1F8XA

Crystal structure of nucleoside 2-deoxyribosyltransferase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
PKKTIYFGAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDIMLGVYIPDEEDVGLGMELGYALSQGKYVLLVIPDEDYGKPINLMSWGVSDNVIKMSQLKDFNFNKPRFDFYEGAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
publication title Crystal structures of nucleoside 2-deoxyribosyltransferase in native and ligand-bound forms reveal architecture of the active site.
pubmed doi rcsb
total genus 55
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2000-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f8xA00
3HNOA 4LJKA 2PFKA 3O8LA 4P5DA 1S3FA 5ITSA 3SBXA 3F5MA 2A0KA 4P5EA 4JELA 1T35A 4RH3A 2IZ5A 2Q4DA 4OHRA 4KXNA 2NX2A 1YDHA 6PFKA 4PFKA 2PMBA 4I36A 4OHBA 2F64A 4JENA 4NPAA 2KLHA 3MAJA 1ZXXA 2Q4OA 3OPYB 3K2QA 2F67A 2KHZA 1F8YA 3GH1A 4KXMA 4I7EA 4U1RA 1KZHA 3O8OB 4KXLA 5AJUA 3QUAA 2HIGA 4WL0A 2F48A 2IZ6A 4A3SA 1S2LA 1MTOA 1F8XA 2IZ7A 4FYHA 4JEMA 5AJTA 2F62A 2F2TA 2A33A 4FYKA 3EHDA 3IMKA 1WEKA 1S2IA 3PFKA 1PFKA 3O8NA 3UQZA 1S2GA 3U39A 4HX9A 4FYIA 3OPYA 4LJRA 4MEJA 1S2DA 4I4IA 3BQ9A 4LJLA 4MCJA 1RCUA 1WEHA 3O8OA
chains in the Genus database with same CATH superfamily
3AJ8A 3L84A 1NL3A 2VQ3A 5DNYB 3DULA 1XR3A 2OMKA 2YWGA 3CX6A 5JWOA 1WHTA 1CCWA 3R0JA 4DDMA 3L0DA 5T4BA 3BRCA 2Q2VA 3HB1A 1T91A 4AXXA 1FXWA 1IHYA 2IW3A 1KMNA 2ID9A 1DRUA 3HH8A 4C29A 2IUYA 3NTQA 4IUCS 3F0TA 3OQJA 3PFFA 3T7JA 4G8JA 5C8VA 5HWSA 1UAAA 1E4OA 2GK3A 5ILGA 5THQA 2OXRA 5LQUA 3ZHZA 1FFWA 3DB1A 3LFTA 5G40A 3AY6A 2W0SA 2P9QA 3KB2A 4XQCA 3HVKA 1KQNA 3NH6A 3RU7A 5ITWA 2WK1A 4CM4B 3OECA 2IE8A 4PU0A 3TTYA 1EXDA 4MGIR 2GZAA 5IXSA 4OGLA 4A92A 1H5QA 4CMGA 2OORA 4H1TA 4B80A 3GLHE 1DI0A 2VC2B 4HDNA 4JLSA 2R5NA 5IK2A 2WT4A 3KLPX 3I1FA 1Q1QA 1XYGA 3HA5A 4GHWA 1ODLA 4N39A 4WX2B 4XB1A 2NG1A 5B58T 2DFLA 2Q6TA 3U9SA 4REMA 2LV8A 4O25A 4IDBA 3C0KA 2H3HA 1U8XX 2QVBA 3E81A 3H8SA 3K32A 5BYAA 1TJNA 5DIFA 3H5LA 4Q00A 1X38A 1N8TA 2WILA 1JDZA 5IDXA 4YJFB 1GFWA 1Z6QA 5C35A 5BV8A 2IBTA 1QM5A 1PV1A 3SHQA 2QLTA 4GO1A 4KN6A 4MA0A 4YLGA 1W36C 5I7HA 4Y9TA 3DOIA 5CDTA 2CXXA 2EKPA 2Z09A 5L6LB 2GPAA 3BS4A 3MC1A 4CLOB 4IDFA 1I1HA 1P0FA 2PSEA 3K5WA 3J7AC 2GLXA 3OJXA 1H6CA 2FE4A 2O8CB 2Q0XA 2Y99A 3QUQA 3T7DA 2FR1A 4CCYB 3U60B 4DQ0A 4FEEA 3EIHA 1R0LA 3Q2IA 3C74A 6ABPA 1F8XA 1P1FA 4R1LA 2XMQA 2G67A 3MMPA 4XJSA 2ZAIA 2P6OA 3R5XA 5D3KA 1U0LA 1U3CA 2YJ6A 2C8VA 4JC4A 5FI5A 4MR7A 3KSDO 3I9V6 4GF5A 4K9PA 3ZCQA 3ZVNA 1C4XA 2QM3A 3C6YA 1T4CA 1WP4A 3KSMA 3CRRA 3AESA 2QX6A 3K31A 3PFHA 1YCDA 1GSHA 1K2VN 1VIYA 2QAGA 3RUHA 3S6JA 4BNXA 4Z3OA 1XMJA 3TG2A 1N5JA 2CSXA 5B3LA 1ZONA 4FDAA 3KLOA 3ZKWB 3LXUX 2DBVO 4X71A 2JC3A 3ESZA 4BC1A 5JZ9A 3PHIA 5DE3A 1YK0A 1UMCB 2YJGA 3SZLA 5JFOA 4OKNA 5KTSA 2ONKA 3A26A 2EJUA 2R79A 3DKKA 3OPYA 1UBRS 1K3TA 2FSVA 2XB4A 3MWFA 2QMZA 3GRCA 4JFAA 4MVCA 4ZT5A 3SGLA 5CVEA 3HDJA 2WINI 4UZSA 3L8EA 3RADC 2ZAYA 3H1AA 4Q03A 4TS4A 4YPOA 3U3RA 4EMUA 1GZVA 1W75A 2YHBA 1GV0A 3MFQA 3EXG1 1U4SA 2KQUA 2UYGA 3KV1A 5DCYA 4BVEA 2PLNA 1MJGA 1O89A 3TB4A 2OBNA 3GRYA 2DG2A 2Q7DA 4Q9NA 3RK1A 1UWVA 5AP9A 1PKXA 1EVLA 1JQEA 2JCGA 2WICA 3B1KA 2BI7A 3FFAA 5DTIA 2B2XA 3DAPA 4UHBA 2OO5C 4A8JB 4L4UA 5DM1A 5CX4A 2QTAA 4C5CA 4EW6A 1F38A 2J45A 4GX0A 4TWZA 1R6UA 4N76A 4PSDA 4DFDA 3R5HA 3PJFA 2CJPA 3QV2A 1B43A 1XLWA 4KQMA 4UCWA 2IF0A 2WG1A 1ZNZA 1ODKA 4OPMA 4UU8A 3PDHA 4EY5A 1RNLA 3QFRA 4R2LA 2HSJA 4ZRDA 4NKRA 3HCRA 1JEYB 1UWCA 2H1HA 4HDMA 5I7FA 1XMSA 4D4GA 1JIXA 2C78A 3VO2A 2ZJ6A 2YZMA 4BVFA 5JSZB 4W5RA 2BRUC 1WSWA 4AL4A 5LL6P 1YMQA 1EJ2A 2CYAA 1Q7EA 4B8WA 3OG9A 3ZNQA 2I34A 2GJAA 2QMQA 3AINA 3L7OA 3NUZA 2NP6A 1GL6A 3LRXA 3MB5A 4BUJA 5BWOA 2QY9A 1VGQA 4NZZA 3QF4A 2BHNA 3KPWA 3LA6A 5EQTA 3AFIA 3VR4D 1GZ5A 4LNUB 4LYAA 1CZNA 4PLHA 2A58A 3SYRA 1K6MA 4WXRA 5I5EA 1QJCA 4YT4A 4I6JA 3GFGA 2QK4A 3PVCA 5JVDB 2GYVA 2VLIA 4QDUA 1WXGA 3T61A 2EG9A 1P9RA 1SCKA 2D8MA 1BCSA 1NDQA 3LUGA 5IVIA 3HMQA 2WHRA 4TKUA 1R15A 2XNDD 3LUBA 5KYXB 1MH9A 2RJ3A 3DMYA 4OM7A 2VHWA 2WVAA 1GDHA 5G0VA 1LCIA 2X7JA 4G0OA 4B73A 1XZHA 5A7GA 5IF9A 2B8TA 3FYDA 4RNDB 1DGQA 1O2DA 1WMFA 5FEMA 1F1BA 1TVKA 1H0HA 1SULA 1AIPA 1XHFA 4FR5A 1MT0A 1SR8A 3SDSA 2ZRQA 3SYTA 2DHDA 3RRMA 2F48A 2IZ6A 3V7WA 4ZI7A 5EHQA 4E5VA 2EBFX 4LDAA 1S2MA 2F7SA 1X14A 4PZEA 2PFGA 1QHEA 3G8AA 4OMDA 4M9QA 2J9GA 5AVJA 3TOCA 2G5CA 1LS6A 1ZMBA 3GVCA 1HG1A 4F4JA 4UTNA 3AHFA 5CRIA 3ZD9A 3ESXA 1JDBB 2R2GA 3R0ZA 4UHFA 1MOSA 