1F8XA

Crystal structure of nucleoside 2-deoxyribosyltransferase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
b'PKKTIYFGAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDIMLGVYIPDEEDVGLGMELGYALSQGKYVLLVIPDEDYGKPINLMSWGVSDNVIKMSQLKDFNFNKPRFDFYEGAVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
publication title Crystal structures of nucleoside 2-deoxyribosyltransferase in native and ligand-bound forms reveal architecture of the active site.
pubmed doi rcsb
molecule tags Transferase
total genus 55
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2000-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f8xA00
3K2QA 4PFKA 2IZ6A 4JELA 3HNOA 2IZ7A 4JENA 1PFKA 4I4IA 2F62A 6PFKA 4P5EA 5ITSA 3OPYB 1RCUA 2PMBA 3BQ9A 1S2GA 4I36A 3EHDA 4LJRA 4MCJA 4U1RA 1WEHA 4HX9A 3MAJA 3PFKA 1KZHA 4FYHA 4KXLA 2Q4DA 4JEMA 3O8NA 4KXNA 4LJKA 1F8XA 4NPAA 2F48A 2F2TA 2A0KA 2F67A 3U39A 2A33A 4KXMA 2KLHA 1WEKA 4OHRA 4P5DA 2F64A 2Q4OA 5AJTA 5AJUA 4FYIA 4A3SA 2NX2A 1MTOA 1S2LA 3O8OA 2KHZA 3F5MA 1T35A 3SBXA 3QUAA 3UQZA 3IMKA 1F8YA 1S2DA 2PFKA 1S2IA 4FYKA 4WL0A 3OPYA 1ZXXA 4I7EA 3O8LA 3GH1A 1YDHA 4MEJA 1S3FA 3O8OB 2HIGA 2IZ5A 4OHBA 4RH3A 4LJLA
chains in the Genus database with same CATH superfamily
5EIOA 4DJDC 2RJOA 2O5EA 3GLGA 2BGLA 3NWBA 2RGXA 5BXYA 3IVXA 5C52B 3KX2A 3EEBA 3PC8A 2J67A 3IXQA 1K8XB 5TGDA 1L5HA 4YAUA 1ULZA 5ALRA 2O2GA 1ZNWA 3R0ZA 2CXHA 3EUEA 3UTCA 3NUQA 1Y4AE 1IBLB 2O8VA 1GWNA 3CF2A 5IMSA 3THYB 3QPDA 1EA5A 1YULA 3BRQA 4MEAA 3RG8A 3WB2A 3BK2A 3PQ2A 3P45A 4G84A 1ECJA 3SFTA 1V0JA 4M7PA 4EL5A 3G0OA 1KHHA 1A9XB 5AP9A 5BYJA 3AINA 1UJ2A 2VCYA 2JGDA 1V71A 1KZ7B 5D5PA 1HSZA 1Z62A 5BN1A 2BGRA 3GGSA 3H5RA 4FNOA 3ANMA 1CJMA 3HEBA 5G0VA 2FN9A 1C7EA 4HY3A 3NKVA 4YYEA 3AM3A 1XVVA 1EG7A 2QLLA 5BUCA 6NULA 1SC3A 1YC2A 2V96A 1D2EA 2QRJA 1NJSA 1T4BA 4H59A 4A8PA 5IN4A 5F77A 1DCTA 5AKHA 3BWBA 3SYTA 3ZD8A 2QPAA 3T7CA 3OHSX 2L42A 3QXXA 5DNVA 4BMXA 5AUOB 4YMSA 1KY5A 2J9RA 1WW8A 3PNSA 2YWFA 5JD5A 1A4IA 1XCLA 1HKHA 1LLCA 5E9AA 3RYHA 5K0ZA 3HM9A 4MKFA 1GNPA 4HF7A 3AC0A 3TQQA 3ETCA 3ZBUA 2YH2A 3OF2A 3O3NB 2J08A 2IEIA 2NPOA 4TV8A 2QD1A 1G3MA 4B17A 4N5IX 2GD0A 2DJIA 3I6MA 2ZUUA 1M6EX 2XZOA 4LQLA 5HHTA 1UWLA 1JU9A 3H1EA 4BHTA 4B3GA 3GMDA 4X1IB 1CP2A 2CKDA 4KN8A 2PSJA 5DNYB 3P27A 5AJTA 2XLBA 3RIMA 2I4MA 3F6SA 4ADSG 3EIXA 1CUHA 1BAPA 3UWDA 3ZE1B 4ZYTA 3UK1A 1IJKA 2G77B 5A1JA 3DPIA 1YJ8A 3A6ZA 4KW7A 4L0CA 4AN4A 4HVLA 1MPXA 4WJKB 3QYAA 2DMRA 3URMA 3F5MA 4MYSA 1JA9A 1YR9A 1C4OA 4LRUA 4KQXA 1VJGA 2YY7A 3AP2A 5DF1A 3I4FA 1FQWA 5KNCD 1ZL2A 1AUPA 1EXDA 4NIMA 2OL4A 1RXSA 3IBTA 3A4NA 2FQQA 2YICA 2PZMA 4DYVA 3LQ1A 4KRFA 3K9GA 3G9ZA 5EINA 1QK4A 5AHRA 4FQ8A 2FR1A 3MCUA 4B80A 4OQ4A 4Q82A 5JBQA 4Z0TA 2AXNA 1ESNA 1Q0TA 4D3FA 1IJFA 2O0JA 1GZVA 3ZWQA 1ZO8A 1NXOA 3C41J 2OAP1 3CB4A 1DAFA 4NH4A 2DRIA 5A2QA 2V03A 3NC1C 5KKNB 1K0FA 5D87A 1Q3TA 4XIGS 3CM0A 5EXEA 3IUEA 1JI3A 4LG1A 1J8QA 4JI6B 1QYWA 3WRWA 3QJGA 4LISA 4D7AA 1J5XA 2LDBA 2GERA 4YRAA 1Y8AA 7ABPA 1UBSB 1SR8A 4KYIB 4MYDA 4TTRA 3DDOA 3W3AA 3R76A 3WYBA 1M7BA 3PJDA 4ZJYA 1U8TA 1AGNA 1R50A 2CMGA 2J0EA 5BT8A 1BDIA 2TMDA 1LA2A 4KR6A 4B45A 6REQA 2AF4C 1GNRA 2CK3A 2Z43A 5F1YA 1T6XA 1Z56C 2Q8QA 4C0WA 4PNEA 3E9CA 3DUFB 3ZGYA 5FNVA 5IXYA 1XNGA 2A3NA 3DE1X 3SXUB 1QP7A 1PQPA 1XRMA 1V45E 2G5PA 2I4OA 2VF7A 3D8TA 3I9LA 3VYSB 5KTPA 1O1YA 1G41A 1EQUA 2JJ2A 4MWEA 2D3WA 1DPGA 2B2NA 2CV2A 2VKTA 3PUHA 4URYR 4PG5A 1AF4A 2H4YA 2BFDA 3ROKA 3I28A 4OHMA 2Z5GA 1X9IA 3BXXA 5C4IA 1PK8A 3E22A 3TO5A 3ZWPA 4RY0A 4C0LA 1TTQB 3T1YB 5FQNA 2C7BA 2D6FA 3A2NA 2FWMX 4JS0A 5EWJB 5JCPA 4IG4A 5EIHA 1DBQA 3TIFA 2DUNA 1P3JA 2FJ0A 2WHXA 2FR8C 3H42B 1BGWA 2F3PA 1D1SA 1E6CA 1EB9A 4OFBA 4S2EA 5DM4A 4ZEXA 1G8AA 1WSAA 3PFIA 4YWJA 4N5DA 2XA2A 4MVJF 1OYWA 4YECA 4S12A 3MTAA 2W2LA 2P90A 3IPCA 5CTAA 4DSUA 6GPBA 4Y9SA 1G0OA 1PR3A 4KCGA 4ABYA 3O4VA 3PPXA 1A2BA 1L5YA 1QTQA 2C92A 3GYBA 1CEEA 1P8AA 3MJDA 2ROQA 3B7PA 3V6LA 1UC8A 2WQ7A 2EGGA 2CXNA 1YR3A 3DH0A 2WD9A 4MW5A 3NRCA 1CUJA 4HWRA 2Q0XA 3L0DA 4Q3NA 5B7QA 4ZODA 1VBFA 3GL9A 2CLEB 4GP7A 3TUZC 1E3TA 1GAEO 2R96A 3Q8XB 3NIWA 3HBAA 4NYMR 1NRJB 4K6OA 4QJ4A 3BSYA 3GUVA 4F2DA 5CA0F 5HQTA 4PC3A 4E08A 4QJ3A 1R4ZA 1X70A 5EHGA 2J4DA 1RBQA 2W2NA 3T9CA 4L5YA 4YRRA 3RQSA 3RVBA 5JS2A 1XLWA 3ZWXA 4CN9A 1DLJA 3BXGA 5HF9A 2YXEA 3EDCA 2JLZA 1MENA 1R9JA 2C7VA 2QTVB 3L79A 4KQIA 3D6TB 4EKNB 4BUZA 2PZAA 1CTQA 1MDBA 2FG7C 5K20A 5DHFA 2VTDA 5C8VA 3A9WA 1M8GA 3QVVA 5TVKA 1NXXA 3KM0A 2W6IA 3N6XA 4ALNA 2IYVA 1DT5A 1G8PA 2P62A 5COQA 3QJ5A 5DGCA 5ALSA 4B0PA 3SHOA 1Q92A 2F9MA 4CLDA 4QT4A 4JLSA 5TS3A 2JKZA 4QEKA 4RPHA 2WZDA 1L1EA 4ZTBA 4MIEA 4ESVA 3GN2A 5A4FS 4E5PA 4EITA 3IRVA 3SZOA 4D80A 3SBEA 1WL8A 4Y18A 2R6ZA 1QAMA 3GF4A 4RK0A 4KG7A 5T3YA 3WMEA 4DMGA 3I5XA 5BUQA 5K6RA 2RGEA 2QM8A 3I2FA 5SY6A 1JPNA 3QMVA 3UPTA 2PXXA 3M1IA 5GWXA 2CNWA 4M1EA 2AW5A 1DHTA 1V16B 1DQZA 1N2CE 4Q7QA 1IPHA 3ZJUA 1RC1A 2GAIA 2OK8A 2FEAA 3GGOA 2QE7D 5FULA 1W0JD 4QU5A 4DHEA 5C32A 1QHGA 2IEZA 1L8XA 4ZTUB 3VR6D 2GM4A 3IHLA 3KOUA 3R40A 3AR5A 5I7OA 3ZU5A 1X7ZB 1I30A 1LY1A 5AKIA 1EIZA 2WMOB 4B34A 1EU1A 