1F8XA

Crystal structure of nucleoside 2-deoxyribosyltransferase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
PKKTIYFGAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDIMLGVYIPDEEDVGLGMELGYALSQGKYVLLVIPDEDYGKPINLMSWGVSDNVIKMSQLKDFNFNKPRFDFYEGAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of nucleoside 2-deoxyribosyltransferase in native and ligand-bound forms reveal architecture of the active site.
pubmed doi rcsb
molecule tags Transferase
molecule keywords NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
total genus 55
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2000-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f8xA00
1YDHA 3GH1A 1MTOA 4LJLA 2PMBA 4KXNA 4NPAA 4P5EA 4LJRA 1KZHA 4RH3A 1S2DA 4LJKA 4U1RA 4A3SA 1S3FA 4I36A 3IMKA 1PFKA 4KXMA 3OPYA 3PFKA 4JELA 1WEHA 2F67A 2HIGA 2IZ7A 3OPYB 2A33A 4FYHA 4PFKA 2F2TA 4FYIA 5ITSA 4WL0A 3EHDA 6PFKA 4JEMA 4I7EA 4JENA 1WEKA 3O8OB 4FYKA 2PFKA 1S2IA 3BQ9A 2F62A 4OHBA 2NX2A 3O8NA 3QUAA 2F64A 2IZ6A 1F8YA 4HX9A 1S2LA 1F8XA 3F5MA 1T35A 3UQZA 2KLHA 3O8OA 2IZ5A 1S2GA 5AJUA 2F48A 3HNOA 2Q4OA 4OHRA 5AJTA 3U39A 2Q4DA 3MAJA 4MCJA 3K2QA 4P5DA 1ZXXA 2KHZA 3O8LA 1RCUA 2A0KA 4KXLA 4MEJA 4I4IA 3SBXA
chains in the Genus database with same CATH superfamily
4HYTA 3VO1A 4LF8B 1JG1A 1YZQA 4WLOA 4DIDA 3E9RA 2VG8A 3HZHA 4MVJD 2PD6A 4NCJA 1KF0A 3T5BA 3C6KA 4C0SA 5KTSA 5LQSA 1YZGA 1RHKA 1YJXA 3E03A 4JEHA 5JPCA 4YCAA 4XCQA 3H5RA 4OSPA 5CA1A 5B4VA 2C57A 4D5EA 1Y7TA 4L51A 4UUQA 1E6LA 3IMEA 4RJTA 3KC2A 2X23A 2TSYB 3GLHA 1VJRA 3NTUA 2IX9A 3TW6A 4N3GA 4JQYA 2GN0A 2ZWVA 4RPJA 5FJIA 3ZNQA 4AX4A 4YPFA 4Q19A 1T9ZA 1VKNA 3JVVA 3NTQA 4OBBA 1L5HA 4EG3A 1Y6ZA 5K0NA 4BFXA 3DFFA 4LW8A 4EKNB 4ZTZB 4ND8B 4UAJA 2EEZA 4NP6A 1I2AA 3CT4A 3RJZA 1YJ8A 5JPDA 4TYMA 2B8TA 3IURA 5AI0A 2JGEA 3ISTA 1XF1A 4Y9SA 3FDZA 3IJPA 2B9EA 3AY3A 5DB4A 1U8YA 3I45A 5FX2A 4FW8A 1TVEA 1F0YA 3N05A 3AGQA 3BORA 1AN0A 1AO3A 1VMAA 1FPQA 1XTTA 2IEBA 3BSFA 1GPLA 4MVJM 3R7DA 3T3GA 1ZUNB 1WPGA 3UJ9A 1ZOPA 1IFXA 3IPXA 4V0MA 2V4UA 3O4JA 4X5OA 2ADOA 3DZHA 2NLOA 4FYPA 2IEZA 3KDSE 4OQLA 5EJ9A 1NXSA 1KKMA 2D5LA 1VKHA 3OPVA 4PIMA 1LK0A 5CH3A 3NIWA 1WUYA 4RIHA 5I7HA 1CF9A 5KI6A 4G5SA 1J24A 1PGPA 1MOPA 1RAHA 4IJVA 4JVLA 2J5RA 4MHSA 3BB4A 4ZYXA 1VXRA 3NJ8A 4GMGA 1M0WA 4Z4EA 1ZKMA 2CDCA 2QRHA 3MELA 4G5RA 2BSXA 2AMVA 4BFZA 1SXQA 1FFYA 1C2YA 3BIJA 4CT5A 3AFIA 2IUTA 3PFGA 2YZNA 1N1EA 1Q22A 3CV3A 3IQXA 4PX5A 4YRJA 1JDJA 2O6HA 4RUKA 4XB2A 3WKCA 2G83A 4BN5A 4DJ5X 3IESA 1JMKC 3OTIA 2XDQB 3CE9A 2PT6A 3EZXA 4F4FA 3UT5B 3AMVA 3FNQA 2AXPA 1SK8A 1SQGA 1FVHA 3FPAA 4FFBA 1VHDA 5D3MB 4AJIA 1KETA 1MAWA 2F3TA 3HHPA 5CXSA 5AYVA 2HXSA 3RTAA 3P4YA 4CMCA 2R2AA 5FWYB 5B58C 4J1TA 5FH9A 1F5SA 2D7CA 2HFKA 5KOJB 4Y1RA 1Y8AA 4TXHA 4JHXA 4UMVA 2CXTA 3QK7A 1ZLYA 4UCQA 1TIBA 1J90A 2VFAA 4MAMA 1GZVA 3IALA 3WE7A 1YFLA 3C2QA 4ARZA 5T67A 3U1BA 4IIVA 1E9FA 2ECOA 5HM8A 3RU2A 3T5DA 5DZSA 1XQ9A 2V6IA 5FB3A 2FGJA 3VI4B 8ATCA 1SVLA 3QX8A 4HAWA 3O82A 4R98A 4C4OA 4X1KB 1G6OA 3R3JA 3OE7A 2FFQA 1NVVR 3C45A 4FUQA 3LSTA 4KXYA 4BRUA 1VFPA 2N0SA 2HWUA 4GEGA 4C7KA 4NATA 2C5FA 3UG7A 2QT9A 1I4DD 3KQVA 3SDZA 4A8TA 4P34A 1JQBA 1YMUA 2FMFA 3AF6A 5K01A 1N5JA 1RI3A 2QZ9A 1NN1A 3HVKA 1QOPB 1TJNA 2EKBA 3C85A 1J0CA 3HA5A 2O8CA 1WPXA 3MVEA 5KNBA 5TQVA 5CB4F 4WDRA 4FDAA 5BSGA 5EJ5A 5IX8A 4M7RA 2GVZC 3T0GA 4B0OA 3JWIA 2GNAA 5HUQA 1IIBA 5HEKA 1KKUA 5HFJA 5I01A 5EKTA 4M22A 3M82A 4X6UA 4O4LF 3CEAA 5JVDB 4CLOA 2R3SA 2O20A 4BBZA 3P2OA 3LDGA 2CFSA 3RTBA 3AUUA 3WHKA 4R1SA 3GYBA 1A2BA 1GTG1 2FWAA 1DIBA 3AQIA 2H2GA 4YAEA 4ZEXA 5JNVA 2QD4A 2OCPA 4ITRC 3OZFA 3D2AA 2RBGA 2P4SA 1ZRMA 2WKWA 5A71A 2FI1A 4PVDA 1A9PA 3CCFA 1B8NA 1Z6QA 3B2QA 3C24A 3GJRA 3I37X 4GI3A 4DGSA 1WZIA 5BV8A 5BUQA 3QXJA 5JXIA 2Z3WA 1T34A 2QU7A 3FCAA 5BSWA 1JB1A 3K94A 1GXSB 1BFKA 3L0IB 2ZIVB 3WL5A 4FYJA 2DB3A 3PXAA 4HAXA 3KJXA 2XIQA 3SM9A 1KIMA 2ECKA 1KDYA 3TB6A 4EO7A 4PC7A 5T4BA 3H1AA 2H2HA 4HYYA 5CXQA 3SHWA 5JD4A 2PZ8A 4PSDA 5CYGA 1BE6A 5EPEA 1ETUA 3IFSA 1IWOA 2CKMA 3IYLW 4J29A 2CJWA 3ZWCA 4Y2RA 3DB1A 4QSMA 3UEOA 4EA9A 1YZHA 1H9AA 3DEZA 3S3TA 5IUJC 2BW0A 4KIUA 5JLAA 3ANYB 4DAOA 3O74A 1T29A 5LSAA 3S7ZA 4RJKA 4EVQA 4EHNA 4Z0NA 3T1QA 1JVNA 2IITA 3ZLBA 2YJ4A 4Z9AA 1E6KA 5EIBC 1ZAYA 2Z2IA 1YDFA 4ZT5A 2NG1A 3JYPA 4RNDB 1U9IC 1XZBA 5H83A 3T3OA 1MAHA 4A03A 2JJYA 4FXPA 2AKEA 1KYXA 1ULSA 3J7AC 5CM2Z 3R0ZA 3WGKA 3LUGA 1EFKA 3MT9A 5F3WB 1UWCA 2NO7A 1FRFS 3HWSA 5B1YA 4JKYA 5JY1A 1XZPA 4WY5A 2P0EA 1LWOA 2VT6A 3CX6A 1VA5A 1ULZA 2JGKA 2C03A 4D99A 2XA2A 4HFRA 1IULA 2P2LA 5NLLA 1JR4A 3OIVA 3TKAA 4MR8A 3LC7O 3N5CA 1QKKA 4Q3KA 4DLBA 2I22A 1ZOSA 1E3EA 1LWNA 4ZCMA 2R1VA 1FVXA 1N32B 1WY5A 3BD6A 5FL3A 2H4FA 4FWTA 1II9A 4FFNA 3ZCRA 5J5CA 3VDQA 4Z4FA 3EZ7A 2YYYA 4HS4A 1OFUX 2JL1A 2VOEA 1K3FA 2CUTA 3OLWA 1UBHS 1XJCA 3PDWA 2PIDA 4LJ9A 1UZNA 2EFHB 2WE8A 5FAXA 1CUSA 2D59A 3CLTD 3FNFA 2E9SA 3TZLA 3UJHA 4H1VA 4DLYA 5FYDA 1Y6FA 4DJDC 4DUGA 2A2ZA 1NV8A 3AL2A 1AK9A 2Z2XA 3Q6MA 2YJ3A 4IH4A 5DOZA 2R7MA 4JYCA 4K1LA 3UY4A 1TB4A 5JNUA 1L6IA 1P5ZB 1PS8A 4HEA1 1UL1X 1W76A 1WUIS 2X9LA 4R2JA 4QT0A 2ISQA 