 1FDPA 1VZQH 1ZGVA 1C1OA 4WXIA 1WQVH 2GP9B 1UTNA 1ZLRA 1O3IA 2GVFA 3BSQA 3SUFA 1ANEA 2BXTH 3E16B 2O8UA 1W11U 8ESTE 1AUJA 1P10A 5AFYH 3GCNA 1FIWA 1LVMA 4WVPE 4DIIH 1ETTH 1A61H 1PPGE 1YC0A 3SORA 1EPTA 3RU4D 5LPRA 1SLXB 3KN2A 3MO6A 3DD2H 2ZU5A 4FUHA 1TMUH 5T6DA 1UTJA 2Y80A 1TA6A 3K6YA 2I6SA 1F92A 3A87A 4GCHG 3ZZ3A 3MOCA 1YPMH 1G2LA 3LGVA 4LOYH 2B9LA 1G32B 1CT4E 3K65B 1ELEE 1CBWC 2OCVB 3SU1A 1TRYA 3SU3A 1Y3XA 3MO3A 1O2YA 5EXLA 5K0HA 1J15A 4WF8A 1XUKA 1ZZZA 2ZTZA 3ZVFA 1TX7A 1FMGA 2BDYA 4UFDH 1L2EA 1PQAA 1SMFE 3U9AH 1GJ4H 3ZV8A 4ZKOU 1O2WA 2P3FH 3UR6A 1XXDA 1QBNA 1BBRH 3FP6E 2EI6A 4K69A 3AAUA 3FZDA 1YPGH 4Y76A 1GJCB 2FO9A 2ZWLH 1EB1H 3GCHC 4NZLA 4TY6A 3OSYA 2WV5A 2OC0A 4CRDA 3LOXA 3RXKA 1CVWH 1SI5H 1NROH 3AW1A 1L4DA 2ZCHP 2B8OH 4ZKSU 5JBCS 3RXRA 3HATH 1NN6A 2XBVA 1O3AA 5C1YA 2VWLA 1HAXB 5EG4A 1P2JA 1OWHA 1O2KA 1IHSH 1SGCA 1MD7A 2Y7ZA 4THNH 4AZ2B 4CBOA 1TONA 1O2GH 2PGBB 2QN5T 1QJ1B 5AHGH 3S69A 3O8BA 2IPHA 1DXWA 4TPYA 3M3TA 1GBLA 4UONA 3QX5H 2A4QA 3UPEA 5F8TA 2R2MB 1IOEA 3RXPA 1PPZA 3MYWA 1FUJA 2J94A 1AFQC 1BMAA 1HFDA 2SGEE 3MMGA 3UY9A 2ALVA 3A7TA 1HXFH 3BTKE 1O34A 1VCPA 1ZHPA 1D4PB 1EQ9A 4A1TA 4ZHLU 1DS2E 1BMLA 4DIHH 1FPHH 3BEIB 3GCTG 3RXMA 1HRTH 4WMEA 1SLWB 5EXMA 1ETSH 1AVGH 4DG4A 1OP8A 1KXAA 2OC8A 1HIAA 1SQTA 3U8RH 2HOBA 5EW2H 2P93A 1F5KU 3BTME 5EODA 2BD7A 1DITH 3RC6A 1ZHMA 3H7TA 3STIA 1SGFA 1UK3A 1Z8IB 1EKBB 3SU4A 1CT2E 1EAWA 1EXFA 1E34B 1EB2A 2AEIH 2YNBA 3U1IB 3E0NB 1CSOE 1XKBC 2ILNA 1P06A 1XKAC 4OS4A 1ZR0A 5ESBA 2PKAA 5FCKA 3ZZAA 1O3CA 3T5FH 4AGKA 2FYRA 2AGEX 4ZXXH 2EI7A 3T29A 4IMZA 4MPVA 5J4QA 2Z94A 3RXQA 3K6ZA 1SQAA 2FDAA 4JK6A 4HI3A 4FU9A 1W2KH 1UTQA 2XBWA 2CHAB 1GBMA 3CENA 3GICB 2BVRH 3A8DA 5JYIA 2BZAA 2DE9A 4ABFA 1FN6A 2P94A 1RD3B 3M5MA 2A4GA 4X8SH 3C27B 1Z8JB 3SU2A 3D23A 2BDIA 1BRAA 2VNTA 3M36A 2TGAA 1NS3A 4X1QU 1YYY1 4D9RA 1Z8GA 3AAVA 1WV7H 1V2WT 1MBQA 4ABEA 1AB9B 1BTPA 4UD9H 