3QITA 3TL3A 1LY1A 2ZANA 5I48A 1V8FA 3NQ41 4N4AA 3FTDA 1Z8DA 4D82A 2VHXA 4KW7A 4AO8A 1Q44A 3DBVO 1QWOA 4L5IA 3DOEA 4GM0A 5D1HA 1W52X 5JR3A 3D6HA 3P20A 2P9JA 3DWEX 3OFND 1B6RA 2ZFUA 2JLBA 2P91A 4FFPA 3SJUA 3RVSA 3UG6A 3TLYA 4LE0A 5EIBC 1EUCB 1H3EA 1WB6A 1QMGA 2HYDA 4ZEWA 1R8YA 5HKKA 2L69A 1QV7A 2GBLC 3FNEA 2B4YA 1R4MB 1M2NA 2PSJA 3EBPA 4OM8A 4JT2A 4PCAA 3DFUA 5EJIA 5FI3A 7REQA 1DAGA 3ESYA 4CKEA 4TL9A 1CZOA 1P91A 1DL5A 1ZIOA 2A5JA 2PZEA 4WD3A 5GV8A 5KYTA 3OMWA 3MIZA 3CM0A 3DMGA 3JD4A 4G1CA 3NPAA 1IZ0A 3CZ9A 3VZSA 4KLCA 1K97A 3B2NA 3KIPA 1TUGA 2WTXA 3MSCA 4G41A 4S35A 1U0FA 1TTPB 1NXWA 2PNFA 3AW8A 4JASB 4FW9A 4S1VA 4HMPA 4LXXA 1UMDB 4RXTA 1Z4QA 2A5LA 3M9LA 5JASA 1KEKA 1SU4A 4MWGA 4LMAA 2PGOA 1YQWA 3VYVA 2R6AA 4XTRA 2PKXA 1AOXA 3GUUA 4NPCA 2YMMA 3OFKA 4XD7A 4YACA 5J2UA 5M2QA 1PCXA 2DEUA 1IN4A 4JXJA 4CM1A 3EHEA 5EWLB 1ECCA 4P5EA 3QU9A 5C5EA 4V1CA 4NMMA 4REOA 4QHSA 1TT7A 2QRGA 1KOFA 3E4DA 3U81A 5JQGF 4QXQA 1IBLB 1NYRA 4PW0A 4B3IA 5K8LA 4KYUA 1LSUA 1SXHA 3KQVA 4EG7A 3ER8A 4OK5A 1L5RA 1NSFA 2IQ5A 4TKLA 4MPPA 3WJ2A 3C3BA 2PGNA 2ZVJA 1EXWA 2UZ1A 2B83A 3K5IA 1E1KA 3C2QA 4P2BA 3BD7A 3TRKA 2QLLA 5TARA 4KQCA 3RIEA 4RQTA 1E32A 4DV6B 4RDIA 4EUKA 1G291 5AKEA 4HLCA 1EVYA 4GX1A 4C08A 4TS1A 2NZXA 1J0BA 1M6EX 3DXYA 3W6ZA 3NS7A 5AK3A 2X7XA 4B7ZA 3K92A 4XWTA 1FX1A 2A6PA 5JNSA 4QELA 4A82A 2ZXUA 3QWIA 4R51A 4BNIA 4NMWA 4ARVA 4LG1A 1OLXA 1XCPA 3OQNA 1T5OA 1ULHA 2FUKA 3NYIA 2PKYX 1U8YA 2QV7A 3FX2A 3N2KB 4U4AA 3D7KA 3HM2A 4IIEA 3G2LA 4UC0A 3EQ9A 4P4SB 4PNHA 2ZBDA 5C5DA 3QKRA 3DLCA 3RLIA 2PMCA 1YZLA 4NCKA 3SM3A 1PUXA 5F1KA 3Q40A 1CZHA 1CWUA 4FJ0A 1F14A 5ER9A 3VHXA 3G9ZA 2JI4A 1A8QA 2C2WA 3LHKA 4IEFB 1V1MB 4L0DA 4WADA 2J46A 3BIXA 2NT3A 3Q5DA 4XB2A 1Y3FE 4F56A 1DRKA 4HCJA 1F9EA 4FGUA 3ZY2A 1RRGA 1AXEA 4YR9A 4YJ2F 5JS6A 1JBEA 2G25A 3IQGX 3KOUA 2DFDA 4FCWA 4QFDA 4XWOA 1SMKA 4PCUA 1P31A 4P80A 4RQAA 1OI7A 1UC4B 3OUUA 1L7XA 3PNLA 2RHTA 1UK6A 4Y98A 4XGIA 2XCUA 1L0BA 1J8MF 4J6EA 4Q7LA 5D5HA 4EJSC 4R8MA 5T6BA 1I4EB 2R65A 1Z5ZA 1ZIPA 3ZWCA 5BR1A 2FDCA 1U0BB 3LRTA 5FWNA 5AW8A 3EQ8A 3QEJA 2XBLA 4MQ4A 4Q1DA 1Z13A 4D80A 2HQSA 1UJNA 1YJAA 1F5SA 2JGFA 1TKAA 2TYSB 4Q66C 5FPTA 1ZNWA 2QR2A 1J8FA 3C43A 3Q3VA 4GRAA 4JX8A 3UXMA 5BMVF 2FEPA 2JBAB 4ED9A 5IBQA 4JYPA 4X41A 1GV1A 1UM9A 3Q9UA 2JI6A 3PLRA 5G4KA 4FHFA 3OFVA 4CFYA 1JI3A 3N7TA 4TXLA 4JI0B 1DO8A 3K2EA 4IXWA 3W5VA 4LJYA 2OUKA 1AUXA 1VCHA 1JU9A 1YU9A 2EATA 4HB2A 4R1QA 1DAOA 3UJ9A 3K72B 3D0RA 1MENA 4WINA 5TVKA 1Y6GA 5EXDA 4WKPA 1T4BA 3ONVA 4RORA 4F72A 3E0XA 4Y2YA 1PIWA 3JARB 4MQ6A 5H8WA 1PT5A 1W5EA 4LWPA 2QYSA 1ICIA 4Z4EA 3TZBA 4F8JA 3M89A 5HG0A 2R1TB 4RM3A 3WO1A 1HT1E 1GUDA 2P0EA 4IOMA 3SIWA 3PIIA 3JV7A 1LU9A 2BPOA 3JY6A 3BAZA 5TF4A 3TQSA 2WTUA 3LXMA 2O2CA 3O2JA 2CL5A 3REFA 4E2ZA 3TIGA 2JHGA 1NVUQ 3LQ2A 4J75A 3RUPA 2BFAA 5A5FA 2O8DB 5HKBA 3TXYA 1TM4E 3DONA 4YO8A 2OV6A 3KJQA 2D0DA 1R5OA 1LNQA 2LDXA 2NZJA 2I91A 1C30A 1G66A 3R0XA 4CM3A 3V7FA 3ABSB 3HJBA 3LX8A 3I6YA 4P3YA 1D2HA 2P1RA 4RPIA 2G36A 4NJEB 3R6GA 3T1YB 1XTPA 2LTAA 1XNHA 2QTHA 4ZANA 4GLLA 1MJNA 3S2UA 4KQWA 2VK4A 1T2FA 1K2WA 2V6JA 2GZDA 3KB8A 3AEUA 3EMKA 4ICIA 4B46A 3DCIA 2WWGA 4BNFA 3OCWA 3JQ6A 4WEQA 2ZJ4A 3M6XA 2NUTA 1EVZA 1LFAA 2FPIB 4TMTA 2IOFA 2R25B 4KPYA 4KQEA 1LB1B 1H6AA 2JB9A 3HDQA 4OOFA 1SUAA 1YR2A 3FPKA 5FNZA 2OYRA 3VU3A 2C4NA 2HZBA 3L5KA 2IYRA 3PQDA 2NACA 4HWTA 4BLQA 3WK6A 2NM0A 3KRTA 3UMVA 4U9UA 3PKZA 1RJFA 1LA2A 4FJ2A 3U7GA 4HG2A 4PV7A 2G04A 3NCHA 1FFDA 3AR6A 4LGMA 4MKIA 1R0KA 5CB0A 4V0OA 3E1GA 1C1YA 1DCKA 5CH3A 1B16A 3HCAA 1GTVA 5C53B 1YBAA 4IIJA 1Z2DA 4OIFA 4WGGA 3OJLA 2H9YA 3M6FA 1EI9A 3TTTA 2XB6A 1G2PA 1WLSA 2CXPA 3QLVC 3AY3A 2RH5A 1DO0A 3KO8A 4JBNA 4KQFA 1JQDA 4P22A 1F6WA 2YW2A 2GNAA 1JFRA 3GCWA 3NH9A 3DV0B 4KOAA 4Y9DA 1J0XO 2R1VA 2JNWA 3VR6D 3SEFA 1CQZA 3D4BA 5ESXA 4DV5B 2A78A 2NU9A 2C3MA 3A25A 2VEOA 1ODSA 3C1TA 3C8ZA 4C6SA 1QPBA 1T36A 3VFDA 1W4RA 2I1VB 1W1UA 3KOYA 3KYIB 1ZVJA 4K03A 4BO3A 2AD5A 3PPIA 2BFEB 2C77A 1QGYA 4GOLD 4KAAA 4Y2PA 2WSMA 4JJIA 5J1TB 3SZMA 1WMEA 1NUHA 2GM9A 3ID6C 3NHJA 4PN7A 2AN3A 3PUXA 1P7CA 1KQFA 4DA6A 2X2PA 4C3VA 1MRSA 3WK7A 1N25A 1JVNA 1LC3A 1NFRA 2JJYA 5EERA 4E4RA 3L5OA 2Y0EA 4NBNA 5CT5A 4YAKA 1THZA 1B15A 3RFXA 1MX1A 4H59A 2HXSA 3RUFA 1RWKA 4CTOA 2CDAA 1T2CA 4NECA 3V4LA 2QRHA 3JVEA 1UXKA 3QEMB 2II6A 1P2TA 4JLOA 4JT9A 3T4EA 4NABA 3W79A 4GMGA 4MV1A 5AI8A 2GNOA 2XD4A 3PGA1 4X8HA 1UUFA 3W4JA 4OLAA 1J9GA 5KDLA 1A71A 4J2OA 2AUNA 4MITA 5NULA 