1F8XA

Crystal structure of nucleoside 2-deoxyribosyltransferase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
PKKTIYFGAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDIMLGVYIPDEEDVGLGMELGYALSQGKYVLLVIPDEDYGKPINLMSWGVSDNVIKMSQLKDFNFNKPRFDFYEGAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
publication title Crystal structures of nucleoside 2-deoxyribosyltransferase in native and ligand-bound forms reveal architecture of the active site.
pubmed doi rcsb
molecule tags Transferase
total genus 55
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2000-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f8xA00
4A3SA 2IZ7A 2NX2A 3HNOA 4JELA 1WEHA 3EHDA 1F8YA 4U1RA 2F2TA 2A33A 4P5DA 1S2GA 4FYIA 4I4IA 4NPAA 3O8NA 4LJRA 3O8LA 2KHZA 5ITSA 1T35A 2F62A 4JEMA 2F67A 4FYKA 3PFKA 4I7EA 4I36A 1S2LA 3OPYB 1WEKA 2F48A 4LJKA 1S2DA 4PFKA 4FYHA 3SBXA 4OHRA 3IMKA 3QUAA 4RH3A 3UQZA 6PFKA 1YDHA 1F8XA 4MEJA 4KXLA 1KZHA 4HX9A 2IZ5A 3K2QA 2F64A 4KXMA 2HIGA 4LJLA 3MAJA 2Q4OA 3F5MA 3O8OA 2KLHA 5AJUA 1MTOA 1RCUA 2PMBA 3BQ9A 4MCJA 2IZ6A 2A0KA 2Q4DA 4OHBA 1S3FA 1S2IA 1ZXXA 3OPYA 3U39A 1PFKA 4WL0A 4JENA 3GH1A 4KXNA 5AJTA 4P5EA 3O8OB 2PFKA
chains in the Genus database with same CATH superfamily
1JLSA 4KMSA 1ZU4A 4A3SA 2EP5A 5I5GA 5CVCA 5JCXA 1MA0A 2J0UA 1H2AS 2BT4A 4IDEA 2XHZA 2XQJA 4MKHA 4V3BA 3IBGA 3ZE2B 2WTUA 3JD2A 2WM8A 2B8WA 4TRNA 3W1WA 4J2HA 1EUDB 3ZI0A 4UM5A 3SNKA 1KOJA 3JVDA 4MUHA 2PQ2A 3IUPA 1YJBA 4A92A 5K6RA 5JRJA 2ZWOA 3NR2A 3AFNA 3I9MA 3BYZA 1TU4A 3KWFA 4GWKA 1TEHA 2DLDA 1G7TA 3L7BA 3JATA 5COQA 3NT5A 3ET4A 5KOJB 1PZGA 5EP3A 2I29A 4C0XA 2GXQA 1FTSA 3H42B 3DTVD 4LTMA 1D7AA 1KZ9A 2PWPA 2RHMA 1UP7A 4UMFA 5T5QA 3TLGB 4YGYA 3HYSA 1IHXA 3H4VA 1KGSA 4G5RA 5G0UA 1QH9A 3VMFA 1BGWA 1VHQA 4CU2A 4YQYA 1QQTA 4P2BA 2BDUA 2VT7A 4RJJA 3BTOA 5EI5A 2QIOA 2FSUA 5KJFA 3OQBA 5JDIA 3WLJA 3N07A 4X1YB 5LMZA 2PMFA 3NHLA 2BMJA 2UZAA 4FDMA 1TOAA 5CD9A 2AE2A 5IXJA 5LD2C 2Z6VA 2A5LA 3P9IA 4UAJA 3WIDA 1HUQA 4P53A 5ESXA 1JEAA 1GUAA 2JZNA 8OHMA 1L4UA 1U0BB 2ZR7A 1CF4A 3VHXA 3IQZA 2F3TA 1JHUA 3AEUB 3QF4A 4XDHA 4AZWA 1ACJA 1QBKC 1T1GA 2YWRA 4H1VA 4IDBA 1N1MA 1CFZA 1VDMA 2A7XA 3OIDA 4R8SA 1PVVA 1XZMA 5J5CA 1SVNA 1VCIA 3O4IA 2JIPA 3L7AA 3GD7A 3RUDA 4XWKA 4AWXA 3AEYA 1I14A 2X8JB 3GA5A 3LA6A 3NWJA 2E6KA 4G67A 2OFFA 4CIBA 1EGMB 4MWDA 4MEJA 4OXYA 3DTVA 3Q7PA 4EDHA 3NT4A 2IHUA 4XB6B 1GEGA 1NLFA 3S3TA 1AA6A 1TO1E 3SY8A 5A3QA 1VI2A 4EG3A 3KSZO 2B0CA 4O4HF 4MVJA 4OHWA 4GUDA 3LS2A 5CEJA 2DWUA 1QPBA 3QBJA 1W19A 1ZJ5A 3Q3IA 4FIDA 4GOMD 2E5LB 1RYDA 5FOUA 1DAHA 2YX1A 2PVPA 2ZJ2A 3BKWA 4IYJA 4RY9A 2F43B 1UKZA 3A3NA 5CTAA 4J2TA 1LLFA 2FV8A 3TJZA 4D6XA 3WGVA 4QRIA 1W0KD 2D4HA 3CF2A 3RWOA 5LWQA 1ABEA 5LM3A 1QFZA 2DKOA 1TU0A 2ZIZA 3HWRA 3N76A 1L2TA 1N6LA 1P9WA 2OORA 1L5ZA 1XTUA 3DYBA 5JD5A 1JVNA 3M70A 3B3FA 4AC9A 4ZI7B 1KIAA 2C98A 4LVNA 1S2MA 3FGZA 5HBGA 1LVHA 3PKJA 1GPLA 4KAXA 1M7BA 3UXMA 3ZLUA 4DLZA 4ND3A 5A6SA 4NQZA 3VSEA 1KP3A 2HADA 4L3VA 4CLEA 2D2XA 2XE6A 1BEEA 3R3VA 1YFJA 1WULS 1V6SA 4RVCA 4KI0A 5IMBA 3RU7A 3JQAB 4CIAA 5LYJF 2ZCUA 4H60A 5KJEA 2X5JO 1JLLB 1KTIA 1Q0HA 4I5FA 4AS2A 1OU4A 1OXXK 3IAM6 3BWCA 5JDCA 2HHCA 2FFBA 3LDHA 2GR9A 1YAHA 4D99A 1PL6A 5C5IA 4PYRA 1F12A 2GNOA 1D8TA 2QUIA 1GTMA 1W4ZA 2C29D 3NETA 2WM3A 5DGTA 3RAPR 4R83A 4FSHA 4B80A 1ZGHA 5EIAA 1U6KA 2BFFB 4X7BA 5DHUA 1VCOA 2QAGB 3I83A 4B6JA 1M6WA 1P8JA 1WVGA 2Q8PA 2DX7A 2VO1A 3OZSA 1JFLA 3ETHA 4HFNA 1RPTA 2KS6A 5DULA 3SSOA 4JX9A 4F46A 1XKTA 2DWQA 3BK7A 4R6XA 3G2OA 3P0IA 4BB9A 2WTNA 1G3IA 1ZU5A 5JECA 1DHRA 2HO4A 2NW6A 3L8FA 4ZVOA 1FZTA 1XEXB 2H4XA 4S35A 4MUJA 1J07A 4CQMA 2I65A 3U6KA 4NMMA 3MHTA 3FOFC 2DUWA 2O48X 1DC7A 4Y18A 1XA0A 2OFXA 3V32A 4AULA 1PQYA 4GEGA 1B43A 5FWAA 4G23A 1PTJC 3JV7A 5ED4A 2YXDA 1G20B 3KTOA 1HO3A 1W47A 1FF9A 4YJDA 1QG4A 2VBIA 5D51S 2WSIA 4LQLA 1WEKA 2CHUA 2CLLB 2DJIA 2FHSA 3LLSA 4I1SA 1V8DA 5AVSA 1Z3IX 4XDGA 2YZ7A 1V2GA 5JCJA 4ZAWA 1Y8RB 3VH3A 4ZYWA 5ALXA 1ZUHA 4M1SA 1RXVA 1Z4NA 3R7NA 5BPFA 3ZK8A 1G9TA 2G04A 5DGCA 1DCMA 2UYCA 1JFRA 5E6UB 2VDKB 1O9BA 2J5BA 2I99A 1KO1A 2QRKA 3SBXA 3WKBA 1QIGA 4XPZA 2Q5CA 3N70A 5EPUA 3WRWA 1SRRA 5JT1A 5KHOC 2OKGA 1QU3A 3W8RA 1Z0AA 1I36A 1L5FA 4OQNA 2HCJB 3AXTA 1WZCA 1P7ZA 3SEQA 1G7CA 2F8LA 2PQ6A 1XE3A 1O9HA 4P7KA 5TJ9A 1K8XB 1K5GA 3VFDA 3UKOA 4OK3A 1YSCA 1U11A 2XCQA 4WSOA 1MRZA 1MO4A 1QRAA 5F7ZA 5I4KA 3VR5H 1E9VA 4DBZA 3FVTA 1WF6A 2OL4A 1DHTA 1X39A 1L5SA 5C7IO 1ZOIA 3TIXB 5KJ1A 1CERA 5LUAA 1HDCA 4AXXA 4TXHA 3L8GA 3NCTA 3EGXA 2VAWA 3HXKA 4LV8B 3EXG2 1CUCA 2WUEA 3NORA 3KM0A 3ZN2A 4IHJB 3MCUA 1LC3A 1PJLA 1RRVA 3Q2KA 3TIVA 1H94A 5A2GA 2OCKA 5CVVA 1NVVR 2PZJA 4UUMA 5E9JA 3DMTC 4L6AA 3VHLB 3TGLA 2HMSA 4JBWA 1JJIA 1QP0A 3GT4A 4KK3A 4LOHA 1KEEA 1SOMA 5KSZA 1JS1X 2CLSA 2XF2A 3R1IA 2CCKA 4OG2A 3PNOA 1VC2A 4NATA 4BLWA 1C0IA 4XGRA 1OB2A 4ID9A 3H84A 3LTEA 4IVNA 3T1NA 5AM5A 5KS2A 3H1TA 1XVAA 1RWKA 1E6EA 1XD2A 2LCFA 4GKAA 4BNUA 5KC8A 2ZP1A 1E7YA 3EEYA 2GZAA 2O3SA 10MHA 1O5OA 4HLQB 2WY2D 5KNCD 1YQGA 1T1JA 1DT5A 1DTWB 1HWYA 5KVVA 1TTTA 1BVHA 3FSGD 2L0XA 2A86A 2ZJ7A 3B60A 3KPJA 4ND8B 2ZCJA 4J07A 