4D4LA 4HRXA 4LISA 1QCCA 2BGGA 4GM4A 3MZ0A 1SVNA 3DBRA 2ZR7A 3OAAD 4RY9A 2I99A 3TPFA 4P5DA 2OFFA 1UFOA 2YV5A 4URYR 2K7FA 4LF5B 1NJ5A 1N2ZA 1EGHA 1ORDA 1SIUA 2AQIA 2F3RA 2HH9A 5ALZA 5F7ZA 4JWKA 3RF6A 5I48A 4RTPA 3CEJA 1YOBA 3P4UA 3E1KA 4P2BA 4IFEA 1P2DA 5KYUB 1QP7A 3KAKA 5IBPA 1ADYA 1D4AA 4PHTA 3TXYA 4WFIA 1TUIA 2CLSA 2QN1A 3FWNA 4EB0A 2EZ8A 4WASA 3ELYA 1HOXA 1SEVA 3P5BA 4ZT3A 2HCTA 2O3TA 3U31A 4DCCA 8ABPA 2GSDA 2X1VA 2X41A 2CXNA 2Y1CA 5D85A 1ISJA 3OZ7A 4PF1A 4QBTA 5DO9A 2AJDA 5TQ0A 3VZPA 1GDTA 1N3BA 1IBRA 1HBJA 3MOGA 1P2UA 3G2JA 3NT4A 4RQUA 4KB5A 5L3QB 3COZA 4X1KA 3TRKA 4BKUA 1LK7A 2ADMA 3WQSB 2PKRA 4JCOA 3TBFA 4TLDA 3UHAA 2YWDA 3FVRA 4S1TA 3KPVA 3PQ5A 2JGDB 3DKRA 4G3XA 4BV2A 4EHAA 1P1KA 3Q8MA 4M37A 2PSHA 3OETA 3FLAA 3UBTA 1Y1PA 4MWDA 3RAGA 3T1VA 4B40A 4WCFA 4EATA 3P4XA 4K3VA 2GAJA 5K4GA 4FQ7A 1QAQA 3HHEA 4X24A 5DX1A 2JFGA 1S7CA 1VSBA 1ZD9A 2P6OA 1GQRA 2IUSA 4ML3A 2EZ9A 5HZMA 2JLUA 1KYWA 2QG6A 4LRSB 3L7IA 1K98A 1T2DA 1Y48E 4IDEA 3WSVA 1TU3A 4WJLA 3ELDA 5CRIA 1A4IA 1CULC 2BFMA 1PCXA 1P3Y1 3G2QA 3O4RA 4R2MA 3O6VA 1ZIXA 3C74A 1UBUS 1Z34A 3FMVA 2Q3MA 1TT7A 3QVSA 4LKRA 4O3FA 5AVVA 4RLSA 3A6GA 5C5DA 3BVPA 4QOSA 2NYUA 4Y2PA 4N4AA 3P19A 3KOUA 3VVCA 5T5QA 2W6OA 3H97A 4EG6A 5B7QA 4DB2A 2A0FA 3MTGA 4CDGA 4WESB 1GRCA 2OXEA 1PJ2A 1EBBA 3R2JA 4KO8A 5JAQA 2VP6A 2PPVA 2O07A 2PL9A 3LLCA 1P7WA 3NAZA 1OBVA 5AJHA 2ATIA 1TC2A 3CPEA 4FMCF 3F74A 4KN8A 4B6GA 3WK7A 1Y5LA 1VPVA 3FXAA 5F3RA 3UJPA 2PMFA 2FR8A 1E99A 1NV9A 4RZQA 3AG6A 4ZKDA 2EERA 2P65A 5JAMA 4ZD6A 4BZQA 1US8B 4F5DA 2CXHA 3Q1KA 3M4JA 2Y71A 4RKWA 1BQ3A 1XT6A 2P9JA 2PXHA 1VMDA 3E7FA 4ILKA 4TL8A 2H08A 3IPRA 1EQ2A 5JD5A 1CUJA 5EZSA 3AF1A 4KJXA 1SUSA 4FOLA 3U4QB 1Y81A 3L02A 5I9SA 4R69A 4B17A 3C8HA 4NXNB 2IPMA 1IU9A 3HVUA 3RSZA 3WGYA 3EIEA 3OZDA 5DLPA 1ID1A 2E4XA 4KWTA 4KEAA 4EG5A 1E2DA 2I29A 4IGAA 2DP4E 1L7VC 1Z0ZA 4KE8A 1X7DA 3PXUA 4KKVA 1Y6RA 1EU1A 1PFVA 4IJ6A 3GVCA 4XWAA 1OXBB 2R6GA 2EJWA 2VDKB 2WF8A 3RRZA 1Q0HA 2PE5A 1BHJA 3MBIA 5DMHA 5IT4A 1GTRA 4ARVA 1CJTC 1ZJ5A 5LDHA 3DMNA 4ZJYA 5K8LA 1GZHB 1QYVA 3AV0B 3DEHA 2ZG6A 4WOKA 1A82A 1PFUA 1ZK4A 2XADA 3R44A 4HZGA 4IIDA 3UJ3X 3WLSA 1KXJA 1V8DA 1WXFA 1ZMXA 3PCXA 2Q6TA 4IQ0A 1Z8DA 3QXGA 2XT9A 4CODB 6GPBA 4YYZA 2XCQA 3DE2X 1YDHA 3CXRA 3T5TA 1JDNA 1JKFA 1LVGA 4RPLA 3LE8A 5T6MA 1BE0A 1P6XA 4X64B 2NXWA 1RZUA 1QGOA 3JQRA 1WB6A 2AZTA 3AG5A 2M9MA 1GTJ1 1YB2A 4IIJA 2LIVA 1F60A 4OBXA 4RD6A 4UREA 5DK4A 3W8NA 4BUCA 3IR5A 2PUJA 3C48A 1JAHA 3M3HA 1FSSA 4DRYA 1EBFA 1VL1A 1XCPA 2A5FA 2P75A 1R9GA 1NQUA 2OHXA 3I1YA 2JKYA 2CXSA 3FUUA 4MVXA 1HRKA 1M2NA 4FOPA 4UZEA 2ZYGA 3NO4A 3OPMA 4KPEC 4M8KA 2Q41A 2ACKA 1D04A 2WTMA 3TQHA 3PDHA 3ZBQA 4PVCA 3ABZA 2FSIA 1YVPA 3FFTA 1V0JA 4XRGA 1FUUA 1TXGA 2WFLA 4IQ8A 5HIJA 5JQGB 3JW8A 3KD3A 3IA2A 4QOFA 1W25A 4BO3A 2PWBA 3TQIA 4ZYWA 1J8DA 5B1IA 1U8FO 4MA5A 3LPMA 1C0LA 3B1ZA 1NXXA 1U98A 1LJ8A 4QUAA 1LA2A 1MDFA 2CB9A 3CKLA 1C29B 5CW2A 4DRXA 5LYJB 1OHHA 2GTIA 2G6BA 5FPYA 2C2MA 4EMSA 2HZ7A 5KB3A 4E31A 3GJYA 4G5OA 1XQ1A 1CZHA 1OV6A 2KSQA 1DQRA 2R00C 1SUCA 1NSYA 2FUCA 3FA2A 2ZQZA 3R41A 3B13B 4JUIA 3C5VA 2FKAA 4O0MA 4ZVQA 1WCIA 2WSIA 4OOEA 5L3QA 2GO7A 5IXYA 4OGLA 3BREA 1P9LA 2YVQA 2JHGA 2O2XA 2QTCA 2IZ1A 4X6YA 4IEIA 2Q4BA 2EX0A 3M49A 4U7GA 1QSGA 1P19A 1U6JA 1YO6A 1CYDA 1XTQA 4B35A 2PUBA 3GD5A 3D0RA 4L4XA 3V46A 3KB6A 4NTZA 2NVBA 4EEXA 3PE3A 3EGEA 4PCVA 1MR3F 3SOZA 1WPRA 2OECA 1U28C 3K9NA 2R8YA 1MENA 3ZXXA 1GQSA 2DT5A 4U5XA 4YMUA 4CN8A 2XUDA 3FOEC 4XQCA 2FZLA 4M99A 3MGAA 1MDBA 4I5IA 2Q5OA 4BVBA 3QSYA 3QEBZ 1D3AA 1JL3A 3K9BA 3RJ5A 5C1OA 3IDOA 5DHAA 3N2EA 4G0UA 2HDWA 4YA6A 4MV6A 3SR0A 1ATZA 5J2UA 4JGBA 4AZ0B 3DKVA 3KVYA 4HNHA 1SKAA 2DH5A 1FFSA 1RC0A 1W5EA 4PPNA 1I0ZA 2C0PA 1NR7A 4G0PA 5COAA 3G2LA 3RV3A 2Z1MA 4A8JC 5CFLA 3FOFC 1L7EA 1UJ4A 1QTIA 2JFUA 4KYIB 1SBHA 3M4ZA 1CLEA 3OFJA 3X2SA 4S1NA 1LPNA 1MB2A 4RHTA 2XNSA 4RFSA 3PXXA 4Q9IA 5A6SB 4UZFA 4DDTA 3C3XA 4Q9AA 5C9ZA 5CP8A 2EGGA 3ZK8A 2R5NA 5C1BA 3ADBA 4L50A 1R8QA 4WVLA 4E5DA 3IE1A 2XMQA 4M83A 3B7PA 1ZITA 1M2OB 2OP1A 3IUMA 4Q9LA 4HK4A 4BFWA 2ICAA 3BULA 1Z2OX 3KLNA 3KSAC 1RLTA 1L1FA 2OHHA 4YP1A 5FBLB 3OPXA 1MB4A 4BJ1A 4D1YA 4D3FA 4RV9A 2VQSA 1D09A 1UDRA 3FVVA 4FC6A 5D3ZA 5I3CA 2GUWA 4YRFA 2YXLA 5DT2A 5KYKA 1RXSA 1E32A 2IQ5A 2Z6QA 1MUUA 4C21A 2W9XA 1AH2A 2P9EA 4OY3A 5HKOA 3KKMA 1Z47A 3E5NA 4XDYA 1I3CA 2SCUB 1F06A 1X9IA 3FHLA 3HFRA 3USCS 3F6CA 3W5IA 4JZKA 2CWWA 3HP1A 4Q48A 2QT0A 1S96A 4DNPA 3SEAA 4ZHSA 2WG0A 4FBLA 4I08A 2BGLA 3GUYA 3QELA 4XXHA 2BR4A 5MN5A 2ZS8A 2GBLA 3SJUA 3QJ5A 3NHMA 4CLRA 1IN1A 3N0VA 1JF8A 2ZE5A 4GFDA 3HDQA 1FYFA 2O7RA 4DRZA 5AVQA 3B1KA 4D4IA 5SZIA 4HFMA 4TTRA 3A58B 1Y3CE 4WN3A 1X94A 3HADA 4LRQA 1GTMA 3WLTA 4WINA 3T94A 4WZBA 1KARA 4BNJA 4I5EA 5IW8A 3PICA 1GSAA 4M88A 4DQVA 3OPYA 2QAGC 5CITA 3BFXA 1KZYC 3UHJA 1O95D 3DT6A 5JWHA 2CEKA 1BROA 1N9GB 2HA3A 5GM1A 3LT1A 1J06A 1P45A 3DQZA 4KC0A 3TZ6A 2PNJA 4MYDA 5ITZB 2NVUB 5A9RA 2B0CA 3TQQA 2XB2A 1TL7C 3F98A 4KVFA 4Q0MA 4IOJA 4KG7A 1Z4MA 3CUEF 3AZOA 1MP0A 3BZBA 5SZKB 1K7EB 1HLPA 2H5LA 1NBAA 3KE8A 4I46A 2R8OA 3F3KA 3D0QA 5JTUA 3F9CA 5I8WA 1EHYA 1DZ3A 3AKEA 