1G17A 1KEPA 1QQTA 3K6JA 4R54A 3HRIA 1T5SA 3AHGA 3PT9A 4KIJA 5AVXA 1PG0A 4B3GA 1PUIA 3NWEA 4MICA 3P9IA 1NPDA 3T7KA 1U2PA 3OQ6A 3JD1A 3LOUA 3K94A 4URFA 5DHTA 3HCFA 2PPLA 2XKBA 3SWWA 5JJKA 5GZ3A 1JI0A 1SRQA 1ECFA 2M6RA 4ACAA 3TGLA 2PS9A 3UA4A 4RHEA 2CLFB 1AQLA 3C16C 4MGKR 4LYJA 1GCIA 5LMZA 3OF5A 1NDHA 4I55F 2ZI7A 1WDWB 1GPAA 1RZRA 1YS4A 2LRHA 3JRWA 3OKFA 2Z2JA 1KE2A 3WOHA 1U9CA 2FWBA 3GYGA 3HHEA 1RXWA 1ZXBA 3PCRB 1Z45A 3ZX5A 3RKSA 2W83A 1TJ5A 3RI3A 2FEKA 3DXFA 1NMYA 1W1WA 1ISPA 4ZPJA 5GMOA 1ETUA 3F9RA 3H4TA 3ZYCA 2XA9A 4AK9A 4E13A 1JHQA 2RI0A 3IB6A 2GKGA 3HPQA 4DPLA 5I9TA 2CK3A 2VP6A 3P19A 1X9HA 4PICA 2B1RA 4OQZA 1XEAA 1OVGA 3RC7A 3RT9A 4HNUA 1XL0A 2UDPA 3U1TA 1T6NA 4HP8A 1S8NA 2V7EA 2VH5R 3ESCA 4HZIA 4HEA6 1M2FA 4A8PA 4EGAA 3GEBA 4P0TA 4B81A 3UAYA 3L6DA 3D2BA 4XYEA 2W7TA 1TK3A 3UC5A 3D3WA 3QY0A 4XR9A 1BNCA 3ADKA 5AMXA 2AFIB 2BP7A 2YL2A 3AR9A 3GPCA 4L28A 4TV8A 5LZ5A 1RI5A 4GDFA 7GPBA 3OOEA 1HFEL 1DARA 3PJRA 1OTXA 3ASYA 4MV3A 4AZTA 4C7MA 5KSZA 1PTJA 2W4QA 1SN7A 1IDN1 3NHKA 2GCNA 4OB6A 3PXAA 4DC1A 5I3ZA 4D9JA 3GRUA 3HXQA 7REQB 4BMCA 4RF4A 1O08A 3KLNA 3S2YA 4Z4QA 3EOZA 2ZVPX 4B9AA 5IH7A 3UIEA 1GNVA 1RM0A 2MINB 2Y66A 3VISA 1YRLA 3S8MA 4EX7A 4ZCLA 4U9HS 3G7SA 2IDKA 4EAQA 5FBLB 4ES6A 1ILEA 5CLLA 4PG7A 2OORC 4LHWA 2IYSA 5KX5F 5KSPA 2C0QA 1E89A 3M4JA 3R9WA 4RQUA 3JYOA 2C9MA 3QE2A 1JQKA 4DHWA 2REBA 2H0QA 1W36B 4NDAA 2ZB3A 1CZRA 4GQBA 4O4JA 5FBWB 3GBPA 5HSGA 1RWBA 2I7XA 2GWHA 1ENYA 3GYBA 5DB4A 2QM0A 1LLDA 2LDBA 2RHDA 2VJMB 3ML1A 4QPNA 5JECA 2QG9A 3IP7A 1B2LA 1MO4A 4ZTZB 4ME6A 4AJOA 2CLMB 3VNBA 2F8SA 5HRCA 2O6HA 1G8JA 1P81A 3EA4A 2PCLA 1T8PA 2VHTA 1TK2A 1YU6A 1TRKA 3LUHA 5AOCA 5IAGA 2OFFA 3RIXA 3UY4A 4M7WA 1FFGA 1WF6A 3GFSA 2PZMA 2WJ4A 2XJ4A 3QMMA 1U7XA 2WDZA 5JCOA 3AVWA 1LBTA 3W2HA 4LECA 1B0UA 2RGEA 1E4VA 1H4QA 1KYQA 3FGPA 3I1IA 3IBYA 1DJLA 3KQYA 3DQQA 3IQDB 1U9ZA 5CJJA 1HRKA 1UH5A 1TA0A 3GZ4A 3ONEA 2BFPA 3FIJA 2BEKA 4Y1RB 8ATCA 5AUPB 2JLSA 2ZJZA 2ZWVA 3NTRA 2WYOA 5DCLA 3HJRA 3PQCA 3U4IA 1AN0A 1FZQA 4JI2B 2OP0A 3QKSA 4GMFA 2AXPA 3RFFA 1NN0A 1MQSA 4NOMA 3VTAA 3H0CA 4EX6A 1SWWA 2CD7A 2IHKA 2QJFA 3EVGA 2K87A 2VPTA 3ZH9B 2FX2A 4W5TA 5IARA 4JOSA 4CJXA 2ZXFA 3A14A 2W22A 3ZDCA 4UUOA 2XMDA 4CF4A 4RGBA 4NBVA 4WERA 4Z4GA 3GLQA 4AMGA 2B1JA 4HV4A 5DN9A 2VTDA 4XQGA 4NICA 1ZMXA 3ZGVA 2NPOA 4O4LF 4UVGA 4AXBA 3LCMA 3WWCA 1JKJB 1N5DA 5B4VA 3EVEA 4Q01A 2R8PA 1O03A 1TVEA 1VOTA 2F9MA 1BW9A 2QF7A 4PQEA 1U4OA 5FH9A 2AJDA 3UK6A 1DG1G 1IEWA 2LWIA 4EY7A 4YMLA 1BU8A 1NN1A 2ODTX 2IUSA 1IJFA 2D1TA 2Q1YA 1WXWA 2WMDA 3CUKA 4M38A 3VKWA 3I0NA 2B8EA 3A9CA 2GMWA 2QYOA 2ATEA 5K03A 4PSUA 4CFSA 2OT3B 2HPHA 1B73A 4EPWA 4W9RA 3OJFA 4WJKB 1VCIA 4JL5A 4ZO6A 4RCVA 3E3LA 3WBBA 4YAJA 2V3VA 1WTCA 2ONZA 2YV5A 2XVXA 5FRDA 3R8CA 1E64A 4CHTA 3G6WA 1V43A 2PS3A 4PGGA 2QTRA 4EF6A 1AURA 1SO8A 4S3MA 5BYJA 3BK7A 4F2PA 4PQFA 1JZTA 2RHRA 2Z5FA 1XQXA 4I81A 1M2VB 5ESRA 3DHVA 4FINA 1N0IA 2HIMA 1QPGA 3PGLA 3AH8A 1XTUA 5KI6A 3FRHA 1G8HA 4JU8A 3TZLA 5EKXA 1WW3A 1NPYA 3NAMA 5K6AA 1OQAA 3OO1A 5B7GA 4KXMA 3A1TA 4LAFA 1IZZA 2V54A 4UE3S 4AVYA 4AS1A 1CIVA 2GF9A 3U3KA 5BSKA 4PSKA 2H06A 2H59A 4EJ0A 5A3SA 2X0EA 2FW6A 5EZYF 1ULSA 2KW5A 1KARA 1RBYA 3IJPA 3LO8A 5K05A 2YDYA 4NATA 4UUBA 4F1WA 4LDQA 3JRNA 4YRDA 2OK7A 2WJIA 1F60A 1A9YA 3PNSA 4BN5A 1U2DA 4X85A 2ZYWX 4QNMA 2OSBA 2PJDA 3SS8A 1F4VA 2QM8A 1IN6A 2ZZKA 4BN0A 1GNPA 1CJBA 3DVLA 4JB3A 5E9AA 4BO7A 3CRMA 3W3AA 3HUDA 5HNKA 2IQIA 1O3YA 2C98A 5B1SA 5L3RA 4C4OA 2QP9X 1RBZA 4IVQA 3TPZA 1M7BA 1Q1ZA 1SA0B 3IAXA 3PHGA 3TLKA 4B4UA 2DWOA 1XYYA 1E4EB 2Y1FA 3H5AA 3I2HA 3DR5A 3GJXC 2J67A 3WLHA 5IXJA 2O5EA 1SHJA 4MQMA 4IQFA 3UK0A 2YCLA 4OYLA 4CUKA 1L1RA 1JPUA 4Z1MA 4KOEC 5EMKA 3TAUA 4JSTA 2X5JO 2CHEA 3P0HA 4ER0A 1MVNA 1RRKA 1GUYA 1Z5VA 3T3IA 1CUFA 4NNJA 2V7VA 4FLEA 5KHOC 1WQ1R 2C9ZA 4RK1A 3B7WA 3VOAA 4HX2A 5E6RB 2I9PA 2X0NA 4K6OA 1UKCA 2P6NA 2JRLA 3FZGA 2B4TO 4MS3B 3ISTA 3U1VA 3HYSA 2ZJYA 1QH1A 4I9NA 4Q48A 2BFFA 3DSRA 1KJWA 4AKIA 4GS5A 1FP4B 1LV7A 3ITDA 3O8QB 3TUZC 2FQWA 5LBUA 5HUHA 5K3CA 2B36A 2G3YA 3GRKA 4GI2A 1RRFA 2CXHA 3WGZA 5EMJA 1KA9H 1SQGA 2OP1A 5IT4A 3IEVA 2ZDHA 4JAVC 3H3JA 1WBBA 3G5LA 4RLSA 3FYSA 3SP1A 5FFNA 4ENUA 2CJFA 3A70A 4URWR 2G28A 2P5UA 4M99A 5FB3A 3BMQA 3AVVA 4YAEA 3K7EA 4YGYA 2W2KA 1GQ2A 3HB4X 1ATZA 4O4HF 4C0JA 4ZOQI 1P7WA 4RIIA 1CUDA 3EBLA 5BRNA 1GZUA 2K2WA 3BFVA 4UHHA 3ZTWA 1ZBQA 2OAP1 2CB0A 3NONA 1XTQA 2HOQA 4B79A 2GXAA 1MJFA 1FRFS 3OQVA 2EYUA 3RC1A 1UAYA 3WLRA 