1SC6A 4OKNA 4A4DA 2VHQA 2K4MA 2QBYA 4RZSA 4WPGA 1RYFA 2V6IA 4XXHA 2VJBA 3HNOA 3WDKA 4ZYXA 5EHZA 3HWWA 1Z0DA 1KAEA 4N49A 5JJKA 3L7OA 1N3BA 4Q18A 4GYKA 2JIQA 3CEPB 5DYNA 3ZZNA 1V96A 3FDZA 1YMUA 4ETIA 5B2FA 1M3SA 1BYUA 1FLNA 2ZE6A 3M4ZA 4BJ3A 4R5MA 2WB4A 1KDYA 5BQ3A 3KOMA 3FYHA 2FDCA 2YWHA 4LI3X 2IH5A 2PUJA 8LDHA 2HAEA 4UU1A 5ALPA 1AKWA 1CY4A 2ZEJA 2EEZA 4ZFNA 2C3OA 2PJRA 2A92A 4F5ZA 1Y48E 1R8YA 3VPDA 3SVZA 2O1WA 4JUIA 4OP3A 1E2EA 2WIDA 1E5DA 1T2UA 2I9PA 2ILTA 4DLTA 4URZR 1N5MA 1XXHE 1QK5A 1IEQA 2VJAA 4LMAA 4R1QA 3ZC3A 1C30A 1F0PA 3U44B 4B6OA 3B48A 2HBQA 2HT1A 3M5CA 2V7PA 5EJGA 5K4AA 1OAOC 1ODTC 1IUPA 1SZJG 2FMHA 1XCJA 1E94E 2YIMA 3NYWA 3FSGA 2FDRA 1MLDA 3BA6A 3JVVA 4GPD1 1EP9A 2ODPA 5EZYF 3UATA 4MRSA 4ZJZA 1SXJD 3IMEA 3K9LA 4G2TA 4UM9B 4NYIQ 2JFZA 3BL8A 3VDRA 2DYKA 2WKQA 1K8YB 3D8UA 3R3HA 4ALKA 4NI5A 1E3SA 1BHQ1 3KFVA 3IERA 3MYYA 5JOQA 3RYHA 3IULA 2BH9A 2YMMA 3A1UA 5K3CA 3OCXA 1TE2A 4TKVA 4JDPA 4EB0A 3WIEA 4U2CA 3AF6A 2HB6A 4D25A 1RM4A 2IEYA 2Y1DA 3KC2A 2FFAA 3D0KA 2OG1A 3X2FA 1L7BA 3PRYA 4U39A 1Q14A 2BFCB 1OLXB 2ZPUA 5D7BA 3SKVA 2ISQA 3UHPA 1YDMA 5CLIA 1ZBDA 2EF0A 3FGOA 3MGAA 4H18A 1MXHA 1P19A 2OQIA 4M60A 4QJIA 2WOJA 4PX2A 1N6NA 3G2KA 4TV9F 2VJKA 4URHA 4MMZB 5E2BA 5EIBD 3ZPXA 3L1KA 3H2GA 1PV2A 1YOVA 3ENVA 4M99A 2ZZNA 4H3HB 2I7XA 1HDYA 3L9XA 4EHNA 2ZRNA 2VSOA 3LVBA 2OP1A 4PLVA 3F1KA 1G98A 4XVQA 2UAGA 4MV3A 4H27A 1RCFA 4QGHA 5KYYB 5HP4A 2PLWA 2WSYB 1S89A 4HX5A 2B8TA 1Q2XA 4MTCA 2YFYA 3PR3A 4FJ2A 2PVCA 2BKLA 3BJRA 1HDOA 1PJ4A 2I54A 1FY2A 2B1JA 1SQGA 3VSDA 2ZBFA 3HCDA 2X41A 3ZJVA 3W2EA 3WP0A 1U8YA 5I7EA 4YROA 2X9LA 2XVZA 3RODA 5C34B 4ZYYA 3H16A 2VBGA 2FH5B 4DSZA 1UBJS 2MMGA 1V5IA 3M6XA 2HSGA 3GLIB 1CC1S 3LDGA 1LNSA 3TQQA 2VOEA 1MG0A 1LVGA 4HGOA 4Q3LA 4XFJA 4CLHA 1OB5A 1DC4A 3C2QA 1MB9A 1FP6A 2JA1A 4AP5A 4BFCA 4TLEA 4KODA 3UAOA 1BC5A 1Y9ZA 1YS9A 4B8YA 2DFVA 2ERYA 4U7GA 1GITA 2WMYA 3EA4A 2L18A 4QTXA 2E4UA 2GK7A 2OBFA 2DFKB 4ML3A 1RMTA 3TD9A 3VH2A 5HIKA 2H4YA 1SU8A 2AOUA 2FRDA 4IGAA 4M7OA 4DL9A 1QK4A 1DS6A 4JCOA 3VPHA 3ZQ4A 3H3FA 1MABB 4UMEA 3DEJA 5JCZA 3OWHA 1DV1A 2XDWA 1B41A 4QSMA 4V38A 3CZ9A 2ZQZA 4DIKA 2YTZA 2P9FA 2SCUB 3ROQA 1A9XA 4DIFA 4PTYA 1T36B 1Y3IA 4WJLA 4GBMA 4B3HA 4DLLA 1GPJA 5L9AA 1EVEA 5DHQA 2K7FA 1Z6XA 5JMOA 4NL4H 3I23A 3WB0A 4DHEA 4EP1A 1R5NA 4D4JA 1CJUC 1ZCZA 5DDIP 2F9LA 1POWA 1QVAA 4EYEA 3HMKA 3O8NA 3Q7EA 1UMDB 3ZNNA 5HZHA 4XQ0A 5K3AA 1M0WA 3I6IA 2H1SA 1ZCFA 1BU5A 5CFZA 2IODA 2Z1DA 3ELDA 3M7IA 5DMXA 2O8DA 2PX4A 13PKA 4XLTA 1Q83A 1M1YB 1SM4A 2XA9A 5I9BA 4GE3A 4JLAA 1GNVA 2PRJA 4UDNA 5I7UA 1YKSA 2AUNA 1KFEB 2ODWA 3CM0A 2CMDA 1RW4A 3PS9A 3LY5A 2XIQA 3LSTA 3PVSA 2NTNA 3V4ZA 4IFEA 2G88A 1PGJA 5ADHA 2H4FA 7MDHA 2YIJA 4KEAA 2X0KA 4N6NA 3UJ8A 1LK0A 2C4VA 5FB3A 3PHCA 2BEWB 3ZDBA 4ZO6A 4ZAFA 3IVXA 1LDNA 3DZIA 1D6JA 3FZYA 1T8YA 2WU3A 2I2DA 3REQB 4DJAA 5KQSA 3W2HA 3KTAB 1HQDA 3PKZA 4RD2A 3PRKE 3WLKX 4Q1CA 1E7QA 2BE7A 4HNHA 3KJZA 1T5DX 1NN3A 3IUJA 4M9RA 4S1NA 1ZD1A 2GYWA 4FEAA 1WZNA 4I9GA 4OXIA 3LX8A 3BAZA 5MFZA 1RRGA 1JHVA 4LKOA 1I94B 5A3VA 1U0SY 3GGDA 1MC4A 4OIFA 4V0QA 1HYEA 5LR6A 4B3TB 1TNDA 4D4MA 5B1IA 3FGPA 4CMGA 3GN1A 4JYZA 1LU9A 3IBSA 3OAAA 1HEUA 1USGA 2X5XA 2X5OA 4JVLA 1C5KA 1Z8HA 5DCYA 3FNHA 2OV4A 3ETEA 5H7XA 3MUOA 5J2UB 5A3SA 4BZPA 5HMLA 5BVHB 3AWDA 3ZKWB 5JZMA 3QXXA 4BLRA 1A95A 2GK6A 1C9EA 1OAAA 3E8MA 1M54A 3O91A 4RVUA 2B4KA 3ITDA 4UHEA 5EIWA 3ROEA 4DDVA 5BSGA 2IT1A 1XF9A 2PKYX 2D1YA 4LRWA 4GQBA 1NYRA 4EG5A 2AFRA 3KJQA 1QLWA 5ER9A 4HKTA 4H7DA 2AHOA 2E87A 2FFRA 2RHJA 4LNHA 5CT6A 2FSSA 3M2PA 3WV4A 1VPDA 5CNKA 1P1RA 5JRDS 3HR8A 5ICCA 3KUDA 3C97A 5EQDA 2XVMA 1N0VC 1S8OA 3F3YA 3SE7A 1HPLA 3ZX4A 5A4DA 1UP4A 3CO5A 2V7VA 2OB1A 3DLPX 4TOIA 4D9KA 1Q20A 3ZWDA 1EVZA 4BX3A 1TQHA 3DOIA 3ND5A 4MV6A 4NULA 5EJ2A 2GJ8A 3DYVA 5H3LA 4K7JA 3TSOA 3VV2A 4FHEA 3AI7A 1M2HA 1KI4A 1QH8B 1SBHA 4WIAA 2QU8A 4M87A 4OHOA 2A4KA 5HILA 2CXTA 1HDRA 4EGJA 1JG3A 1J6UA 4O2BA 2J4DA 3C16C 4KIJA 3ILYA 4MDYA 5K4HA 4CODB 2OXEA 1O0CA 4Z51A 1LBHA 4LXHA 1EZZA 3OJXA 2YJ4A 3HY3A 2ZTUA 5CA1A 2E89A 4IJWA 1H9CA 4DR2B 1IUKA 4NZZA 1PT7A 1OFIA 1WPXA 2BGRA 2UZ0A 3LECA 3EIWA 3Q7IA 4KMOA 4NABA 4PNZA 4CQLA 2C2KA 1Q0ZA 4ZK6A 4Z4GA 4TZTA 1V39A 1A5SB 5K8IA 1IN8A 3FKJA 3LC1O 4YJHA 9GPBA 2C97A 1LDYA 2WILA 4MULA 3C1OA 4A6DA 2FPSA 2Y76A 3NTQA 3K53A 4KBYA 3OJWA 4QO8A 4HNRA 1PDVA 2B78A 1PR0A 2ZPAA 3H5VA 3HLTA 3ZHTA 3LWDA 1NBMD 3H4IA 1WETA 1UPCA 1A04A 3JQ7B 3ADPA 5KB3A 1JQ3A 1X8KA 4R05A 2IUSA 1SHLA 2PBRA 1AGYA 1MG5A 2RI0A 2XUJA 1VXOA 2Z2IA 3C1AA 3LXXA 4LFAB 2YNMA 1QTNA 4HS4A 1H22A 4FR5A 4PYOA 1N1GA 3WIBA 1Y8QB 3LKVA 4GDMA 5C5DA 1RM5A 2VN8A 3VO1A 1GUZA 4KWCA 4DSTA 2F7SA 1KNQA 2AOTA 4NICA 5F12A 4G0NA 4XWWA 3DE5X 1W1UA 1G38A 3BMCA 1RKXA 4UKDA 3RIHA 2B6NA 3VM6A 5CFMA 3CKYA 2ZSAA 4HYYA 5DT9A 3TLMA 3T3MB 3UW3A 4PFQA 4CKWB 4TKUA 4RH3A 4YT8A 2G7MC 1OT3A 5G3ZA 1AIPA 2VHUA 2LZ0A 4F2HA 3FYUA 3W5SA 4WZAA 3IDSA 1BHSA 3W7AA 4X3CA 2A3RA 5BQ5A 2ZUUA 4RIEA 2RHDA 1AUXA 4M0UA 1GQRA 1ZGJA 2HQOA 3IP3A 2IWRA 1CJBA 3ICOA 2W2NA 3GVCA 2V7GA 1PW7A 1QSGA 3FNIA 4BLTA 4FYYA 4A6EA 5JIBA 1ZSYA 2RHLA 1SD1A 3ZCTA 4DWVA 5FQOA 3VOAA 