3R75A 4EHFA 1X1DA 1LS6A 2HK6A 3L0BA 3LSYA 1PX2A 1V71A 3IOYA 3PGKA 2GPNA 2CMHA 4DZTA 3PC8C 1AX9A 4TQAA 5EXEA 1DX9A 4AKHA 3IC5A 3BE6A 3TCXB 2ATVA 3L8GA 3OT1B 4BTLA 1BG6A 1KEEB 2DWPA 2PLNA 3DMTC 5HILA 1YRBA 4O08A 4ESVA 1DXOA 2WWRA 1YBVA 2R6AA 1VE1A 4ICIA 4L8FA 5AMXA 2GAAA 3KPWA 2W5UA 5JT1A 3VZDA 1CZNA 2GAFA 1M67A 2J9RA 5EE5B 1QRDA 5K7SA 1W0CA 5AHKA 4BMZA 1UMCB 4CT0A 2P4QA 4X94A 1EK0A 1PV2A 1X0XA 2IYXA 1VJ5A 2YASA 4I0WB 2ECFA 2HSDA 3KWMA 4RS4A 1KZ7B 4G65A 4XPZA 2JKVA 1WCIB 5CLIA 3RKUA 4BVLA 1ZMTA 5IDXA 3CBQA 1PUJA 4D5GA 3FNHA 2BMDA 3P9SA 4E21A 3SAJA 3P97A 1S2GA 1TVMA 2VDJA 2PZAA 2WU3A 4BB6A 4AY5A 3S2EA 3O91A 1JVSA 3D7RA 2RHLA 2ZAMA 5FUQA 1V4VA 5LUAA 2IPXA 1EM8B 5BN1A 10MHA 2Q7DA 4WY8A 3CNQS 3RG8A 1UWVA 5DTQA 3ZKWB 2G88A 2JJ1A 1PJQA 1R8JA 2IVZA 3A8TA 4QU0A 2AZMA 1ZIOA 3DBIA 4ND8A 3HDHA 3RUPA 4CTJA 3HJGA 1AKEA 1OBCA 2P9CA 3AF0A 2GN9A 2PS1A 3RR2A 1DCTA 3WMWA 5G3ZA 3A4TA 3OI7A 1G21B 3EEBA 3LRPA 4JB3A 4CQMA 1E9VA 3G0BA 3GHYA 3RLFA 1WXGA 3F73A 5JRJA 2I5PO 4K6MA 4G8JA 2ANBA 3ENKA 1QB8A 5CH8A 5LM3A 4Y2XA 5EY5B 1JT2A 1PT6A 4J4HA 4WLVA 3QFHA 5J4KA 2WU4A 1U7UA 3RGWS 2H3EA 1E2UA 1OLSB 3R20A 4IG9A 4XYEA 2BM8A 5JSQA 3I4CA 2GF9A 2O5VA 3U56A 1N6LA 2EWVA 3SPXA 4C2BA 2QAGB 2QWXA 4DPLA 2PJUA 4YDQA 2JLZA 3PJRA 4MUBA 5A03A 3GFBA 2QIPA 3HKBB 2HA7A 4DIUA 2FZCA 3BC1A 1Q0ZA 2EIHA 1P4SA 3GFFA 4GICA 5JFGA 5K05A 2I6QA 1W7AA 2XGSA 2BT4A 1LU9A 1RYEA 3LBFA 2QY6A 5K0FA 5TIIA 2AMYA 1KDZA 1U31A 2HTFA 1U9JA 2EGHA 2ZSIA 3EXFA 3F5DA 4HQRA 1VKZA 4E03A 5DWVA 3DTVA 3JQ9C 2QTZA 4GD3Q 1O89A 4FKBA 3SC3A 1EVIA 4FLFA 1KZ1A 3UJBA 4DXHA 4U2EA 2JFNA 3RDPA 3ZE8A 1EQAA 1NTOA 2YXEA 1SOUA 1TW3A 1XZDA 2PG3A 3LYHA 1OT3A 1AMNA 2IGTA 2QZ4A 3F6BX 3JD3A 2OCKA 4P5PA 2BUBA 5A9TA 3RPEA 4C7XA 1RI1A 4EFLA 3V00A 3GNTA 1RWQA 3G2KA 1AE1A 2HHLA 4Z1OA 1E4EA 3KR2A 3QMWA 3O4VA 3QWBA 1S1CA 3KEOA 3HJTA 2N75A 3A11A 2OYSA 5GGYA 4ZAWA 3IKTA 1SVSA 3U7RA 1Z33A 4KMMA 3DA8A 4YRMA 2B0JA 2WHQA 3HRKA 4LECA 4RDXA 4CVNA 2R65A 2JVJA 4KLCA 421PA 4WAUA 2GA8A 5AR1A 4NH4A 1XWWA 3UB2A 4RJJA 2P3QA 3CGGA 4FBGA 5EHNA 4AY2A 3TBHA 2EWWA 3HQ4O 4IOLA 4UBJA 3ZUGA 1KEZA 4KR2A 4U2BA 4ZJUA 3RKSA 1GGEA 3EISA 1N9GA 2HBQA 3WTCA 4YV0A 2JG3A 1EGVB 1SKYE 3RWBA 5I4IA 3GRFA 2DBZA 3CR8A 3H5NA 4OKSA 1ZOIA 3IKMB 5AJZA 4CQMD 1IPEA 3EY4A 1MXFA 1ZR2A 3RABA 2OCYC 2XBUA 1F6DA 1QHSA 4Y6OA 4D0GA 3F7TA 1J1ZA 1VCMA 4FNMA 1ISSA 4E09A 2C7VA 3MEQA 4FX2A 1GZSA 3SYNA 4A0QA 1NF3A 2C2WA 2MSCB 5BWCA 2IF0A 3ZTYA 2OYCA 3CLRD 3L43A 5BRNA 3ICQB 3HCDA 3H6HA 4AJNA 4GC5A 1F2TA 3SQDA 4KDEA 2E37A 4OJMX 5EESA 3SXJA 3VKUA 1C9JA 2ISSD 4QJBA 4RD4A 3WX0A 1JR2A 2DBQA 5DULA 3DUFB 4DCMA 4PLFA 5BSTA 1GXSA 3ETLA 2VEDA 4OO3A 3U80A 4BFSA 4CKYA 2O50A 1H0KA 3I4LA 4O4IB 1JJAA 1PV1A 3OBIA 4KXLA 5AI5A 3C4JA 4A0FA 4UOQA 6YASA 4QA9A 2WJZB 3TSWA 1ZQ9A 4UNSA 1PEDA 2IXDA 3OJFA 2GM5A 5CFOA 3UMFA 1E9SA 1HT0A 4DLRA 1QH1A 2WWXA 3R4VA 1P74A 5L3VA 1J8VA 2AUMA 3C5WP 2O2YA 2GT1A 1B42A 4IRUB 4NH0A 1R8XA 1YVUA 4HG2A 1YE3A 2GILA 3UAOA 3WL8A 5K09A 1CB7A 3GRKA 3HJUA 2IVFA 3I5XA 3VR4A 4TS9A 4DDWA 2OZLB 3I0MA 5IU6A 1M8PA 3HXOA 2RC5A 2JGAA 3QVTA 1JFFA 4FFPA 3TDMA 4KREA 1PP4A 2YYZA 4R0VA 4FU0A 1COWA 4OIMA 2HGZA 3LL4A 2P4EA 4GPIB 1HNWB 3EVFA 3PLNA 5BYKA 1GQYA 1ZX1A 2Q9AA 1RP1A 2N42A 2WPNA 4HUQB 1RDFA 2GZMA 3EQ8A 4PLCA 4CFYA 4F6RA 2F4NA 2ZRMA 1AZTA 4X1IA 4RTRA 4G25A 1T9GR 1OAOA 4JP5A 4OMDA 3MBOA 4AO7A 3D5TA 3KUUA 6NULA 3FMGA 1WHSA 4YBZA 1WW8A 2HSZA 4UHDA 1P0PA 1A4XA 4KXFB 1JYEA 1N78A 1IDN1 2JFVA 2WD7A 3CEPB 4TSFA 3VR2D 4HVAA 2DHEA 2FR0A 3LC2O 3T4PA 2FWJA 3GCGA 4C4PA 4DCNA 3QW4B 2B1QA 2IYZA 2AA3A 1OIXA 4R01A 2ALJA 1X2EA 2NNWB 3AR5A 3GLHE 4R1QA 3HC7A 4A82A 5C18A 3V6LA 3ZWBA 2BFFB 2HQBA 5M5BA 1CR0A 3IP8A 4HVTA 3AF2A 3AJ9A 1NPDA 4R8KA 3GUUA 2FH5B 2PSDA 4DC9A 5HUHA 3TM5A 4DMFA 5LXTA 2XE8A 1FS5A 4OYYA 1VBFA 2YYAA 4UU1A 2WY2D 5K6TA 4S0XA 3A6ZA 2CLCX 1AXRA 2CLHB 3OM9A 4G5XA 4I8XA 4IINA 4XWTA 2GUGA 3T7CA 3WYAA 2DTEA 1MA0A 1TCBA 2OO5A 2OCXA 3A4LA 1Q0SA 2ZB2A 3ILXA 3LUAA 1UXKA 3OOYA 1KI2A 4QYWA 4WLUA 3TXXA 4E12A 2UUCB 1NPTO 2CBXA 2IL1A 4TYQA 5MFPA 2OQRA 3HI4A 3KAQA 2A9FA 2CV2A 3WSWA 1PD0A 4BMYA 4ZOCA 3LW8A 4I1RA 1W73A 1RR6A 2ID9A 4Q9NA 3W6NA 3W8DA 3WKBA 1R0KA 4PGFA 3GJXC 3DTVB 4I5GA 2D00A 1IZZA 2ZIUB 7MHTA 3R8XA 1FFAA 3EVZA 4YALA 1GSHA 4H35A 3N75A 2VNKA 2V5UA 3T5CA 2V4MA 4QFCA 2YIMA 3SSNA 1X1CA 4TMYA 3GPCA 4BMDA 4IDGA 1Q7RA 2O59A 4AICA 3EXG2 2GZSA 4Y18A 3W78A 3ZG6A 2E48A 1KNQA 1DVRA 2CJYA 5IVHA 2I4NA 3T1NA 3O26A 4B71A 5C8YF 1CVIA 2WUGA 1DP4A 1XRLA 4X3OA 4KQ1A 1RKQA 4LYHA 5KS2A 1XPJA 3PU6A 3GLFE 4AJ1A 2VPPA 5THKA 1Z0SA 1Y37A 3Q72A 3GJ0A 5TGTA 4D3XA 4CQLA 2OCAA 2WHPB 3LHKA 3LT5A 4YJ3A 1R10A 3V7YA 5KYWA 2OGTA 5CYFA 2JGDA 3CHYA 2AQHA 1KYIA 3SD7A 3IHWA 4EKGA 2H4HA 1T4BA 1CS0A 3VZBA 4DBVO 3PVCA 5J4LA 1J09A 1QNLA 2FW6A 3PGXA 4KUHA 4BATA 2IS2A 1JIIA 1GILA 1NT2A 3MRXA 1A5TA 5FOWA 5A9SA 4MDEA 2WIFA 5E7IA 4W1RA 5I7AA 2XEXA 1WDWB 4A7PA 3FHJA 3TB4A 1GGVA 1LQUA 3U7IA 1ULUA 1DU4A 4KBFA 1DCKA 1R5BA 1T9GS 4E30A 1L4FA 5B1EA 2IBTA 2CXPA 2I8CA 3DH0A 4Q3BA 5CAEA 2MU1A 1QVWA 1SXGA 5LIRA 1U5AA 4HEJA 2B6NA 2XYRA 1QLHA 4CKEB 5JZBA 4DWOA 1P1JA 4KXNA 1KMCA 5TXGA 