3ZGYA 4KR7A 5E0KB 3VKHA 1I33A 4FMBB 4G2NA 2XUKA 1YACA 1RRVA 2FNAA 3IT1A 4FGZA 2PUAA 3TTVA 3F74A 2NXJA 3QPBA 4A26A 1CV2A 2ECFA 1E2KA 4B85A 3P2MA 1DCTA 5HHTA 2JLWA 4RV5A 3HC7A 1UT6A 2XVZA 1L8AA 4Q4LA 1ZZGA 1LBIA 3CMCO 3NIFB 1KAMA 1WXQA 1OH5A 3H0KA 3PNOA 1JPVA 3H1FA 2H1RA 4IF4A 3BB1A 4ZYVA 1Z5NA 2UAGA 4KH0A 3ICQB 4EHDA 1SURA 3T5AA 1YBHA 3MJRA 3OE4A 4XWGA 3UJ3X 2A30A 1JQBA 2FG5A 1FQKA 2HCFA 4PPNA 2BM8A 1A76A 5AJVB 5BQPA 3QU7A 4V3CA 4CYMA 4EVQA 3IQXA 1I13A 1W9HA 5IFLA 1XZAA 5TF0A 1L4MA 3H5NA 5DHQA 2TS1A 4L4ZA 3R9KA 5IEJA 3C15C 1GIAA 3SE0A 2QPLA 4B6RA 3IDAA 5F21A 3GG2A 3HWX1 1QO9A 2G0AA 4DLYA 2K2QB 4KQHA 2BGMA 2Q3EA 2QTVB 4P3OA 5I5GA 3I61A 5ELXA 2VHEA 4WFIA 3RW9A 3IDQA 4PTLA 3GRPA 1ZVVA 4GMKA 2Z8YA 3BVPA 2D2VA 4C89A 2RGNA 2CDBA 2Z8YM 3B36A 4TZ6A 2QD2A 2VDJA 3R3JA 1YQTA 3ND5A 4MYCA 3C3MA 3LNCA 3ZHUA 3NCTA 1W29A 2CL6X 4BDTA 3RR2A 1CFJA 4XQ9A 1GTRA 1Z2AA 3VTFA 1S2IA 1ZN8A 3TQOA 3FHJA 3WLNA 4KMMA 4DREA 4Z51A 4OH7A 5D6NA 2AFHE 2BTEA 3ETDA 3QPUA 1GPJA 1NIJA 2ZSEA 1KSJA 1WUIS 1T43A 3L0IB 1ZHHA 3CE6A 1HOTA 1KL7A 1TXGA 2IHNA 4DN6A 1UDRA 3GFRA 2C03A 5AW3A 3KVRA 3SR4A 2FWPA 1UFOA 4BQPA 1OFGA 3EY9A 4NS1A 3S1AA 2ZR0A 3AWIA 3DW3X 4GKKB 2WZBA 5DK6A 1C7JA 7MHTA 2RGXA 2XRYA 1IUPA 1R9MA 3PXEA 5LR6A 1HQDA 2QY6A 5CCDA 3LW8A 4C4AA 4EJSB 5B6IA 2DETA 2FA9A 4LZNA 4ZYTA 2FEXA 4D26A 2XD9A 2XT6A 1JYFA 1OZAA 2OXIA 4R2HA 1QH9A 2I6SA 3Q9LA 3ZGNA 4NI5A 3AM4A 3CRZA 4CEIA 2OQVA 3HN2A 1FUIA 1KFJB 3B2EA 4O08A 2ATXA 1OZ0A 4KX3A 2Z95A 1P5HA 1N2BA 3ETCA 3THWB 4TOIA 2DUUA 3JRXA 3KG2A 1FFAA 4NH0A 2X14A 5E4TA 4EEZA 4C6RA 2CXOA 2WP8J 1A8SA 3NXKA 7YASA 1HETA 1UK9A 2QW1A 3FKQA 1UKVY 4YN3A 4KFCA 3WOVA 1MW9X 5MF6A 4ZRNA 2UZ3A 4NF2A 5A6SB 3T94A 1QYXA 3ASUA 1RJ9B 3A2KA 3ZGLA 4QDTA 4C7OB 5D3ZA 3EG9A 3LZDA 1ESMA 1SU8A 4HF7A 5A4IS 3PU6A 3S1AB 5KNCD 3D54D 3WRXA 3ONDA 1NMQA 1WPXA 4U2CA 1MRZA 1E1QA 4X1YB 1ID8A 4P3XA 3EVZA 4Q9HA 3DBIA 4M1KA 1EFAA 2EZ9A 5A71A 3O7WA 3L02A 5C34B 4BJHB 3ZCXA 3RRNA 1MNQA 2YUIA 1PBTA 2C20A 5KC9A 3SBOA 2AX4A 2OHXA 3HS3A 4PR3A 4IUBS 3CRQA 4D4MA 3TN7A 4YRSA 5DWVA 5EG5A 2Z2YA 1KVSA 2BLNA 1HE5A 3KT6A 4TRNA 1X1QA 2E49A 3E9NA 3MTIA 3Q8LA 3U31A 1P33A 4G5GA 4WY8A 5IG2A 2Y0DA 1IQRA 2WWTA 3BYZA 1L5OA 1YJ5A 1MIOA 1YFZA 2D2XA 3DGFC 4JVOA 4QHTA 2FRVA 4DADA 5D5PA 2FHPA 1T26A 5BQ5A 2AR7A 5EIWA 2FKAA 4XI9A 3M5WA 5H4GA 1DJMA 2YWFA 4KLAA 3JPWA 4KPEC 3O4IA 3ZEAA 1ORTA 1FIUA 3GJTA 4J9VA 4P4UA 2EU8A 3IAUA 2ETVA 4LMRA 4YPFA 3UAGA 4A0QA 1UC5B 4XWAA 1SXIA 4JB8A 3A58B 3PFGA 1RYYA 1KVRA 2VRCD 4R69A 3WDMA 4MA5A 3T1TA 2R5FA 5C8DA 2NU7A 5DCWA 1G21B 3LYAA 5G0UA 1BVYF 2ZJ0A 3HGMA 1KAQA 5I45A 1Z2NX 3CNEA 3OZFA 1DAPA 3WHPA 4FZVA 5CVVA 2P3OA 2DAPA 2EJWA 3ZDDA 3U6KA 3RWMB 2XCTB 3GLKA 5EYPB 3UTCA 3VO9A 2XVMA 1NLUA 2YFKA 4FYYA 5ANRB 4BPRA 4DGSA 5ICFA 3OJ0A 4BL5A 4B3TB 4QWMA 4HNSA 3SIPA 5AK0A 4LWZA 3G7UA 4ZYXA 3MTAA 3WB9A 4Q0MA 4D9BA 1OAOC 1FXSA 2WYHA 5ALSA 3FTFA 1CS4C 1OC4A 1OU4A 5L4SA 2A4KA 4FEYA 5DH9A 1T0BA 1GG8A 3W8NA 4ZU6X 2BKVA 5ITVA 4I9GA 3RUEA 4R9SA 5IASA 3HDVA 1B76A 1GD1O 5C1BA 5C3MA 4P34A 1ZOLA 4ADSG 1VL2A 1GA4A 3DNFA 4FDMA 3E4CA 4L78A 1A9OA 2VVTA 4A6PA 2OCLA 4RL4A 1CJKC 3KCQA 3SQXA 2VFAA 1SFRA 1G3QA 1LK7A 2ODPA 2Q4DA 2VKQA 4LOAA 4MJLA 2ILVA 3BWMA 1OB2A 1UXIA 4LIPD 3GNSA 3H87A 3DF7A 1I0LA 1ZCAA 2FW1A 4TX1A 1BE8A 3PXBA 5J58A 4ZD6A 1YTLA 2X58A 1RAGA 4A27A 2CDRA 4N1AA 4A5OA 1GL7A 1P1CA 4FTWA 4MAAA 3A3PA 4E5MA 1E2GA 2XA1A 1GNRA 4QGBA 4ARZB 2XOKA 1IM2A 2PUTA 4XJVA 3IUMA 3OCZA 2YXDA 4IIVA 4OJYA 4E21A 5EWMB 2G7ZA 3BA6A 3MLAA 5F35A 1JQ5A 1G38A 1G20A 2VP9A 1DFHA 4L2IA 4HNQA 5B36A 2FSPA 1MQ8B 2HV9A 4QM7A 1CE8A 1P60A 1KXZA 3KXIA 3LKZA 5ILQA 1G5HA 5ALHA 1Q7RA 2QN6A 1X1RA 4F3TA 2BR4A 2HH9A 2Q21A 4M6WB 1I7DA 1DBRA 3HUTA 3NC4A 1DC3A 1L5YA 3OZTA 1SUBA 2D1QA 1T1SA 1GEEA 2V3WA 3UXHA 4EO9A 4KC0A 4Q7QA 5E2AA 1QRTA 3BDVA 3M83A 2BBTA 1V5WA 2CJYA 2EKDA 3VVCA 1OIWA 3RRBA 5B6JA 2Y1LA 3K9HA 1CVRA 2CUKA 4ENVA 4GIBA 1WHTB 2VT3A 1ZQ9A 4QAJA 4C4PA 3ZQ6A 2X0JA 3MOIA 3PF8A 1JQJC 1GQQA 4MPRA 3D3KA 2JLCA 3EIUA 1OOEA 1YE3A 3L01A 3NBYC 4CIWA 1KNQA 1GILA 5AFSA 4NENB 3ZWVA 1OXVA 2A33A 2X9NA 2X0DA 5BW4A 4K9DA 3RAPR 3T9FA 1IHPA 1OBVA 1WLYA 5JQGA 2XNSA 3HR7A 3T9AA 2AEJA 1VXOA 1SXGA 2AB0A 1KDPA 2WFZA 1P8JA 1MX9A 5JTTA 3ANLA 3FDXA 3O4FA 2GAIA 2ZR7A 3PCXA 1RM5A 2ZYHA 3OMLA 1M2GA 2BM0A 4NMXB 4HDNB 5CBPA 1RT9A 2DCUA 1ORHA 3AJAA 4MKRA 4NZMA 4RD3A 1KK2A 2BY4A 3GAZA 3ZHCA 2XMPA 1Z0KA 3L8ZA 3NTOA 4XKJA 2ZS7A 2G07A 3OQ1A 5BNTA 4QUIA 1Q0HA 1D1SA 