2P1DA 1J2RA 2PU5A 3DAYA 3HKDB 2JIRA 4IIJF 3D0QA 2JD2A 1LS6A 1QO9A 1W6RA 3U5ZB 5B37A 4FI3F 4G0WA 4DCTA 5DE3A 1JSRA 3EA0A 4FT2A 2F3SA 3RQIA 2DHRA 3UB4A 3T4EA 4RTNA 3LHIA 4OU4A 5IJWA 3SP1A 5EHXA 5DNCA 1W4RA 2CFTA 1TAGA 4FEYA 2QN7A 1TK2A 3HUTA 5TPWB 1HE3A 1ETHA 1U3CA 3AXSA 3EW7A 3LBYA 4AY3A 4BMCA 5E7QA 2XQKA 2PMDA 2BM9A 2RH4A 3LO5A 4KXNA 2QUBA 2HQSA 4BVHA 1LDMA 5AJTA 7MHTA 4PPFA 1U7DA 4CM9D 4F4IA 2IIBA 4HN9A 3EWNA 4ESVA 1EHIA 5BUSA 5KTKA 5A03A 4Z4FA 1SUPA 1XMSA 3D6NB 4AURA 1F9AA 5HM6A 5JALA 1FUIA 1WG8A 2BI7A 3FH0A 3QPCA 4B4VA 3GPLA 2B7LA 3MUNA 4RC9A 1RRKA 2GRJA 4OYRA 1TPZA 1VBMA 3TOXA 2ZYAA 4QRHA 3SC4A 1ZOPA 1KDZA 2CXXA 2R4UA 2C5GA 2Z08A 5B6JA 1QKJA 2WZCA 2E9SA 4DEYA 2DY1A 2JGKA 3CWZA 2UVPA 1KI1A 2XMPA 3EPRA 2QZ4A 3BT7A 4XH9B 2IIVA 2PX0A 1QGOA 4FDLA 4MMXB 2HIHA 5B3JC 2WMOB 4I08A 4LBYA 3RASA 1DPGA 2B4TO 1G55A 4D9GA 1KQOA 1V4VA 2B82A 3U4HA 1K66A 1E4EB 3VSCA 3I28A 5C35A 5HX7A 2G4VA 3E3LA 2OTCA 2WJWA 1QYCA 3THXA 2F3RA 4C7XA 2DCUA 1G7SA 3QU4A 1TVMA 1RHUA 4GLLA 1DINA 1U9IA 2I2AA 4M8LA 3T94A 4ETWA 1NFFA 5KYTA 1FXWA 5AKYA 3NUQA 4J4BA 1M6VA 4J7CA 4CM9A 2Z6AA 4RF3A 2GESA 1ODSA 3OCCA 2D74A 4BWVA 5K4GA 4PYKA 2IYTA 3NLLA 3PQ6A 4CDNA 4H6WA 3PRHA 2AZDA 2P0EA 3D7MA 3VZCA 3DCNA 1Q0PA 2FVYA 4MAMA 4NZYA 1QORA 3SX2A 3J7AC 3TIIA 1RQGA 1SQ6A 3HC7A 3NWBA 3SHVA 4G1CA 4KH1A 4E07A 1NVFA 1SCDA 4BLPA 4MIYA 4CEJB 4JZKA 3GJQA 1U8AA 2GPBA 5B7NA 4M1OA 1G8SA 5CX1A 2BOVA 3VPBA 1KI6A 2H8GA 3FRIA 4JLKA 3R5KA 3JAMA 1E1YA 1ZP6A 4X60A 2QL6A 2ZJOA 3EISA 5DSTA 3UWSA 3ZW9A 4ZAGA 4H59A 4ZQGA 2A0UA 4ZKEA 1ZZGA 2FZGA 1UT8A 1NJ6A 2BN4A 1PK9A 1C14A 2QMYA 3T3EA 2DKNA 1F0YA 2R6AA 3IHWA 3UG6A 5IJ9A 1H8ED 1EINA 2YFQA 4MP6A 1GLGA 1IHOA 2AF3C 3FPGA 1UXOA 4GU5A 4OGKA 1OX4A 4QWWA 4Y1GA 3RK1A 3S8EA 4U2EA 3WFJA 1T3TA 3UH0A 1ZIOA 1G8GA 1II9A 1ILWA 3FYDA 4LI0A 5IK2D 3IOBA 1JALA 5CLQA 4DBLE 3GFSA 1NKVA 2HQBA 4N5LA 2DRIA 2AJCA 2FW8A 1SZCA 2GUGA 3MJ4A 1QKIA 4NAVA 4J3NA 3EXIB 5K7SA 1JTFA 3ZWKA 2O5RA 1EUDA 3AF2A 2NTEA 4M37A 5EZSA 3S55A 5BY2A 4IWXA 4INJA 3NC4A 1XTIA 4EJMA 2CD9A 2QS9A 1SKBA 3O92A 5E8JA 4KLRA 3IT2A 2EG9A 1QUFA 3NBMA 4WLFA 3WXMA 5JFOA 1HLFA 3CT6A 3ORQA 4B75A 3DM5A 4D9NA 5KOJA 2SKEA 4KVGA 1SCBA 3DT8A 3GGSA 4HH1A 4F7DA 1YQQA 3CWQA 3EIUA 3LPNA 4Q39A 4UFPA 1HSZA 1T0PA 2XLBA 4OLHA 4I1OA 2HPHA 3L93A 1PWEA 4X5OA 1Z2AA 3UMBA 2AG1A 2AX3A 5C5CA 3OOHA 4IIBA 1XCBA 1K7SN 2JGRA 5JATA 4KO8A 3MW8A 3WL4A 2C4TA 4TTPA 2DHDA 4JWTA 4LHWA 1JKJA 4DREA 1R18A 2C8VA 1VZ2A 4MITA 4KQEA 2ZBVA 1QAOA 1HORA 1QH0A 1YZYA 4JBLA 1G0NA 2NYUA 5IK2A 3NQ41 3L02A 2X58A 1C2TA 4NZOA 3S29A 1GZ7A 2Q4RA 4TMKA 1N5IA 2EG5A 3T7CA 3LT4A 1FQOA 1ULAA 3JY6A 4KR9A 2EOAA 4UVDA 3TQOA 3I8OA 1ARZA 3W5HA 3WNDA 2PLNA 4YR7A 1V9CA 1N78A 2JASA 2Y6VA 3DVAB 5FBLB 4BMSA 3TZ6A 5L8VA 4ITVA 1KK0A 3TSCA 3UYLA 4AI6A 4GKKB 2JS7A 5KTRA 4QNMA 1HTWA 1M72A 2OC9A 2WF9A 3L7IA 5JC1A 5GADl 3DGEC 2WSLA 3BXFA 6LDHA 3PJGA 3ETNA 2BHNA 3X1JA 3OQMA 5LLTA 2X8JA 4K2HA 2G63A 2HX1A 2ZOSA 4LJ9A 3JQAD 3OO1A 2CNLA 2I6XA 3VH1A 5JAOA 1TF7A 3NBQA 1AKNA 3N0WA 4BNDB 2ZLBA 1NI4B 4OQDA 1RBZA 3D1VA 3GT3A 3V3TA 3COYA 2GTHA 3K09C 5ALKA 4YREA 4FEGA 3C4VA 3WYEA 3ZY2A 3QVTA 3A3KA 3IHLA 2J6HA 3COJA 2IHBA 4Z1OA 4PGMA 2PE5A 4LDZA 3HN7A 4YALA 2HGSA 2HV8A 2VPPA 2CFOA 1WV0A 2HO5A 5JFTA 1U2PA 4LKRA 4BY9E 1PKEA 1WE2A 4I1RA 4KGXA 5E3IA 1EDBA 1Z13A 1FOEB 3GHYA 4H6VA 3ABOB 3G89A 3LCJA 4MLPA 4YJGB 4BYMA 1BSVA 1WO8A 4BV2A 4EYQA 1UKYA 2OESA 4A2QA 4G85A 3VR5A 4DCCA 3IUQA 1CY8A 3KKOA 4BNZA 3UQZA 1NXQA 2QVYX 1SVUA 2Y4NA 2VT3A 3FSEA 4K6OA 5LP1A 4PYQA 1P1JA 1JIUA 5LA6B 2HRBA 1BU8A 2J9GA 3IIMA 5MF6A 2X3YA 1AF7A 2FJPA 3OHSX 3VR2D 1JDZA 4AMBA 2W71A 3PIIA 4K9RA 4MDHA 3JQAA 1NNUA 1IB6A 2JIZD 1K7XB 1NTOA 5EQFA 3TXXA 2XZOA 1PL8A 2PX6A 3A6ZA 3HB4X 2XD4A 3K0FB 3DMYA 4AMGA 3UMMA 3NYRA 1XD9A 3I39X 4RS3A 4X95A 4M9XA 2FPIA 1R88A 2C4KA 5DLQC 1E5TA 4Q4AB 1BCRB 2VK8A 4V2IA 5JNWA 1UC9A 1K68A 1OILA 2Q0QA 3T38A 5BMVF 2FPOA 2JFOA 2B4RO 4O4JF 3DYIA 3RABA 1SGWA 2I76A 3PTLA 4RF5A 3UTCA 4C3OB 4C6RA 4A8JC 5IN4A 2WF5A 1MRNA 2AVDA 2BI8A 2FLVA 3OZIA 2BFFA 4QXPA 5A0VA 1SKQA 2QAGA 5IFLA 5LP6F 3N2LA 2QTCA 3T1HB 3Q8WA 1FRFS 1TT7A 2WR8A 2YJ5A 4RVFA 3RVJA 4XIJA 5MFPA 4G0MA 1ZR2A 1L3IA 1SC3A 2HYIC 3K7EA 4DT1A 2R8EA 2BUCA 4IXMA 1SB8A 2G5TA 2EP7A 2FCAA 3GVHA 3T7KA 3H19A 3KAQA 3GDOA 3QHQA 4BTVA 4ZOBA 3DBRB 3KOOA 2BKAA 3B7WA 1H1DA 5GINE 4IKEA 1NMYA 3CPEA 4DPLA 1QC5B 2QSZA 3TTUA 3ADDA 5D3MB 3WGOA 2QD4A 1DIBA 1UJBA 3H6GA 3PJEA 4PLFA 4Y6SA 1C80A 3NWEA 2RAUA 3NKFA 4MJXA 1EA5A 1HFWA 1ML4A 2JIZA 2NPOA 3DQZA 3EGOA 2OGWA 1D3AA 2FWIA 3GPDG 4IGFA 4WXRA 2NVWA 2ZKLA 5FNZA 2V03A 3OU6A 1NX9A 3I5UA 5ALTA 3SIXA 4ENVA 2ASEA 2QRMA 3BRWD 3C8MA 2VNKA 4PEVA 4R01A 3V1TC 1B6GA 1G1AA 1U99A 1VE1A 3TIGA 1E64A 4Z4IA 3ELBA 1NW3A 2NU6B 2WMNB 3K73O 1VRCA 1GTVA 3BMOB 3L8DA 3KQYA 5A4MS 1R5JA 4E2YA 1Y8RA 3TZEA 3I42A 1FRNA 3CJRA 4CMEA 5COAA 5E6UA 3ROZA 3MILA 1QCZA 1QPGA 2OAQ1 4YJ3A 1XNJA 4F93B 1H2YA 2ERCA 2FN3A 2NZVG 1A27A 5E6RA 4RX1A 4KQWA 1HRDA 1ZM9A 3NWPA 2GAIA 2L2QA 3D4PA 5LL6P 1PI3A 3STUA 1USIA 3ELWA 4HQFA 3IE0A 3V1NA 4OHKA 3M1AA 4WA7A 2CDAA 2VAXA 3DFUA 3SCZA 4BGEA 3KQQA 4EYSA 1Q1ZA 