3PCRB 4MVWA 3VYVA 1CV2A 1ZR4A 3I05A 4V0QA 3VPHA 2OY0A 1RYMA 2C94A 3RO7A 3UYKA 1C1DB 3GWZA 4J6EA 1HDRA 1MFZA 2ZRNA 2ODWA 2X0FA 4YT5A 5CNIA 1FTGA 1P2SA 5SZJA 4BEBA 3OFNA 4L4RA 1BXKA 4PN3A 1WETA 2HSGA 2YMLA 1UMKA 2FRXA 5J47A 1N5DA 1GQ2A 2A1UB 4KVGA 3MHPA 4MUAA 3BWMA 2GFHA 5LP6F 4KXWA 5BSVA 3JQFA 3PLRA 2XVMA 1WQ1R 4M1EA 3P0FA 1H0HA 3X1KA 2RGBA 2D54A 1C4WA 2YWCA 8LDHA 1XB2A 1SEPA 1Z45A 3GRRA 3NT2A 3NHFA 3Q5GA 2HYIC 1JAXA 1U0GA 2PH1A 1J8YF 2NTEA 2O8VA 1FDVA 3UATA 5T6BA 2DVMA 1NQWA 3O31A 4HN9A 4EJSA 4Z3OA 4Y8VA 4N18A 4BYGA 5BUSA 1NKSA 3VKHA 4HSGA 1CWUA 3GC6A 3QPUA 4ZC1A 1J22A 1PZFA 3DE3X 3VOTA 1N5RA 4YP5A 2FN3A 2O8EB 3LKBA 3TIXB 1U94A 1GKIA 3GY0A 2OZLA 2NV6A 4QOGA 3EC7A 4MPJA 2AIRA 3IHLA 3E9EA 2CYAA 1SO8A 3UK7A 3JYOA 1V8FA 1CY8A 3CRW1 1B4DA 4JUCA 2KQUA 2D5CA 1O0BA 4DG9A 3MXTA 5FNVB 1HA3A 5IF9A 4O2RA 1GPDG 2LIPA 1H3EA 4C07A 3BGOS 1JQLB 3FFBA 2C83A 1T0IA 3NDRA 1KS9A 1HFEL 3GGDA 5I8ZA 3H1GA 3EZ9A 1PDOA 1DTWA 3T8YA 1Z13A 1M34E 1HNZB 1R64A 2WD7B 3SS9X 1LX7A 2PT9A 1GPNA 3NZEA 2HJHA 4DCOA 5JBQA 1ZW1A 3OM8A 4OX9Y 1IZ0A 1U2ZA 1MQ9A 4XTCS 3BK7A 3U3XA 5FWDA 1NRJB 1DRVA 2BFFA 1U8TA 3GN1A 3GRPA 4I55A 4L02A 3V1UA 3WIDA 2XR1A 1ZK1A 1AG9A 4OXRA 5J58A 4J43A 3ZJUA 1BE8A 3LFHA 2OMKA 4LTNA 2B7LA 4XGRA 1AUXA 3JZAA 1ITZA 2W2LA 4YP7A 5BVGA 3I9JA 4OK5A 4ECAA 1AGRA 2YWBA 3A1UA 4LNAA 3RTEA 3RUEA 2VF2A 4DSOA 2PWPA 3U61B 4R2KA 2ZUTA 3WIVA 2W42A 3FJ1A 1L3CA 2BFEB 3PNKA 4KYTA 3I9OA 2H92A 4DMGA 4QG7A 2GEVA 2BBOA 1R3DA 2EAUA 4KSYA 3HDYA 3LYLA 3ZZMA 3IBYA 5JSZA 1QPGA 3HN2A 3ZW7A 1PFWA 1OWNA 2VDRB 2Y0BA 2VL7A 4KFTA 5IC5A 3AHCA 3BCRA 3OPNA 4D44A 5C8YB 3STHA 4EHHA 2PN1A 1S8AA 1YU6A 2VAWA 3FVTA 1XZAA 3G0DA 2XTMA 5F76A 4KK3A 1O3YA 3BK1A 4ZPJA 3WC4A 1LI7A 4F3KA 4Z9XA 5T8KC 2PMBA 4L74A 1Q15A 3BZUA 1TYCA 1XVUA 3KQNA 2C7OA 3GCXA 1XC7A 1EDDA 2C3UA 7REQB 1QK4A 5KKNB 5KTYA 2DFKB 1S3GA 1E58A 3HXTA 1W1WA 4MIYA 5T4EA 3ZVMA 4RV4A 1BCRA 2ZBVA 1SELA 2IPOA 1E2FA 2HPVA 5BY2A 4JWTA 3H2KA 2BMFA 2YDYA 3N3BC 3VR5H 3KZ1E 1Z0IA 1UJ5A 1V6SA 4DV3B 1GLNA 4RIEA 3LF1A 3QPCA 4GLOA 2GPSA 1V3QE 2ZI4A 2DFPA 4HLUC 1FYDA 4EG0A 3ZHRA 4M0DA 3OE7D 5A9SB 1EP2B 1CQIA 1GFWA 3R5JA 1KSJA 5LA6B 1JQJC 1K9VF 3TQCA 4KK4A 4DLUA 4X85A 3CPHA 3MW8A 3W2TA 1Z6AA 3FKSD 2QK4A 1KO8A 4ENQA 4KDFA 2ZJOA 4OHMA 3WAKA 4XEUA 3CNOA 3N1UA 3SQLA 1GFIA 1IHUA 4V0SA 3WNVA 4C1BA 2AUNA 4NU6A 4P3XA 4DQXA 1JEEA 3BIOA 5CLGA 3L1UA 2I78A 3S7TA 4JDUA 1U2PA 3RNLA 3OM0A 4XYMA 3T1HB 4XW2A 2FPGA 5FWAA 1NL3A 5KOHB 2VBCA 3CS3A 3LPDA 4YAFA 2WZQA 2C54A 2WTNA 5EKUA 3TSAA 5JJBA 2FHPA 3OBBA 4O4JA 3AVWA 4JJZA 1E6MA 3IEPA 4EQZA 4HDMA 1NN0A 1WDLA 4J2OA 5K3CA 4X1YB 3PDJA 4BKMA 2Q3JA 4FFBB 3IAM1 2YL2A 4IDPA 1I1HA 3D6JA 2Q8QA 4QUJA 3X0DA 2OTCA 4ASUD 5K8CA 2P90A 4QTTB 4ZXFA 4ZT7A 3T9FA 4TQ9A 3UTDA 3JWGA 3O8OB 2NU8B 1IQUA 1ZICA 1TFUA 1CETA 1NR1A 1YL7A 2IYFA 3DZCA 1B0UA 1OXMA 1L6RA 4UUNA 1YIOA 2Q3HA 5G1NA 1V26A 5B6JA 5HE9A 5GV8A 2GOYA 4W5TA 3NP9A 1YQTA 2I3ZA 5DBHX 4BV3A 5FBWB 2I4RA 5IHPA 2UVDA 3FPEA 2QVCA 3FTQA 1IQ0A 3IJRA 3NALA 4CW7A 3V9AA 2P62A 1U7DA 4AVYA 5M29A 4IF4A 3TD2A 3ZY3A 3PD0A 9ABPA 1O4WA 2HV8A 1M0EA 4R8LA 3T4UA 5J59A 3S4YA 5IK2D 3OIUA 3KXPA 5CA1F 2QZPA 3JTMA 1YVDA 2E6KA 1KPIA 4L6CA 1EWQA 4YPOA 4AG3A 2ZBFA 1W93A 4JZYA 4W5JA 4Z0PA 3HJBA 4ZN6A 2AKAB 4JODA 1PT9A 1SVMA 4MW9A 2DBRA 3CEMA 1ZI9A 5CX4A 4KV7A 4KPFC 1JJBA 3P9ZA 1IMOA 2CHFA 4J0DA 5D8DA 3THYA 2C5AA 2DU8A 3RVJA 1AQJA 4FOTA 4S1WA 5AOAA 4O4JF 3HXPA 3MWLA 4ZOLF 1FQKA 1E77A 2NU9A 1KU0A 1ZGGA 5ADVA 5K99A 1MJGM 2AF3C 3DZBA 1M6NA 3U9LA 5KVSA 1FUKA 5K0LA 2WKSA 5K20A 1EWKA 2OMEA 4B83A 4YI3A 1MMFB 2XUJA 5HF5A 2QZSA 1QBKC 4GWGA 5B1DA 4M6WA 1X19A 1YZTA 1I2MA 1MJHA 4OQMA 1NNLA 2RK3A 3RREA 1Q0LA 1GD1O 3JRNA 1P73A 1N2OA 1MIOA 4NYMR 2J0QA 2IYEA 1DEAA 3ZUPA 4EM6A 1VCIA 5CVJA 3T34A 4BNHA 5ARDA 5FORA 5LKRA 5KBYA 1PDVA 2DG2A 3PPYA 1CEXA 3VMMA 1PWXA 1S8NA 3DMRA 3Q7QA 1BFUA 1GRQA 3LVQE 4D45A 2W11A 2YNMA 4UU0A 3MN1A 3RASA 5JUWA 3QEMA 2HF8A 4GOLD 1XWIA 2ZAOA 2LKCA 4RMIA 2CLIB 3LO5A 2XTAA 2CZCA 1KO5A 2PTHA 2DSNA 3DBVO 1PBTA 5EJEA 4DJEC 2BI8A 2WHEA 1ZRSA 1JDUA 2QTFA 4RW0A 3ZV7A 1RACA 1MW8X 1I6MA 1XVLA 2X5OA 3C16C 3DZDA 4G4JA 5FV4A 1RU3A 2OXCA 5KQLA 2BMVA 4UMFA 1UBGA 5AJVB 5G0SA 5DN6A 2I4TA 1F8GA 4AJHA 3D8HA 1IY0A 5G02A 3E5MA 2VC2B 3SM3A 5BP7A 2Y1EA 2PAAA 3GLKA 3D02A 3MT7A 5CVVA 5BR1A 5A3SA 2ZULA 1W4LA 2J7PA 4G07A 3JX9A 4MTCA 4BLTA 1RQPA 1SKMA 4KIJA 2IY7A 5K03A 4IIFA 3RE1A 1QP0A 4TKUA 1RT9A 3AY6A 2C99A 3G2OA 4ZARA 4B2YA 4DCUA 2D2IA 1B76A 1W4RA 3FNEA 1E2KA 5H02A 3UWDA 4ZDKA 2YYSA 4WOPA 1BN6A 3NBFA 3OQIA 4JEUA 4AS2A 1BWSA 2X6TA 2PUWA 5B5SA 2YY5A 4DLZA 3AOEC 2UDPA 1IAVA 4HN4B 4PAQA 2H2IA 3IBTA 2NIPA 3K4PA 4NHOA 1APBA 2C7GA 3NJRA 3LT4A 3T7RA 2ZRAA 2ZGVA 2J3HA 1EM6A 2AV6A 2Q5IA 2QR2A 4UTOA 4ALMA 5K0TA 2WUVA 3JARA 1K0FA 4OREX 4WKOA 5KNCA 2O7VA 5GONB 5AK0A 4A0RA 5AVXA 4BOYA 1Y3HA 1VGQA 1BMFA 2HIHA 4L8WB 1ZISA 2F8TA 1UDBA 2R8BA 5DLYA 2MOKA 4EG8A 3E22A 5E6SA 2GCPA 4BO8A 3EZ6A 4CI9A 3HLTA 3NB0A 1V8PA 4MUEA 3IVXA 4ZRMA 4H16A 3QNWA 3HYCA 3FLEA 1U2QA 1AQ6A 1DT3A 4Q21A 1CDOA 3Q40A 1UOPA 5KJ6A 5E2BA 4LYDA 5FADA 3IBCA 2WINI 3L5KA 2V7EA 1I94B 4AY6A 1ADFA 3K5PA 