1RU3A 3UAVA 4LF7B 3M9LA 3EZNA 3KCQA 3FM9A 5DU2A 1V3VA 4GL2A 4J1NA 4TV9A 1W581 5IKOA 1ESDA 1VSQA 3FCSB 2DEUA 5K8VA 2HLDD 4PFKA 1J1UA 2A9KA 1A0OA 5AIBA 2ATVA 3QXHA 1AKTA 1U2QA 4BNLA 3AF4A 3BGIA 4GE0A 2WSIA 4Z99A 4JR1A 1MX1A 4FHEA 4I5GA 4YT4A 4ZA2A 2FUKA 2GZDA 5ALFA 2VR1A 1PEYA 1LVUA 1ZK3A 2OBFA 4FT4A 5DTRA 5E4YA 3U26A 3NWPA 1NF3A 3GFFA 3ZWCA 4F1WA 4INOA 3QKSB 2C4TA 1Q83A 3B6MA 4WCDA 4W5OA 2GRUA 4DIKA 2GRJA 2IW3A 1Z7YA 1R8YA 3IPLA 2OOSA 2GETA 4DMRA 4J43A 3AOGA 3R4CA 5K6AA 1JH8A 1FSGA 4MROA 2GHTA 3C7AA 2ZJYA 4OQNA 3SMVA 3TZEA 5CA0B 2BKAA 3UGTA 4K6GA 3WGMA 1Z4NA 1GRQA 4K81B 5HE9A 1U3GA 2GN1A 4RAOA 5DZSA 5CITA 4YQZA 4F6RB 2AN9A 2I71A 1RAFA 2IHZA 2NUTA 4F3YA 2J5KA 1EFTA 1M3SA 1L5ZA 5ITVA 1OWLA 3QBEA 1IRIA 5LP6F 4U2BA 5IBPA 1HLFA 2YMQA 3IUJA 3PWTA 4ZP1A 3GFOA 1WAMA 3LZ6A 1ORRA 2BMEA 2V5AA 1V7CA 4XYGA 1JKXA 5EIWA 5TX7A 1WB5A 3UWKA 1ODSA 3LPCA 4OQMA 2VC2B 4IIEA 4P5PA 1N57A 4GM4A 5I45A 5JD3A 5TMBA 4GOJA 1IZ8A 4AQYB 1C14A 1NXTA 1SCNE 3PWSA 4H31A 1AKQA 1K4KA 1SXGA 1BOOA 1UXJA 3BIFA 4Q3BA 2A30A 3FW1A 4RLQA 1CQJA 1LDGA 1QZUA 3JYOA 4WN3A 3UJ6A 5CB4F 1G20A 2WY2D 4JUCA 4WXEA 4NQZA 3IHKA 1J06A 3E3MA 4EPVA 4M3NA 2J0VA 1TVKA 2WZQA 2ZWIA 4BMZA 1RNLA 4AWAA 1M66A 5EFZA 5TGZA 1BVRA 2EJTA 3ANSA 1P4JA 3FOZA 2YJ5A 1XEFA 3AUSA 3GP8A 3GRVA 3GJYA 3LQKA 3TOXA 2GH1A 3HI6A 4AY3A 2VTBA 3BE4A 1ZGJA 2FYTA 2OSBA 1KGSA 3F9CA 4BWGA 5HGXA 4TYNA 3AU8A 3IJRA 4HHEA 1ORTA 1FNSA 1J8MF 1YF3A 1E9EA 3FIUA 2Z9DA 4JT2A 2WTAA 3MPOA 2JI8A 5G41A 1M76A 2GNOA 5CD9A 4KR7A 3P52A 2QW0X 2V7GA 3I6QA 2J0UB 3AXTA 1OLUA 1Y3AA 4DMLA 1OI4A 4I9UA 4JT8A 4N49A 4Q16A 1PJ4A 3M89A 3HXMA 4JI2B 2WF8A 3DDWA 3I2YX 3LH5A 3UF0A 5BWLA 3OEWA 1NLZA 1CEYA 3K9HA 3MWKA 4BNWA 3REFA 2YYZA 3DJYA 4C78A 2FFRA 4ZOEA 3O84A 1P7ZA 1T5OA 1WMSA 1GD1O 3NAQA 1YZTA 1WX1A 4C14A 2BLNA 4GZ3A 4C04A 3HXOA 2GSWA 4HPXB 2GLXA 4K26A 3DF9A 3EXFA 3EAGA 3ENQA 2I29A 1VHQA 2XTAA 3PX7A 1T0JB 3PA6A 4IFBA 1CJVC 3ZJ5A 3ZHVA 5IBQA 3CSSA 2I6FA 1R1DA 1VPVA 2R00A 1JJIA 2H54A 2VQDA 4CEHA 4KKXB 1BS2A 2ID7A 1OH5A 1Y37A 1XEXB 3U81A 4II2A 3R9KA 2PR7A 2WKSA 3C6QA 1BW9A 4G1VA 4IWNA 2GX6A 4GW3A 4M8KA 1P5FA 1Z6GA 4HDOB 4FD3A 1I9GA 5EJ6A 1OQAA 1SFRA 3D2BA 3ITNA 4C6SA 4DILA 3GRRA 1Z2NX 1DC8A 1FS5A 2HSEA 3Q40A 4LMRA 5LP6B 1VHJA 3FPSA 3QLVA 3AVWA 4RTJA 4FKZA 4DCMA 5EEGA 5K0LA 4WDQA 3QM1A 3QWFA 2H5IA 1QV6A 4AUKA 1O5TA 1OZAA 1OV6A 2IYFA 5EI5A 1D03A 4WXPA 3ROTA 1ADJA 5DASA 4EARA 4AJ4A 2IDKA 1NE2A 3B1JA 3QSGA 2X0EA 1DJOA 1K4MA 2PKCA 3NHKA 3RVSA 5CB4B 1OLXB 4MKHA 4AF6A 1DJLA 4NMMA 4HNVA 3CKLA 2C5SA 3DBRB 4F84A 4I1SA 4UE6A 2GA9A 4LY6A 3I2KA 3U0VA 1DUVG 5K03A 1E0KA 3M49A 5HDQA 3C3DA 3IUPA 1E0JA 3W3AD 4OKNA 3W0LB 1I7LA 1YI0A 4QXOA 4E0BA 2R62A 5KMGB 4RTRA 2FZEA 1IN8A 1QGED 2E87A 2YTZA 3WWOA 5CDSA 4NDZA 3N7TA 4WLFA 4E15A 3NAZA 3TMAA 2CK3D 1SQFA 2DKNA 1PAUA 3DV9A 3B3QA 3ZNOA 5ETJA 2WJ4A 4L4YA 3L1VA 2R4QA 5DBOA 1JKJB 2IYLD 5CGQB 1V4BA 2HWWA 4NDNE 2JJ2D 4DA8A 5DHTA 4N3AA 4RU1A 1KPHA 2Z5FA 2TYSB 3L06A 4TL7A 3ONWA 1NRWA 1NJ6A 2DOKA 4C07A 1MT3A 2JAXA 3WQSB 1QNLA 2AS0A 4WKNA 1U3UA 3KT6A 3X1KA 1XXLA 1AZWA 5AI0A 2Q1XA 1PGJA 1IHDA 2P4EA 1MC1A 5IKPA 2O2HA 1OYVA 2XMSA 2XMDA 3T6KA 3DMDA 3H7AA 1LDBA 4PBTA 3ZW7A 3LKDA 3AKZA 4KGVA 5GJWC 3X2SA 2AN3A 4RY2A 2D8MA 2AZXA 1RAAA 2OV2A 4KU4A 2I2FA 5AJWA 2Q27A 4RK1A 1MA0A 4Q4AA 4E09A 3PD7A 5D01A 4JCCA 4N5MA 1NN3A 4ZCSA 4B6FA 2W2LD 3F49S 1NBMA 4QWWA 3VTZA 2FWAA 3H9JA 4DPLA 5E8JA 1ZN7A 1NURA 3EQZA 5CFQA 4LBZA 2CSXA 3NEYA 1F5NA 1Z5WA 2D8AA 5ALPA 3GUZA 3KJZA 3OU2A 5IUKC 4IRUB 4YRJA 3TPFA 3UMYA 3RUIA 2BGGA 3IMKA 2ZRCA 1ZMBA 4BAUA 5LMNB 2OR3A 3E81A 4CKEB 2BIFA 3P4XA 3MB8A 2YC4C 1YS1X 1WULS 2RAVA 3OT1B 2BHTA 4AKHA 1BDBA 1J7JA 1LSUA 4PHFA 2BCGY 1L3CA 3I72A 3EODA 5LMUB 1WABA 1AG9A 1P44A 4Y2GA 2WRZA 5DIFA 3FRIA 4CLHA 2CD9A 1V5FA 2D54A 2E21A 3M4JA 4H7KA 4IIYA 5AI6A 1M83A 4TLLB 4HAYA 3SKYA 5A4MS 4AKGA 3HJFA 4DT1B 5TC4A 1HURA 2DPMA 4RPIA 4MUJA 4B4OA 3HLTA 3VBEA 1QOPB 2P3LA 4V0NA 2I7VA 1TM2A 2ZXUA 3PC2A 3ISJA 1D7OA 2W6ID 4MIKA 2ORVA 1G5TA 3I8XA 1UK9A 1R5OA 3AKEA 3ORSA 3IEPA 2IIPA 2BFNA 2V54A 3ELUA 4HB2A 4O5OA 4X1YA 4ZWNA 3QOFA 4DNXA 3G3EA 1N6NA 1LI7A 4QPDA 3UM9A 1KGDA 1V3UA 2ODEA 2OGUA 3H4VA 5F2NA 5B7GA 4H1HA 5JQWA 1KSGA 2VJCA 2EJBA 2BDUA 3FKSA 2FA9A 3FOCA 4BB5A 3MMXA 3QPVA 1MABB 1R6UA 5KVQA 1YB4A 2OAQ1 2CNWD 4DV7B 3G8DA 2ZYSA 3P96A 4FHDA 5EE1A 1EJ6A 3FR8A 1UDRA 1SEVA 4FMDF 3HU2A 3WOHA 4RTNA 4F46A 3ZGZA 1E62A 2Y6VA 1D1QA 2FHSA 4YUZA 1TF5A 1PJ3A 1XK6A 3ACDA 3ZNNA 4DLBA 2V4ZA 4QUGA 5DX8A 5CFPA 1JEOA 2XQGA 4N48A 4XSGA 1IXSB 2O2EA 3PI6A 2FUG6 3OOWA 3AUYA 3HJRA 3PE3A 1RWPA 1XKTA 1OKKA 1RM4A 1Z8DA 3L77A 4OOFA 4H27A 1B42A 4HWKA 1ZA1A 2B83A 2YWXA 1N5OX 4MR8B 4PN7A 2ZRGA 1XMVA 1Q15A 3EFOB 1ECFA 3OA2A 4PYQA 2XUQA 2NOAA 4TQUS 2WU1A 1TOAA 3EZ6A 5FI1B 1IEVA 4GSYA 1RWBA 1CR0A 2QGFA 3ESBA 2QTZA 4M0LA 1OGIA 4XE5A 1YNSA 4UEOA 2R65A 4TMTA 1DBRA 2DE0X 5FL3A 3JYNA 1XRJA 4RH0A 2WHEA 5DBHX 2ZTVA 4CG3A 2C5AA 2JIMA 1BYUA 2NADA 3ER6A 3VKVA 1COZA 3NHWA 4TM7A 1XZLA 4WACA 3ZK7A 5ERGB 1ZW1A 2QL5A 2ODTX 3GJ6A 2IOFA 3NVAA 3I83A 2J3MA 1E79A 2OXEA 4FM9A 1PO7A 2DQ4A 1I13A 2ZUTA 1GPKA 3NXSA 2W4QA 4UMVA 