1JDTA 1OJLA 3FF4A 4AIRA 3HNRA 3AI3A 1B2LA 3Q9UA 4N82A 5DNVA 5AD1A 3I6MA 1OVMA 3BSSA 2H0RA 2FUG1 3A4YA 4MWBA 1ESMA 3CH4B 3SVLA 3O8QB 3MXTA 4Q9JA 1CEQA 1WOYA 3ZK7A 3RBVA 3UOGA 1VIVA 3SYLA 2QMZA 3ILSA 3BRWA 1PR5A 1Y5IA 2P5YA 2V45A 4Y2VA 1JIKA 4ZC1A 3HEAA 3H9BA 2E3JA 1CR2A 1N2JA 2QQFA 4MK4A 3WMEA 1MO3A 3PEFA 1XRMA 4ROSA 3Q15C 5DSXA 2G17A 3I2GA 3VVBA 4ZQEA 2FVXA 1XQYA 2X2EA 3FTDA 4JJGA 1VRVA 4YRIA 1JWLA 4OHUA 4FZ3A 5F3WB 2CLOB 2WAYA 3AR7A 1QONA 3EAGA 3F5DA 4XB2A 2V4ZA 3X0DA 5KPDA 3OTOB 5JYEA 1NF2A 2N1MA 5TXGA 2W11A 4Z2AA 5IEBA 2PA0A 1U6JA 2P9HA 4KO3S 4PM4A 1N57A 1PR3A 2WLTA 3WLFA 1Y1LA 2XDQB 5IDYA 1IAVA 4Y6RA 2ES4A 2GNPA 3GOHA 2Q4OA 4TWAA 4OYHA 4QIHA 4EEXA 1CT9A 1TPYA 2EFGA 2EP8A 3EJ6A 4YP1A 3PC7A 3L6OO 4XZ3A 3SM3A 1ZWLA 4KE7A 2FP4B 2VCHA 2A58A 1XIVA 1Z0UA 1VL8A 1U9JA 4B48A 2JLVA 5EFZA 3OFNA 2H59A 4ZDKA 1ESNA 2YZGA 4M9SA 4BV3A 2VTKA 4YXFA 1KWGA 3IILA 5CW2A 1LTHR 1SUAA 2W2KB 3DULA 4QJ4A 3RS2A 5FI5A 4NZMA 1KHTA 1CS0A 2PUVA 3JWHA 4KSCA 4DB4A 3G8AA 3IOYA 1UODA 1Y3FE 8ATCA 4K2AA 3T52A 1DWQA 2XZDA 1ML3A 3HJUA 4I6JA 4I8DA 3WYCA 4DMUB 2FA9A 4JR1A 3ZW7A 7ABPA 1GFZA 2QTVB 1NZDA 2BDTA 2PNFA 3LYHA 1KORA 3P9SA 5CJJA 4YY3B 1NPDA 1QHFA 2JBWA 5J47A 4FU0A 4F3YA 1C3XA 3PL5A 2BBOA 1Q84A 2V6JA 3ANXA 2B98A 4D0GA 4BQEA 3NRJA 3LGAA 1UZAA 1YOBA 4GFDA 4MQUA 1ZICA 3KOXA 4FYMA 4MUFA 4KN5A 1FUUA 4CCAA 2V9PA 2F55A 2NX2A 3DO5A 4B6RA 3O84A 3FJOA 1UBOS 3OURA 3L07A 3TL3A 2ZT5A 4R9SA 4BBAA 1THTA 5TDHA 1DX9A 5A4AA 2NU9A 1H4QA 2ZSDA 4WFKA 2G7ZA 1RLJA 3TQRA 1VG8A 1D07A 1U0RA 4DSUA 5FTNA 5CG2A 3KQLA 2VLIA 1I1NA 1QHGA 3BDAA 2CSXA 1LPSA 2ZRFA 1XZPA 4KQ9A 4P0QB 3WHPA 1FP7A 1RXUA 3Q40A 3CYFA 4UUNA 3UPDA 4L8LA 3EQZA 2JAXA 5KO2A 3EVNA 2H1HA 4DV2B 2GPTA 1T8UA 1CRPA 1DAOA 1IOWA 3MS4A 5G0VA 5HA5A 3WIUA 1Z8DA 2PKCA 3QVMA 1RPAA 1QX3A 2WDZA 3C5VA 3HZOA 4YMWA 4N8DA 2XE8A 1P81A 1M6HA 5JO9A 1JLRA 4WNAB 5K2OA 1QHXA 1DKPA 4LVCA 4EG4A 2BFCA 4FN4A 1OLXA 1E3IA 2B4YA 2DVMA 5BMOA 2MR6A 5KVCA 2PZAA 5C7LO 4JLNA 2XADA 3WLHA 1JMKC 2HKIA 1G9XA 1GKYA 4Y2GA 2NYVA 1M2WA 1UM9B 2Z4TA 1U8XX 4RE6A 2ZIEA 1E96A 3IPYA 4O4HA 4OK6A 3IQHX 1GG9A 1F1BA 3CVJA 4KIGA 5CLGA 3H0EA 2WE7A 3MFYA 4DWOA 2QVCA 2ZAGA 3FTNA 1DJPA 3ISVA 5E2AA 5FPSA 3Q2OA 4BNLA 1N2CB 1T6NA 5KYYA 1TVEA 3UXYA 3RKRA 2N9UA 3T4PA 1AKYA 5GJCA 2J5QA 4D6PA 4HDQB 4H31A 3QVKA 3R5FA 4Q82A 3WWDA 4RK0A 2HU8A 4YX9A 2AEFA 3MWEA 2B9VA 1DXOA 1U7XA 1ND6A 3KD3A 4PAMA 3WWZA 2IA5A 4OQXA 3SBOA 4US2R 1J49A 3GGJA 1U3UA 2K7ZA 2Z3WA 2QAIA 3EFBA 3QX9A 2WZDA 4PC2A 2BFPA 3K15A 5FBKA 3PTAA 1QQAA 1XVLA 1DO8A 2Y67A 1Y7IA 2C77A 5E9WA 3LAWA 3A1NA 4WKOA 2C4MA 3ZHUA 3N53A 5JYDA 4BL5A 4GI5A 2BTQA 2HHLA 4J0DA 1DDOA 2XGGA 4F60A 3MSXA 3Q12A 5LYJA 1AXEA 4C01A 1D4ZA 4FFLA 4XUCA 3GFRA 4FD3A 4OQZA 1QLHA 4UHFA 2OILA 1D04A 1Q0SA 3H5TA 3OE5A 3U2QA 1ST3A 1YVUA 3T54A 4BHTA 4YJFB 3Q0IA 2GH1A 3LXMA 5BMVB 1MABA 4NJOA 2PTGA 3S0JA 5ADVA 2BM8A 4IDNA 3CQ9A 4I5GA 3UQYS 2A3NA 1ISPA 2A0KA 3HVHA 1L9KA 2ZBQA 3LL7A 3LUKA 2JHAA 2SCUA 4P3XA 4RORA 4DA7A 1PEKE 2QX4A 3LQKA 4HVCA 1R0YA 1MAWA 3L79A 4GMHA 2EFEB 4KL8S 2X77A 4NSNA 4EWLA 4C89A 4FT4A 5EMNA 5DLPA 1XDGA 3DE3X 3QKRB 5BVGB 2B5WA 4ZCRA 4TXLA 4NEQA 1UMDA 2XEDA 1C9NA 1FRQA 3P9ZA 2G82A 2R8PA 3GUUA 1OH5A 4YP9A 4DRZA 3WO1A 3HM2A 1V1MB 3GI1A 4JZYA 3EIQA 1MPXA 2ZJ5A 4MA4A 4DYDA 4DLPA 1XZNA 3QBEA 4ENWA 1M1YA 2QLJA 4Q4JA 3F3MA 4Q48A 3PDWA 2IUUA 3DXXA 3ORYA 4ZP1A 2HU5A 4GT1A 3UWKA 3ZD9A 4R2HA 4E70A 4EJ0A 3KZOA 1JFFA 3OOWA 5JVDB 3S2FA 4RELA 1TGVA 3OJ0A 4CG2A 1F0KA 4HXYA 1BMFD 5B58T 1OZHA 1CUJA 2W2QA 5AVZA 1WKVA 3S6JA 1RABA 2BEWA 3RRYA 4JFRA 4KXUA 4RZ2A 2PO5A 4INAA 4YQZA 2I7DA 4MPDA 4CCYB 2I91A 2E48A 4EVRA 3O8LA 2C94A 3HXLA 1Z07A 3AHHA 3I64A 1UXKA 3O26A 3K0HA 4MGIR 4O4LF 4X85A 4B6QA 5FWDA 1G8JA 3BCSA 3KTAA 1LQUA 4NAUA 2NPFA 4NMXB 3QX8A 4KSYA 1DEKA 2FWNA 3EQ2A 2XGOA 2ZVPX 3AH8A 4HEHA 3K1ZA 4P93A 2I87A 2G5PA 1WAMA 4Q47A 4U2GA 1YL7A 5LOVB 2D62A 3HDGA 5JG7A 1TIPA 1B23P 4PO8A 4DR1B 3KKNA 4B7XA 4RFSB 4QYIB 3KOZA 5FFMA 2EBUA 2ZSJA 2H9IA 2QRUA 3CW2A 1G21A 2BVNA 2VT2A 1ISGA 3VR3D 1WD5A 3IAS6 4GMDA 4CV2A 2GZ2A 1GZ5A 3FWPA 1V43A 2JAUA 3HSKA 4KAAA 4IM7A 2J09A 4MW0A 4OEHA 1JE0A 2L42A 4DFDA 1R50A 1DNPA 2P2DA 3GZ4A 3WKAA 1WY7A 4RTKA 1QIMA 4BQPA 2C07A 1C8VB 1DWPA 2XE7A 4FJ0A 4L8YA 4D46A 1KZ7B 1M8FA 2OT3B 3CONA 3IVGA 4RAQA 3VTAA 4A8PA 5K3SA 4O5OA 2JBAB 5J2UA 1KJ9A 3ZKWA 3CW9A 3EODA 3K92A 1FEZA 1AS3A 4X00A 2GWRA 1S8NA 2QMEA 4OB6A 1YONA 2WG0A 4NU8X 4TXMA 2O0LA 3OD1A 3ER6A 3JQ6A 4IPTA 3D3QA 2VJYA 4NARA 3RYCA 2HD4A 1QXSA 3W5UA 2XOEA 1YHYA 2VPYA 3DW1X 5K0TA 2FTKE 3WRYC 1ISIA 3BCUA 2CE2X 1P1CA 1LF0A 4YDRA 5KTNA 5BQOA 3ZQ6A 3FSJX 2CUNA 2YRWA 3EDYA 4ND5A 4QHSA 4QOSA 1JKMA 4UBNA 5GIPE 3KPYA 1YKGA 2B5OA 4KNWA 4L3WA 5CM8B 5DISB 1EDEA 4KB5A 3VR3A 2PU7A 4LQCA 3VSAA 4EVSA 1CIPA 4TZ0A 4XUEA 4K9DA 4UQLA 1MH1A 2B83A 1NFRA 1PFWA 3D0RA 5BW4A 3L49A 3ZS9A 2EARA 2GGSA 3N6XA 1U1DA 2PL5A 2Z8YA 1QH8A 3JYLA 1E9DA 3HLYA 1CQJB 2VVTA 1UKBA 3KSRA 3PHBE 1ZN8A 4PQFA 2AH5A 4UCWA 5TX7A 2HJSA 1FTYA 1Z4JA 1W1WA 1ZK4A 3LX4A 3P7MA 1EFRD 4H0CA 4OL0A 4C5AA 2CXQA 1DBVO 4L0CA 3UW1A 1MO2A 1QLJA 1T9AA 1VA4A 1YA4A 3QE2A 2R7MA 2XNKA 4TT3D 