3FFAA 1XG5A 4UU7A 4CIXA 1YA6A 2IXTA 4ENVA 1SVWA 1KI7A 1UPBA 3T5MA 4OB6A 5H3LA 4P92A 3MWDA 4HDOB 1YXMA 4V0LA 3ETJA 2NADA 4AI6A 1A5BB 2QJTA 4ID3A 1NYTA 5DCWA 5TEWA 4HP8A 1SXJB 5LD2C 2Z4TA 2RKBA 3M6WA 3WO1A 1ZXXA 3HDVA 3N74A 3COJA 3NH9A 1F3LA 4QYSA 3VHXB 5BW5A 1Y6QA 3D4LA 4KI0A 3OUZA 5KTKA 3MILA 5FTKA 5LQCA 1AC5A 1SCUA 3NOQA 4JBLA 1S89A 2BBWA 1E4YA 2QUHA 3GDOA 4OCZA 3GJTA 1TCAA 2P78A 5CVUA 1P3JA 3TOVA 3CF4G 3AOGA 1LF0A 3STUA 1KBZA 3V4RA 1XAIA 2YX1A 4WK4B 2OYRA 1OYVA 1TA9A 1GLVA 1JLLA 4H0FA 3SZ3A 2AQ8A 1KR2A 4NBNA 1CUDA 2BI7A 2P2ZA 2PH3A 3LUBA 3KEGA 1DFHA 3PPVA 3SYMA 2WK1A 2EFEB 5L7TA 1D4ZA 2HKIA 5E4YA 1VI2A 3DLPX 5L3ZA 1G3IA 5U4XA 3WLPA 4B74A 1XQWA 2EBFX 1X1QA 2PQ6A 3AX6A 4OB8A 2KE5A 5T4HA 5KNCH 1K8ZB 1EUCA 4BYMA 1IQPA 1GUFA 1XQYA 4HQOA 3UT6A 1NQOA 5KWVA 3RC8A 1B74A 3B52X 3RRYA 1HYGA 2A0YA 3BTVA 2QTAA 5AUPB 2GWHA 1X7XA 3UN1A 1RPTA 4ZA2A 4K88A 4W1SA 1DWOA 7ABPA 2W7TA 4YBRA 3RG2A 4CG0A 3LGXA 3CA8A 2H2AA 4XLZA 2JH8A 3TPZA 3VKGA 2DBVO 1L5QA 3ZZUA 4PTZA 1D03A 3VI3B 1LQ2A 2YJ5A 2XQJA 3QOYA 1PL7A 4GP6A 4KQ2A 1R6UA 4TRMA 2QVBA 4PIPA 5DGDA 2QLMA 4W9NC 1VLVA 1BXGA 2R97A 4RY8A 5A06A 4ZHQB 1C3EA 1W30A 2X1LA 1D2CA 2X6RA 3GB9A 4LGCA 4NBLA 1F7VA 1SKQA 1Q57A 3I23A 1ZM2A 4QUDA 1TTTA 4PCAA 2VJNA 2JI9A 1WW2A 1IL0A 1W1IA 1TTHA 4J49A 4MO9A 1LVHA 1N57A 1XHLA 1Z5OA 1ZK3A 4U9UA 4TSRA 4P22A 2IP4A 3ZXSA 1X7YA 4ZQCB 1S2IA 5A1TA 3FPBA 1G5TA 1U4SA 4IV5A 1NLUA 3L7AA 4M7WA 4X93A 2GD2A 2AFIB 4YXWD 1AKRA 2J9FA 1EESA 2ZWPA 3H5WA 1YS2X 1NNEA 4LXQA 3TNFA 1PD1A 4U2GA 5JS6A 1PFGA 5CTAA 1VJ0A 5DBEX 3RVQA 4ON9A 1Z2PX 4HX2A 4MS4B 5E6UA 2NM0A 3EQ2A 2EARA 5FWXA 5HX7A 2AG1A 4LQDA 3P2EA 3EBPA 4K2HA 4OXXA 3W3ZB 3QUQA 4FI3C 4P2GA 4AZ3B 1II8B 4L5IA 4M8SA 2QE6A 5FUMA 4PQYA 3RAEC 3QG5A 3KSMA 3LHFA 1B43A 4IJMA 4KQMA 3GMIA 1ZD2P 3FWZA 2JA1A 2FCAA 4NHEA 1T5LA 3QHQA 1A88A 4BRSA 4ZK2A 2ZJ5A 1E1CB 1WPQA 3GZNB 2J4DA 3IOEA 3MJRA 4M49A 2QMUA 4NF2A 4TYYA 1KPHA 4N6OA 1MO5A 1FFDA 4HHEA 1PJTA 2WU1A 3WO0A 2CSUA 3BCUA 3KT3A 5IH3A 4EK9A 2B4TO 3PXEA 4GE3A 4JJEA 5FA8A 3C7KA 5DYNA 4B09A 4C20A 1UP7A 1HNNA 1BRMA 1XXHB 1W5BA 3E15A 3EH1A 3KALA 3W8RA 3NIGB 2PGOA 5FUWA 5DM70 4J7UA 4RL4A 4AU1A 4FINA 4A2CA 1OI7A 1S5PA 2JHAA 3A4MA 2A0XA 4DQUA 4H1TA 4QTUB 1I8TA 4OH7A 5ELMA 5LXTB 1SCIA 4KKXB 4QODA 1DG1G 5FTWA 4MJLA 5BNWA 1M5UA 4MIEA 4QPZA 3O92A 5KREA 1JYSA 5J2TA 1CD5A 1A8IA 1HT3A 3QMVA 1EK6A 1X80A 4IIBA 4IDHA 1YOVB 3H5LA 4URVR 1SXJA 4I36A 3KPYA 3IDSA 2BKEA 3RVMA 4GPEA 1A2KC 2NOAA 2XGOA 3AVPA 4YUXA 4X6XA 4XYLA 3WGMA 1WMEA 4PICA 2NW6A 3D1VA 2Y0EA 5AW1A 1CLUA 2X19A 3RK4A 3GBSA 2XEDA 4K6KA 3ZV5A 1CZLA 3BSSA 2H9AA 4FMDF 1WMSA 3KB1A 2IXGA 4ALKA 5BXQC 3HKEA 1NMZA 3EUEA 4ER6A 3DE6X 3W1WA 4UTXA 4AJ2A 3MJHA 1GNLA 1RFGE 4I8DA 3SN6A 4QPCA 4F1WA 2OHIA 3DHWC 3EIWA 2YUIA 4NU0A 1JLLB 4PO9A 4EGFA 4P8RA 1T0HB 3DULA 4EZIA 2WU0A 3JAMA 3ZYZA 1XZ8A 1WA5A 1XA3A 1QX4A 2DC1A 2ZSUA 4N76A 4WFJA 1F2UA 3K1AB 3L7KA 4KQXA 1JQ5A 2ESRA 2PZFA 4A8HA 2DQZA 1GHTA 4WZAE 1Q5PA 1MRSA 2V54A 5FLKA 1OREA 2ZFUA 3ZIDA 4KAJA 3DEKA 5I5EA 5K6AC 1VB3A 3L0YA 5EWMB 2FOIA 3KAPA 1O58A 1Q50A 4MWSA 3I0NA 3SHTA 3W8EA 4NNPA 1LLFA 4WK0B 4QLAA 1X7XB 3VR4H 4Y2YA 4J16A 1QO9A 4KAAA 5LCXA 4OG2A 3C3WA 1LNZA 2VRWA 4ETNA 3G8BA 2EW2A 2X8LA 1TYDE 3G0IA 5AVYA 4PC3A 3AU8A 3HJRA 3AHDA 3L0SA 4BB0A 3OQPA 2PV7A 4D9MA 4XM0A 3S5UA 2QMQA 4YUVA 2O7QA 2YVAA 1C3VA 5KVQA 1AKYA 2QKYA 1Z0DA 3NUGA 2EV9A 3SQXA 3FYTA 3KT8A 4M36A 3V8VA 1UDCA 3UO8B 2QPLA 1JNYA 3C5CA 4WT7A 4UD2A 3DTVD 3NDBB 4WKGA 1PR2A 1VFNA 2HEIA 4HQLA 4NBRA 1F0KA 2VI5A 2HX1A 1UQUA 4Q1VA 1RABA 2H57A 1NZDA 3S8YA 2NZWA 5AO9A 3Q15C 4R7TA 2GCOB 2YNMD 4RVUA 4PC6A 3SBXA 1H85A 1K7XB 4TSFD 1NUQA 3O0TA 1PNOA 3HB5X 1FDUA 2O2DA 4G8BA 2C5BA 4KWCA 2PX5A 3BMOB 3MGGA 4OXIA 2FPSA 2MJLA 4DNXA 2ZXUA 3O7WA 3P0HA 3VNRA 1I3KA 4LKOA 4QU5A 7ADHA 4C6HA 3P0JA 4GUDA 4AF8A 1GCOA 3DLAA 5AT1A 4IZ6A 1S4QA 2UVPB 1ZJYA 3NTOA 4X20A 4KTTE 4N7RA 4MV0A 4LE1A 4P0QB 5K3DA 3FOBA 2DM6A 4KR6A 5JJCA 2J1LA 3GEEA 3X1WA 1M5RA 1JLMA 1Z56C 5AI9A 5JROA 2DMRA 3IVMA 3OWHA 3GRYA 5CPBA 3WYFA 5KTNA 5BMOA 4B31A 3DAGA 4YAGA 3IMKA 4MARA 4AJPA 2FLWA 4NR0A 2HQSA 4YXWA 2ZPAA 1DV1A 1RBQA 2QYTA 4S1PA 5BYBA 4PLYA 3U44A 1AS2A 1LQTA 3CF2A 4FDTA 3RRJA 3TOSA 4DMUB 1LV8A 4YQFA 4D9EA 3L9XA 5ALYA 4LF7B 2FMIA 2ZR9A 1H2AS 2C1XA 2HLPA 2ODTX 3EG9A 4IW3B 4KO4S 2X9QA 3K5IA 4PZ0A 1M66A 3VAZA 4G5HA 3A06A 5FLXA 5DX8A 4WKBA 3IQZA 3QBDA 4OH1A 4RXUA 5LR6A 2WSSD 3E9MA 3ES9A 4UFOA 4I8IA 4NFHA 1ZQ1A 4P7JA 1H4TA 1IB0A 2WM3A 3EYAA 5TRTA 3RHSA 4EF4A 5JAOA 4G5QA 4DIFA 4UBLA 2MYTA 1JRLA 2MSEB 4TMZA 2Z04A 2EXXA 3LP6A 1JHQA 4CKWB 3LUFA 3PQ2A 5HIMA 4TPKA 4Z99A 5HW0A 2QUBA 2F1IA 2TMDA 2Q99A 4J0KA 2W4QA 4ZOLA 4ZO6A 4A23A 3DL4A 2YJNA 4BZWA 4YAOA 4KQGA 2YVLA 2H59A 5G4LA 5FOQA 1MIHA 1YJ5A 3KHTA 2X5JO 4K87A 3AEKB 2QVXX 3C7AA 2ADFA 16PKA 3ET5A 4FI3F 4M9RA 4RS3A 4ZU3A 2DULA 2P3LA 4FQ5A 2WJGA 2UXCB 3EDRA 1R0RE 2GHQA 3BXEA 3QE2A 5D6OA 2P69A 4H9GA 3AESB 2V98A 2F4VB 3G79A 3OF5A 3G2HA 1RYNA 4LJ5A 4M0LA 2QRZA 3E27A 1M2HA 3A4YA 2FFHA 2JD0A 2GCEA 3DE7X 3H6GA 1GG5A 2ATXA 4H1HA 4OAPA 3ZQ4A 4ZCPA 1JEDA 2XCLA 2GESA 3AR9A 1BOOA 3L84A 4OEHA 2ZRPA 2SHKA 4TL6A 