2A5YB 1UANA 1U7HA 5I8PA 4LFCB 1SK8A 2YXDA 3PVZA 4Y2UA 1NX9A 4CI0B 2BF4A 1AH2A 2WWWA 3ICOA 4WJZA 1C7QA 2CFOA 4B6PA 4QGFA 4P3KA 4B87A 1Z29A 4RJIA 2F17A 4QTTB 4EKEA 4ZU1X 1T25A 3AF5A 3CX7A 4IJWA 4MQLA 4A1FA 3VZCA 3CZ9A 1DKPA 4WUTA 4RJTA 1XDZA 2DTDA 3PIDA 3W8DA 3P0HA 3U80A 1MN6A 5AUQA 4Y6OA 2JZOA 4GZ6A 3K5HA 2C3YA 3R3UA 5FR1A 3RSZA 5AVWA 3IH5A 2QF7A 3CUUA 3LA8A 7YASA 1QF7A 3UTDA 1S8NA 3AW9A 1S2IA 1RJ9A 2JAOA 4MIOA 4QUIA 4AU1A 1ZH4A 4C29A 5JSZA 1LPOA 4BO3A 1DXOA 4KMOA 5ER9A 2BHSA 2OO5C 3K16A 3A28A 2JAQA 2PS3A 1IU9A 2Q46A 5HIKA 5FEUA 4FQ7A 5HPYB 2LXNA 3IT0A 4ISCA 3HBJA 1JIQA 1WOMA 1Y1SA 1Y4SA 5E7IA 2A1UB 3DEAA 1SKYB 3Q9NA 1HC7A 3W78A 3UPUA 4JR0A 5KAMA 5HQJA 5I7SA 5JQGF 2I9KA 1NVDA 4KVZA 3N2YA 1AKEA 1E9SA 4BVKA 3K1YA 3RYIB 2H4HA 3B3FA 2GPBA 3IPXA 4FMDB 1YDFA 4HDAA 5DNCA 3GU3A 5DI9A 3S5UA 4DJAA 3PWKA 3RRYA 1H9CA 3LXMA 4IUCS 4L5BA 1PG0A 2QVBA 4YAOA 1MIHA 4PRZA 5FOVA 3RF6A 2GJAA 2MYUA 5JBNA 2X86A 2AHRA 4H6PA 2Q1UA 4D42A 1B2LA 2X5KO 5FOSA 3B6KA 1FDVA 3RI3A 2VLBA 4JFRA 1LKZA 2NIPA 1U4SA 3D64A 3EXG1 3RYCB 2FR8A 4PEVA 4S1OA 1DRWA 5BXQC 4ENVA 3LBIA 2H5EA 2AE1A 1XZEA 3EE6A 2EFJA 5JOQA 2KW5A 4TVSA 3UBTA 1I3CA 2QW8A 4U9IS 3FI0A 5JYDA 5J1SB 1GCUA 1PEDA 4HUQB 2QMQA 3QVLA 4R9VA 3ZZTA 1PR6A 2YNMA 3DT6A 1FU4A 2BELA 5BO5A 5JZOA 2J3QA 3X1MA 1RRMA 1LLQA 4YC7A 2BFOA 2E4VA 1MAWA 2EKDA 4UHKA 2RONA 5CVDA 1UDAA 4GOND 1HI9A 4KXLA 3CNBA 4KHZA 4X7MA 5EKTA 4UTPA 3FB4A 1UBCA 3GRAA 2QK4A 4X63A 2BTEA 1XZJA 5IAGA 3M6LA 4DLNA 4LMAA 1KOFA 1PGPA 3LCRA 1YBVA 2WWRA 3BKXA 2O20A 2H1RA 4LS3A 4B76A 1N1MA 1WDTA 3FZGA 3VU9B 5DBGA 4ERNA 5CEJA 4AY5A 2ZM6B 1SCKA 1L3BA 2EFCB 3ITEA 4WNCA 4ZOQI 1DGQA 2AR9A 2EEZA 1YDGA 2LNDA 3HSSA 2Y9PB 1Z6AA 3I6BA 3AUTA 4PZEA 1O57A 4ALIA 4HZIA 4HYEA 3GR6A 1VLVA 2PUWA 1XWWA 3EXG2 4EI8A 1SU6A 3OPNA 3E7XA 3HPRA 1DEOA 4XYLA 5LDDC 2EX4A 5JXIA 1ILWA 2VZ0A 3F6RA 3RABA 4DSOA 2B7CA 4YFVA 1J8YF 2Q2QA 1PBTA 3T5GA 2D1TA 1YR2A 2P75A 4HBZA 2B36A 1PJBA 2Q41A 4MQ5A 3RFVA 4YRBA 5DGXA 1IUPA 3WMXA 3N2KA 5L45A 5B57C 4C4OA 3I1JA 3MRVA 2BFDB 1FVOA 3LI2A 5TRTA 3NHZA 4HSEA 3E22B 4J7XA 1T2EA 3ZYZA 1JDPA 5JQGB 2J46A 2ZCVA 2Q5JA 4HGRA 3TB4A 1P7PA 1RZVA 2ZRDA 2NZ8A 1SU8A 1R9GA 2P5SA 4HDQB 1OYOA 4RQAA 4KGXA 3NWOA 3E1SA 3PT9A 1U0EA 4BQSA 4D41A 5CLIA 3QEAZ 4WA8A 2H7YA 3HDYA 1FNDA 4NFLA 4A7PA 5TE9A 5H80A 4K9RA 5ESRA 5EJIA 1JB9A 2ZJ0A 4DNPA 4EG5A 1ISFA 1OAOC 3T3MB 1OCEA 5TEVA 1JJBA 1JR3E 2HU5A 4XFKA 4DKXA 5G40A 1KXZA 3ROZA 5EJ2A 4EJSB 2ENUA 1PDWA 2JLRA 3A6KA 1Y42X 4IGFA 3AKCA 2ZJ6A 4FWTA 4BBPA 3EK2A 5EESA 4XWOA 3S3TA 3TRHA 1C7JA 1KDRA 4TMKA 5THXA 3V97A 3FX2A 3LBAA 3RPEA 1D2CA 4IVPA 1XNHA 3OF3A 4N3GA 2Q9CA 1M2EA 2Y1LA 3CIOA 5C18A 1NXQA 1ZCZA 1U28A 1HF3A 5HF6A 2ONJA 5JISA 2B2CA 1EWYA 1QAQA 1OXKB 4ENTA 4YV2A 3AI3A 1NBMD 3I9NA 1JT2A 4DQUA 3U9TA 1A8PA 4AKIA 4HUJA 1ODTC 4M21A 4Z3OA 1NI3A 2QQ5A 3FFBA 4WFQA 5SY4A 5AVSA 2V7UA 3BE5A 4KQEA 4F8EA 4AJIA 4MGHA 5FV4A 1P1KA 5JVDF 3K6SB 5IJ0A 3QY0A 4I1PA 1QLJA 1UJ4A 1P0FA 4RS3A 1U04A 5C34B 5BSWA 1RJEA 2PX8A 2Z5LA 1U7TA 4PPNA 3A1UA 5HFNA 4MRVA 2BJHA 1CR6A 3NHAA 1G6OA 5K01A 1U81A 3ZE8A 4HNTA 4RCZA 1DCMA 2JG3A 1T4GA 2B99A 2OLEA 1F3OA 5FYQA 3AVXA 4DV4B 1HQCA 1RRKA 2I6SA 5EPOA 4RGVA 3PCTA 1TT7A 4KFTA 1CNMA 1SU4A 1I4WA 3CRVA 4PO1A 5THQA 1R3UA 1VIAA 2XYHA 5BRNA 1W85A 2I33A 2PT9A 3DBVO 3TLAA 5IZ4A 2XKAA 4D96A 1JH9A 1B74A 1BMFA 3BMQA 3GJRA 2QROA 2AR0A 4L02A 2IHJA 3GEPA 5AQEA 4KN9S 3TLBA 2B1RA 1Q7RA 3LV8A 5KYXA 1GL6A 3UW3A 1STOA 1Y5LA 1JDNA 4GKVA 5CAEA 5KOYA 2VQFB 5JS7A 1PRYA 1YV9A 1L5QA 3A9RA 3PJEA 3LZDA 4Y6RA 3I01A 5T7BA 1Y5NA 3NV9A 1M6HA 2GVDC 4QNNA 3I8SA 2FEKA 4TV9B 3TKLA 3C1OA 4WECA 4KR9A 1JALA 3R9XB 4EIWA 4ZT5A 3HKDB 3BHMA 4RFLA 3L8HA 1YBHA 2Q8PA 2VJPA 2AMLA 4HWGA 1GFZA 2G17A 1XRRA 3K20A 3OCYA 1SIBE 3U7RA 5AUNB 3QKUA 4MV7A 2EW8A 1T1SA 4W5TA 4RX1A 2GEBA 3CXUA 1Z5NA 1QKJA 1WCXA 2XUIA 3T5BA 1WLSA 2O2DA 4RFSB 2V7XA 1RACA 2XQFA 3PRHA 4M7WA 4Q7EA 2IU4A 3FPKA 4QTXA 4QLAA 2L2QA 4ZVQA 1GGVA 2G9NA 1H1TA 2OD7A 3F3KA 1PZGA 3RTAA 2Q7DA 2P4HX 1E6LA 3S70A 5A9SB 3S8YA 3SKXA 4Q1CA 1N5RA 4DWVA 2HSZA 4RD4A 2IYTA 1JDBC 1OKKD 3CUYA 2P6UA 5B1IA 4AJJA 1C3OB 4NFSA 4M1TA 4DFDA 4DWJA 3PF9A 5EN4A 3BCRA 4B6EA 3M7IA 1MG5A 3PKJA 1RYMA 3KKZA 3RO7A 1I3KA 1VSTA 1S2DA 2CMFA 5CBPA 5DH9A 1AK2A 2NU7A 3CE6A 3IO3A 3GLKA 3E2PA 4CCSA 2G1PA 1YIOA 3AEQB 5DMXA 1M1UA 2CL6X 2XNCA 4PWZA 4Y2PA 1ZQ1A 4EB6B 1Y4DE 4CM4A 2HXSA 3E1GA 1NUPA 3NVMB 4E4RA 1RKXA 3WGNA 1EJ0A 2AA3A 3KFLA 3OJWA 5JVDB 4DRZA 5GONA 3A10A 1Z9BA 4Z4FA 1YZUA 1H22A 4TLAA 1T8UA 3MCWA 4X44A 1LI4A 4HDCA 1L7PA 1PSWA 2B3TA 2CLFB 4PAWA 4TZKA 4CCWA 3VYVA 1LWOA 2RAUA 1EVZA 1E79D 2YZNA 1SELA 2RBKA 3MNFA 2OKGA 2GN8A 4WTOA 4IRMA 3I5YA 3LUFA 4YVFA 3A9TA 3SJ7A 3U7QB 4D0SA 1YTUA 3N0XA 3EVBA 2C2WA 3LL7A 1DG9A 2ZSEA 4LVOA 4G6ZA 5FWYB 3ZY4A 2ZDHA 3A7DA 5CHYA 5AM3A 4FGSA 3NETA 1W4BA 4CMCA 3HJCA 3C5HA 3SGLA 3WYDA 3ETEA 5KOJA 3UWPA 4DRYA 2QRVA 1TZBA 2JA2A 3BK1A 2GAJA 4B73A 4IHAA 1WXWA 1WMFA 4OJQA 3EC1A 1EVIA 1I4EB 2R8PA 1NJ5A 3I6ZA 2L19A 5EG5A 3KE9A 4L78A 3SJAA 8ADHA 2VTBB 3T4EA 1GZUA 1DT3A 1SUDA 4PX2A 7GPBA 3BCHA 2VP2A 3BJMA 3HMKA 3DE7X 1WB6A 1IM5A 2ZG6A 3BB4A 3I92A 5IJAA 