3ATIA 1W7XH 1MZAA 1V2TT 2SGQE 2PGQB 4Q80A 1UTOA 4B74A 5HXFA 4IS5A 3SU0A 1K1LA 4AFQA 3FFGA 5F8ZA 2VIWA 1O2JA 1OXGA 4X6MA 2WINI 3S7KB 4D76A 1GI6A 2O8TA 2OUAA 4I8JA 3MTYA 3P8NA 4AORA 1XUHA 4FUEA 1O31A 4HTCH 5EU8A 2BLQA 3VXFH 1C2EA 1A5GH 4I8KA 3UNSA 1P2QA 4XBBA 5A8ZA 3SUGA 3RM0H 2P8OC 2QXHA 1G3DA 3JZ2B 1S5SA 2ZP0H 1JIRA 1KSNA 3MU1A 4H6SB 1O3GA 1TBQH 3GDUA 2F9OA 4RSPA 3T62A 1K9OE 4ABAA 1QNJA 1PJPA 2GV7A 3SGAE 1HAYB 2W26A 1Y5AT 4XBCA 5A0AE 2QA9E 4X8TH 2Z3DA 1XUJA 1A46H 1GI3A 1AO5A 1HAZB 3R3GB 2RDLA 3RXBA 3ITIA 1VCQA 1G36A 1LHDH 2ANWA 2XRCA 2C3SA 1T8LA 1W0YH 3RC4A 1GHAF 1ANDA 1S0QA 4YT6H 4FUGA 1LQDB 1ESBA 1ZRKA 3NPSA 4AOQA 1C5MD 2PSYA 1V2MT 2J38A 4INKA 4BAOB 1PPEE 1J8AA 3F9FA 4E7RG 5GXPA 1MKWK 2VJ1A 1P57B 3BTEE 4ABDA 1TMBH 4JMYA 1GI7B 1O5GH 4HGCA 3SUDA 1DY8A 4BANB 3TPIZ 1O5CB 4SGAE 4FUCA 2ZTYA 4Y7BA 1O2LA 3S9AA 2GX4A 2VWOA 2ZHWH 4MPUA 4ZH8A 1DLEA 1JXPA 1BJUA 2OBQA 1QL9A 4GSOA 1RIWB 1C1RA 3LH3A 4AG1A 4TY7A 1ACBE 3AVZA 2BDHA 1J17T 1JMOH 4Q7ZA 4AYVB 3ZYDA 1C1PA 2BY8X 3MU4A 1SGDE 4X8UH 2PKSB 3PO1C 1GHBF 5HM2A 2QCYA 1GL1A 1Q31A 2ZDLA 1TNKA 1WOFA 4TYDA 1HJ8A 1NFYA 1QY6A 4NA7A 1L1NA 1J14A 3ZYEA 1O33A 1GVZA 5IYTA 3RC5A 1GBEA 4F49A 1TGNA 1PYTC 1GCTB 2R2WU 4ESTE 1ZSLA 1FIZA 1CA0C 4NIWA 4ZHMU 3GISB 2HRVA 1INCA 3L6PA 4CBNA 1A7SA 2AS9A 3NCLA 4B76A 4GUXA 2W7SA 1NT1A 1GGDC 2G52A 4I7YH 3P6ZB 2HLCA 1C5QA 1MQ6A 1YPHC 2OQUA 1BZXE 3LONA 1BRUP 1ZSKA 2AIQA 2GCHG 3ATLA 3M3SA 1AE8H 3A85A 3MO9A 3O8RA 3GY8A 4ZMAH 1AHTH 5JB8S 1S6FA 1Y3YA 3ZVGA 1ELDE 5HMAA 1MU6B 2QXGA 1UJ1A 4AFZA 3V13A 2ZU2A 4BXWA 1AVWA 1A2CH 2LNCA 3BG4C 1QQUA 2CMYA 3M5LA 1NRPH 1PFXC 1PQ7A 1BMNH 3MNCA 3F1SB 3O8CA 1AGJA 2BTCE 1PQ8A 1YCPK 3LDXH 3FANA 5JBAS 1QBOA 2VWNA 3FVFB 4I8HA 3JZ1B 3MWIU 3KQBA 3SHCH 3SNDA 4DY7B 3DA9B 4NCYA 1HGTH 3TK9A 1O3NA 2BD4A 1WTGH 7GCHG 1TBZH 2R0LA 2R3UA 3KQCA 1HAIH 1O3DA 2RCEA 1VGCB 1UK2A 3LJJA 1C2JA 1HIAB 1GHXH 4NA8A 1QBVH 