4P3OA 4N5IX 4YJ2A 5KO2A 5F5XA 2IYRA 4XPIB 4XYGA 1OAAA 3CLUD 3H1PA 2POCA 4ESHA 2OV3A 3HS3A 1ZO8A 3MD0A 5CCXA 4GDFA 4LNUA 1U1FA 4YRKA 2JLVA 1BCRB 1YQWA 5IDWA 4FLMA 3U4GA 4HGNA 5KMGA 1SRQA 2GDJA 4ZXPA 1XEXB 3UUWA 1PQWA 1EZ4A 2UYCA 2QA5A 4LV6A 4CQMB 3D3KA 3TF5A 1CUFA 1G4HA 3B1FA 2HWWA 4EJ6A 2G5PA 4EVSA 3OQBA 4ARCA 1Z8HA 3GEGA 1DWUA 2FSVC 3GLGE 4E51A 1JAYA 4HSEA 2XB9A 3A2NA 4OLJA 3WHPA 2IKSA 2FEOA 2XKAA 5ADWA 1LUAA 2HQRA 2NP7A 1F2DA 1V6CA 2PQ0A 2BTQB 2QTRA 4LPSA 3ZVLA 5DN6D 3A1CA 2HCJB 1D4OA 3IVGA 1A9RA 2Q1XA 5A05A 1RQRA 1G2PA 3DMTA 1W9HA 1T5IA 1UCFA 3PWTA 1ZM3A 5LQRA 4G1FA 2EYQA 4O33A 4XKJA 3KSDO 3W9BA 1HT2E 1KEPA 2GNPA 4FVTA 4D02A 4DANA 4ENRA 4XIFA 3D9QX 3EPLA 5KQRA 1NUPA 2G09A 1D0VA 1IEWA 5CA0B 3AVVA 1QYWA 5BV1A 1R00A 3CUSA 3UAYA 4JVNA 4NEHB 1PYGA 2VRNA 3V2GA 1MG5A 3SIPA 4D7AA 1NLFA 1RAIA 1EWYA 2V9PA 2LDBA 2VAXA 3H42B 1XA0A 4KQHA 1OFUA 1DOAA 4M9SA 1U1DA 4CMEA 5D7BA 5SZHB 4ITUA 4II2A 3CSDA 5DN9A 3SFVA 1ECCA 4QO7A 2A0WA 1WXXA 3PG5A 5HF6A 3D8UA 4ATNA 4YAKA 4G67A 3RVKA 1WP4A 3VPCA 4EG7A 5L53A 1JTVA 5CX1A 1KU6A 2RGWA 4I81A 5EERA 1ZXLA 2QN2A 1QIDA 3I34X 2GCOA 4R83A 5IJ0B 4F85A 4PXAA 1LSUA 1ZONA 3II6X 1MD9A 4B76A 2PEZA 1TAGA 1UXHA 3IODA 4H2DA 5DP2A 3UCXA 4S24A 2LWIA 1CC1S 2VJOA 2X5NA 4DR2B 3DLTA 4FYVA 4WA8A 3H17A 3PTLA 5BR4A 2J6HA 5K4HA 4CZ2A 1T1RA 1Q20A 3F49S 4Q4HA 1G8SA 2BD0A 2IUUA 2XMPA 4C78A 5DHQA 2BKXA 1AM4D 3NM6B 1NW6A 1MG0A 1UT6A 4KAFA 1BDJA 2NN3C 4X20B 4UTRA 5GMOA 1PUIA 1CW2B 2WOOA 3A0RB 4PM4A 3ZCUA 4LWQA 2EQBA 1GAXA 1EE9A 3EULA 1EVYA 1BD3A 1JPJA 2JJ2D 1ZOOA 2ZS9A 4J3NA 2J32A 4NK5A 5BW4A 1U4NA 2B8EA 1XCOA 1XL0A 4LOHA 1I0IA 1QMGA 3IP6A 3WV5A 3GG9A 4L4ZA 3RVPA 3NHPA 4KZPA 3VH4A 1E9AA 3VYUB 1EMDA 2XPCA 4MV8A 4C6SA 2IH4A 4CJXA 3NIFB 2C97A 2AVDA 2VNHA 3EG9B 5ICFA 5K3OA 3SIWA 2G0AA 1T3ZA 3I12A 5IULC 4GL2A 2W2KA 5JS8A 4J0GA 3EVTA 4L9SA 1C7RA 5K1ZA 4HH1A 1RXVA 3GU3A 2VPWA 4RAQA 4TTTS 3D3JA 4QUHA 1PJLA 1Z74A 5IVIA 4A16A 4H59A 5EIWA 5AH0A 2XNDD 2NPFA 3SYLA 3E58A 1K27A 1PSWA 3H4TA 2WABA 1BKSB 4F6CA 1OCEA 1T2VA 3TKYA 3WRYC 3M9XA 2IUFA 3P9QA 1MPXA 3MYYA 3FPSA 2IHUA 2VDPB 1CE8B 2RDMA 4L0QA 1BS1A 3PUXA 1NX6A 1KJYA 1M72A 2AX4A 3QSGA 4KLRA 5FI3A 1WZ2A 1UJBA 4ZTBA 3ZEIA 4JBYA 3A9VA 1G291 4YPVA 4YFYA 2PZGA 5KAPA 1B3BA 1DIGA 4OJNA 4YI5A 1FYWA 3QE9Y 2ZCJA 1Y1KE 3HR8A 4KODA 3RYTC 5A5EA 1E6CA 3MB5A 5DBFA 1QRUA 2X0IA 3HCNA 3I0ZA 1DKNA 1YCDA 1KYYA 2OHFA 1AUVA 3EDYA 4IWYA 1RLOA 3TIVA 4BTVA 1E89A 3EEOA 4H08A 3JSAA 4FHCA 3SSAA 1H6BA 4UARA 3PVSA 5IS2A 3ROQA 2H06A 4MUMA 5AJWA 4TKUB 5GINE 5ENZA 1V41E 3KR1A 2YFQA 1SCKA 3L40A 5BXYA 2Q1SA 5IJXA 5SYAA 3ZE7A 4AMYA 3AEQA 1OPXA 1DXYA 4L16A 3VTZA 4C0LA 1JR3E 5IXJA 5LL6P 3V6MA 1TQ2A 4U8GA 2BFCB 3FD8A 1SZDA 1A77A 2HL6A 4M7PA 3VH3A 4PV7A 4RZUA 1G9SA 3QX9A 2QROA 3TW8A 3H1BA 1M8FA 4G26A 1Y9DA 3CCBA 3JCZA 3GRZA 5UKDA 3BL8A 4ID9A 1FUYB 1SIBE 3IR6A 3OU7A 2Q4RA 4Y2TA 5J63A 1XZMA 4QXQA 1F7UA 5H7XA 1JPUA 1UUFA 2QY9A 3T7DA 2OGWA 2E0IA 2YRXA 4OJQA 2BGTA 1J9GA 4XSHA 4OHCA 1CJMA 1TRHA 1U7XA 3V4SA 4AO8A 1BKYA 1TKBA 1JMVA 1ISGA 2C2ZA 3LHIA 4GG1A 1HE1C 3CSUA 1GL6A 2JAUA 4JGIA 3SMQA 4C0HA 4DQ0A 1TRKA 1KH1A 1UBOS 1XVTA 1IG3A 4REQB 4BNZA 1PQ4A 2RI6A 5CT9A 2WQ6A 4YEDA 4JHLA 3AUAA 2ZUDA 1VPDA 3IB3A 4DCSA 4MOWA 3L7LA 5CHYA 2DF8A 2VT2A 5AVKA 3R23A 2ZATA 5SV2A 2OO7A 1GKYA 5BSRA 2O3UA 1J07A 1C8KA 1QOZA 4N5DA 2AZ4A 1XVVA 4CDRA 1DXHA 1BNCA 2R8XA 4HBZA 1E9DA 2BL4A 3RUHA 1NC1A 1E5QA 1R66A 2P9FA 3D8TA 2FW9A 2RHRA 3TGPA 3AP2A 2GF0A 2VO1A 2W4MA 3E18A 3GRVA 1BU8A 5EKSA 4ZK6A 2XYVA 3ZH9B 2V7PA 5CLFA 1Z2DA 2D5AA 3B1XA 2MR6A 3U7JA 3Q41A 1F8YA 4HX9A 4KUGA 4JD5A 4DV2B 4UUAA 4OXQA 2YW9A 2E5LB 2PT7A 5F78A 2DECA 1UZUA 4CQLB 2VP9A 4Q7MB 1WXWA 4CETA 1XR3A 2IZ0A 4RVFA 2D0OB 5DHRA 5JW6A 2QQFA 5I5GA 2Q2VA 2JD2A 3L06A 1YRYE 4ME6A 2X9NA 1V96A 2ZZKA 1BXRB 4LDQA 1ZZGA 3KOWA 1E3TA 2Z2YA 3P2YA 1Y80A 3ITEA 1ORRA 3O84A 1AKWA 1GVNB 4LDRA 4UM9D 4OLFA 1YUBA 3RI3A 3IELA 2ZAGA 5L4LA 4LFCB 1I5EA 4QQNA 4NFSA 3OP4A 1QR2A 3LUHA 1PJ8A 1XMOB 1N33B 3F3MA 4JI4B 2Q07A 4TQGA 2JFXA 1SM4A 2REQA 1ZHFA 4I2VA 4A8JB 1LV7A 2EKZA 5CM9C 4EZEA 5FBQB 5CDYA 1ICEA 3ZCPA 1MCZA 2IPLA 3EW7A 5A4MS 2OD9A 4UDXX 1W0JD 3SC2A 4RNCA 1SPBS 2DKNA 3DXXA 3FZYA 2M6RA 3AB3A 4LY6A 1JSRA 1F9AA 4AZSA 3RIMA 2R25B 5BQOA 1W5AA 1P2FA 2XTZA 1YQDA 3HY6A 4PANA 4YVFA 2JLYA 3DL2A 4QRHA 2DOKA 2K2WA 4WW0A 1NW9B 1N7HA 1R5NA 3OTQA 1DBRA 3AI2A 3L1HA 3TL3A 2HMWA 2DQKA 2YHSA 1U8AA 4W8HA 2N1MA 5HJ2A 4AB1A 4M55A 4B7CA 2BSQA 1LH0A 4JSRA 4YMIA 4QEDA 3GUVA 4OF4A 5IDYA 4FPXA 7GPBA 2W2NA 3FBTA 2NTVA 2R2GA 2VH1A 1K5DA 4HAUA 1A9OA 2VOJA 4KPGA 4NEGA 5A0TA 5F4BA 2XB6A 4NG5A 3UV3A 4EUEA 4RULA 2AC2A 3SF8A 4UE2A 2QRNA 5TPZD 1Z36A 2MSWA 2GN2A 1RRPA 3M5CA 4BZPA 5JZMA 2XOKD 5K3BA 4IHKA 3B5EA 3VR3A 1GG8A 3M4NA 1W5FA 2CD9A 5A3JA 2R8ZA 4OKNA 4L8GA 1PFQA 4IIHA 3IVAA 2E82A 3N2NA 2O06A 4R9RA 3Q0EA 1PRYA 4YP0A 5AI6A 1KO1A 2WJYA 1HEYA 4FHFA 1T1SA 3SDBA 1RWXA 4RXMA 4S2EA 4CV0A 1Q77A 4JA2A 4EYEA 4YCNA 3K6RA 3BSYA 4MWZA 4QQFA 4MEAA 1GQFA 3ITKA 3C3BA 1J0XO 4F4UA 3BQMB 5L3RA 2OFWA 2PBLA 3VUEA 1P9OA 1CBUA 1T0PA 2V3WA 1UJ2A 3UMGA 1I4WA 1E20A 3ZE9A 4F4IA 3PNVA 1THGA 4HEQA 4MUIA 