2KYRA 1MZVA 2XITA 5AIAA 5F7JA 3E5NA 1ILEA 2HMWA 3GUCA 2XF2A 4HLUA 4MVJG 1E5QA 4BASA 4X45A 1ZHOA 3O5AA 2QX8A 4QYMA 3ZDDA 2A86A 4M7OA 2PVCA 1PS0A 1VE3A 3R8FA 3DD1A 1EX9A 1SVSA 3TLXA 1OFHA 1I2MA 3ZPXA 5KWVA 4B3CA 2HMVA 3UJDA 2AOVA 4RZXA 2VRWA 3WYFA 2VXBA 5CLJA 4PZAA 4S1TA 2VWGA 1PWHA 1U8ZA 4MRAA 2WIJA 2HT1A 3WB0A 1V11A 3B3GA 5JSKA 2NU9B 2ES4A 3VJLA 2C20A 1E1DA 5FX2A 1GTG1 1BJTA 3COPA 1C8LA 1X19A 5EXXA 1K97A 4Z2YA 3UYKA 3ZQKA 4EA9A 3M1YA 3MXTA 4HGYA 2OGZA 3D6NB 4LNUA 2QP4A 3CA8A 4MW9A 3WLFA 1THTA 3O9ZA 1E4OA 4B32A 4GLJA 2RHRA 4DWOA 2C5LA 1JIVA 5EUCA 4P53A 1ECPA 3EC7A 3NUZA 1L5RA 3W2GA 1YZLA 2WEKA 4OBBA 4KV7A 4D6YA 1QANA 3L02A 3GRZA 4WRRA 1Y9JA 3U0BA 4G0VA 4N3NA 2Q6OA 1CIPA 3ZWWA 3AV3A 2QQFA 1M6VA 3V3TA 4JSRA 4EW2A 1L9KA 2OBMA 3ABSB 4OXQA 4WZAE 4CE6A 2ZJ4A 3C98A 3QX9A 4Y2XA 2B0JA 1TZCA 4B46A 5EERA 4DDVA 1EFDN 1H1LB 2FSUA 4TKZA 1MNAA 4IHJF 1IXRC 1EZ1A 2VQ3A 4IUDS 5ALKA 3TKAA 3CR3C 4MRSA 3TZLA 1BHJA 2IHUA 4UE3S 3P9QA 3SM3A 1CB0A 1P5RA 1DKUA 3KWLA 4TZTA 4DCJA 1XZNA 4K05A 2HBYA 1L4BA 1I7SB 4I50F 2YVQA 1UJBA 4K9LA 5FXMA 4DM3A 3PEYA 2IYEA 4F3CA 1JQBA 1UADA 2GKSA 3FJ1A 1M1YB 4OFXA 2XE4A 2X4GA 3FNRA 1MV8A 4BEWA 1N7GA 3MSCA 3O8BA 1KR2A 3UCXA 3M8KA 4Y2SA 1B6SA 3V1TC 1GG2A 4DREA 4DS3A 2WWYA 3P9CA 3KT8A 1NKVA 4KZPA 4MRMB 4QPCA 4ZJUA 2P3QA 4HQKA 1UC5B 4W4TA 4GXTA 5KSZA 5L9AA 3F97A 5TMEA 1U8YA 1L2TA 4INAA 2FW6A 3ZTWA 3K09C 1CUIA 4B5KA 2RDMA 4CM8A 2XB8A 1KORA 3IP1A 3C3KA 3GRCA 3MTJA 2W2PA 5TQJA 3P9SA 3SKVA 3UJAA 3ND8A 1HZZC 1D9ZA 3QBTA 4IUBS 2DWQA 5FB3A 4A26A 4ECEA 4YPVA 4UTNA 4O1HA 5JAOA 4FHGA 4QG3A 3R3WA 1CQPA 1BX0A 1SVWA 2HT6A 3N8KA 2CB9A 4JUAA 4ZDWA 3TX2A 3ICWA 3MTQA 3D81A 1XEWY 4TN5A 3T9AA 3B70A 4HFNA 4ARAA 4F21A 1D2MA 1T2VA 2VAXA 2YWJA 3QIAA 1KFJB 2ZSIA 3ASYA 3K0KA 4K87A 1XRNA 1U0TA 5BSRA 1OA1A 2XRMA 3NG1A 3VR2A 4CF3A 3VMFA 2ZWPA 5BR4A 4AROA 1BJKA 1BXGA 1R74A 3TAXA 2I4LA 1T3HA 1YR1A 1TT5A 1RI5A 2GF0A 2V7QA 3FUUA 1CFZA 4EI7A 3H2BA 5K0EA 1AGPA 1OJLA 3GHYA 2EJUA 4JEHA 1X80A 1RIFA 1TC2A 5I6DA 1YQEA 4O2LA 4ZEWA 1RZ3A 4MQEB 3V4ZA 5EE9A 1E3EA 2H4XA 3EPKA 5F7OA 4NCAA 2ZE5A 1V37A 3DR5A 1W88B 1PT7A 1PX0A 4OHXA 1OIWA 1RVV1 5A5VA 3WLHA 2WJVA 3TKYA 1P2VA 4FSXA 3HPQA 4P7KA 1ULUA 2QNIA 4I5DA 4ZZ2A 3PXUA 3TW8A 4B0OA 3QKRB 5CTJA 4L4RA 4U8GA 1WCYA 2IXDA 2XYQA 3GUHA 1HBJA 4WLOA 2F48A 2OG1A 2VJQA 4QYSA 4OM7A 4JJ8A 1A9QA 1E2UA 4EY5A 4PS0A 1G7SA 4GXRA 3PC7A 4I4TA 3M3HA 3P9IA 3MS2A 2GPNA 1ZLXA 1F14A 4U39A 2HWUA 1ESEA 4EVIA 3MZ0A 3TBFA 2QTNA 3D6HA 4J1SA 1X7WA 4PX9A 3ZCTA 4I50B 4OJKA 4C5AA 3IYLW 3NAMA 1BZYA 2H00A 1RHRA 2REBA 4GLLA 1Z2PX 4PCLA 3G9XA 5JFGA 3DV2A 2YCBA 3NEJA 4E5DA 1LBQA 4M9XA 2EWMA 4X1YB 4MUMA 2FSVC 5E7MA 3L82B 4LBVA 1L5OA 4OQYA 5AVUA 3M6FA 1A8IA 3EUWA 3N9IA 1E2GA 3IAM1 1WUYA 1SU7A 3EUAA 2WJAA 3WK5A 1M2JA 1BE1A 4FN5A 3ZH9B 4N8EA 3TTSA 4JI4B 1MU0A 1NDHA 4C2AA 1P6UA 4TN1A 4HVTA 1NJ8A 3AVPA 2ODPA 2INGX 2PLFA 3L7CA 4HO1X 5JXGA 1V4NA 1BMFD 3MRTA 4RD1A 3T3EA 3VDMA 4D26A 1L1RA 1VFPA 3S29A 3VO2A 2CVZA 1TKCA 2VH2A 5EMNA 2Q5FA 3SYLA 3V2HA 3BWDD 4YLEA 4NWIA 4JHLA 3TN7A 5EYPB 1Z0DA 3ITKA 2C61A 3SIXA 1RS0A 1Y9DA 1U7UA 3I0MA 5HZHA 3T3GA 4TYYA 1I80A 3THRA 5TQVA 1GHTA 4GOXA 3H87A 1U8EA 1NFRA 3B2NA 3M6UA 4ENWA 4DJEC 2CL5A 1S3FA 2LGJA 2WM8A 3MCTA 1Z6PA 2PMEA 3VTFA 3IOCA 4OFWA 4P3PA 3V8BA 3ZHOA 3ZOZA 2XB4A 2O8BA 4N18A 2LCQA 4PR0A 2QTFA 2FPXA 3UA3A 2JDIA 2F4NA 3HO6A 2WABA 2NZUG 2VJNA 2JASA 2VP3A 2ZWMA 4ZJZA 1NQ5A 1PTKA 3FYCA 4Q21A 5AK6A 1ZEJA 2IZ6A 1GN8A 2A9VA 4CL8A 5CDUA 5E8RA 3NDPA 4UHEA 5LQNA 3HNOA 2OP1A 1XLUA 1Q1ZA 2ZOSA 3W1WA 1Y8ZA 2A5GA 4ZYVA 1KXJA 5GIPE 2VEDA 2OCXA 3TOZA 1XRSB 2EZUA 2ZBVA 3N5CA 4UXJA 4U8HA 3UC5A 1ZD8A 4HDMA 5KPJA 4JU9A 2C7QA 5EA2A 5H0IA 4LKRA 5AYVA 3PNKA 2O5RA 1Q77A 3OHMA 4PYLA 1W96A 1OFGA 5DCYA 2RIPA 4PGMA 1GEEA 3WGUA 3C97A 4ER0A 1L4UA 4GNRA 4F97A 1ZA2A 3VVBA 1XALA 1ACJA 3ABIA 3E7DA 3NW9A 1HZJA 4UUBA 4COOA 3GMTA 1GADO 1L4KA 3M34A 1EWRA 1JX6A 5CJ2A 3CWZA 2ZR0A 4HGNA 2R5FA 5MFPA 1N9GA 3Q41A 4YR9A 3MS4A 2R84A 2HU8A 2YJGA 2F3TA 2OFFA 1TFUA 1Y6FA 4CCYA 4ZHQF 2AOUA 4Q00A 1RI2A 3H2ZA 1I4OA 3RFFA 3P19A 4LXGA 5D86A 1NF2A 1Z18A 2WUVA 3H3XA 3DR3A 5CPBA 4NPAA 3FVWA 4H2DA 4M1ZA 5G0WA 3GLTA 2AMYA 3X43A 2R3SA 2EKZA 4E7PA 1KC3A 1VSVA 1IUOA 3GLRA 4JC8A 3Q98A 1E5TA 4WLUA 3DMHA 3EG9A 2G06A 3I9MA 5DWDA 2ZM5A 3LT0A 4LE2A 1MV5A 4YRGA 2PX6A 1T2CA 4HNGA 3H8JA 1FYVA 4G4SP 1X9GA 1PYDA 4M87A 4TLMB 2PGIA 1DXHA 1V1MB 1Z17A 2RGAA 3NTXA 1G4HA 1YU9A 1VDMA 4AAYA 2P9CA 2RHDA 3QTBA 2C4HA 3FCXA 4PBSA 1IQUA 4Q9NA 5BNIA 2NQTA 5FV7A 3VTKA 5FQOA 4HAZA 1YZ3A 3JQFC 2QXYA 3G7UA 3GFQA 4G9GA 1WB4A 1NA5A 3NO4A 1V6CA 4P98A 5HG0A 1FCJA 1UDXA 1PW5A 3RVQA 1FY2A 3U4GA 2VBIA 2FF5A 2YC2C 4YNBA 1GPBA 2IP1A 3OIYA 3HXTA 4YGXB 1OAOA 4RW0A 3ROMA 1N36B 3F9RA 3IOBA 1SQ5A 1QGDA 2KE5A 3AERB 1VGVA 5GPBA 3DMGA 5CX1A 4LNHA 3JD1A 1R0SA 4FDMA 2XDYA 4RH1A 1I0ZA 3DYVA 4EUEA 1K9VF 4YRZA 3MTGA 3WKCA 1NQUA 1J4AA 4Y0AA 2Y0EA 4OL9A 4NRDA 1T1GA 5B3LA 3TJRA 4D45A 3OQVA 2PPLA 3ODGA 4I7EA 4IIDA 2ZATA 4YDSA 1XLTC 2QN6A 1NR1A 3SQLA 2DB3A 2XB2A 3OOYA 3CW9A 4R83A 5IF9A 1VSUA 4OQFA 1TUIA 7MDHA 4RZHA 4OKIA 3W9UA 1DX4A 4YR7A 3G6KA 1NLYA 2PFGA 