3ACDA 1T2VA 4YV2A 5IPFA 5K8VA 3GLFB 1H2FA 2FZVA 3ZHQA 1M0SA 1XZCA 5JYCA 2JH8A 4RH1A 4TPKA 4E5KA 1MB3A 2WJWA 1NFQA 2H7XA 5CPFA 5IKXA 5TMPA 1KRXA 2YHUA 3U0BA 5TGDA 4INPA 3RYCA 3GCDA 1X74A 1OLSA 3D8SA 1DTEA 2OENG 3GIDA 4OSOA 2HC9A 1D2RA 4DQLA 4XVHA 4DDTA 2YXBA 5IK2D 3OAAA 3OIVA 3VVMA 2GLUA 2XDAA 1VMIA 3H1GA 4HRXA 3AF6A 1I9CA 2R9VA 3FNGA 4Q4AA 2R8OA 2WE7A 4QREA 4CEHA 1KOGA 5CXXA 2YFHA 4DKXA 1D2AA 2AX3A 3EZYA 1EVQA 3A1FA 3LZCA 3H6KA 4PZYA 5AM1A 1V71A 1AHHA 2B8WA 1BXZA 6Q21A 1HZJA 1KSHA 2NVBA 1XIVA 2A3NA 3ZIUA 1N6OA 2CZGA 5COQA 4K6HA 4HYYA 1DBWA 1PZFA 4OHRA 1TZCA 1T4CB 1SUFA 1Y6RA 3I1YA 4AS3A 5KQLA 2WZDA 4CL2A 4ZV4A 1H1DA 3RARA 3WR5A 4KRFA 1JG3A 1XA0A 1AGNA 2RMKA 4BMOB 4A23A 4YJ2A 3KJEA 1AV6A 4DWJA 2QAGB 2PMBA 2WD9A 3SD7A 3WXMA 4OHOA 5L7YA 1GCUA 4JJ6A 4WXMA 3RG2A 1E6MA 3TLZA 3LP6A 4A5SA 1DKLA 4DLBA 3HYNA 2Z2IA 4KX5A 2HMTA 2BBOA 2MSNA 3UGKA 1U0EA 1E94E 1SCDA 4XQEA 3RS5A 2CDNA 3MWDA 1WRBA 2X9GA 1H9AA 2Q4OA 4IJUA 4X6XA 4BQOA 2CF5A 2BZ1A 1VIAA 2Z4SA 2FPGA 3CKKA 2VWQA 3OPYB 4A2WA 3OPYI 1QDEA 3BH0A 4NCHA 2QR5A 2HO4A 1E2PA 2C5EA 4WJLA 1CU1A 2CUTA 1VDZA 4LZPA 5JH7A 2O48X 1M6HA 2WF8A 3C1OA 4YWHA 4BFSA 3KUUA 4MIOA 4OQYA 4ZMSA 5A7FA 5AJWA 3C7DB 3KAPA 1U94A 2HY7A 4GI7A 3WGJA 4PNEA 1ZSNA 3I58A 5K9ZA 1MB2A 2D1FA 2AV6A 2VCHA 2A9FA 2R85A 3QXGA 3WTCA 4II3A 2GB4A 3M33A 1WUTA 1G8GA 1K86A 3E6AA 2E0IA 3FJ1A 3PJEA 3Q1LA 1ADCA 3ICOA 4J9UE 5AK6A 3BB4A 4PLWA 4Q21A 2BGUA 1XLTA 1Y5MA 4ZP1A 2H29A 2Q5OA 3ENQA 5T57A 5CA1F 1O94A 4MUGA 4TWRA 1HQKA 2Q9BA 3R7LA 3GP8A 4RDXA 3UV3A 2BMDA 1Z47A 1Z7GA 5HE9A 4OVKA 5JZOA 4EW2A 1XRNA 2H2AA 2FJ0A 2XYVA 4XPIA 5FOQA 3Q15C 1QIMA 1QV9A 2ISSD 2XMBA 1JH8A 1KAOA 1GFIA 2RSLA 1OIVA 2AA3A 5ALFA 4G0NA 1XCOA 3CBGA 4WXHA 1VPDA 4LFAB 2RGCA 2IY7A 2J3KA 4MQFB 2LKDA 1A9XA 2V7QA 1TECE 4MCIA 1RZVA 3E9QA 2AT1A 1PZXA 3QF4B 1X92A 4Q4DA 5AM5A 8LDHA 2KBFA 5JSQA 4HYEA 2VNHA 3ET4A 4ENPA 3AVOA 1XLUA 2Q5JA 2O50A 5KYKA 4GP7A 1ORVA 3MINA 2E4ZA 2WF9A 2JZCA 2DWQA 3OOJA 4MEJA 4YRBA 1FNDA 1BCSB 1YB5A 1TGVA 5G0TA 1B0AA 4B6FA 1CUYA 1VPTA 2GD0A 4JOCA 5TDHA 1U2DC 1UFKA 1N9KA 4TKUB 4B84A 5J47A 2IEIA 1F7VA 2ZJ3A 1AGXA 1K7CA 3AIIA 3L40A 3TKYA 3HXOA 2VZ8A 1P3Y1 1MEEA 1SCUB 5CEJA 3NOVA 2GD2A 4G07A 3RJTA 2QPAA 1V3QE 3KPVA 3TDNA 3KUDA 2CW5A 2HWUA 2CVZA 4ALLA 5HQ3A 1QUEA 1SHLA 1AKVA 1WMSA 2GSWA 5M34A 5LQAA 3HSSA 1PUJA 3AI2A 4UBOA 4B71A 4R1MA 2LZ0A 1UDWA 3HWRA 4PVDA 4XGKA 4JC8A 1LJ8A 4Y1EA 3J81A 3FSEA 3D6JA 1YT5A 2HU7A 1IUOA 5EAIA 5HK9A 3X0DA 1JQ3A 4DSUA 2CJWB 1H5UA 3SE7A 2P1DA 3SKXA 3OP4A 2DE0X 3NBXX 4LXGA 5DGHA 4QTYA 1Z5GA 4ZZ0A 3X2FA 4GMHA 1L5HB 4MWOA 3OSZA 1II9A 1QOPB 4LDJA 2YRWA 4RPGA 5FOVA 2Q49A 3AVQA 5T6MA 3RFCA 2B4RO 3FTNA 5KQGA 2V59A 2GAOA 3DG9A 4RA9B 3D1LA 4KP7A 4WZAE 5DLEA 3TO5A 2EHJA 4EEXA 2D54A 5DXJA 1BMDA 4F96A 5JJBA 2OL4A 2Z83A 3F6YA 3K8ZA 4FIDA 1U2RA 5FUVA 4ZEMA 3NRJA 5HZHA 4ZOLF 1RFLA 3ICWA 2WJ3A 4K6MA 2IY8A 2BHLA 3CF6R 5K4GA 2PGIA 4PFSA 4KODA 4BNDA 1CUJA 1EDOA 1XJQA 3GRVA 4M46A 3MIIA 3K09C 5BY2A 4N5NA 4TTRA 4ZVSA 1LJUA 1A04A 2XV1A 1NQAO 1YFKA 3DFKA 4M8IA 5IWAB 4HPJB 1RHMA 2AEMA 4G4JA 1ZGCA 1ESDA 3TXAA 2VZEA 1G5PA 3FKJA 4YASA 4OBWA 2ON6A 3ILVA 4XUDA 3IX7A 4O2AB 5J2UB 2RG1A 1TW2A 1U31A 5HKKD 1NUPA 4YH1A 1P77A 4I99A 2P79A 1SBHA 3ODGA 3A6LA 2GPSA 3TRJA 4V1CI 4YJHB 4BLTA 3BF7A 4X7RA 4MQUA 1L3CA 1M5UA 2J4DA 4I55A 2Q8QA 3EAQA 5AW6A 3KBOA 5AW9A 1FYEA 1EBFA 1JB1A 2IIPA 3VZBA 1OBHA 3ZQUA 1Y4DE 1I4DD 2UZ1B 3UJ6A 4BB9A 3UMBA 4ER5A 3AI3A 3K0KA 1RQGA 2FGJA 2I6FA 4BO0A 3NHSA 1RHRA 4P5PA 4OL0A 4QT4A 1N2ZA 3EQ6A 4V39A 4XWKA 1YBMA 5JMPA 1IMJA 1FRZA 1PWXA 3Q7TA 3MRXA 5LXTF 1SQFA 4AJ1A 5EA2A 1XKQA 2AD1A 2PZGA 1S02A 2UYOA 1O6FA 3BJRA 3C3XA 4KVGA 4QKQA 3NTVA 3I6IA 3S7TA 2ZZNA 3UATA 1J25A 4JLDA 2B98A 4FEAA 3UTDA 4BV9A 2R8BA 5JBNA 4BMPB 3DZCA 1U1IA 1CNMA 4TN1A 1N34B 2JAQA 2O8VA 3VMFA 1UDXA 4AZVA 3LK6A 5IANA 4XDZA 4LY6A 3ANMA 5T67A 4PC6A 4ARCA 1KKMA 3W06A 1MC1A 3D8RA 1JHXA 2I8LA 3NBZC 3QKRB 3LGSA 4L3VA 3VDQA 1PFYA 1AVTA 2ASEA 3PR1A 4HB4A 2V8BA 3BH7A 4WXPA 2DT8A 3G6KA 1RM3A 4P7JA 1JDVA 2IEAA 1LF0A 3VVLA 3WGNA 1CXZA 2Z2XA 1H65A 1J2YA 4IIYA 4L0CA 2UUPA 3BH6A 5TNXA 5EE3A 1VHJA 2BGRA 5KX5A 2B4AA 5HF5A 3G3EA 4OJTA 4C7VA 1V37A 1E2JA 1FSZA 2ADMA 3I53A 3NVAA 3SEAA 1G98A 4BLPA 1UJCA 4QICA 1IY8A 1RAEA 4X61A 3SNHA 3W2GA 1OZHA 5F5NA 3PBKA 4E30A 1N1DA 1H2YA 1NUAA 3GDWA 3V3KA 1PR3A 2B2CA 4JS0A 2ZCJA 5EP4A 3LDGA 3PCTA 2QTGA 1FFHA 5IW8A 5INTA 1GY8A 1NLFA 1ORRA 2ZP1A 2KSQA 2OBLA 2RGDA 1N1MA 2QX7A 3S70A 