5H1YA 3HLKA 4BO1A 2YMQA 1RYBA 1IHPA 3CH4B 1NYLA 4PC1A 3RBZA 5M7EA 1UKVY 4LOAA 3GT3A 4HDKB 5JIBA 2HOQA 1YBAA 1O4VA 2ZDGA 3VGJA 3HNRA 3QPAA 3GV0A 1JSCA 5I9TA 4Q3LA 1JLHA 3W06A 2X13A 3CZCA 1FP4A 1H2EA 5FA6A 1YB1A 2VLIA 3ZBPA 1TO2E 3BL6A 4IEFB 1OYWA 3COSA 3VJLA 1XXLA 2VJAA 2G0TA 3UUGA 1YS6A 2JAQA 4MP8A 1N6NA 2AFRA 3L6UA 2QI9C 1ONBA 4PSKA 4D9HA 3KUCA 3DDNA 2VDWA 4NPCA 1U90A 3HRIA 2F00A 4HFJA 2G06A 2JI6A 3BH7A 5AP9A 5EIHA 4EAQA 4LMBA 1YCGA 5C3MA 1XAGA 4I50A 4H15A 1QQBA 5JH7B 2BSAA 2PKWA 2GZ1A 2UV8A 3DO6A 3LFTA 3LV8A 5E1BA 1N8KA 2YV3A 3OAAA 5E6RB 3W5SA 4Z49A 1WBBA 4KPYA 3VJRA 1AS3A 3QLUA 1ZGAA 4QOHA 5J5VA 1M8GA 2YY6A 2NSYA 1OYYA 1E0DA 1LDEA 4BX9A 1MEOA 3R5FA 5KTOA 1SHJA 5CFZA 5LOVF 3KB2A 4P3NA 3SI7A 3KZMA 2B9VA 4N12A 4MB0A 1YIAA 4R68A 3IQHX 3UKOA 1QHYA 3N6RA 4II7A 1Y33E 2OPBA 4X66B 1H0RA 2HMVA 3AINA 5TQ0B 2GJ9A 5AM0A 2XJ4A 3MUNA 3COVA 1VGVA 1X8JA 4UQOA 2WB4A 1Y9ZA 1UFQA 3PEFA 4KH0A 3JD4A 4HS9A 4KAXA 4P9NA 1KXZA 1XN4A 1Z15A 1H22A 2W8BA 2Q4TA 4ENUA 2QI9F 1V1JA 2GAOA 2V7BA 3LLSA 4GNRA 5IAOA 3ROFA 3WKDA 1IJFA 5DEIA 3WGUA 3KKEA 4CLEA 2EFYA 4YRCA 5CCEA 3LFUA 1KTVA 3N7TA 1BHSA 1N1MA 4DLTA 3DP7A 1C81A 4DQDA 3ADKA 4L5AA 4JH0A 1OFHA 1Z06A 2DTXA 1YZFA 2RB5A 1UXOA 2QMZA 3K1AA 2CLOB 3WWEA 1E59A 5IZ4A 3NEYA 4FUTA 2V0CA 5ECWA 2OZKA 1J2EA 1J8MF 1ORIA 4B73A 1A9XA 3A26A 1X0VA 2B83A 4GPTA 1AIPA 3R0QA 5K0JA 1PT5A 2JIPA 4U8HA 1JKIA 4BUJA 2HRDA 4DDUA 4DFDA 2YWHA 4W8GA 4GMDA 4R3NA 2YVUA 3GAAA 5MGNA 3D3QA 1L7PA 3LHDA 1E5XA 4WI1A 2H2WA 2ZRHA 4V3CA 3LQKA 2W6QA 3E81A 4J0HA 4ZT4A 1CFZA 1MGPA 3HJFA 2EDCA 3K9LA 1DKRA 3C70A 3GGOA 3QI2A 1E1RA 2HAEA 3KLPX 3NV9A 4HADA 4IX1A 4RGQA 3KT0A 5LP1A 1E1MA 1C3OA 3UKDA 4HXYA 4HWSA 5K2MA 3NXSA 1DAPA 4WNYA 4EJMA 2D8MA 4JY7A 4RYLA 4WL0A 1FDWA 4MX8A 4MR7B 4L78A 4OV6B 1U7PA 4YO7A 5HVNA 4YO8A 1D2NA 2AWNA 1HWYA 1VLLA 3NAMA 3R7NA 4XR9A 4PLPA 4U00A 1AUPA 2ZPUA 4CHGA 3HTXA 3W9YA 3ZHYA 3CVOA 2GBIA 4WXMA 1W0JA 4NJEB 4YRTA 5CEFA 2QN3A 4V0ME 1PFYA 4LCEA 4CIAA 2V65A 3NYRA 4MDYA 2PFKA 2ID8A 5DF1A 3OPQA 4OPMA 4Z8XA 3PZRA 4C03A 4YMHA 3WLQA 3DE1X 5ALWA 5JECA 3UJNA 1QGYA 1ATIA 3OZCA 3ELUA 3KUDA 2ZBGA 4I3GA 1BW9B 5EIFA 5EKXA 1K6IA 3AR7A 5EPOA 3W2FA 4BMXA 2R66A 3L1KA 2XLCA 4HAIA 3H1EA 3BMOA 3OX4A 1EB9A 2NV2B 4M1KA 3QU4A 2HWXA 2SKEA 4YJKA 1CF4A 5JSKA 2G1UA 3OMWA 5EJ6A 5JJKA 1U0TA 4GPZA 3TJMA 3A4VA 2IC5A 3NEJA 2DFVA 3BCSA 2KBEA 1UKEA 2ZIFA 4R05A 3UMCA 4U2FA 1V7PC 1M1YE 2VPIA 5B4UA 3FOZA 1PL0A 1F20A 4LXGA 4C4TA 1XDSA 4LPKA 1XQXA 2UUBB 4R9UC 1BTOA 4NBWA 1VPTA 2ZRKA 1AT1A 2XCTB 2O7NA 1SUAA 1ADJA 3LX8A 2ZB4A 3BWXA 1AKTA 2FUG1 1P5RA 2HXGA 4G2NA 3BXFA 3LM8A 3OY2A 4ZAXA 4B7AA 2LKDA 5FHRA 1HM5A 2BCEA 4KUEA 3B8HA 2BKUA 1HL7A 3K72B 4UXHA 3AB8A 3SYTA 3P9XA 4C2AA 4BFCA 3EIQA 5C52B 1OXXK 1JKJA 3IQFA 2GZ3A 2W71A 4RKFA 4RVCA 4YLYA 1YSCA 1ZCZA 4U2CA 2XKKA 5KJEA 1EFAA 1CDEA 2JRCA 4FK8A 4KR9A 4BO7A 1GNVA 3KQQA 5LNK1 2XNCA 4C22A 2O1XA 3QFCA 2J5XA 1CR1A 3IBGA 2HUNA 5IP5A 3VVBA 3KL2A 3CN9A 5AI8A 1H5NA 1V6AA 4NOMA 4H18A 1YNOA 2WFLB 3PF9A 2C0CA 2LV8A 3NOXA 4CKWA 3OQOA 2RI0A 1SUEA 3AUYA 3G5MA 2B78A 3ETNA 1NW4A 5FOVA 3THRA 2XYQA 3KKZA 5BO5A 2G70A 2IXAA 2AI2A 2ZZNA 1YB7A 3NFRA 3LNTA 1H2FA 1WR8A 4ECEA 2CNBA 3T7TA 5HK9A 4J0IA 5ALRA 3IPLA 2PANA 4QPDA 4FILA 2QV7A 4LF4B 1A76A 3F78A 1WEHA 1C8LA 1XNHA 2G8NA 2OXRA 2WJWA 3H1TA 2RHWA 2VZEA 2RAPA 4HPXB 3PNBA 4CLRB 1WWKA 1P2TA 3PT5A 3SEFA 4BIMA 5I7FA 2B6HA 5KCZA 1U7HA 1UR5A 3DKPA 2VA8A 4A9AA 4BDSA 3QU7A 2QBYA 3VR6A 3PQDA 5CLQA 1ZU5A 2HJGA 1ESCA 2GS9A 2XWQA 3EARA 1FA9A 1CUVA 2ZJ3A 3GVXA 4UATA 4NV0A 4YJ2B 5DIFA 2J45A 1J99A 5F2KA 2C9MA 1K3UB 2BJVA 2WF6A 1DKLA 3RW9A 4MV3A 4DJFC 5ALNA 1QC5A 1I6KA 1S1MA 2FK7A 2FJUA 4IDQA 3T0IA 5KYYB 2HHAA 4GBGA 4AY3A 2WF9A 2CW5A 3VR6H 2O8FA 1T3GA 3S2YA 1HE2A 2ATCA 2HQOA 1NRXA 1JFLA 3IUBA 5EWJA 2DWOA 2IK8A 4DIEA 1BVRA 5KNDH 1G2QA 2FX3A 2NVUA 3EGVA 1P9WA 1QBGA 4EY8A 1OI2A 2HSJA 3I32A 1QVAA 4JNKA 3R8FA 1VDMA 3WMRA 1HR0B 8MHTA 1O6ZA 2PA0A 3DVAA 2B1GA 4JLBA 1WDKA 3GZJA 5AVWA 1NUTA 3MSXA 2A59A 1O9HA 3FBWA 1EX1A 1GFZA 4HPWA 4XX0B 2IV3A 3DJYA 4J0CA 4I1YA 2P0AA 4RADA 5FXMA 1SCJA 2GEJA 3KOOA 4IIXA 3H3FA 3CLSD 4IBOA 1T3SA 3CKKA 2HYDA 3JQAA 3K8ZA 1PGJA 1DLIA 3RSHA 3X2FA 4AJOA 3GJ5A 1J70A 1C7JA 3G5UA 4D4KA 2QAJA 3HB4X 1KBQA 2JGMA 3FPJA 2VJBA 2R87A 5AHWA 2YR0A 2P4UA 5H9VA 5TT1A 3WQBA 5BVHA 1UFRA 2HIMA 4OQ4A 3G8CA 1Y8ZA 5H82A 4JL5A 1X39A 4EHDA 4BWGA 1BIFA 2G6TA 2ZIGA 1CRQA 1P1IA 1CUZA 1BA3A 3L7YA 2BEWA 3G68A 3VHXA 2VTKA 3WL4A 2MINB 1PKXA 1MV8A 1L0BA 2JH3A 3I92A 4DREA 3NDPA 2XUOA 4B3BA 2FV8A 4CL2A 4ARIA 5I51A 2M6KA 3CZRA 1FX0A 1PEAA 2JBWA 4CBVA 2P2DA 4OA5A 1KK0A 3BICA 1VXOA 1N4DA 4I99A 2HV9A 1X87A 4LJYA 5B36A 5CFQA 1YR8A 4JR1A 1EAMA 1Y3IA 3TR6A 2QMHA 5KPJA 5KYGA 3ZWOA 3PF8A 1Q0QA 5I6DA 3BSWA 1WDMA 1PQYA 2V6BA 4MITA 3ZWAA 5LP6A 1IVNA 4IRXA 1GN8A 1R37A 4NMWA 5FP0A 3NWBA 1EUQA 1BDBA 1VG0B 2R6ZA 2Z6VA 4HWTA 4OTZA 3TLYA 4A2PA 4HRVA 3QVVA 4Y0NA 2QB5A 4NBKA 4R2IA 3VKFA 4L28A 4BUZA 4EA7A 5JRZA 5E1OA 4Y6RA 4YRRA 4CV2A 1SCQA 1T5SA 1I1QB 1UM9B 2NTNA 2X22A 3BJZA 1BX1A 3O0DA 4BKRA 3CISA 4D25A 1V8ZA 1KJQA 2YWXA 1KVTA 3QEOA 1HZZA 1CUCA 2B98A 1JHOA 2FSFA 2QJRA 