3VR5A 2A35A 2AEJA 4C4RA 4HG2A 4OHOA 5JV5A 1QBKC 2FZWA 1IHXA 1FVHA 3GH3A 4JL6A 1G6Q1 5FTWA 3V34A 3BMOA 1Z63A 2QUIA 1G8JA 2R8XA 3HCEA 1Z0JA 1M34E 4CMAA 2BEUA 4L73A 3FNHA 3PYMA 3H2IA 2O6LA 1JHVA 3PDIB 2VDPB 1NZJA 1A9TA 1XCOA 2G9ZA 2Y2UA 3R6TA 3RTDA 4ZHQB 5I7EA 1SXQA 4EUHA 3OMWA 3Q6MA 4DCCA 1O5IA 3Q8MA 3D7LA 3N2KB 4IOJA 4L6CA 2AJTA 3QU7A 2WTMA 3PUKA 3MJHA 2O0KA 1CXZA 3HBNA 1K6IA 2P65A 4ZN6A 3WO1A 3G9UA 1C50A 1HG0A 4W8OA 3W7BA 2VK2A 1N8KA 3NNNA 5G2OA 3PP8A 1N3IA 1KSJA 1CDEA 1PQWA 3AEUB 3HVRA 1N2ZA 2C5HA 4OA8A 1JR4A 4N7RA 1ULHA 1K0UA 5E1BA 5TQ0B 1ZDMA 4LHXA 3TOSA 1Z22A 5JPCA 3T0GA 2I6GA 1ZI9A 4KLAA 3KQVA 4FFMA 2FXIA 5KTSA 5DBFA 1VKOA 4CMEA 3WLTA 4NBTA 2IA5A 3ZJYA 3IIJA 1WZCA 1XTPA 1NVVQ 1OXXK 3WY9A 4G0XA 2PZFA 2YIVX 4BGVA 1HT0A 1SOAA 3VHLB 8MHTA 1LJUA 1VB5A 2AFIB 1F8XA 1V48A 3NALA 4LZPA 1C0EA 3SU8A 1GILA 1QH0A 3K1TA 3KEQA 3CUVA 4XR9A 5GJBA 4LDAA 3QLUC 3EEYA 1ZJYA 3HN2A 5JUWA 1LSOA 2H5JA 2QP9X 5E9JA 4FGLA 4CIDA 5KJFA 3BDAA 3ELWA 3G9QA 3EXEA 4Y6LA 1KDVA 3RFTA 2OCAA 3VR2D 3WV4A 3ZCQA 1YA8A 4H4CA 5ITWA 2C99A 1VE1A 1EM8B 3G9TA 5LZ8A 2FV8A 2V7QD 3ESAA 3L6OO 3R3XA 3FBWA 5LLDA 2AJCA 3K6JA 1XD9A 4YHBA 2O57A 3QUTA 3DCNA 1AO0A 4NHEA 2LPMA 3I39X 2VH1A 3KJQA 4M88A 5H02A 2CBZA 3RDPA 1SD2A 4XVCA 2G82A 1SKUA 3HABA 4DIUA 4S0XA 3BE8A 3QVKA 2WWXA 2Z6UA 1DG3A 1Q7CA 4LMPA 1YZVA 2JBAA 4LX8A 3JVEA 4EAAA 3QU4A 4W8GA 2PUFA 1HDGO 5AVVA 1FRVA 4B43A 1KI6B 2A9PA 4KBFA 2P77A 2XCQA 4S3MA 3WNQA 4PNZA 3OFJA 3WNBA 3E8XA 3SIWA 4NOMA 4RIEA 1VL1A 3MRSA 4ZVPA 3R7LA 3BCSA 2RG7A 1SA0A 1PBNA 2P6PA 5LP1A 3SS7X 5LQDA 1I1NA 3PB3A 4NBKA 3HJAA 2XOXA 1KKMA 4NSNA 2JKYA 1K6XA 2WJHA 1YGYA 5BWCA 5HNKA 1KZ1A 4DSTA 1B8VA 3BMQB 1SVLA 1CVRA 4IZOA 5E6SA 4DUZB 3QIVA 2NPFA 5L4SA 3SDBA 3DO5A 4TS9A 3KSRA 4GICA 5T8KC 1ZNQO 1EQAA 2GXQA 2IZ5A 3P9YA 4CDRA 4ZI2A 1GPYA 6AT1A 5K45A 1KYVA 1N7JA 1HX7A 3OX2A 4KWEA 3FA2A 2QY6A 3NJ4A 3WKDA 4D4LA 1T4DA 5EE3A 4ZXFA 1CP3A 3KKPA 2HQSA 3HGQA 1MJ5A 3IALA 3IBCA 2QMHA 3HJUA 1TKBA 4MB6A 3FHOA 3H0EA 4DMCA 5I7UA 3CBGA 3PGMA 4EENA 4MWZA 3GRKA 2ODAA 4X71A 4O4LF 3FAZA 1OTHA 3NKLA 4D6XA 3QELB 1I1HA 4RD2A 5KDOA 1XCMA 4BVBA 3UICA 3GY0A 4Q9IA 2C7GA 1XC7A 1EXWA 2WG1A 3ZCRA 4LRXA 5KTMA 2G83A 3VZSA 1UOEA 4YMIA 4FJ2A 2C8VA 4GKKB 4PPFA 1UODA 1TZKA 2WF6A 2O5VA 3LNCA 4ETNA 5LZ9A 3OFSA 4R6XA 2Z8ZA 4YUXA 4Y7CA 1MB0A 4MVJM 4WAUA 3DTTA 3FZQA 2Z6AA 5DSZA 1PR0A 3QMPA 3LWNA 3LK6A 5JNWA 3QA3E 5JYCA 1J2TA 4NENB 3AR2A 3RGWS 1JKIA 3EXHC 4MVXA 2WIFA 5IH3A 3SG0A 2NU7B 1E32A 1D5WA 1UP6A 3QHAA 4KKVA 1SBZA 4R6WA 4RDHA 1H4QA 1R5NA 2JDID 2ZVDA 1YQQA 3COSA 4NG5A 4I46A 3E84A 1GUYA 1RFGE 3BERA 1WF3A 4CM4B 3EIWA 2H1FA 3EFBA 1EI9A 4G1UC 3SK0A 1P18A 2B7LA 4PLPA 2W11A 3OD1A 3V33A 1JIJA 1N2GA 5ED4A 1MJGM 1R0XA 2R4UA 4YJHB 1H2FA 3K2IA 4A6EA 2HRQA 5EUMA 1SOVA 2C9ZA 2FG6C 2HF7A 3L01A 2VHQA 2O8FA 5E6UA 1TQ4A 3IDZA 1X7HA 4HJXA 4JBYA 4OIFA 3EISA 5L4LA 4GMFA 4GVPA 1Q50A 3KBOA 3OOHA 2IW1A 4J2HA 3ECCA 4BVJA 1ZH8A 2WNHA 3D3WB 1UBUS 3P20A 4UQLA 5A4DA 2Q4TA 1M7HA 3JQRA 3E3OA 4LVNA 4N6NA 3TVTA 3UHPA 1CRZA 1Y8RB 5T3UA 5DYIA 1JDUA 1ONBA 3B2QA 2XMZA 2GBFA 3IR6A 1J2RA 1RHQA 4LUCA 4CF5A 3NCHA 3GRPA 4KIGA 4IVQA 4OYRA 3ME5A 4RQBA 5FFNA 1WXXA 4H0CA 1UC9A 1EMDA 4LJ9A 1EK0A 1LB1B 3F67A 4G07A 2H65A 4JGGA 1L7OA 3AWDA 3V4VB 5B58C 3W5CA 3P5SA 1S1MA 2HA7A 1PHRA 3OIGA 4ZRMA 1GPMA 1C80A 1ZOIA 3K09A 1JU3A 1OFIA 1R4MB 3KEFA 5ESXA 2O2JA 4EB3A 2PT5A 1GTJ1 3BTVA 2Q3EA 3LJKA 4O4LB 1VZ3A 3SHTA 4HAVA 4ID9A 2FSHA 3SLRA 1FX0B 1HZZA 3KWFA 3PT5A 1WXQA 2ZR7A 4BVGA 5IT5A 5JY6A 3KC2A 3AFHA 5HJ5A 4YASA 1OGJA 3JWGA 3LOUA 1TTTA 2RK4A 1IBRA 3JAKA 4N7JA 4QIHA 3F90A 3T34A 3ZW8A 2QN8A 1YQWA 1C0KA 3A04A 3FF4A 3HJNA 3DTYA 4DJTA 2QX7A 1GAWA 3DM5A 1U7ZA 4ZCMA 1FP7A 4LJSA 4OK5A 5HX7A 3EPJA 3D2LA 2ORED 4WADA 4XTRA 2ZJOA 2OHXA 3FOBA 4LNUB 1K7YA 2VRBA 3WL5A 1ESCA 2O1WA 1PJ2A 3NHRA 3QKIA 3F8SA 1Y34E 1DC4A 5A3VA 2OHGA 5KNDH 1QYRA 4A36A 3L5OA 3CVOA 2NG1A 1ZUNA 1ISHA 4MEBA 2Q2WA 3CVVA 3DBOB 4HDKA 4JWKA 2YJNA 3OPYB 4JNCA 4L76A 3T7DA 3W05A 5FOTA 3T9FA 3ZLVA 4Z7QB 3WK6A 4R8RA 4G24A 2HLPA 2R1VB 3P2MA 3TYXA 2Q9AA 3BMCA 4UZEA 2FWJA 4RLSA 3KJHA 4J29A 1MF7A 2BSAA 1UBHS 2ZAIA 2B8JA 4W6QA 2R66A 3DMFA 2Y1GA 3TIXB 2O3SA 2Q6KA 1R9MA 3TS1A 2B4YA 2HBZA 2PWZA 1L1FA 2VCHA 2ZSUA 1XDGA 3FDXA 4WINA 3A1FA 3MCVA 4JLUA 5J2TF 3V48A 3PFKA 3NPAA 4UNIA 3L4EA 4MV6A 1ZGBA 3JWIA 4TKLA 4RSRA 3M6MD 2WJ6A 3I9JA 4Y67A 4LDPA 4YBRA 5F7ZA 1XXHB 2IWHA 1P0PA 2O8DB 3PXEA 2QSYA 5FEMA 1DRKA 3JWHA 1GARA 1JXOA 1L9XA 1FS4A 3H97A 3UB4A 2QI9C 4HLCA 3VR5D 4L5CA 2CF5A 1E20A 1NVMB 3QG1A 4MJXA 3RS7A 1CLEA 4PHTA 4DV2B 4P32A 1WD7A 3G2IA 1URPA 3MTBA 4NONA 4F0JA 1MH9A 1ZD3A 3AHGA 1USUA 4H6XA 3HLKA 2LCIA 2CXOA 3QUBA 2W8BA 1E6MA 4F3NA 3TMKA 1GQRA 5JAIA 3WQHA 2UDPA 1U2SA 3N2EA 3EDYA 3MILA 4R1MA 4QBHA 1KYWA 1T6YA 2ASEA 4DEXA 2CLMB 3TUJC 4L22A 3OKAA 3FPCA 4MV0A 4RZ3A 4MLCA 4PNHA 4C87A 4EI9A 2YJ3A 1D1TA 1VL8A 2YVLA 4L57A 1IDN1 3LX8A 3QU5A 1XYVA 2D4AA 4X6XA 3CZ4A 2P78A 2P9TA 4GC9A 5JDCC 3HDTA 2GOYA 4RHEA 1IN1A 4P8RA 1J56A 1RWXA 2Q28A 4KEAA 5AR1A 1H4TA 4R1UA 5GGXA 2XWBF 5LA6F 3RT1A 3N2GA 1WZNA 1MRSA 3ILHA 2CVOA 4FILA 1WE2A 3KVOA 3NIGB 4HWOA 