2ZANA 3IJPA 1G2OA 1NA5A 3WQRA 4KXWA 2BEKA 1D7OA 3DEKA 4JKOA 5F3RA 2BI4A 4MOWA 1XUOA 4WTOA 1HKHA 1I6LA 5KDDA 5ILGA 1K6EA 3O8BA 3T7RA 3URKA 3WWPA 1SG9A 4B46A 1FBNA 1HLPA 2M32A 1KQFA 3RTEA 4D42A 1IY1A 2JK0A 3QPBA 5E95A 2VDJA 3OZFA 2BKXA 3I8XA 3V34A 3JQ7A 3TPCA 3RBZA 3T7EA 5CDTA 5IABA 1Z28A 4I2VA 4IIYA 2Q9CA 1C8LA 4EFLA 1Y6FA 2F9MA 1U9CA 1UDAA 3KLPX 4NMLA 5EZYA 3FIUA 4F2GA 4ZVRA 3LFTA 4MGZR 5KCMA 1D2RA 3CCCA 4RU1A 3KXDA 2ZIFA 4MYSA 2GZSA 4EMUA 1E3WB 5E1BA 5LNK6 5K3FB 3I2HA 3I58A 4FYIA 3GLFA 4Q03A 4B6PA 2HK9A 4WI1A 3E03A 1GZHB 4YAFA 4UTNA 1P2BA 1KEWA 3CG0A 3O3MB 4FONA 1KJQA 1M73E 2BSAA 3DMDA 3EFHA 5TQ0B 5FO1A 1DG1G 1J1IA 1H2RS 4J0QA 5IHXA 1SJ9A 5TMDA 1Q5PA 3N8HA 3PCXA 4HZUB 4TT3A 2Y05A 3VU8A 1X1QA 2OSVA 3DDSA 1Q7GA 1PE0A 4RAOA 4Z9YA 4ZKDA 1A2QA 1YRLA 4G9EA 4CKWA 4Z53A 5LZ7A 3L7KA 2R1UA 4JT4A 1E1NA 5G2OA 3R3YA 3SSNA 4DLSA 5K3OA 5DLYA 3USZA 1KR2A 3NZEA 4TMFA 4TV9A 5J40A 3WGGA 1Z06A 5TE9A 2C04A 1XTBA 1ONSA 1PJBA 1U0FA 2Y1GA 2HNAA 1OH8A 3G02A 4UBKA 5BOSB 2YWDA 4DOMA 4I50F 1NLUA 4N40A 4Q4HA 1N5JA 1A96A 3VV3A 4ARAA 4TROA 1TCUA 2ROQA 4ZQIA 2ZUWA 4GOOD 5DHSA 4JXZA 3WLLA 5KQMA 1HE5A 5BUQA 1R6VA 1BKSB 3ACCA 2YV5A 4AP6A 1O3YA 4MS4A 4QPNA 3GEIA 1G66A 1SEVA 1DPFA 4GM0A 4K8RB 4EELA 1GN9A 2GYUA 4PBSA 4AO6A 1Z16A 4EFMA 1A98A 4UEJA 4J1TC 1GPUA 1POXA 2ZRPA 2P1RA 2PYZA 1S6YA 1ZHOA 4BRWA 3FPSA 1F8GA 1U1EA 2YMLA 2AJBA 1ZH2A 3AM5A 3JZAA 3PDIB 4MZXA 4TRMA 3S28A 3VAAA 5B3KA 4LGYA 1TAUA 1JDPA 3GLGE 1YQWA 4X7MA 3PXCX 3EUWA 2VQ6A 5TPWA 1N92A 4BNWA 2X7JA 4ZK2A 3IMFA 2B1QA 2HEGA 5KQRA 3R6DA 3UFXB 2CL6X 2G9VA 2YVUA 2BEVA 3EJWA 1SBNE 4IUBS 4LYJA 1YWGO 2NZJA 5FFNA 2XAUA 2B94A 3GHHA 4TS4A 1UR5A 2SKCA 5L3RA 1G6HA 4QDUA 4TSFD 2QP9X 3ZDRA 1O6FA 3DUFA 1Y1RA 5HKBA 4PO1A 1QZZA 2G07A 4V3CA 1UBFA 2J45A 1RQ7A 2P6NA 4DKXA 4UBIA 2ZBRA 3SQMA 2HSWA 3ZCSA 4ZOLF 1RXWA 3TF5A 5IVPA 1HKUA 2O3JA 5AHKA 2HA0A 1RYEA 4RMJA 2GSWA 2O1XA 1GAXA 1CG6A 1X14A 3PEVA 1U28C 2W6JD 5FA8A 1VYHA 4XWTA 5DVZA 3PXAA 3RGGA 4N39A 2D7JA 3RRFA 4DIEA 1N5KA 2WWIA 1WQ4A 4ZZ1A 1K97A 1VE7A 2QPLA 1HY3A 2OCYC 1C7ZA 2WKSA 4BWFB 4YMGA 1E99A 3GWZA 4KR2A 4DDKA 4WGFA 4LRYA 1D1TA 1RHRA 5K5EA 2WP8J 1ZVJA 3GEEA 4WEOA 1CJKC 3KHSA 3HHPA 1CUZA 3W2IA 5D5PA 4W5JA 2ZS7A 4XM2A 4IX1A 3MLBA 3AJ8A 4B32A 4UVHA 1FXSA 2YS7A 3H97A 3PFIA 1TTQB 1Z6YA 1C0KA 1SVWA 3DP9A 3R20A 4XGQA 1Y3DE 2BJVA 1HDZA 1KZ4A 2BELA 2IV2X 1Z4OA 1B0AA 2FCRA 2OCAA 4TWIA 5K2MA 3UJAA 3RADC 3S2UA 4Q9KA 5TT0A 1W34A 2MSKA 1A1VA 4G0UA 2ZPTX 3G2NA 3A4NA 4YO7A 3CUYA 1UBNA 4ZGWA 3CH5A 5JAZA 1GG2A 4B7UA 2JGJA 1KDPA 2XTMA 4KQXA 3A04A 3BWMA 3CIFA 4HN4B 3X44A 1RM0A 2WKRA 5JCOA 5AKXA 5BQFA 1JXOA 4UUAA 4MUYA 1EWRA 2IRWA 2C5LA 2WP0A 4M49A 4H15A 4OTZA 2F1OA 1GKIA 5HBRA 5DBGA 5JY6A 5FOQA 4M1MA 2PO7A 4K6KA 4DG5A 3DSRA 1VTKA 2OAEA 1GTG1 2Z58A 1KE2A 2VK1A 1GPMA 1L5GB 2HCTA 1CR1A 4Z3OA 1P74A 4NK5A 5ALLA 3CRZA 5KYWA 3BFJA 2PMCA 4XGKA 3GU3A 1KS2A 4ZDJA 3H5NA 1MOSA 3IJ5A 2E1RA 2RKBA 1D2AA 3ADOA 3EDMA 3GMTA 3MCWA 5L4SA 1SOUA 3O4GA 5JJIA 5AVRA 3BH6A 1DBPA 1F06A 1YCFA 4UAVA 1CBUA 3GRAA 4YRLA 1M33A 2PSEA 3EXIA 2XSZA 3T1TA 3QF7A 2EKBA 3KKQA 3TFWA 3G1UA 3HR4A 1RWWA 4NIMA 4EMBA 2PEZA 4C4AA 3INRA 4FD2A 2QX7A 3LZDA 1KYXA 2YVKA 4RH0A 4I1IA 2OYCA 3EMDA 3BL5A 4MVJP 1CB7A 4OHXA 4EABA 1KQ3A 3E7XA 3QOFA 2JZCA 4HGNA 2R25B 2YV3A 4HAVA 1XLUA 2QSUA 2J85A 3WAGA 4S1TA 4JN6B 1PJCA 1BX0A 3I0NA 1HL7A 1LBSA 2Q0XA 4KVZA 1J21A 4K9OA 1GAEO 2NU7B 3OC6A 3ESZA 4Y6OA 5I8PA 3WLMA 1ODFA 2G71A 1L4YA 3EZNA 2LKDA 1V7ZA 3KX2A 1AHPA 2JW5A 1IG3A 2OV1A 3HZZA 2JLRA 4J7UA 4M0FA 4JS0A 2O5EA 5C3UA 5IAKA 1KH3A 3CEAA 3FPJA 4X9XA 1OJ7A 1BMDA 3E9EA 4KGZA 3RC3A 2G1PA 4GOKA 3V80A 3D31A 2ZE5A 1X7XB 4EGAA 4Z9XA 1J25A 3QNWA 5ALDA 5GVRA 2Q3CA 2WPDA 5EKUA 1GL3A 2HK7A 5AUQA 3RVPA 2CUTA 3LBIA 4KO2S 4IIDA 1I6KA 4M89A 4ICIA 2ZBEA 3NHFA 2ONCA 1EGVB 4QTUB 4XQ9A 4F38A 2MIIA 1IY9A 3HVJA 4UFOA 1YVRA 2XQIA 1FXUA 4I9HA 4K9QA 3JSAA 3I53A 2HUPA 1IC6A 4DARA 1XZCA 1DZ3A 2CZQA 4J0EA 2HMVA 4EB3A 4IDPA 2DBZA 1PYGA 1TCCA 3RW9A 1OX6A 5K20A 1YZ3A 3E5RA 4PTLA 3AR9A 2NIPA 4PPGA 4QLOA 5K6TA 1KU0A 2GEUA 1LNZA 1RI4A 2B4AA 1FMJA 3GLSA 4LXXA 3U7IA 4NECA 2A33A 3QX7A 1JT2A 1T9HA 5EJFA 2WJ3A 1E0DA 2HQ1A 3LI2A 4G63A 5PNTA 1MQAA 5JRZA 3EC7A 2Q07A 4TL6A 3ND8A 2SNIE 4AMVA 3FPFA 4JT9A 5FULA 1I0LA 1V5FA 3GYGA 2MDTA 3Q72A 4JJ7A 2HL6A 3JD3A 1IL0A 3K72B 1NV9A 4IJQA 5ELXA 1T9CA 2N42A 3MOIA 2Q9AA 1AU9A 1A7UA 1E2IA 2O7RA 3I12A 1EKXA 4URUR 5D5QA 5TQVA 5I3CA 4HXEB 5SZKB 1H5UA 1JU4A 5EP2A 1MQSA 1U7UA 3II6X 4JBIA 4L4RA 3UJHA 4TXNA 3VPAA 1QQBA 3HY4A 5LA6A 1TYAE 1HL3A 1SXHA 3WE7A 4DDHA 1C9DB 1WDTA 2PXCA 2B1IA 3CVOA 2D06A 4I50B 5D1HA 4F4FA 3SQDA 4A03A 1T1IA 5IDWA 5FTJA 2IEDA 4HB3A 2PUDA 4G6ZA 2EFCB 1CUYA 3K0FA 3ROFA 1V9LA 3P0RA 4FYPA 3IUNA 2ZIVB 1SCUA 1E4VA 3NDRA 4Q4AA 1W94A 1SQ0A 2CZGA 4IIJA 1L8OA 4QU8A 3NU1A 2OK7A 5HXAA 4DB2A 1OFHA 2VPWA 4J16A 1T2DA 3OKAA 4DNXA 4R9VA 4AKEA 1JQBA 5IT9A 1V8OA 1WKBA 2AJTA 1APBA 2QI9C 4XCVA 4AD8A 4N7RA 1GPAA 2YWCA 1EYZA 1Z75A 2VZEA 5EEGA 3NAQA 3SVTA 2CD7A 3K71B 1JR3E 2QNBA 5C8YF 2X3UA 1WZIA 4AKHA 3OCVA 2IYAA 4PF1A 1YNOA 2HTFA 1PFUA 1NYQA 2VYNA 1W88B 2NYAA 3LP8A 5EE1A 1GGFA 