2ZRBA 3BM5A 3GXOA 3NYIA 3ICCA 1ZM4A 5HRCA 2DPMA 1OWOA 3PPXA 4HGOA 2TMKA 4XDGA 4DLVA 3A6LA 2XIJA 1VHLA 3DF9A 4IHQA 3EXIB 1RJGA 3U81A 4RSMA 4B32A 1VE9A 2FSSA 4RPGA 1G5IA 3VYSB 2XWSA 2G1KA 4U7JA 4P53A 1DI0A 4JL6A 4EF5A 1TYBE 2R96A 3VYWA 5EHXA 4TYWA 2PUTA 1QQAA 2OT3B 2DSTA 1XVAA 1I3OA 1K0UA 1PJSA 1NLYA 2ZJAA 1IOWA 2I66A 3D3NA 5K4AA 1HO3A 1UXGA 3NNNA 3P26A 5FPSA 3SJCA 4Z7JA 3FCXA 4DVGA 2OUIA 2VP4A 4EZBA 2X1HA 4Q9HA 1FLAA 4TS1A 4NYMQ 3M6VA 2ZBUA 4LK3A 3WGVA 2LD4A 3MRSA 3HYRA 1QLJA 3FNRA 1KHTA 4HQKA 1KRXA 1B2LA 1AKMA 2BJHA 2EC5A 4R1PA 2IWHA 3H2ZA 1K6JA 1TZJA 4MVJH 4OHXA 2WAMA 4QDOA 1LFAA 1EFRA 1QH9A 1Z5PA 2ZJ4A 4LOJA 5CBKA 2P5TB 2WUEA 3EY9A 5J3JA 3ZY5A 3UWMA 1I5OA 2AG6A 3L7BA 1NU6A 4F9EA 4CUKA 2IT1A 1OQAA 2VHEA 1SC9A 5BNFA 4WVFA 5A3QA 1E4EB 4P6VF 1LKZA 4B6JA 3E5HA 2WSYB 3HA7A 3LQYA 4GQIA 3GPBA 4WEQA 5L9AA 3WKAA 3L0PA 2GKSA 4DMRA 3KSBC 1XNRB 1V5WA 3GFSA 3PFWO 4TL9A 4U6SA 3SJBA 5C34B 4E0BA 2O54A 5C51B 1AUOA 2BFNA 1R9MA 2YFYA 4UMDA 2NTJA 3PR3A 2XCSB 1KORA 1VCHA 2OORC 4G0NA 4B6FA 1CJKC 3IT0A 4WJZA 4XX0A 5IXSA 1N3YA 2Y1OA 2C95A 2G3YA 4PAMA 2YXBA 1EM8A 3DBOB 4O5AA 2F9MA 4ZV9A 3HEAA 1OH7A 4M98A 4BNLA 3KK0A 1T2CA 2VP5A 3GT4A 3NRJA 5DHPA 1E0AA 2H4WA 3FHOA 3D4NA 1DOZA 1JSZA 1P0IA 3WVNA 4DTIA 2GZ2A 2SICE 4UZSA 1KOGA 4ZPXA 3PNYA 4B87A 1N6PA 3DV2A 3FPGA 1XZFA 2QL5A 5JSUA 1T26A 5AJTA 4AWBA 1L4HA 2C00A 3H99A 2RJOA 3Q8WA 3R0JA 3WDLA 4ZDJA 1IIRA 2YCLA 2HU7A 3A3PA 3OVMA 1WXIA 3AEXA 4L8LA 3A7EA 1VJDA 1EK1A 3A25A 4MYTA 4Z8YA 4AKEA 1G9XA 3WA7A 3D81A 4YJGA 4BNDA 1E61A 3JYLA 1RCUA 4UM8B 1PWYE 4AJKA 2A7XA 4TV9A 5CVTA 1XKLA 1O94C 4CE6A 1GYRA 4R1UA 4JMPA 2W6MA 4QO8A 5HOEA 2XOKA 1G59A 3D2LA 1Y9EA 1DWPA 1Z22A 5IAGA 1OLUB 2Q21A 3K31A 3JQAB 5EA2A 1TZMA 3U7QB 4EGCB 4Y2UA 4GF5A 4Q7KA 3VOSA 3HA2A 3ZE0B 2D1YA 3QENA 5CGQB 4EKEA 1V8OA 1ULTA 2IIQA 2OBYA 5BN4A 1R27A 1YOVA 4KXUA 4RTKA 1GYPA 3R3SA 1EGAA 3I2GA 5CDTA 3IXQA 4KE9A 4ZANA 1SQFA 5FEUA 3EVBA 5TX7A 2QDKA 2VH5R 3TJRA 1WOMA 2BEWB 2MIIA 4L6AA 4HMPA 3A2KA 3Q98A 4IPTA 1QP4A 4A3SA 5EKDA 1IXYA 3U4IA 3H2JA 3HFSA 4X8HA 4K5QA 3G9UA 2C04A 5F77A 1AZLA 1QCYA 4ZWNA 1FX0B 4LJ6A 3KYCA 1CVLA 1CNMA 2H18A 1U8ZA 2ZWIA 3HKEB 4Q9JA 1EPUA 2H7CA 3KQKA 1J56A 3F9IA 5D5PA 3I3SR 2QW0X 1ODTC 3LO8A 4EYGA 1B16A 3V5NA 3NHUA 1NBHA 4FZJA 5EMMA 4GM0A 3H7IA 2A9QA 1KPGA 2E4YA 2QTMA 3T9AA 1Q3KA 1E9BA 1GUYA 4BNKA 4CF5A 2AYYA 4GZ3A 3TRJA 5IJ9B 2YV1A 2FFBA 4I50F 3PUVA 1NRWA 1KJ8A 1KTIA 4ZZ2A 3ZVKA 3GA5A 1F2UB 3TZBA 2HHJA 3BS4A 2QX9A 3BE5A 2NO9A 4TTJA 1XI2A 3JU3A 4UTVA 3IBFA 2P2YA 3ET4A 1RRKA 4I1IA 2VWGA 1XUOA 1Z4OA 5EWMA 2BGNA 4MYRA 5EZYB 1QU3A 1O5IA 2AD1A 2DZDA 3MTBA 1KC1A 4PGMA 3E5RA 4EW3A 5CFNA 2NTYC 3BGIA 1GA6A 1VPEA 3MJEA 4LF9B 3H7AA 5HA5A 3AXSA 5IAJA 2Y68A 2HLNA 3AEUA 1Z6ZA 1X1SA 4ZYYA 2VNAA 3JZFA 1J5XA 4UCXA 3E82A 4IFBA 3UICA 4L8VA 2FOLA 4NE7A 1QOQB 3DWIA 3X1JA 5E9JA 2Y1DA 3CKMA 3ISVA 3HEBA 1FDOA 4XVQA 1IM5A 2WILA 1KQNA 4PZUA 4CV1A 3HDJA 5HGJA 1PL6A 2VJDA 2MMGA 1UKCA 4UBKA 4U63A 1NVMB 4DUYB 1QAOA 2HU5A 2QRKA 3F5MA 1IRIA 3FOAA 4ZP1A 1F2TB 1T1JA 2H1FA 3SS7X 3ZLJA 4HQ0A 3MHTA 4MQLA 1NW7A 2VQ6A 3L8FA 3MNFA 3ZWQA 3AFOA 1UKAA 3PNPA 1HRDA 5GQSA 4OHFA 2BRUA 3G89A 2ZROA 2CMGA 3ZDEA 5C5CA 1SBYA 2C4TA 2O7SA 2H2FA 2GCIA 3HG7A 3LCRA 4WTOA 4XFKA 3TI7A 3W8FA 4GLBA 4E07A 4E6EA 2JKZA 3IUPA 3HM2A 1KAEA 3GGJA 1DQPA 5CB6A 4FD3A 3STYA 1KAOA 3KZCA 5F4ZA 5KZMB 2XOXA 3P32A 2BFAA 3BFKA 3PX3A 1DQNA 3NBKA 5EIOA 1Q3TA 4HWRA 1T6NA 1WTAA 4XAQA 1GAQA 1V9CA 1QH1B 3D64A 4O1MA 4HXGA 2A8YA 1G7CA 1CYEA 5AW9A 4BNTA 2AMFA 1KMMA 2WG2A 1U0RA 3OZAA 4QREA 1IWPB 2QT1A 2BM9A 2MYNA 4EP1A 3E23A 3L93A 4L8YA 4U7DA 3SQMA 1MTOA 2OO3A 1WMFA 3JQAD 3TS1A 1DC4A 3UMSA 3WGOA 1MLDA 3VKWA 5IWAB 1FTYA 4MRMB 4BL5A 5AOCA 2I34A 1JFFB 1CS0B 1OFTA 2QN8A 5KYNA 2CJXA 4L15A 3W3AA 4Q4JA 4AKIA 4Q18A 4OI1A 2ZTLA 4YY3B 2O48X 3K4HA 4KVAA 5DM1A 2NXJA 3JAWB 1I4TD 1BHO1 1OH5A 4G1UC 4DM3A 1Q95A 1T1EA 2A88A 1T8YA 3L6BA 2FCRA 4A27A 4EGAA 5HXAA 5JI2E 2C59A 1KI6A 2VUTA 3PQ3A 5HMMA 5CAEB 3VNQA 5L6MB 2XITA 3RS9A 3LOQA 3TLBA 5CDFE 3CVYA 2ATEA 3EJ6A 4J3FA 1YZVA 2HA5A 3HU5A 1UT8A 4PYNA 1JHPA 5DHTA 1I36A 1C3LA 2RJNA 1RE1A 3G9XA 1YI8A 4LDZA 4RVDA 3C1UA 3JQFC 3UH0A 4YS6A 1JPNA 2OBXA 4EDFA 4M38A 2WNIA 2EX1A 4JXKA 5AW3A 1DNPA 1CK4A 4QGHA 3EPRA 3N6XA 1G63A 2NU6A 4BS9A 3GP5A 3TE7A 4Q66C 3VMFA 1TADA 4YH1A 1L8XA 3P94A 4ZOLB 2B7CA 4DT1B 1GG9A 4DS3A 5BN4B 2H1HA 2JIOA 2NT3A 2Y6UA 1RWPA 4GSLA 3NH6A 1E7QA 2P6NA 3STVA 3VJKA 4R1LA 4NMLA 1K7FB 3ASZA 3PL5A 5SYNA 4ZZ3A 4HGYA 2IELA 1T8SA 2V8OA 1XCGB 2I0FA 4R2WA 4C0AC 3BRQA 3AESA 4DLAA 3OCUA 4KDCA 2AXEA 2G9ZA 3L07A 3M4XA 3FZEA 1G0NA 4R8SA 4ENWA 1N5LA 1PGQA 1EK5A 3W5HA 4LEIA 4D0NA 4WKCA 1LBTA 1T25A 4H0CA 1NDUA 4CTNA 2O8EA 4HDSB 4EB3A 4C0XA 2X2OA 4N9QA 1DUVG 1NGSA 1RXEA 3QTTA 5SY9A 4HAVA 3TLAA 3OJXA 2ZUCA 1MH9A 3CC8A 5ALMA 3VC1A 3GFQA 4BDTA 4U6NA 4M9CA 4Q12A 4U7FA 2H52A 3WRVA 1DEOA 2F64A 2OL4A 4P81A 5K8IA 3G6WA 3PI7A 4HGQA 2NUBA 4IH9A 4CRWB 3NKLA 1GRNA 2W83A 1TPYA 3KTAB 4M1TA 4LNUB 1EG2A 3AR8A 2K5UA 3ILHA 3H84A 3NKVA 3UBMA 2KLHA 2IHNA 1QFYA 4NONA 1CF2O 4C6TB 3RSSA 4WBSA 2FW1A 2BE7A 4JKOA 4X45A 3VR4D 4ZDIA 1LPSA 2W6CX 3I28A