1NT2A 2P40A 3HE3A 3WBBA 2WOJA 3T1HB 1Q2XA 2NO6A 2QM3A 4OAOA 5FO1A 5I9MA 4E5NA 5DNDA 2SBTA 1DVRA 5K0FA 4G4IA 3DFFA 4YXWA 3LY7A 3SZGA 1ZHFA 4XVQA 3ZZUA 4HDNA 2O2YA 3LBFA 1Z68A 2Q2OA 3TTXA 2UYQA 3QNMA 2Y1CA 5I9SA 3U9SA 2I9PA 4C88A 1EFLA 1G21B 3EA5A 4MUNA 4D56A 4F6CA 2Z3ZA 4IJMA 4DCTA 4DTIA 4A9AA 1S6YA 1TGVA 1SCUA 1LJ8A 3JX9A 4EECA 2FVYA 1H8ED 1CUAA 1KZ4A 1QFMA 4US0R 1MZPA 1VHDA 1YKFA 3HDQA 4MR7B 3U7FB 1J42A 1T9DA 2AK2A 2GVZC 3B82A 2J6IA 4BO7A 4D4HA 1OYYA 2FP4A 4FHCA 4Y9TA 1UMBA 1RWOA 3QKTA 4JIGA 2A5FA 2IELA 3BULA 5FYDA 1TM5E 1QJ4A 2YN2A 2Q3FA 3H6KA 4MW0A 1OLSA 4Y30A 4ARSA 1KTIA 3ZI0A 3UEOA 4ZCLA 1AKMA 3O0DA 4BLWA 3UAYA 3USES 5J2TB 2I2XB 3CRMA 4EVQA 2PA0A 1JJFA 4TLDA 2ZDQA 4H35A 3K31A 4L6AA 2BMVA 3HBFA 3M6IA 2IYWA 2IPMA 1GGKA 5C53B 4I8XA 1CE8A 1ZISA 4RKWA 2Y27A 2ZIVB 4JZKA 3AI2A 2YHIB 3PTAA 1NN5A 2K6GA 3ZHRA 5I7HA 4OV6B 3Q5DA 3H8SA 4W5RA 1XGKA 5K3BA 4ID3A 3DVAB 2CSUA 3PEUA 4HOYA 2PMBA 4YCMA 4QLOA 3CX6A 4F85A 4XYMA 1NNLA 2XUAA 3EIEA 4IKPA 3BF8A 1QF9A 2QHXA 4PVDA 4KDFA 2Q3BA 2V55B 2Y4NA 2B8NA 3U44A 2F43B 4FFBA 1CY8A 3WYNA 2JFVA 4RY9A 4UBOA 1R00A 4O0MA 3ZHUA 1YZFA 1YIDA 2VBCA 3A3YA 1Y1PA 5A3JA 4RF4A 1W4ZA 2ARKA 2OPBA 4XR4A 3K2BA 4TX1A 5A03A 1OREA 3G5AA 2CV0A 3A1WA 1Z34A 5HCNA 4YCBA 2ZRBA 4C2BA 3WYCA 3PKZA 2MIIA 2WFZA 4NV0A 2PUVA 5AD1A 5LA6B 1YZHA 3PR3A 3SP1A 1B4DA 2A58A 2ZUFA 1DWPA 2W4MA 3ZD9A 3LGAA 3QXJA 2IPLA 3JQ9C 1SXHA 2AXEA 1Y81A 3HFSA 2VP0A 4H0NA 4JLBA 4M99A 4JX8A 4LSMA 5LWHA 4KPUA 4KDRA 2QRNA 4ITVA 1AUOA 1CR2A 4I3HA 4LPSA 1T36A 4PCVA 4XSVA 4WX2B 4YJ2F 1QFYA 1IATA 3R5SA 1RXWA 2J9YB 3JQFA 1T2UA 1CUDA 4F2PA 4K86A 3GLSA 3DC2A 2G7ZA 4B3BA 2TECE 5IVPA 3LS2A 2V5VA 4BZXA 1PWYE 2EJCA 2P5UA 3JQPA 5IUNC 4BNFA 5CFRA 5EAIA 1S89A 1K3UB 2UUPA 3HTXA 3LC1O 3O4IA 1G8GA 4ND1A 2W2MA 3PGXA 4QJBA 5KJEA 2POQX 1YQTA 4BFYA 5TPWB 2DWPA 2CJWA 2RI6A 5EEHA 2D4HA 4DQDA 4RTSA 4M86A 1O9GA 1DKRA 1G42A 1UT5A 2P68A 2XBMA 1AQIA 2WHYA 4LF6B 4GX0A 1PR4A 2IOHA 5B6IA 5KWSA 1NSYA 2AYYA 3QEMA 4B6JA 2BEWB 4G09A 3GZNB 2HN9A 2WTBA 3LQYA 4QEZA 4B31A 2GTHA 3QWIA 4C22A 1NY5A 1WIWA 1UQTA 2DQKA 4J3JA 3B6IA 3QUQA 4AP9A 1EVEA 1NRXA 5LUAA 4NBUA 1YKGA 1OFVA 4OOEA 4INPA 2AV6A 3K73O 3DV0B 2RGUA 4IEFB 4G2NA 3UV3A 2R11A 2JZNA 2K5UA 2WR8A 3UQYS 3FYUB 4KXUA 4EHDA 1KO8A 2D2EA 2Q8NA 2X5XA 3A4MA 2X1HA 4BB6A 2VL7A 4CLOB 5JDIA 1ATZA 5KNDA 1SM4A 3NBKA 4R0MA 5ECGC 1W5TA 3SR3A 1AE1A 3HCWA 3O8OB 2F9LA 3BSSA 2HIGA 3QOXA 5CDTA 3ADDA 3X1YA 1FLVA 3L2OB 4H7JA 3EZGA 5EP3A 4DM7A 1BOFA 1P75A 3COVA 3LCVB 3SLGA 4BKOA 1YL5A 3BXEA 4GECA 4IIJF 1JSLA 3T54A 3P2IA 2PO7A 5J47A 1LI5A 4J16C 5ARBA 1MRZA 3K05A 4JNKA 2J87A 4AL4A 2C2KA 4BNZA 5HP4A 4IW3B 1MOQA 1TJYA 1GFSA 4QAJA 2BC9A 2UXCB 1UWCA 1DEAA 3HP4A 1ONNA 3PX2A 4OGLA 3CLUC 4N0EA 4ENPA 1DBSA 2OCLA 3GOQA 1NXVA 2P67A 2D7DA 4C7KA 1KJZA 1WVIA 5C46F 4G56A 4HK4A 2R85A 5KDLA 2BE9A 2NW6A 1MB9A 3LBHA 4P3NA 3EBOA 3W8EA 3U1TA 1JB1A 2GD6A 3COJA 2WYIA 3OLQA 3FCEA 2XUKA 3KOYA 3TTVA 1T9GS 2F1OA 2V9ZA 1R12A 3HKCA 4EZEA 1ZR2A 1FSPA 3V2IA 5FLYA 2GBLC 1AQ6A 1Y48E 2HA6A 3AR6A 4YJ2B 1W30A 1IY1A 1D3AA 2NO9A 3KVYA 3M5DA 3RUCA 3UA4A 4D97A 2R8RA 2GB4A 4O2BA 4CIAA 4I1IA 2W6ZA 3NX4A 4MQFA 1V9LA 1R4NB 1NXWA 3UAWA 5FI3A 1XDWA 3D8HA 5DXAA 4FFPA 1PFWA 5FNVB 3ZE2B 1JWBB 3HWX1 3PHCA 4H6WA 2P2LA 3QLUA 3GNLA 4PO3X 5C5DA 5LDHA 1GGHA 2YXBA 2GTPA 4BNMA 4JEMA 3ZD6A 1TK9A 2BCEA 4BRSA 1R5JA 3MF4A 1FC0A 2RI1A 4HEHA 3V5NA 1X8XA 1RAGA 4I5EA 4V0QA 5L3VA 5L3SB 2G88A 2P0AA 3C3WA 1Z6XA 2BT4A 4MNTA 1ZRNA 1YDWA 1Y4ZA 2OZVA 4F9EA 1APBA 1KF0A 3LLCA 1UM9B 3BFJA 4IHJA 4UUMA 1YJQA 4IPTA 1QRDA 1E8MA 3NOXA 1DXQA 1W73A 1XVUA 1JN0A 1GPJA 3IBYA 1RPJA 3W5VA 2AD1A 4BV3A 1SIOA 1RQRA 3KXPA 2KB0A 3BMOB 3WLAA 1H66A 3NONA 1QV7A 4M9QA 2H29A 4GQIA 4M9SA 3RAPR 4B6RA 2CVQA 4MI1A 1QQAA 2I91A 4P84A 3UFBA 2ZYGA 3H1BA 2UZ1B 4G4JA 5IAEA 2IXTA 4ASUA 3FMOB 3O91A 4B6SA 3K53A 1RYYA 1BIFA 4TTSA 3DDSA 2WJJA 3VUFA 1ZU5A 4M0EA 1U2DA 4GXNA 5BQ5A 2OB2A 1JKFA 1XJWA 1ZZGA 3U40A 2PH7A 3OX1A 1P6QA 3V80A 4YAJA 1GR0A 4WK0B 1I2CA 4EK9A 2PWPA 1R8SA 2NZVG 4IIJB 2PU5A 1WPRA 1AXRA 3HBMA 3W5HA 3GLFA 1FZQA 1JIXA 1LBSA 1AHIA 1MPTA 1VZ2A 3K5PA 4DR7B 2O1EA 1LH0A 1ML4A 1XF1A 2CLOB 2R6JA 2SCUA 3UH0A 3OE7D 3HMQA 1NVBA 4FCVA 3HS3A 5T8KA 4YMHA 5YASA 4GEGA 1XJ5A 2AEFA 1OASA 1AB6A 4LYYA 4PZYA 4QXAA 2PXCA 3AUKA 3DXXA 3E8MA 5AKGA 1SHZA 2PTHA 3LHFA 2CE7A 4B3HA 4CKYA 3JR3A 4I6GA 4DIEA 1SCAA 2E37A 5AW2A 2I2AA 1HA3A 3FWZA 2Q3MA 4V0LA 1F0YA 2FZCA 3K92A 4X97A 1ELOA 5DISB 5JCOC 4QM7A 1U98A 4KUHA 3ZBQA 4P1ZA 3OJ0A 5KTKA 3UMJA 2MINB 1G9XA 2RBEA 3ZKWA 2IYNA 1Q7EA 3GFGA 1G3QA 3UXHA 3ER9A 2FAXA 3HLYA 3UKOA 4RE5A 4GF5A 4I99A 4EG0A 1QZTA 3O8QA 3VO9A 1SURA 2DBRA 3N87A 4EA6A 3NRJA 4ZI5A 4D9HA 3TLYA 4EABA 2DETA 2CXQA 1SUBA 4LYHA 3KP1A 3ZDYB 3IBGA 5HR5A 1BVHA 3SHFA 2RKOA 5DW0A 5B6PA 1UAGA 4YP1A 4E14A 5I7AA 1DJNA 2BMFA 3PDWA 3SOZA 1JDBB 4E5SA 4Q4CA 4YXWD 5K3EA 4ZTZB 1G9SA 3C6XA 3LUKA 4J91A 3WMRA 1EP3B 4F93B 3PTZA 1I32A 5I7RA 5JJIA 1WUTA 3S7TA 1A8HA 3BQ9A 1PCXA 4MS4A 2P2CA 2BRUA 2C8JA 4TMXA 3L93A 3EXHA 4WFKA 3CR7A 1CLUA 4D9CA 1WWKA 5AVRA 1J2YA 2JBAB 3QGMA 5ALMA 4PXSA 1X1TA 3KXDA 3FNEA 4QO7A 3IQEA 5F12A 