2ZC9H 1Z1IA 5DP4A 2WPJS 3TVJB 2GMTB 3B23B 2SGAA 1HV7A 2RG3A 3RXCA 3PM3A 4Y71A 4BAHB 3KF2A 2OTVA 2TIOA 1AKSA 2ZFRH 1CGHA 1LHCH 1GI5A 2A1DB 1IAUA 3UIRA 3KEEA 5JPMH 1BB0B 1V2PT 1OSSA 5EQSA 2HPQH 9ESTA 1IHTH 3G01A 2OD3B 1HBTH 1O2OA 1ELCA 1JRSA 4CREA 1A3BH 1WUNH 1C1UH 2J4IA 1O5AB 4AYYB 2GD4B 2ZA5A 1GJ9B 1T31A 1T8OA 1IQFA 3UNQA 2FI5E 2J9NA 1QGFA 1UTPA 1N6XA 3RMOH 5E0JA 1EZSC 4B2BA 1P3CA 3PLPA 1QB1A 1EAIA 4A92A 4DT7B 2IJOB 4BTUB 1T4VH 3PMBB 3UFAA 3BIVH 4HFPB 3A89A 4DW2U 1N6YA 3FP7E 2F9VA 3TGJE 1BTZA 5TJXA 4F4OC 1IQLA 5TCAA 4NGAH 5DKMA 1D6WA 3CS0A 4E05H 2BD3A 1ELAA 2PTCE 2XNIA 1Y5BT 1TMTH 1THRH 2AGGX 2ALPA 1UVPA 2C8XB 3GDSA 3GY2A 2ZQ1A 1XVOA 1MD8A 1F7ZA 1GBHA 2JH6D 1GHWH 2ZPSA 1DUAA 1O37A 1J9CH 2A5KA 3MNSA 1GHYH 1QRXA 7ESTE 1D9IA 1E36B 1KXFA 3I29A 2GGVB 1TOMH 1THPB 1ZYOA 1UK4A 2BVXH 2WV4A 2ZU3A 4E7NA 2BZ6H 4JK5A 5EPNA 2W3IA 1NM6A 4JZDH 3T27A 4FUBA 1GHVH 1V2NT 5G4BA 4TWYA 1RRKA 1AFQB 3MH4A 1SR5C 4Y0ZE 4DCDA 1Y3UA 1IQGA 4K2YA 2P3UB 4ISLA 2WPKS 2VIQA 5FBIA 8KME2 3FZZA 2XWBI 2ZDNA 4NSYA 1DXPA 1RXPA 2Z9IA 3RXTA 3SQEE 2PUQH 1YCPM 1ELTA 1HAHH 1VR1H 1H9HE 1RTLA 2B5TB 2TGPZ 3OYPA 1P0SH 2Z9JA 2FOGA 3TK6A 1GMHG 2ZEBA 1BHXB 1EJMA 2H5DA 5HYOA 1NFXA 1V2UT 1SVPA 2ZPQA 3R0FA 1L0ZA 2BDGA 1UMAH 1BT7A 3RXLA 2STAE 3GY4A 3PMAB 1SOZA 1C2FA 1ESAA 2P95A 2ZCLP 4NWKA 5EW1H 3BEFB 1CGIE 1J16A 3EDXB 2QGRA 4U30A 4Y11E 2FODA 4KP0A 2ZG0H 4D7GA 4B1TA 3ODFA 4JZFH 4R8TB 3RXHA 3VGCC 1PYTD 2PHBA 2Z7FE 1C5YB 1LHFH 1P02A 1AMHA 2D1JA 1C2MA 2CGAA 5CHAC 1EOLA 2H5CA 2ZTXA 3E8LA 1O5EH 2FOEA 1TB6H 2VWMA 3K2UA 1BHXF 1T7CA 4ZKRU 1LDTT 1GL0E 1MKXH 1C9TA 4J1YA 1GHZA 4DJZB 3PMHB 1OYQA 2BM2A 4NFEA 1HCGA 2ODYB 3DFJA 4CR5A 1ZRBA 4YTAA 2Z9KA 3ZZCA 2ZPRA 2HALA 4H4FA 3Q3YA 4NIVA 1LCYA 3BTQE 1YPKH 4JZEH 3RMMH 1UTMA 1S0RA 2IOTA 4YESB 2NU1E 2FMJA 1ID5H 5E8EH 1MUEB 1TLDA 1O3HA 5FPTA 1PPHE 2EI8A 1HAPH 1B7XB 1C5PA 2VH0A 1QB6A 3Q3KA 1F0RA 1EAUA 3SHAH 1P3EA 