1ETHA 2HLDA 4Q18A 1YKFA 2KWIA 3GEPA 4K9OA 1EIWA 1HQYE 3AJRA 5H68A 3A37A 1MC4A 1NRXA 3HP7A 1PKEA 1Z0IA 3IV9A 5BRAA 1L8OA 3NFRA 2VJDA 4HGYA 4FONA 4JN6B 4AY5A 3BMOA 3T1OA 4KSCA 4I4CA 4Q4HA 3CNQS 3MB8A 2PL1A 3NU1A 1TJ3A 2IYNA 4PM4A 3EGDA 2E55A 5FORA 3SHOA 3TAHA 1ZD1A 2IX3A 4JL8A 4MW9A 2V7XA 5JXIA 4OQNA 1DWUA 2O7RA 4NK5A 1PEAA 1MX5A 2CL7X 1SBIA 2QNIA 3EEBA 3EGWA 3KEFA 4L15A 3KOXA 4MCAA 4DBZA 5IXYA 3E2PA 4EQ6A 4K6CA 4MCHA 5U4QA 4PC1A 5JQWA 5AW1A 2PBZA 1QFZA 2CEAA 3GFVA 4M8KA 1NJ5A 1OE0A 2AMVA 5F1OA 5J2TF 1ACJA 2JAPA 3DL4A 1Z0DA 4JJ8A 3HBJA 3IO5A 4IDNA 4O4LA 1P2BA 4BKUA 1M2HA 4CMJA 1O6BA 1EA5A 2GAFA 4XYBA 3UBMA 3V32A 3HUUA 1VE9A 2RONA 3G0HA 3IIIA 3QVGA 4J29A 1SBYA 4JLUA 5DRTA 1D6NA 1DLIA 2BF4A 3WSWA 1C30B 3ZQ4A 3H2YA 1KR5A 1XKLA 2C5LA 2HKIA 3H5VA 3QVOA 4G01B 3VSBA 5E8JA 3RTBA 4RHYA 1UAGA 1Z7BA 3LBFA 2ZRDA 4WZZA 1EDEA 1R88A 1NBHA 2KE5A 3KZMA 2PZJA 4NPHA 4RYDA 2QQEA 5DTJA 1P4HA 1G7SA 2AYZA 2B7LA 3D2LA 2C0PA 3N5CA 4W9NA 3AEUB 3ZDZB 2W48A 4AG3A 4ZJPA 4H77A 1JN0A 1U63A 3IS3A 1NVXQ 2NQ2C 2FPOA 2JAXA 2PMKA 4XYMA 2AFIE 4F4UA 1NN5A 5ADWA 3GEHA 3SOPA 3GT0A 4B87A 5CCXA 3VPFA 1NOIA 3H5OA 1CRQA 2PKQP 1Q50A 3CEMA 1B8NA 4CKZA 4RBNA 4X62B 2BEVA 1AU9A 3O94A 4RMGA 5BW8A 3WK8A 4HNVA 1HL3A 1S2DA 1YR9A 3FROA 3II6X 1YQEA 2GS9A 1RXIA 1WCIA 1JRLA 1BROA 1QZXA 5JO0A 1XCMA 1QQ7A 1SXJE 4NXNB 1MZVA 2VNIA 4HN9A 1GTG1 1MPTA 1A5SB 2OGUA 1W76A 4LA4A 4BO9A 1ZHFA 1O95A 3CH5A 1GTJ1 4YX9A 1KDYA 4B6GA 1NR5A 4RZUA 1X80A 1Z88A 4TZTA 1QE3A 4XWYA 2YV2A 4EKGA 2IH2A 1GRRA 1Z7YA 5EZYA 2J5XA 4RLQA 4COOA 4YCDA 7ABPA 2C7QA 3ZD6A 1JF8A 3DCNA 3H9CA 2OKGA 2R1VB 4GR9A 1VJ1A 1T4MA 3S68A 4PF1A 3FLAA 2LNDA 3IYLW 3LQKA 1D2EA 2I0FA 4IJVA 2NU9B 2O3SA 2PH7A 2Z6UA 2BFBA 1T36B 3ADPA 3IHLA 5IYZF 5CFNA 4EJMA 4BC0A 2FZEA 3AMVA 1D4FA 3CPSA 3IESA 3KHKA 1T1EA 1IRIA 4CQMB 4KXFB 5KQSA 3WLFA 5FYDA 1TTQB 1Z4OA 3KAKA 5KWJA 4NL4H 3OHPA 1H69A 1C1DA 1I4LD 2YCBA 2VSOA 1ULZA 1W2GA 2D3WA 1W581 3GJSA 2CFRA 3CXRA 4KQ6A 3M5DA 4W4TA 3PV0A 1E3JA 1G6Q1 2QTTA 5DNCA 1Z6XA 2QS9A 2ZVDA 3QTBA 4OHUA 1TMOA 1AKRA 1VJGA 3Q2KA 4IPTA 3AR8A 4YALA 2V9ZA 5F33A 4D6XA 2HJHA 3BJZA 4O8CA 4IY1A 3GQBA 3WLOA 2SHKA 5HGXA 2ECQA 5AKIA 1SHKA 3TUJC 4RTSA 4CQMD 3W5IA 1CUBA 2A14A 2ZRNA 4LDPA 5FEUA 2IIVA 3STUA 4L5YA 1NVFA 1IVYA 1LPOA 4FW8A 2OV2A 2IHTA 3V48A 2ZLBA 4MV0A 1QORA 4JP1A 5EUMA 5CLIA 3S27A 4C06A 3SR3A 3HP4A 4B6SA 1SC3A 3NJ4A 4UHCA 1IUNA 1FLAA 3CY6A 4ZJZA 1ENPA 1U0GA 3I8SA 5HF8A 2X1LA 1P1BA 1BU5A 1QFXA 1UL1X 5ALQA 4WK6A 3W6OA 4A3SA 3GJ5A 5I4KA 1DJPA 1RS0A 1WTAA 2QAIA 3QW2A 2FI1A 4JKIA 2ZIZA 4M1EA 1TF7A 2HJSA 3GBSA 1KH3A 3Q5EA 1OF1A 5DXFA 3QVJA 4LI0A 2C5AA 3GRZA 4MR9B 1CDOA 3L7LA 2HYIC 3UEOA 3EGCA 4D3FA 2QWXA 5KYWB 4JEUA 2IHJA 4LJAA 4O4HA 4Z9BA 2VPPA 2IC5A 2QZZA 2HNAA 4C0AC 2GZ1A 4GDMA 1PZMA 4EM6A 3A4NA 5EVJA 4U2KA 1X15A 1HYQA 4HHEA 5ESWA 5L3ZA 1ISGA 2F3SA 1V7CA 5D7NA 4AKGA 4WTOA 2HCJB 2C4HA 5FTKA 2ARKA 2C8KA 1X0XA 3OA2A 3Q41A 2XUIA 4NESA 2HR1A 5JWRA 1JAXA 4NYIR 3W90A 2Q2NA 1E4YA 4H7KA 1Z7EA 3HB5X 3QSGA 4RJTA 2ZUFA 1UT8A 2FQ1A 3UB3A 3ZE2B 1NY6A 3M7IA 3JVVA 3D3WB 5DIZA 5HKOA 5KMGB 3PL1A 1RZRD 2BP7B 4JJEA 4TV8B 1E7WA 2Q27A 5TEWA 4BMXA 1Y48E 5KO2A 1WETA 4R2XA 4EI7A 4QL3A 4DLVA 1M33A 4URHA 5IT5A 1W59A 5CB4A 4KU4A 3U7QB 1EQAA 3L82B 3NM5A 4AULA 1V16A 1ZITA 3TLEA 3ANSA 5D00A 5EKDA 3MWYW 2AN1A 2QIPA 1J9ZA 3A7DA 3JQ8A 1V2HE 2VO1A 3IPRA 3BXEA 3SLGA 4IKOA 1K8RA 4PO1A 1NQOA 2WKQA 3UXYA 1FB5A 2BJWA 2P27A 2Q41A 3G2MA 3LH5A 3O8LA 5ALMA 3WWEA 5J5VA 4I5FA 4Q15A 1L4GA 1SCNE 2JD1A 3BWYA 1HDYA 3FMVA 2JIRA 5FKJA 5BR7A 5JEEA 4WKCA 4P53A 2D7DA 4GGMX 4GZ6A 5JMWA 1M6VA 1T9GS 4KE8A 2J7PA 2W11A 3M1YA 2MSLA 4TVBA 2INGX 3EODA 1JVBA 1YZGA 2NSJA 2ZWMA 4Y30A 4F6RB 3BIFA 3H86A 3IRVA 3FZQA 1P7PA 1NXXA 1CKEA 2V4MA 4TKMA 3BICA 4Z3DA 2C5FA 3HO8A 3SQWA 2Z6VA 1Z83A 2CXQA 3SFZA 3UT5A 1BMFA 1ONPA 1F2UA 3Q6NA 4LQLA 4QPJC 3W2IA 5LDDC 2PRZA 1Q1BA 4DC9A 4NTZA 3MT0A 4KUEA 2Q5CA 1AB6A 1E1MA 2ZBRA 3BKXA 2FG6C 4I1RA 5D3QA 5J63A 3RV4A 1CK4A 1SOAA 4XVUA 3JD3A 1Q77A 2J9RA 1XZDA 3IA7A 1U2TA 4OL9A 2I1LA 3ZZTA 3KSZO 3U7HB 4OJMX 3QEKA 2COUA 4CT4B 1Z33A 1O8CA 2H9AA 4KTVE 3KETA 2DTDA 2GVDC 4EMSA 4CTNA 2IKSA 2QN8A 1KWGA 1R6VA 1UKEA 3CRNA 3R2JA 4EA6A 5KOHB 4B4VA 2N9UA 1L4HA 2Z5GA 2IGBA 1XN1A 1WU8A 1ZMOA 2EBUA 4HNAA 4YRJA 4DXAA 4MWTA 3K9CA 4X20B 2OCAA 4PYQA 1BD4A 5TMEA 5JD5A 1R0YA 4D2IA 4JVMA 4U2BA 4RW0A 3EZXA 2M6KA 5ICGA 3UJAA 1XD8A 1BRMA 3LMKA 2JGEA 1KPHA 4KNWA 1DAKA 3DJFA 3JPYA 1J90A 1X7HA 3MNFA 1J4AA 