2P1ZA 1I6MA 1R1DA 1VMDA 3BORA 3KPVA 3MVEA 4GD3Q 2Z1MA 2EFDB 1WABA 2IHTA 4MGHA 3I2JA 4UOEA 1G3MA 4LF9B 3A1EA 3OPNA 5D3MA 5KYVA 4ADSG 1G8YA 4YTEA 4BFVA 3W1EA 2CDNA 1E2UA 4NU5A 4J1SA 5DTJA 4F5EA 1O94D 1FW8A 1PD1A 4FILA 1JB1A 3JWEA 5KZMB 1B16A 3NTUA 2WHXA 4WNCA 1WXGA 4IOMA 3H18A 3ND7A 3QU5A 1FPMA 1RP7A 3ND6A 3FCYA 4FGWA 1DXQA 5IULC 3A6PC 2JI6A 3ZY4A 2NU6A 4UOQA 5HS6A 3OESA 3BZBA 1NXXA 3BSWA 4K40A 1VGRA 2QTNA 1NU8A 2FNAA 1RAEA 2Q6IA 2HSDA 4E88A 2QPOA 1XL0A 2QTLA 4BGUA 2FYTA 1XT6A 1TECE 4BJ6A 1QG6A 4MNTA 3F3KA 2OUKA 2B1RA 1IWBB 2VXYA 2BM1A 4G07A 1I32A 2Q5JA 3ABQB 2W70A 4WLOA 1PEAA 3IIJA 1XEFA 4P9NA 1ABBA 4JVOA 3KJNA 2BHTA 4R16A 2XB2A 5JADA 3WJ2A 4REQA 3KB2A 1P0IA 2CEAA 4F92B 5M29A 3CBQA 4WN9A 3L1JA 3MSCA 3NASA 4UE3S 5EXSA 3O8RA 3B9RA 3PNBA 1ZKDA 4WZBA 2P9CA 1O94A 2VG8A 2W2XA 1XJ0A 1A76A 2WU8A 3WLSA 3ZDZB 4DJ5X 4MAAA 1G2QA 3IGFA 3PENA 4R0VA 3USES 3UXHA 4PIPA 3JQ8A 4B8WA 4QWMA 3I6BA 1T8PA 3L7NA 2G0NA 1ISMA 2W83A 3KZXA 1KI3A 1T26A 4U2BA 4EF4A 3AGPA 1E9RA 4DA9A 3K2EA 5GGYA 5IPFA 3D4LA 3DOFA 2XYVA 1UAGA 4Z4CA 1G4UR 5LZ8A 1XXHB 1CQIB 4Q3BA 2QEQA 3I76A 3VI3B 1BX3A 4MQBA 1ZMXA 1XFDA 2JGIA 2OHIA 3OICA 1XQXA 4OMCA 5T4EA 5B7QA 2GHTA 1L5OA 1H9BA 2IE0A 2WHPB 3BHMA 3TTXA 2G8NA 5B1DA 1P0MA 1PDOA 2Y66A 1YB7A 3SGLA 1LC0A 2CHQA 1J0EA 2JARA 2PEYA 3FTQA 2OGZA 4PSDA 4US0R 3GJ4A 1E1DA 2ZDQA 1B1AA 2FUG6 2JJ1D 3SOZA 2R96A 4ARCA 2Z0MA 2FR8C 1P9LA 4GRIA 3V1MA 2D59A 3WKEA 4PZDA 1SIWA 4YXWA 1V1RA 3U48A 1GSOA 2WWRA 2D2IA 3H05A 5LU9A 3CZAA 3M6VA 2R751 3BEDA 2KMLA 3D6JA 3IBCA 2ZE8A 3CRQA 2W2KA 4OGLA 3HJTA 1GNPA 1Z4KA 4QJBA 5JAPA 2RB4A 4HWPA 3PDJA 1PTKA 1WF3A 1DLIA 3AUYA 3D8NA 3V4PB 3ZLJA 2JH3A 2Z8ZA 4ALLA 1PQ4A 3DMFA 4FBGA 4ZT4A 4X63A 1OBOA 2HMTA 2PY6A 1JLHA 1SHTX 3H65A 3MT9A 4TTSA 1LDEA 1N8KA 3R0VA 4LVOA 4XVCA 2XW6A 1GU0A 3W2GA 1N3IA 2YOGA 5EUQB 4DQ0A 3S4YA 1F4LA 3GVXA 1UQUA 3KZCA 4KN6A 1A2BA 2Y0BA 3L3BA 4A6XA 2GMWA 1PG0A 2RGBA 5CVUA 3I6ZA 1NUSA 5EJ9A 1D4FA 2MSDB 2JATA 4G0PA 5BSKA 2Q1SA 1K92A 4QU5A 3OZVA 3CB2A 2PRYA 5FWXB 3A3YA 3KWMA 4B84A 2JJ1A 1P61B 4R9UC 6REQA 1BA2A 5LQJA 1WXDA 2PIAA 2IXTA 2ZRKA 1FJXA 2O2EA 2Z98A 4S24A 2QE6A 3V9PA 2P6MA 4MVCA 1H3NA 3ZWAA 3IKVA 1WHTA 3HYCA 3A6JA 2O8FB 3MRSA 2Y71A 3CNBA 1U0NA 1U3VA 3L7MA 5TS3A 1IDN1 1RP1A 1VG0B 3DZCA 2Z6QA 1KOFA 3O74A 4Q02A 3ZWYA 1W4LA 2VPIA 4X7RA 4GW3A 3A25A 3KB6A 4K9SA 1HQCA 1CDDA 4X97A 1CDZA 1G6Q1 3LVFO 5E38A 3TW8A 4Z54A 5HRAA 3KQMA 4Z99A 2B7BA 3BB1A 2DR0A 3GLKA 3QE9Y 5KWVA 2CLMB 5HJEA 1CUIA 3ASZA 4N03A 4LJYA 4X54A 5P21A 2JIOA 1JA9A 3PXEA 3PUVA 1JT9A 1AV6A 3D2BA 2C57A 3QOWA 4JDUA 4P4SB 3T0GA 1ZWKA 4N7BA 2UUAB 2DH6A 3DE6X 3O8DA 4ZCIA 3VKGA 4I19A 4IFIA 2VR1A 4X1IB 4ZJPA 1N2CA 1SXJC 1GG8A 3IELA 2ZIGA 2ZYHA 1ESCA 1P0FA 1YIDA 2D2EA 2Q1TA 3ZK9A 3CX7A 2JI9A 1K5HA 2EHJA 4BWGA 3OX3A 3N39C 3CVWA 1ZGCA 2D2VA 3KQWA 3CX4A 1WB4A 3IBFA 4H35A 5C4IA 1BVRA 3QEBZ 4HN2A 1N2XA 2B8NA 4LZAA 4FHGA 5JQGF 1YU6A 4B3CA 2XTZA 4KLNA 3OPQA 4RIFA 1CB0A 3QW2A 2OFWA 2HWWA 2WIJA 1MMFB 4Y0VA 2WRZA 1MH9A 3FYTA 1AS2A 3SC2B 3WGUA 3BCHA 5EIBC 4QPCA 4YRCA 2PPLA 2X23A 5C81A 4JI2B 4EPYA 2I6GA 1ZM4A 2VYQA 4UTRA 1KC3A 5A4JA 4S2UA 2W90A 1CFJA 5E2IA 3EGWA 4X1KA 4EHAA 5ECWA 2JCSA 3HXPA 4POAA 2BC9A 3IAXA 2BY4A 3GCZA 4GMGA 3TH5A 3EDOA 4KDRA 1KF0A 5HQ3B 5JPDA 2OGSA 3TG2A 3I4CA 4FGZA 3R9WA 4YJFA 5BMVA 4O4JA 1X9HA 2ZB8A 1RBYA 3UMRA 4YCDA 3RJ9A 1R8SA 1Y3CE 1RU3A 3C8ZA 4WWHA 1U2QA 1NI3A 3ZQKA 1CRZA 1BMQA 1L4NA 3BHJA 1R74A 3DD1A 2OQVA 1I7LA 3BKXA 3UUWA 4IH9A 1PX2A 3FNBA 5BYAA 5LP6A 2OGTA 4R9NA 3UEOA 1G3RA 3ABZA 2OBYA 3TAXA 2DB3A 2FPXA 1OF1A 4XOUA 1K9VF 5DTQA 3JS5A 3QUBA 1Y7HA 3PDUA 3AY6A 4L28A 8GPBA 2Q9BA 1N6OA 1V1MA 4PGHA 2WSMA 3CJQA 1FBTA 1KKLA 4N48A 3ON5A 4S05A 4LMBA 4OA8A 2VNSA 5BN3B 2VNJA 1H6CA 1J5XA 1BXRA 1ZQ1A 3IAEA 3L0IB 3JYHA 1ZLXA 1UWCA 1GRNA 1FFWA 2H00A 2GYVA 3OJOA 3PPYA 4JH0A 1WB5A 5JVDA 3GELA 1BDMA 1FE8A 4IQFA 4Y2JA 2G5GX 2LXNA 3OUZA 2BMEA 4FR0A 3D7LA 1AHNA 3A58B 1QO7A 2JRLA 4M1ZA 3NNSA 5ALGA 5I9TA 1QJCA 1REQA 2FMKA 3E3OA 2W0MA 5D8DA 4CCYA 5LJLA 2HGZA 1GDTA 4IDQA 4PBTA 4OSPA 3OQOA 3QMPA 4Q1DA 3H8JA 3QOXA 4QQ8A 3BMNB 4V02A 5EOVA 4BKRA 1NNI1 1FDVA 2TYSB 1L7DA 1LCIA 1YZLA 4YNBA 1TQ2A 2DU8A 2X8BA 3LJKA 1YJ5A 2BR4A 4UPVA 4L51A 4IGKA 2HXSA 4R2WA 1RAIA 1X8LA 1Z39A 2O0MA 4QYIA 1KQPA 1JE1A 3NJ8A 1Q1BA 4RFSA 1V26A 4L7QA 4L7VA 3PFHA 2H9YA 3NHKA 3OOYA 4Q24A 5DCLA 4B0OA 4CPDA 3QLJA 3QK7A 4PTZA 1WU7A 2P4QA 2IGTA 3LQ4A 2VTDA 1WUKS 1QIIA 3A1CA 3ADKA 1ZR4A 2O7SA 3H9UA 4HWGA 1WMBA 1TYCA 1ETUA 2B36A 2D5LA 2CHGA 2FQYA 2JBAA 4PHHA 2PGLA 3SBEA 5GZ1A 1O7JA 1NU6A 5DNWA 3UTDA 1K3UB 1R6DA 4EDFA 2GEBA 1RHQA 1QIJA 1JAYA 1NUTA 3Q0TA 1DDIA 1ZHFA 5FBQB 5TPZD 1ONOA 4AN4A 1VJTA 2ALJA 1CY2A 2WFZA 5H68A 3OTGA 2D4AA 1RI3A 3HABA 4BQNA 1J99A 4QVGA 2VOJA 3FVRA 4ZXFA 2CMFA 2DTXA 3BMQB 3ONFA 2FG7C 3AUUA 3FWHA 1GCOA 1L7QA 3O3CA 1S2NA 1W93A 2WZQA 4DPKA 1RS0A 1L7MA 1FX0B 1XRPA 2BL4A 2F90A 4KHZA 3FJYA 5FA6A 1BMTA 3ZZTA 5CEFA 2YMQA 2GD1O 4TUYF 2AZTA 2XH8A 3H2IA 3R44A 3L18A 1WIWA 1WVIA 3RTCA 3TLEA 1SCKA 1B0UA 5J5VA 4WY8A 5EL0A 4GXRA 2JLBA 3TDKA 4CNQA 2FX3A 3A11A 3VC1A 3P2MA 4M21A 1ADFA 2LRHA 2IU0A 1X42A 2IKQA 