1T8MA 3BTDE 1ZPBA 3LH1A 2NU4E 5C1UA 3PB1E 1EZUC 1MCTA 4X6OA 3RXEA 1C4U2 1C2LA 5A09A 1DM4B 1G3CA 1TYNA 2BLOA 1IQEA 3LKWA 3TGIE 1BRBE 3RP2A 3SU6A 2HPPH 3TJVA 1YKTA 3PWCA 2XBYA 3RXJA 3BTHE 2TPIZ 2ZFTA 1P2MA 4GVUA 3GY5A 2OBOA 1LKBA 4NWLA 1AWHB 1K1PA 2J95A 4X1PU 2J2UA 2A2QH 3A8BA 2BQ6B 5EOKA 2XBXA 1EP6A 5A0BA 4FU8A 5E0GA 1O39A 4X6NA 5FX5A 2QF0A 4CR9A 3F9HA 1MAYA 1F2SE 1BIOA 3DT0H 2C8WB 3ENSB 4XBDA 1EZXC 4BOHA 3A7ZA 4FXGH 1NU7B 2P59A 4BNRA 4B2AA 2XC5A 3T26A 1DFPA 1W7GH 1JOUB 1UVUH 1BDAA 4Y79A 4K5ZA 4X2XA 5DP5A 2C8YB 1LVYA 4K8BA 4ABHA 1BJVA 3SOSA 1MMJN 4ISIH 1YGCH 1TGTA 3L3TA 2R0KA 2FESH 2TGDA 2AMPA 1LVBA 2O8LA 2P16A 2VGCC 3PLBA 1QR3E 1FAKH 1KTTB 4I8LA 4U2WA 1OKXA 4WY3A 2V6NA 4NA9H 1SHHB 1P09A 3TH2H 5LPFA 3TITA 3M7TA 2BDAA 4X0WU 1EOJA 3SUEA 1IQMA 1NESE 4K60A 1AKSB 2WPHS 4WXVA 1Q2WA 1O3PB 2ZFFH 3PWBA 2HNTE 3WY8A 4AB8A 5FXLA 4PROA 4TWWA 9LPRA 3MHWU 1SGTA 5EQRA 1HLTH 1ZHRA 2BY9X 5I46H 3MNXA 4K1EA 3BF6H 2FS9A 1M9UA 1A0HB 2FZZA 1JIMA 4NFFA 1O3EA 1LHGH 2M5TA 2A32A 3TH3H 4CHAC 3PO1B 3IG6B 4B71A 4ISOA 4B2CA 3P95A 4NIXA 3UNRA 5DJ7A 3MFJA 5PTPA 4X1RU 1H9LB 1OP2A 2ZGCA 1IQHA 2WUCA 3V7TA 1CA0B 4O03A 1TPOA 2F9NA 2KAIA 1YLDA 2C4FH 2J92A 1GI0A 5L2ZH 1C5VA 1GWAA 2A5AA 3HGPA 1GGDB 1GI9B 3SI4H 1B5GH 4UE7H 1CT0E 4UFFH 1KYNA 2DE8A 4KGAA 2FOCA 3RXAA 4BTTB 4Q7XA 1LTOA 2WUBA 3VB6A 3ATWA 1O2VA 1FY3A 1SG8B 2A2XH 5JDUB 3VB4A 2ZGXH 3MI4A 4OGXA 5F6MA 1ZJDA 1FZZA 2NU0E 3SV7A 2F9PA 2Y5GA 1T8NA 2BHGA 1SFQB 2ZU1A 3BG4B 4X2VA 1QJ7B 5DG6A 4BAMB 3KHVA 1LPKB 2BX3A 2FX6A 3RXGA 1MTNB 2VIOA 2Y82A 4K1TA 2G5VA 2QY0B 4CRCA 1CHOG 1FJSA 1Y8TA 2FOAA 1NU9A 3F9EA 1GMDG 4IW4E 5T3HA 2EC9H 3GYLB 1VITF 3P8OA 1LO6A 4E06H 2PV9B 1V2LT 3BG8A 4Y8ZA 1GJ7B 2BY5X 1O5DH 3GCOA 1KLIH 4YOGA 1HUTH 2ZFPH 1SGPE 1EASA 2ZGJA 2JH0D 2OP9A 5GPIB 5C5OA 2OINA 3EAJA 2ZF0H 2XW9A 4YZUA 1HJAC 4X1NU 1WSSH 4ZHAA 1S84A 2XCNA 4MLFB 3LC5A 4OGYA 4Y10E 1TBRH 2BLVA 3SGBE