2QVLA 3H6GA 4RMIA 3PWZA 1XVUA 1GQRA 5F3DA 1JAHA 1TADA 1BW9B 1G1MA 1K27A 3R5TA 2PGDA 2HF9A 4WACA 4FR0A 1W73A 1R9NA 1E7RA 2EZUA 3TD2A 2EV9A 3BWBA 3F78A 2FW8A 2RARA 1UP6A 3Q3IA 3LQQA 4FYJA 3ZV4A 1APBA 2B2NA 5D5QA 1VSBA 2Y1EA 2BGLA 2ACWA 3F4LA 5CDFA 1G5FA 2J3LA 4H6XA 3AF1A 3T54A 4EPRA 2PLFA 4I6EA 5HM8A 1U3TA 2H0AA 2R8RA 3D2AA 4NE2A 4A73A 2C9DA 4YRFA 1ZCZA 1PJSA 1PO7A 1ATIA 2Y1KA 1MRNA 2VBGA 3H18A 3JQAB 3KYCB 4MA4A 1HKUA 1N6RA 4GKBA 2H7YA 1PW7A 1RMQA 2D59A 4I50F 4MVXA 4BFYA 2WU8A 5FUBA 4EYSA 5KYYA 3K1TA 3ZJYA 3KYDA 5EFZA 4KG7A 1XNRB 2O59A 1XLTC 1YJ8A 5HFAA 2GCGA 3MM4A 4MGHA 1AF4A 2I67A 1YR8A 5CMLA 3C5CA 5K0GA 1EGVB 5LQKA 3L05A 2JLZA 3T1NA 4BVJA 3ADOA 4NBTA 2QL6A 3CUSA 5EE0A 1SIWA 1GPH1 1UZLA 5DM0A 2VYCA 1KYXA 2YY7A 3NIWA 4TLBA 5A9RA 1BQEA 2W6PA 5JCZA 3H2GA 2JF0A 3DOOA 1VG8A 3CXUA 2YVQA 5HP4A 4F45A 2IZZA 2Y4NA 3HXPA 3ANTA 1NOJA 3NWOA 2QN2A 4LE1A 4UD6A 4XAQA 2P69A 2K7FA 3N2GA 1VLZA 3PUWA 3ORQA 4GBJA 1MB4A 4DNQA 3PQ2A 4AMZA 1T3ZA 1XTSA 2D8AA 4RKQA 1YONA 4LCJA 4LOHA 4EFLA 1LPNA 4TM7A 3MT7A 5HILA 5KVCA 1IOVA 3PGMA 3D43A 3LO5A 5D87A 1ABEA 2H65A 1YZHA 3C87A 4WVLA 1NTRA 4MUYA 1JE1A 5EFOA 1NKTA 1Q17A 2GJ8A 5L7WA 3WXBA 2J3JA 4AO7A 3SHTA 5BT8A 3ZHSA 1ZOIA 2ZIFA 4RK6A 5F4ZA 4A2QA 2YC4C 5BR4A 2Y71A 1GGEA 1O9GA 5ARBA 4RL6A 2PT6A 1PT7A 1Q0SA 2NO6A 5BSTA 5M04A 3NBQA 3A6ZA 2R60A 3ECSA 3WYEA 4EPTA 4G1MB 3WE7A 3QWBA 4X9XA 2HTFA 2GBPA 2Q2OA 2Q3LA 4H08A 4QXPA 3DBHA 1MFZA 3FHLA 3MMXA 1UBCA 4MZXA 4YDSA 1K89A 1Z5UA 3MAJA 3LLVA 4GXNA 3ANNA 2FMXA 2GKOA 3I4FA 1IPFA 4IV5A 1X3LA 1IE3A 4QARA 2CXNA 2XRMA 4BNLA 5ICSA 1G4HA 1HEUA 3LD9A 1TB4A 4KDFA 1V25A 4XCQA 3W3AD 5BUSA 1N0WA 1B6SA 5JYDA 5JXGA 2FTKE 3JYQA 2X2OA 3ZXSA 1EPUA 4TV9F 3KU1A 1C7FA 4RTMA 3EVTA 4ESVA 5AO9A 2G5TA 5BWNA 2P6MA 2ZRIA 5BOSB 5H9VA 2BFFB 4H1UA 2GASA 3RRZA 2QRKA 5B57C 5IDWA 5BWLA 1O4VA 3MEQA 4PTYA 2I87A 2PZAA 5CK4A 3RGGA 4ZK2A 1WPRA 1J07A 4F1KA 5BWMA 2N46A 1UZAA 4KPUB 1JMVA 1KFBB 3RRYA 2NO1A 4DBVO 4EVIA 4Z1MD 5FDFA 4YBRA 3T5DA 2I4TA 1SC4A 4IINA 5BYBA 4EL5A 2JS7A 3BTSA 4C0BA 4EI2A 3UPUA 4DA4A 4OMCA 4LI3X 2JGDA 3P2YA 1DMSA 3LTEA 4RVCA 3DBOB 3F7NA 4D46A 3BMQB 3VOTA 1ND5A 1YNSA 1TT5A 4PZZA 4B6EA 4DLWA 1BKDR 3T0GA 5IUNC 2FQXA 1GPKA 3PPYA 2FMUA 5DOVA 4RAQA 3AY0A 4URVR 1JIVA 2PBRA 4YJKA 4G26A 3ZWQA 2QORA 2Y1WA 4Y9SA 3DMRA 3ENKA 3D8BA 2CGEA 5I8WA 4AY3A 1QOQB 3PEWA 3CVYA 3V9AA 3DP9A 1GHTA 2WJAA 4JP5A 1SBQA 4GT1A 3DKPA 1S2NA 3U0VA 2YJ5A 2C7PA 1RP1A 3B6MA 3U2QA 3SM9A 3M81A 3FFXA 3FR8A 3SYMA 3TI7A 3I5UA 2FW9A 3GROA 2Y93A 3PX7A 3BQMB 3HG7A 3TLCA 1E20A 3GWGA 2XLBA 1A8PA 3OT1A 4EYKA 1ZFNA 2BHTA 3V4FA 1QR2A 4BCDA 4WEOA 4DJDC 4HY3A 3DDSA 4J03A 4J07A 4OXXA 1XEWY 4R1UA 2OOSA 2PJUA 1VKJA 1CHNA 3AVPA 3MPOA 4QVKA 1LSSA 3JWIA 3S3TA 4MV5A 1H4SA 3UOWA 1TZMA 3ZHVA 1FXUA 1VG0B 1NBOA 3ZD8A 1VLLA 4U9IS 4YP5A 2Z8XA 5K0FA 5KINB 1QFJA 1ZGAA 2JKYA 2YICA 1XDBA 1ZUNA 3CGGA 4UHKA 3VJLA 3NT5A 4MSUA 1FDUA 1QK5A 2FPSA 2WWVD 2C2XA 2WJ6A 4C22A 1J20A 3N58A 3GLIB 3I6QA 2EKBA 5IN5A 4E33A 1BE6A 3E23A 1TM2A 1JPJA 1JS1X 2XKAA 5FAXA 1CD5A 2JATA 3DM9B 2K7ZA 1BKYA 2C97A 1IIBA 1MC5A 2CFIA 2DWUA 3DFMA 3K8YA 1KAGA 5LB4A 1HYGA 1OD6A 3QEBZ 5BSRA 1SZPA 1F20A 1NVEA 1K7FB 3O93A 4I5DA 4XEUA 2JJMA 4KMOA 2WDPA 3S1LA 2G1PA 4C4RA 1C7QA 2XCRB 3KL4A 1VRCA 3HKEA 1Q1AA 1U9IC 3E70C 4UFOA 1UQTA 3WGOA 5FWYA 1YHNA 5AOVA 4H3HB 4A6EA 3F4BA 3UKOA 1QPZA 4AKTA 1AUPA 1VSQA 2BD0A 3QNWA 3VHLB 1UP4A 2HT1A 2VCEA 4RSHA 2Y8EA 2VPYA 1K75A 5K3OA 2VJNA 2Q8PA 3EZFA 3HA3A 3TSWA 1CF9A 1E98A 4Q1CA 5KSWB 4OHVA 2WYIA 3RIMA 2RH4A 1XGKA 1PLLA 4HUQA 4QYTA 3UB2A 2C88A 3MD0A 1T5IA 3AI1A 3NUGA 2ZT7A 1P0CA 3EC1A 4FGSA 3CPJB 1P5JA 1VCMA 4IRMA 3MOSA 1NBME 4IIXA 3SJBA 1GZHB 3QPDA 3MTBA 4Q3OA 1U7PA 3EGIA 1MO5A 2PZKA 3NGLA 4AP5A 4FQ8A 4JYZA 2SKDA 4J3NA 3VX4A 3E82A 3O1HB 4OOEA 4OREX 1QVWA 1TAGA 3N75A 2I4RA 4NCNA 3U9LA 2CCKA 3UK1A 4AS2A 3NBAA 5C31A 1HG0A 2VP4A 1CRPA 3R7FA 4EH1A 4CEIB 1TQ6A 5AXBA 3CINA 4FOLA 4QDJA 2ZU0C 2GOYA 4B4OA 1I6KA 3N2NA 3TVYA 5FWXB 4QO7A 2V5AA 4E51A 3IVAA 3SCZA 3ZTTA 2FMTA 1VE7A 1HNWB 2Z1MA 2OAGA 3F6CA 4F9FA 4EBFA 2R751 2BM1A 2DUJA 3DVQX 3HVJA 3Q88A 4ZDJA 1H6BA 2B1QA 2XI4A 3OT5A 1V48A 1Y4UA 4D79A 1T6BY 5DHRA 4JXZA 4HDOB 3TW6A 4PTZA 1NYTA 1WDMA 1TQ8A 4QJ3A 4MXDA 3T35A 3QBVA 4HR7A 1PK8A 1PL0A 2HREA 4G67A 2RC5A 2ZTVA 4MJ3A 4A6DA 3EG9B 5ED0A 2AMYA 2IP4A 4JBHA 2NADA 4PIMA 2XUHA 2W6OA 4HSGA 1GPUA 2J59A 2ZSHA 3R40A 4IZHA 1I3CA 1XMVA 2P11A 1YH3A 3SYKA 1CUUA 3WWYA 1TOAA 1TCBA 3Q3JB 4D5EA 3KQHA 