3L7AA 3KQPA 1FSFA 5SV2A 1QHHB 3ZWBA 3H1AA 5KYWA 1OH8A 3L7BA 4NZPA 3ZWYA 4CJXA 1D2HA 2IDZA 3PZBA 4R1SA 3OMLA 3SBDA 1PG5A 2QR3A 1UH5A 1AIPA 1H6DA 1W1WA 3OCXA 2NGRA 4ZKEA 1XMPA 4EFMA 2H1VA 1YL6A 3A1NA 2IU0A 3TWOA 1G3IA 4MS3B 5AKLA 4AZ0B 4QUHA 1KYZA 1SUWA 4HXEB 3RVPA 4DEVA 2XW6A 5LQUA 3KYBA 3OT5A 2FKAA 5C7OO 1BKDR 5JJKA 4H3HB 4JP2A 1Q7BA 3N3AC 2Q3HA 1E3WA 2RC5A 3RB8A 2C9MA 3R5HA 5HE8A 3ORYA 4EEXA 2F67A 1TJ5A 5EQDA 2W93A 1JSXA 4R68A 4KIUA 5C2JB 2WF7A 1GKUB 1WNTA 2I1QA 2QX9A 3HKEB 4M1YA 2QTLA 1U2TA 4BP8A 4DIOA 4MGIR 4EF5A 2QLFA 4NZZA 3H11A 2VT7A 1P0MA 3F6EX 3H5OA 4MKIA 4X65B 3MOGA 3GLHA 2AL7A 3HVHA 3IMFA 5COBA 5ARCA 3RHFA 5F51A 3L6UA 1HNWB 2HDHA 3UC9A 1PWEA 3WQRA 4DA9A 3T5DA 1YZYA 3ES9A 3L46A 3RHSA 1ZR4A 2O3UA 1JLLA 2H3EA 2EJVA 2I3ZA 1UKVY 3NM4A 5L53A 2Z4SA 4Z4GA 1PJLA 5D8DA 4CKWA 3KUXA 4N4AA 2OGSA 3RUDA 1G8KA 3UQZA 1UBLS 7AT1A 4AJHA 1DDIA 3ZX5A 5M29A 1AS0A 2FPIB 2GUWA 4LDQA 5HDBB 5KQRA 4ZHSA 4PYJA 5JD4A 3F5SA 1TPZA 2QTTA 2HZBA 1M2GA 2BGIA 3BBLA 4JJ7A 4LVUA 4P0TA 4K9NA 4OUDB 3ZTYA 2FMKA 2AZDA 2FWPA 2PRKA 2YVAA 3R5KA 1Q7TA 4KUEA 4MVJE 4TKVB 1BDJA 2HQBA 4O2AA 1DIOB 4BFUA 4DXAA 5EKSA 4ZV4A 2HDOA 1MVNA 2NNLD 4GH5A 5E2AA 5ECDA 2IUTA 3FB1A 4V0RA 1WW3A 4W6ZA 1CUVA 1XQYA 2FN4A 1RXCA 3OI7A 1VBKA 5EZYF 1QX3A 2ZE6A 3JQBC 5AO9A 5AW8A 2X3YA 4A5OA 5K09A 1XEAA 5FA8A 3UJHA 2WOOA 1S8FA 3QE0A 4WVFA 3DLPX 1BXRB 1RYEA 4YMVA 3EG5A 3RHZA 1BQEA 1EUDB 4BNKA 2QYSA 2DJ5A 4GYKA 3IELA 2X14A 3PXDA 4HTAA 3OURA 1VC2A 2EQAA 3U61B 2CUZA 4OU5A 4H18A 5HSGA 1FMFA 3MIZA 3RGGA 4UCXA 2CL7X 2FRDA 3JU3A 1XJ0A 1L5MA 3R41A 4U7DA 4C01A 1RD4A 1WG8A 1QB8A 5HZGA 4PLGA 1UOOA 1W8DA 3WFIA 2CUNA 4RL4A 1VLHA 2ZI5A 3A70A 3E9DA 4NE7A 2XMBA 3ZTTA 1ULSA 2MT9A 4MB0A 1K5DA 1A2OA 3BRWA 5G1OA 3GC6A 2P1ZA 1FDSA 2P0EA 2WHQA 1DX6A 1UMCB 2YV3A 3CPHA 4Z4QA 3B6ZA 3NQ41 4FYJA 4BNHA 1MR3F 1PL6A 3ZGLA 4L0DA 4EY3A 4JP8A 3IV7A 2RI0A 4JLJA 3OIFA 2P6OA 4XJVA 1QGUA 4ZI7F 1FFYA 3STUA 4L9RA 3R6GA 4CV1A 3H2HA 1F0PA 1C1DB 2IZ1A 1BO6A 4EVSA 4ZCRA 5KNDD 1DV1A 3BL6A 2M98A 2C31A 3OU6A 5GINE 3MAGA 1IYZA 3BORA 1CNEA 5C1DA 1QM5A 3UUWA 1K63A 1SG0A 3RC7A 2ABWA 1R27A 4YMTA 2WWHA 4YCNA 1ENYA 4OY3A 1LZLA 4RE6A 1SPXA 4FEAA 4U0JA 4DBLE 2II6A 1C9YA 1Z3CA 2J09A 1U1CA 1Y8CA 4ARCA 4HTFA 4IDOA 1CS0A 4KXNA 1KRHA 5B4UA 1YVRA 1UMDA 3JQEA 4WK6A 2Q99A 2W6CX 3KG2A 3ZV6A 5IBCA 5A0VA 2WW8A 3TIIA 3ADPA 1YU6A 1A7JA 3VNRA 2Y71A 1A3CA 5JDCA 3WTBA 2JFFA 5I7VA 4BFVA 3FHTA 2I4NA 2D1RA 3TUIC 1HRDA 1TM3E 1C2YA 2X42A 3AF3A 3MFYA 2C1XA 3EGDB 4IR7A 3P26A 4XLZA 5FUBA 1E58A 4CQMA 2Q4EA 2AQKA 3JZDA 4N39A 4CEJB 4GYYA 1ZD5A 5CU7A 3DD5A 3NJ8A 3GMIA 3AEKB 4E1AA 1GPLA 2L69A 2VSOA 3MFQA 3V8MA 3OZCA 1PZXA 1UBFA 4HDKB 1T1IA 2C7OA 5EZYB 2OXFA 3RF7A 4BVAA 5B6JA 3K0SA 4KQWA 2HJGA 1SPBS 1V3QE 2VDWA 1B76A 4LK2A 1OB5A 1TYAE 1OW3B 2JGNA 2JI9A 1OWMA 1NUTA 3T1TA 1R88A 2Q5IA 3LL4A 1WU7A 3WLPA 4XUEA 3SN6A 2J6BA 1FK8A 4Y2VA 4G5HA 1YBMA 1S2NA 3OQ6A 4YJ3A 3SCZA 2CWWA 4RZSA 3ZE6A 3TTUA 4Q4JA 3K70B 4ZGBA 2JJYA 4ZALA 3ENKA 3DGEC 2E2WA 5P8WA 3SSAA 5B36A 2HCBA 3K5WA 1TI7A 2BUBA 2HA0A 1P17A 3L04A 3Q1KA 2I8AA 2QTWB 4I1YA 3IEMA 1PNRA 2IUUA 1XPOA 3SXPA 2ZIXB 1ZVJA 4EA8A 4Z4IA 1J09A 4V1CB 1FFAA 3I73A 4R40A 4F72A 1JBQA 2KX7A 1UBMS 2O7SA 3I04A 1EHCA 3EGEA 3K2EA 3MK31 2HHLA 3OT4A 3Q7IA 5CT4A 5M3BA 3CRNA 4UAUA 1CZRA 1YGPA 3Q2IA 2YW2A 1NSTA 4ZI7B 1WUJS 4I9HA 2YZGA 4UMDA 2CLCX 2PRSA 2ZRLA 2ZITA 4JB0A 3BWCA 4KPGA 3WL3A 4LZNA 4ASUD 1TVEA 4BJ6A 4BE9A 1UEXC 2O3QA 4C1NA 4Y9DA 5HRAA 3EJWA 1LC0A 1V8ZA 3ZY6A 4X85A 2FMUA 5DTEA 1L4MA 2IPAB 3JRXA 5FPSA 5EJFA 3BUSA 3AEYA 3KZOA 3NHFA 1X7DA 2ESRA 3BKWA 1U3TA 1TIKA 2OILA 4MWTA 5FA6A 1JAZA 4B35A 2PGAA 3D7MA 2VJMA 2IYQA 2PDAA 2C9OA 5C7LO 3AM1A 1P9NA 2BFFA 2HJHA 1GR1A 1Z47A 3AB7A 4A8JB 4YHHB 1XAIA 4OSPA 3OQMA 4U1RA 4ARIA 1A72A 3RSFA 4MP8A 1NC1A 4I55F 5ELXA 3NTRA 4NICA 3BWXA 5I8ZA 3JZAA 2YOFA 3LRXA 4H1UA 4D9JA 4E22A 4EY4A 1JHAA 3GG9A 5G0SA 2QD4A 3D7RA 1ORVA 2HEIA 1T8PA 1O96A 2LKDA 3RAGA 1BE6A 3JQ9A 4QYXA 4BATA 4H3KB 4B3JA 4XFDA 2MMGA 5H16A 3COYA 4N76A 2H0RA 2ZJ1A 3IVRA 2FN3A 1XZCA 1N5IA 4NE2A 2VUUA 4BZPA 4ZGGA 4EPWA 1II8A 3UOWA 4JVNA 2GN4A 1W52X 7REQB 5B4VA 4MUGA 4O1IA 2B98A 4LXUA 3VAZA 1PFVA 2GA8A 1MAVA 1Q14A 3VPSA 4BLQA 1VLQA 4XX1A 3B60A 1JTVA 2ISCA 4X8HA 2GI4A 4J0CA 5BWNA 1NFFA 16PKA 1BMDA 1Z33A 2JL1A 3PUVA 1M10A 5EIAA 5ILGA 3TR6A 1ZN8A 3CNQS 4OF4A 4AJPA 4XH9B 1V43A 4L4ZA 4YUAA 3IR5A 2EAUA 2I1VB 3ZXYA 5JI3E 1V8BA 3C3MA 3IAXA 2HJ9A 2VDKB 3F6YA 4KZKA 4TM8A 2YIDA 5A3SA 3SI7A 2QW1A 2EGHA 4CT4B 3J81A 1CE8B 2Y9MB 1E6WA 1JWLA 1SD1A 2F1HA 5A4JA 3VSEA 4KQFA 4IFIA 2R8ZA 4G0QA 5CFNA 4R9RA 4EYQA 5FUVA 3EQ9A 5IM5A 3NR2A 4KFSA 4NKRA 1EB8A 2NUAA 2QJOA 4WI1A 4V38A 3VHRA 5FORA 3QHPA 4TKUA 2GN6A 2IX9A 5C8YA 3WGHA 5C7IO 9GPBA 3K30A 2N75A 2XJ4A 3PIRA 2A59A 2VH5R 3G8YA 1XNJA 3OMXA 2VATA 3LGSA 4FFBB 4QREA 1SBQA 3DULA 1K2WA 1NQVA 1XDSA 4G3XA 5LB2A 2BVNA 5KAPA 3H4MA 1ECBA 4GP6A 5AW0A 1JHXA 2VXCA 2BBTA 1SCDA 6YASA 1B0AA 1BQ3A 3TI7A 5LBUA 1B8PA 2IUFA 1JDZA 4UUPA 2QVLA 4OQDA 4EFKA 3WBJA 4JOCA 1RVDA 4E5UA 4WMLA 1QIFA 5B5SA 1I94B 5GQSA 4AY4A 1RLMA 3R4VA 4N9QA 4J16A 5KZMB 4RGYA 3N0TA 3TSYA 1FFHA 