1Y80A 4U9IS 1Q16A 4DLKA 3TQHA 1CQJA 3EQ8A 1W5SA 4DR4B 3LX6A 3M0EA 3TVYA 1QFJA 2YY5A 4M8KA 1LJUA 1SC4A 2XYQA 1E6KA 2GAFA 2HF2A 2HJRA 4W7IA 3G9ZA 4AJNA 4YCMA 3CRW1 2OO3A 3K9NA 4FFOA 4FGUA 2C9OA 3NDJA 4TWJA 1Q7BA 3MTJA 5TPZA 3PLRA 1NXSA 4QDZA 1XA3A 1Y3AA 4JGIA 3NWOA 4NHOA 1RPNA 1P2SA 4JQYA 3ITNA 3ET5A 3UV3A 1AJEA 2PX3A 4GBGA 4NAHA 1Z22A 4OHFA 3JZDA 3OU7A 4UPDA 4HGPA 5BN1A 1N32B 4RJIA 5JUWA 2O8CB 1PIWA 3IPAA 1I7PA 3UWMA 3NG1A 2FF5A 1K89A 3X1MA 5B1SA 4ZAXA 1P39A 1H66A 5CIWA 4XASA 1D9ZA 1Z35A 1WPQA 2PR7A 2RBGA 4DKJA 1Y1PA 3GG2A 3EAFA 3MJCA 5IBRA 5AIAA 3CUTA 5EHQA 3AOEC 1T1EA 2W6ZA 2Y3IA 5ALRA 2EZ8A 4JOQA 4TYMA 1VL0A 1W5FA 3NTRA 1E3WA 3COPA 3OTWA 1XVUA 2HN9A 5IVIA 5K3FA 5CIYA 1EHCA 3DBIA 3D3JA 3ILVA 2W2LA 1Y37A 3B6ZA 2HDNB 5K8VA 3ZWVA 5HZGA 3TB4A 2H48A 3ESBA 1Z3CA 3LPAA 1IUOA 3SHOA 1TT5A 5DXAA 3B70A 2WHEA 2CJFA 1IZ0A 4NV1A 5IW8A 4CCSA 4ZMBA 5I45A 4NPHA 1UXIA 4HO1X 4HZUA 4RJKA 3G79A 1U7PA 4KGDA 2DKFA 3EDCA 4L16A 4L15A 2FUCA 1AKQA 1ZD2P 1V11B 3JQEA 5FHRA 4UZSA 4D3YA 2EBFX 2ZRJA 4YK7A 1K6JA 5LC1A 1WUJS 2TSYB 4S1OA 4CDMA 4EL0A 4UOZA 4A36A 3ZNQA 2I6SA 2VHCA 1COZA 3JSXA 2PT9A 2V3CC 1R0CA 3FWNA 1OHHA 2HLNA 3SR4A 4EVQA 4RVSA 4UTVA 4ZYTA 3AL0C 4HR7A 2WD9A 4YRGA 3NFRA 2H65A 4UTZA 1RI5A 3PUZA 3E6AA 2A6PA 2O4CA 1EJ6A 1IZ7A 1H9AA 1MW9X 1P44A 1E8NA 2C7GA 5D3KA 4DQKA 3GP8A 2BV3A 3H4MA 5JJLA 1E32A 4FWBA 3HFJA 2Q62A 2XB6A 4JLPA 4PC6A 4AP9A 1P17A 1Q7CA 4BNFA 3N0TA 4QFDA 3OE4A 5EJ7A 2J48A 4CBVA 4RIHA 3IMGA 5ITSA 3G2JA 5TEWA 1F8UA 1PLKA 2OZLB 4HFRA 4HGRA 3P19A 3OKCA 4XB1A 4R2KA 5BRNA 1C1XA 3UCXA 3WDSA 4BZWA 4MWTA 1GU7A 2B2NA 5BV0A 2QRJA 2CXNA 5JQGB 1KPGA 1UBSB 2GBLC 3OT5A 1T5SA 4WXHA 3TQIA 1PJSA 4MQLA 3GLQA 4QUBA 3I5AA 2W4MA 4DVGA 3PDIA 1TUIA 1JQAA 3W2TA 2WC1A 2OYRA 3DC7A 1LSUA 4Z7QB 4HDMB 3ZHBA 1P9NA 2E4YA 4MS3A 4GC5A 1FK8A 2QTTA 3I62A 5B1YA 4V0MA 1UFVA 3C7TA 3S1LA 4HEA1 3NHYA 2GN4A 2EYQA 2JFGA 3KXLA 1PZHA 4NENA 3CUUA 5EHGA 4YAIA 2AI3A 4WVFA 4F4UA 5CDSA 1DC3A 3PYLA 5JS7A 5ALFA 3ZWNA 3H75A 3C3XA 4E5UA 3EBOA 1G7RA 1KGDA 1ENZA 4HWTA 1JHMA 2CJYA 2JZOA 1INLA 4GL4A 5D6NA 3WNVA 2K6GA 3QFSA 3CE6A 3GUCA 2AOWA 4WK4B 2XGSA 3HGMA 1N8NA 2SHKA 5EE3A 1PUXA 4OFWA 3WK6A 4LRXA 3S68A 1OMOA 2J5KA 1WTAA 2PH3A 2AV6A 1PHRA 1M2OB 1YGPA 2RKWA 4HLUC 2FQQA 4II3A 4MQ4A 2FK8A 4Q5IA 2QLMA 2ZYDA 3L0YA 3VHRA 4F21A 1TJ5A 1PTJA 2VIIA 4KXMA 3Q85A 4BGDA 1ZRNA 2C31A 1GT6A 1WJGA 2GCEA 2GD0A 2I3BA 2XBLA 3OJEA 2ZUEA 4PLYA 3TMYA 2DMRA 4IDAA 4F2DA 3MJEA 5CCEA 2BONA 4G5OA 4BNXA 2IJGX 4EKNB 1JSZA 5DNYB 1T2NA 2PV7A 1GL6A 4G89A 1LVUA 4GOLD 1PSWA 1IZ8A 4HC4A 1XEWX 1R0BA 3Q8XB 4MW5A 4CEIB 3B3JA 1OREA 1Q44A 1UEIA 2GX6A 3O6VA 3SFZA 3KLOA 1VJDA 3BILA 3MTIA 4J3JA 2ESRA 2QD1A 4DCGA 4D26A 3OLCX 1AK9A 1OSNA 1QFSA 3FUVA 1BE8A 4BLUA 1VIYA 4WA8A 2XV1A 4AF8A 4KREA 4RGVA 5E1OA 1N7GA 1XTJA 2X14A 4HNSA 2AFIE 4LNUB 4V0NA 4J4HA 3OQIB 5U4QA 4YRSA 1KU6A 3TOSA 2WABA 3KV3O 4O4LA 1DQYA 5GTDA 3R74A 3C7DB 1JI3A 3EDRA 1U2TA 2OPBA 1UBGA 3GXOA 3PC4A 1DE0A 3QLTA 4RABA 4AKTA 3TYXA 2GN6A 1D0VA 1TTPB 2QL5A 1N2HA 4TL7A 1Y8ZA 1CF2O 3OM0A 4U7TB 1OLOA 1KDVA 1OWMA 5DI3A 1T43A 1G2IA 2VI5A 2ZREA 4QFMA 2WWYA 1G20E 4KLCA 2WTBA 3K6RA 2PD6A 4OXXA 2AN1A 4EGFA 5K0GA 2Q5IA 5EESA 2AEJA 4UTOA 3SEZA 1R9MA 1V41E 1KMMA 3Q9SA 3I2IA 3ZBUA 5EERA 1U1FA 3ELUA 3SDBA 3THWB 5HW0A 3DMTA 5A6VA 4MKZA 2D3WA 5AW4A 4Z4EA 4MP3A 1JQDA 1X2BA 4CR7A 1KDOA 3AF0A 3L0SA 3WGQA 1GTSA 2H7XA 1R8XA 3OQVA 2B34A 4JKIA 5HUQA 3LFHA 1D5WA 1XZJA 2JLCA 3Q98A 5CPBA 1KSGA 1M76A 1MB2A 1MR3F 1XAIA 2IDZA 4WFQA 2PD4A 3I05A 4PZCA 1X1TA 1M2FA 3EIOA 3KSMA 3D8TA 4JEMA 2Z3VA 5DM0A 3STXA 4KBFA 5K0CA 5EGNA 2ZW9A 4JY7A 3OJLA 2GARA 2Y1EA 3CLHA 1G2PA 1MN6A 4B34A 2QL9A 4WCVA 2JLSA 3L8MA 2YASA 4LRSB 2NO5A 5TMPA 1XDSA 2R8YA 1Z4LA 4JC0A 2ACWA 1M2NA 3KVNA 1JU9A 3FCSB 4H7IA 4OIMA 1ZM7A 2H7VA 1HLDA 2BHSA 2Q0SA 2XUFA 1M1ZA 3L6EA 3M5DA 3OCZA 4TUYB 2OXFA 5C1IA 3NYIA 2JJYA 2A14A 1LPMA 4TLLB 421PA 5JSFA 5JZOA 4H08A 2Z30A 1OXKB 4MJLA 1KMCA 2HSEA 1K3FA 4PZYA 2NU7A 2YCLA 3E8SA 2C8KA 1Y33E 4LF5B 1K0UA 1KMNA 1WTCA 4H7HA 4B9AA 4LXTA 3AY7A 5TV2A 3CZ4A 1FDSA 3MRTA 3ZDCA 3TLKA 3EF0A 2X6TA 5TGTA 3D7KA 3EB9A 1SIOA 3R5XA 1R0WA 3MS2A 1FLAA 3TRDA 1R0LA 1EFVA 1X7XA 1SUIA 2X2PA 2Z43A 3QLVA 4BYGA 2PWAA 4KWHA 1ISSA 2ZQ5A 2JL1A 1SR8A 4UREA 1ZK2A 3VO8A 5C53B 2B3DA 4IS2A 4HUTA 1IJFA 1Z74A 1TB4A 1UXGA 1XO1A 2P9GA 2IYSA 1CPYA 3RC9A 1T29A 3AFMA 1I4OA 3DD5A 3VDQA 2PUGA 3FCOA 3SS8A 5T7BA 2NACA 4RY2A 1M1NA 2R66A 3WIVA 5FTKA 5AKKA 1TW3A 3M6LA 4TT8A 4KZPA 1ZI6A 1HURA 4YRDA 1JVBA 1ESZA 1MENA 2IHJA 2GDZA 1L1QA 1NG1A 1VSTA 3IALA 3HBLA 3ZE9A 4CF7A 1Q19A 3AUSA 4DUPA 3KB1A 2HCBA 1J00A 4EHIA 1USKA 3DDOA 2NOAA 3GFTA 1GLVA 1L5QA 4C2BA 4BVGA 2PN1A 2XTNA 1TXGA 1NF3A 4ZQCB 4IIVA 4J4TA 1NRXA 4KXVA 4OMDA 4TTTS 5DM1A 3V5NA 3PJDA 3RI3A 1BFKA 1LI7A 4GSYA 1G5PA 2W9XA 3R2JA 1FTGA 4O5AA 4LGMA 1TUEA 1Z7WA 2OY0A 4R98A 1X7WB 5JFGA 4J0IA 1W9HA 2GK4A 4PNPA 3N05A 5H4HA 3T5BA 1NY6A 5HOEA 3HJRA 5HIIA 1LPNA 3IVAA 4CM7A 3H2KA 3FHTA 2FAXA 2C9BA 1IN5A 4PCLA 2AC4A 1TLLA 3HB1A 3HEBA 2ZVQX 4J1NA 2AKYA 1VBFA 3R09A 2NN3C 4X7PA 2H0AA 1EK6A 3W6NA 2PS1A 4DUYB 4Y6QA 1NX6A 2JEYA 4XQCA 4CLRB 4CM8A 1UOQA 3KUXA 3R7DA 1A2KC 4B2PA 3AW8A 2HIMA 2HRZA 2Q5FA 4NU6A 4EJSC 8ADHA 4I50A 3TOCA 4B3FX 4EFKA 5FUQA 2FG5A 1F9EA 4LYEA 1JLMA 1W0JA 1AM4D 1GHTA 2H2DA 4NQRA 3NFYA 3NYQA 3AIIA 3I01A 4ALNA 1JH9A 1UC8A 2B4QA 4A5SA 4BP3A 3QLUC 1R6TA 4DCUA 2XGJA 2ZXFA 2BZ0A 3WGNA 5TNXA 4HYQA 4OX9B 3FUTA 3KELA 4DAOA 4W5HA 3DEHA 5JROA 2OBNA 1Z6AA 2GZMA 4TQGA 2RG1A 4N0QA 1CZKA 1Y9JA 5ALHA 3C87A 1HR0B 3RC7A 2WA1A 4RDIA 5EFOA 4R0MA 1E2KA 1KKUA 1H0HA 4H7FA 2BLLA 5CM9C 3S81A 3L8HA 2RGNC 5FTWA 4G5SA 2VP4A 1DKMA 3DCIA 3FBGA 4NY1A 4P7JA 3TUIC 4G8JA 3RSOA 4D0RA 1QR2A 3ORFA 4IWYA 4XLLA 5IYZF 3EGDA 1W48A 3ZCPA 2YJGA 1QJ4A 4YP7A 1CULC 4HQNA 3RAJA 4PNHA 1TIKA 2A5YB 3WYAA 1N0UA 1JAHA 1A72A 3EOBI 2BFBA 3WP1B 4RANA 3A9UA 3KYCA 2I4IA 2DF8A 4NS1A 3N2EA 3V8PA 4N0MA 5ARCA 3EVCA 1BRTA 1R5OA 2NXWA 3CNLA 3L2OB 5TJHA 5JYCA 4ZOLA 2FDXA 3GLIE 1HMYA 1NMEA 1T10A 1HT0A 2AF4C 3IHKA 4HWSA 4MWGA 4DA4A 2C7QA 4H1TA 2ZUVA 5K3BA 1II0A 4IJUA 1KZHA 3EVDA 3VPGA 2VDWB 2EATA 3L6DA 4YEDA 4ZOEA 1BFUA 4JUCA 2VA8A 3ZCQA 5A9RA 1GL9B 3CNHA 2D1RA 3CLTD 1ZISA 4FMCF 3CRRA 4YUZA 5KU7A 2Q5OA 3T5DA 4DNFA 3AF1A 1TEVA 2I6QA 3GA0A 3CE9A 1NJFA 4Z3KA 2X9QA 2SECE 1YQXA 3AEQB 1RKBA 2XNJA 3TINA 1JQJC 1AQ6A 3D7RA 3F0TA 1ADCA 1XQ9A 5FUWA 2I2CA 3DVRX 1U98A 2R3SA 3IJRA 4MUEA 4E31A 4DBVO 4G09A 2Z3ZA 3AT1A 5AJVB 3KR9A 1VMIA 1KBZA 3SQOA 5DM70 3TWOA 4NS4A 2Q5HA 2QMHA 1Z68A 3LC7O 1S2IA 3BE8A 4C0AC 4KQJA 3K16A 3HI4A 5FV7A 3GK3A 3S2GA 1ZUWA 3VYRB 1P1FA 4EUFA 4E33A 3HYRA 4XEUA 1B2RA 1YHNA 1Z5WA 1H85A 5ED0A 1QANA 3X1YA 4OQYA 4DM7A 3K6SA 3TTWA 3K70C 2VLBA 3T1VA 3IAAA 5FKJA 3EVAA 2RGGA 1ZNYA 2I4OA 2RHGB 5D3ZA 1ZVVA 1EP1B 5MGNA 3B9BA 4W6QA 1S3SA 1GTJ1 3UCFA 5EMMA 4HT3B 2PFKA 3C4QA 2C84A 2IEAA 4D8XA 2JHPA 3ICCA 1UBMS 4NMWA 3VA7A 1U5CA 1XXHA 4RD1A 3F73A 4J43A 3R0IA 5EXPA 2Y92A 5JLAA 4CKBB 5KCZA 4WBNF 5CU7A 2GD6A 3O2NA 5HFAA 1MIOB 1IFXA 1KERA 3HU3A 4RGYA 1YU9A 1YJQA 2TMDA 4TSKA 3ORRA 2O20A 3PZBA 2I62A 3R77A 4OVKA 4EKEA 2C5FA 3NTXA 4X90A 1VOTA 2HBZA 5H8WA 2FSIA 3F6EX 2VFAA 4ZVSA 1XDBA 4QBTA 5E0OA 2R6GA 4PYNA 4MPTA 3H5RA 2I6UA 3A27A 3ZCXA 3IDOA 4QNNA 4TQUS 1DCFA 2UUPA 1V16B 2KPOA 1U1CA 3TO5A 5BSVA 1ZQ9A 1PNQA 4BP1A 2PGOA 221PA 1SAYA 4YECA 2CL7X 1EVLA 4RE5A 1P5JA 1BWQA 4KSBA 2ZBDA 1MO5A 1C3OB 4TVOA 4XPIB 2NXEA 3R8CA 4B6GA 2QZJA 3MEQA 5B30A 3ZVKA 5C31A 4EHJA 5A7HA 2I9KA 1XEWY 4MPPA 3R5JA 1IOVA 1FTNA 2IHYA 3GEDA 3SXJA 2P67A 1U4OA 2D0PB 1WQ3A 2V5UA 3STYA 1I2MA 4C76A 4C7VA 4YRFA 1OA0A 4W5WA 1XHLA 2WHRA 2JFFA 3VZBA 2IDJA 1EK0A 2GD2A 2MMCA 3QBDA 2JAQA 1IK4A 1ENPA 1TYEB 2IP2A 1OBHA 1E3LA 3HI6A 2QJTA 3DFIA 3GAZA 3MHPA 4OHRA 1FRVA 2Q6TA 1G291 3RVRA 1GTL1 2OLJA 4Y98A 1FTWA 1PSDA 4X20B 3TLAA 3UV7A 3K30A 2XNDA 3HBNA 4PR0A 4MCHA 4QSHA 3X2SA 1Q0UA 1YD7A 3K2QA 3LBHA 4EZIA 3BC1A 3BTVA 3H5OA 5IAEA 2ETVA 3DKIA 1U81A 2A7QA 2J6CA 1BZYA 4RD4A 2ZJ8A 1E1QD 1VPEA 3AG5A 4GYYA 5CNJA 3TBKA 1KMIY 2FFQA 2IBMA 1U63A 4QOGA 1FMTA 4XQEA 1P4SA 1FNBA 3INYA 5CDHA 3GF4A 5I7FA 1B8OA 3UMYA 2Q3LA 1PLLA 3BD8A 2PFSA 4M83A 1YV9A 2BFEB 3T3DA 5JTTA 1L4MA 1AKUA 4EUNA 2WV9A 3JQFC 1DIAA 1QHNA 1USUA 2OHOA 2R9VA 3B5JA 1HYHA 3A6KA 4K8OA 5JH7B 5HQJA 4Q6WA 1WZ2A 1I4DD 1QVRA 2IHNA 4HTFB 3CLVA 5IKMA 1GVNB 1IWOA 2AW5A 4WE3A 5A04A 2AFHA 1XCLA 4WCFC 2CLEB 1U1GA 1H2WA 3AI2A 5KDOA 4V0SA 1T4GA 2JCXA 2PIDA 2C58A 5DGDA 3RUHA 3LOQA 4RKYA 1E3JA 4O2RA 2J4CA 4NE7A 1BQ3A 1QB8A 3DCYA 3AFGA 3N5CA 2DPHA 3MGGA 1RYBA 2ODQA 4RMIA 3QMVA 4ZRDA 4EA8A 4GWLA 1NVVQ 4M1WA 3W06A 1EVYA 3ND9A 3CCFA 4KP7A 5DM60 2EHDA 1IXZA 3LHDA 1TLFA 2AC2A 1AXGA 3BDVA 3C43A 7REQB 3PB3A 3LQYA 1GQYA 1EXMA 3NHAA 4XD7D 3GL9A 3CPHA 4YVFA 3SC2A 3A37A 3G13A 4U2FA 5IUJC 5GQSA 2AG8A 3CH6A 4H7PA 4RADA 4D98A 3SDSA 3QI7A 5JXWA 4C4XA 3PNVA 4TMWA 4GLFA 2QI9F 2YXBA 1FVFA 3IPRA 4W7SA 2NVUB 3WLNA 4P54A 4CUKA 1G4AE 3DO6A 1FW6A 5H82A 3JWIA 3VJRA 1TA4A 4PRYA 3RDPA 4C2AA 5ADUS 1TJNA 2OZPA 3CXUA 2PWZA 5EUCA 2DLCX 3N2KA 2GFQA 1V1JA 2FPPA 4LZOA 3LUJA 3TEJA 1PHPA 1CVRA 3HACA 2CVQA 3UJDA 1SWVA 5JZBA 4IAOA 1KFBB 4CNBA 1XF1A 4PRZA 3E2PA 1ORRA 4D82A 3K0KA 2OV8A 3HO8A 2ID8A 2MSWA 4XGIA 2SBTA 2XUZA 4M98A 3RREA 4U9UA 3FUCA 3S7ZA 2AN4A 2NUAB 1NFQA 3ETDA 3UIEA 4LY9A 3NVKI 3GQBA 2IYNA 2I2WA 2XBUA 1SC9A 4UVIA 2DECA 2P5TB 3NHJA 3OPYB 3QUSA 4K9PA 1VFPA 4N9QA 4BQFA 4BNTA 1VIMA 2D2FA 4H3KB 4ZEOA 4BKQA 2OWEA 5B53A 2JGEA 2GCNA 4IDOA 4NP6A 4XD7A 1C7RA 1U8CB 3VDNB 3ZUPA 5AVJA 2FJ0A 5F2NA 2PJZA 3DXFA 4HDSA 4IJKA 3UUEA 1IIBA 4YO8A 3G2HA 4BAZA 5KYXB 5CEEA 1D6SA 2N3ZA 4YA6A 4QVKA 5B3JA 4C30A 2XVXA 4UE6A 4M0DA 4OJNA 3QGMA 3H2BA 1O6BA 5JAQA 1TJ3A 1SPXA 4N8SA 2FOIA 1L4EA 4AO7A 3BRSA 3P27A 3ZV7A 2ORIA 2W00A 4ZGGA 2NP6A 3QTLA 1F2VA 2ODBA 1WSBA 4GPAA 4YRMA 1HXHA 3QM1A 4MUGA 2HU2A 4IKOA 3VDMA 4QOEA 4E2ZA 2EU8A 3EXAA 1VG9B 1Z83A 3BMNA 2AG0A 3OZBA 3W5VA 3T06B 4OJQA 1XBTA 4BJ5A 2PT6A 4E2FA 1ZXLA 1N6IA 2G70A 3PF9A 5FL3A 3WK9A 5CDUA 3SLRA 4GMFA 2Z2ZA 2HA7A 3L1UA 4BJ1A 2QIPA 3LIPA 2AQIA 3RB8A 3TLZA 5L7TA 2BEUB 1N7IA 4L5CA 3ZGOA 1OXBB 4E5NA 2C4HA 2YH2A 3QFCA 2ZIWB 3P96A 3AJDA 3H5LA 1U90A 3PFWO 5SY4A 4EY6A 5KMGB 1SBTA 1EK2A 3FCCA 2JJMA 2XOKD 4G36A 2GLTA 2DQZA 3QIVA 3OIUA 4JB2A 1EBFA 4BX8A 4DA0A 3A3PA