1UKZA 3V1NA 4H6VA 3GT4A 3N2IA 1MDFA 3NT5A 3NFRA 2Z83A 4I55B 5JFTA 1SBNE 4RQTA 3L0IB 1EXNA 1U6KA 3OUUA 4R2LA 3ELDA 4WN9A 3CFYA 1DTSA 4LHZA 1GTRA 4U63A 1C9JA 4AP5A 3ETGA 4MA0A 4F7WA 4ZO9A 3DXZA 3ORQA 1C0IA 3QEJA 1JLRA 2GYWA 1XZDA 4H7PA 6PFKA 1F17A 3Q12A 2VHCA 4YRTA 1MGOA 1EGAA 2YBDA 5FPKA 4TYPA 4U5QA 1BD3A 4A16A 1DLIA 1SVKA 3JARB 5B7NA 3JWJA 1AA9A 3UB2A 4BNNA 5A7FA 4KRYA 1S2GA 3V4LA 3WBKA 3PFGA 2E3JA 3D8RA 4IF6A 4A6PA 3RVJA 3ENWA 4JL5A 3LU1A 2WB2A 4YDHB 1NAIA 3QNWA 4NYIR 4P38A 3MGGA 4QYWA 3A1SA 3R3HA 1R0YA 2WA2A 4G5RA 3KCNA 3ET4A 3K9WA 5EJAA 4OX9B 1E0AA 3HN7A 3WL4A 5E9QA 4UOZA 1ECCA 3WRYC 1WSDA 3O1HB 3C15C 3VU0A 4D5GA 3VVCA 2H1OA 2ZZMA 1U8CB 2BFBA 5ERYA 5EVJA 1P1IA 4O4HA 4XDGA 4OI0A 4WQMA 4PTZA 1LBTA 1YVUA 3E48A 1IZ7A 2OZLA 4K9SA 1TYEB 2TMGA 4YP5A 4XOUA 3WKBA 2JHFA 3FYHA 3WWCA 3SJZA 3IAS1 2ZT7A 4X0EA 4WVLA 3SYMA 1AS2A 4WZ6A 3WNZA 1P2TA 2B20A 4LGCA 1AF7A 1IVSA 1EA7A 1Z38A 1AM4D 3GD5A 1JG4A 2P4UA 3C5VA 3O38A 4V0ME 3L05A 4D3DA 1CHNA 4FR5A 2GN0A 4LE0A 5ICMA 5K05A 3KFXA 4ZK6A 4AMZA 2ID4A 3D3JA 2YJ6A 2YXLA 1OV4A 3BRWD 4KI0A 4WZBA 4ZOCA 5ALQA 5C1IA 3T7SA 3U4DA 1SKBA 4EQZA 5K0CA 1BDHA 2PGXA 2BFEA 2RGNC 3ZHCA 4TSRA 5DLYA 4XEUA 3VR3A 1VPEA 1X7XB 2FI1A 2J6CA 3BYZA 2FW8A 5TF4A 5CYPA 3WIVA 1OJ7A 5GP1A 4OXRA 5EC8A 3UJ9A 5EHXA 4NULA 1F06A 3GBVA 1W1IA 2Q6VA 4V2UA 3U3OA 4QM6A 3QP9A 1SZJG 5BN3A 4LYGA 4RYDA 4HZUB 5IT9A 1JZTA 5HMMA 4GKAA 2O5CA 4X66B 3HA2A 4RKYA 1Q0UA 2W0SA 5B58T 2I34A 1ZM4A 4DGSA 4MPRA 5KC9A 3EXIB 1GU0A 1SKYE 1E2KA 4JYMA 3RKSA 3U3MA 1AV6A 1U0RA 3DOEA 3T38A 3ZHQA 2PXHA 2QKYA 3LGXA 3TL2A 2WJZB 3NYWA 2ERYA 1Y9AA 3KKOA 4O2BB 2NO0A 2Z2ZA 4CT0A 1R16A 4RZ2A 2A5JA 1DEHA 2M9MA 2IEGA 4RULA 5LZ7A 3IP5A 2EDAA 4RVUA 1HY3A 3FOEC 5CYGA 3ZDCA 5EE0A 1U0LA 1XQVA 3DOFA 2VJOA 2HJSA 4YX9A 1UUFA 3FJOA 5TEWA 3UMRA 2AC7A 3V46A 4OSEA 3GJ0A 4ZC8A 3BGOS 5AKEA 5ICFA 2ACEA 5T4FA 3M3DA 5BPFA 1DTEA 1V1RB 4QUJA 2ZBRA 4IUYA 4MR9B 4NX2A 1E63A 2F7SA 3OE5A 5EWLB 4CQMD 1FTQA 2JFPA 5IK2A 3B8HA 1EVJA 1PLKA 4HN9A 3WDSA 3BK7A 1ZKDA 2BKLA 4GS5A 4MDEA 3CLHA 3T3IA 1KI4A 5LIPA 2E89A 4EA7A 4D8WA 1Z0FA 3DGFC 3E9ZA 4R1OA 3O93A 1DNPA 5G3ZA 3A32A 3IESA 4FP9A 5MHTA 1BRTA 2O7NA 3F8TA 3UY4A 3RC2A 2PZLA 4GVLA 4B47A 4TS3A 3R7NA 4PZZA 1B3BA 2ZYDA 3GJXC 4BJ1A 2QT1A 1K92A 2OMKA 3MJVA 2OA0A 5IABA 1QS0A 2JBWA 2X8LA 1GQQA 2X4LA 1HSOA 4RA9B 2H57A 3U48A 5CM9C 3AB3A 4JI1B 3H13A 3CG4A 3ZXIA 1TUEA 1U7OA 5AICA 2NVUA 5HJ7A 3BIOA 3LSTA 5AK0A 4ARZB 3GG2A 1QRUA 3EH2A 1LPPA 4JITA 4KGDA 1QHYA 2C9YA 2FJUA 1CVIA 3OZDA 6ABPA 5TQ2A 5K3OA 5JU6A 1V2GA 1LJLA 1L7RA 3R2JA 4I9NA 4IZHA 5D5HA 2ECQA 4ONEA 4F6LA 5EFOA 3DKPA 1I1OA 3A3OA 4MHSA 1WQ4A 3QVJA 2JA1A 4GOOD 4MP3A 4Y1FA 3FVVA 4RVSA 4ZCQA 1W5BA 5FO0A 5KSWB 1CZUA 3TQHA 3L8FA 4JKOA 1JYSA 3W7VA 1XZQA 5C5EA 2YYYA 5JANA 1YFLA 4B4UA 3S1AB 5KTTA 5IN5A 3BH7A 1T5DX 3INTA 3S1SA 3FMIA 4O29A 4M83A 1F1JA 3LMKA 2IV3A 1ID1A 1SCBA 3SEAA 5JLJA 5DWQA 3ABRB 1EVQA 2DZDA 3LQFA 3NC0C 1JS1X 1JNYA 1Y1KE 1PFYA 1E8NA 1UJMA 3CUTA 3HDGA 4LBYA 4Q01A 3LC0A 2FZLA 3QMWA 3AESB 4D46A 3HVUA 4A0QA 2AXPA 4TTQA 4ZPXA 1EGMB 1FTSA 1GZHB 1RPTA 3EZLA 4Q1VA 5AKZA 1VA4A 2EFGA 5HK9A 4Q7MB 3WRXC 2AQ8A 4XWAA 1ZAKA 1HE4A 2DTXA 3QF4B 3V7YA 1JG7A 4XVUA 4R7GA 2XNHA 1E7QA 1FJ2A 2EGUA 4BGUA 1U31A 2ZSDA 4N0QA 1RYNA 3RBVA 2XEXA 3SC2A 2FPPA 3FVQA 2D1SA 3DL2A 3NC4A 4QBIA 2DUWA 1FX1A 2OGTA 4CDMA 4XGRA 4L5AA 2IWRA 8OHMA 2CB0A 4YT2A 1KIFA 4PYMA 2NZJA 1GL3A 2IBSA 2VN8A 2WPDA 1ICIA 2Q5OA 4Y98A 2BKXA 4EYGA 1DE0A 3MN1A 3K5IA 5CLHA 4QZVA 4YV1A 2PFKA 1XMOB 1CQIB 1VHLA 4ZU3A 4KGZA 1UK6A 1QVWA 5TGTA 3VH4A 2XMGA 3G49A 3NH6A 4PYNA 4I1RA 3HDHA 1Y98A 1ZNXA 2N9UA 4EUSA 3WIEA 1D09A 3VNUA 2NYVA 2PK3A 2FDCA 4KTVE 1IM8A 3UJNA 2FKNA 4L75A 3ZU4A 1T8YA 5I3ZA 4MUHA 5JNLA 1U1DA 1D4FA 4G26A 3N8HA 4U2FA 1ORHA 2I2BA 2Y93A 4HNAA 2PX3A 2QJWA 2B25A 2BI4A 3D5QA 1Z0AA 1QFZA 3IP3A 1NBWB 2JLSA 3OH8A 1OPRA 2DBQA 2MWMA 3GCZA 3TFQA 3H9QA 3QW2A 3LVRE 2BM0A 3UAZA 3GT0A 3OZBA 4HATA 4Q1BA 4BMDA 3C6MA 4C3UA 1CUXA 1F12A 3DO8A 4YMUA 3QVOA 1Y8QB 3VZBA 4B3DA 4JJEA 5BSFA 2PRYA 1FTNA 5LLSA 4QXPA 3CZRA 3KR9A 2XUFA 1YRHA 3LPAA 1VG8A 2QNBA 5EXTA 2D2XA 3ROEA 3I04M 4J94A 4TMZA 4QVKA 2VT2A 3ZU2A 1PJQA 2C5EA 4Q02A 3OLYA 4ND8B 2FCRA 1LPAB 1TEZA 1Z2DA 2JCSA 3KL2A 2BWJA 1JEDA 2ZRPA 2PUTA 5BUZA 4D43A 3S28A 5DT2A 1CDDA 2HF2A 5ITZA 4MI9A 4DUPA 4C30A 4BO8A 3CF0A 1SUAA 1DSSG 2MDTA 3BWMA 3PQ7A 4RCVA 4UPEA 1GFWA 1XX6A 2BMAA 2WYHA 4WHMA 5GVRA 5C1OA 1ZC3A 1KYQA 2GF9A 2WG2A 1SXIA 1GLVA 2WE8A 3H5WA 3ONVA 1L5GB 2YMPA 2ZSFA 3EN0A 4QXQA 4PLZA 5F3RA 1TF2A 3AJ8A 3MMPA 2DLNA 4EUNA 1CRQA 2H2DA 4BZZA 3B85A 3OZAA 1CS4C 1U1GA 3CLUD 4EQ6B 2R6HA 4EKDA 2Y1EA 1ZUWA 1PT6A 2Q1TA 3R77A 4ML3A 1CERA 1LV8A 1LW6E 2R5NA 4H15A 3GCXA 4YT5A 4XGNA 1TRKA 3RS2A 4PSAA 3RSQA 4KAXA 2IU6A 3X3HA 2P3SA 3CIFA 4ZARA 1VPTA 1JDVA 4P92A 2AOWA 5AVOA 1HT3A 4EW1A 4WJLA 3I1FA 1AVTA 4XQEA 2ZULA 2GKOA 2ZJAA 3AM5A 2JARA 3II6X 1GAXA 5J4LA 2PWYA 1ODIA 3PR2B 3KV1A 5G0UA 1NONA 5ES3A 1GQSA 5FBLB 5KIAA 2K7ZA 6CHYA 3AF6A 1EESA 4V2IA 1VKZA 2J5XA 3PEWA 3BD6A 1MAHA 4JT9A 3L7OA 1A71A 3QE3A 2O2SA 2G9QA 4OMUA 3R09A 4F56A 2AI3A 1WY7A 1FFEA 2VYCA 1D2RA 1GGFA