2ZB2A 3C5VA 4A0FA 1OTHA 1OVMA 2ATIA 2J5QA 4JBIA 4KQ9A 1XP8A 3FCSB 3BCHA 4CMBA 1CDZA 1PWHA 3W5UA 1NSTA 4ZICA 3N2EA 3KQSA 1CQWA 1JT9A 3K71B 1XZLA 1DUVG 1PZHA 2EL9A 1QDUA 4OG2A 4BFZA 1LBQA 3OEED 3EPKA 3AVUA 1TW3A 3WLTA 3PUVA 4F4IA 1MIOB 3RAFC 4R8RA 2QZPA 5IULC 3EFOA 2P90A 2X8WA 3FTPA 1E1QD 4DQDA 2D5CA 2BIFA 2KLBA 3NHAA 2A0UA 4U7TB 4LZWA 5E9QA 2ZU6A 4R1OA 5FI0B 3W5DA 1QP4A 1SH7A 2C2ZA 2VWPA 3UOGA 3GJZA 4W8OA 1JECA 2FW0A 3R3HA 3U3ZA 3KKLA 3SBXA 5I4IA 4F3KA 4G0WA 2X0RA 4IJKA 2X1HA 3RQSA 3SJ7A 1AGYA 4L9SA 1GG2A 4HXFB 1IVSA 3GC6A 1NKVA 2CCJA 1W94A 4ZVUA 1QIJA 3DVSX 4QXOA 1ZCBA 1JFFB 3EQ7A 3UJBA 3QX8A 1ANKA 1GU0A 2OAQ1 4UASA 5F1PA 1CZKA 4D8WA 1U3WA 5KVVA 3ACBA 2QVZX 3WB0A 2NU7B 3AERB 4C14A 4DPKA 2GILA 4R2MA 3BXXA 3G5UA 4R0NA 2I03A 4WNCA 3PC6A 3G17A 2CLSA 4BQNA 3LBHA 1LVHA 1EG7A 3OTWA 4ODIA 3WWZA 2AXNA 3NXSA 1QQBA 4B3MB 1NTOA 1Z75A 4KFRA 2YOGA 3HTXA 5YASA 4DIEA 1TYDE 2D5IA 4IRUB 1BWPA 3GT3A 1DBQA 1TK9A 2Z1DA 3EEFA 4MYUA 3AKYA 1GRNA 1K6JA 2IVZA 2ZPTX 1UWKA 1TZ2A 721PA 5AUQA 5KYGA 2CUNA 2FUCA 3B8EA 3K2QA 1UODA 4OA8A 5I7UA 3IPCA 2W9XA 1ZK0A 3WL7A 1SBZA 2GZRA 2AXQA 1KIFA 4MVJF 4MI9A 4R01A 4IDQA 5FJJA 1NVKA 2G09A 4F2DA 3GPDG 4DY4A 1JJFA 3HXKA 4ZT2A 4F46A 5GIOE 4A8HA 4AUKA 1CY2A 4MH0R 4GKVA 4D74A 4DM4A 1RE0A 4DR1B 1JEAA 1XZGA 5JS2A 1FVHA 3MUNA 4L9WA 2GCOA 1QTRA 3O4JA 1VLHA 1KDZA 5DBHX 4D99A 4PQGA 1CY7A 2VDVE 3UXEA 1B6GA 2WTNA 2XGGA 4L72A 1M75A 2DPHA 2H92A 2WABA 2Z43A 3KEGA 3AV0B 3CT4A 3JYNA 1NONA 3GJ8A 1D0IA 5LZ8A 3B20A 2OCBA 5HK8A 3TRFA 3K1JA 1IN5A 1JLKA 3NV7A 3QE0A 2JLXA 1N5RA 2L2QA 2WMOB 2EG5A 3E8XA 1U5BA 4RGQA 5KTMA 1DG3A 4L73A 1NF2A 3TTUA 1AX9A 2I2DA 1IWBB 2OD9A 3PFCA 4BV8A 4EABA 4DV1B 3T7CA 1XJCA 2JASA 3LPLA 3NHZA 3HSKA 4LGYA 1HWYA 3T9CA 4ZZ3A 5TSDA 2QYTA 2L0XA 5EP3A 4POOA 1DT5A 2A92A 3ESQA 1XZKA 2Q4EA 3B6ZA 4TZKA 1JXAA 4U2DA 4ZO8A 4AF7A 4HLQB 3G49A 2FRDA 4QG7A 4YUZA 4ZTUB 1GGMA 1M83A 1G20B 2PA0A 3BK2A 5T8KC 3QFFA 3QIVA 3DHEA 4ZYLA 1CE8B 1V9CA 3VPHA 2IF2A 1FFSA 2GJSA 3KWMA 1WUHS 3BE8A 4HMOA 1PDOA 1RYZA 1HURA 4BU1A 5FLXA 3UMFA 3HI6A 5TC4A 4HWKA 3MWGA 4XARA 3EN0A 3CE9A 1NU8A 3CWQA 3NBKA 1ZZEA 3GGGA 3K6SA 2H48A 3AR4A 4WXEA 5H3HA 1JKMA 2QQ5A 4LHXA 4G1VA 5F4BA 5JU6A 1CQXA 3EIFA 1QXSA 2XOKD 3I01A 1IZYA 3QWHA 3RVKA 4AF6A 3I01M 4HC4A 2C9CA 4UZFA 3H16A 1Z34A 3QP9A 5CTJA 1LLQA 4RJKA 2HBQA 4Z4FA 2Z9DA 1QX3A 3JU3A 5JAZA 3IE2A 1ZS9A 4GX2A 3I9LA 4UM7A 1QAMA 2IW1A 3B70A 4PZAA 2JEYA 2XQIA 1R4ZA 1Z16A 2OLKA 2QT1A 3L7YA 1YMUA 2DX7A 2WIAA 1C4OA 4FOSA 4Z2AA 3LT4A 3K5PA 5DWQA 2HDNB 2N3ZA 5L3SB 4K7JA 3B3JA 4I4NA 1V6SA 5JCXA 3NOQA 4HAIA 5EJ6A 4X7BA 4ASUA 4OF4A 1SQ5A 2M9MA 3C8MA 1BHO1 1FMTA 2VP3A 3SG0A 1NC3A 2IEZA 1XLVA 4YQFA 3CZMA 3C6MA 3IXQA 2CVFA 2VJLA 3G5TA 5AVUA 3C3WA 4JBXA 2WV9A 4ZVRA 1ZD8A 4P35A 4AZ3B 1FBTA 5AW5A 5LXTA 1C41A 1RWOA 5CNIA 1T1JA 3R7AA 2VQDA 3ZY5A 1JXQA 2EZTA 4J7AA 6REQA 2CXSA 3EQ2A 3W3ZB 1QMPA 3EE6A 3OBBA 4AJLA 1LRJA 1GUAA 2C58A 4EYGA 2CNWA 4UVDA 4K2HA 2F67A 2O2DA 2XUPA 2VF8A 4EY4A 1QGED 3IJ5A 4K9MA 2OLEA 1USIA 4FKZA 1ECGA 1F8YA 2WOOA 3I6MA 3PENA 4PPYA 1BVUA 1QO0A 3TCNA 5LYYA 3WRYC 5A02A 3SYNA 1GITA 4FNOA 3D64A 3KNZA 2I4LA 3WL3A 5TGZA 1OGYA 1HT0A 1VI5A 2C29D 2LUOA 2NO5A 3OP1A 4G9GA 4LPKA 4M9UA 2OHIA 4X91A 5JPDA 3ZN2A 2R00C 2R84A 1X1SA 4CEHB 1S7CA 2CLKB 4Q4AB 2HA3A 3T15A 2PUFA 1K6IA 1LBEA 1M6WA 4ZYWA 1RAFA 3FNIA 4K0RA 4N54A 4CUJA 4WL0A 3T5TA 2J5KA 2V7GA 3PE6A 1F48A 3EZ2A 3PHCA 1XJ0A 3ZDEA 4JLMA 2G83A 3D6MA 1BA3A 2VBCA 3DDHA 3FSGA 4YP0A 4YLYA 3CH4B 5DEOA 1L4KA 2FOIA 2OR3A 2B25A 1NVGA 1LK5A 3R5JA 4J0JA 2AMLA 3QLEA 4K2AA 1Q57A 3L4SO 4OBBA 4CQLA 4DR3B 3KR0A 4YJ2B 3UYLA 1SM4A 2FUG6 3SF8A 1XXLA 3CN7A 3GUCA 4JT4A 3OHSX 3CBQA 3REGA 1KVTA 1XA4A 3I5MA 4DLUA 4RVGA 4U39A 1J00A 3W5BA 2BF7A 1XAGA 5HE8A 5A4FS 3TMKA 5CFZA 4IHJB 3FIUA 3V34A 4FN5A 3OCXA 4US2R 1T4DA 3W9UA 4CU2A 1X8LA 2LCIA 5K01A 1KR2A 3T3MB 1HNXB 2SCUA 2E48A 1LZLA 2WYUA 2JJ2A 3GUHA 3ZBQA 4F85A 2ZE6A 4ZHQF 4M0CA 2PUDA 1WUYA 2ZQZA 5KWVA 4WZBA 4Z3KA 2FPGB 2WUWE 1V6AA 3NW9A 5G0SA 5MN4A 2WIJA 4C9BA 5HZMA 3MJHA 1JIUA 1P75A 3PRJA 4B6JA 4LJRA 3BSSA 3FAZA 5JH7B 3YASA 1CP3A 1X42A 1P44A 4OHZA 1LVUA 1DAMA 3L1UA 4GI1A 2SBTA 4RKWA 2FPXA 1NV8A 1XCGB 3E9YA 1UPFA 2GZSA 3MPUA 1PGOA 4I4LA 3NOOA 4X7MA 2VDWA 3PC8A 4HADA 4I4TB 4W1SA 4WOKA 1ZEMA 3WFZA 4CF5A 3L0YA 2YWCA 2HW8A 3G8CA 1E1YA 2HRRA 3DBLA 2ZT6A 5D84A 2NZ8A 2JA1A 3D0KA 4PC2A 3KJGA 1MV8A 4HVTA 5CEEA 1PVOA 3C8DA 3G5MA 1A95A 3JXEA 1XZNA 3R75A 4EYEA 1HZZC 2NV6A 3AR5A 3AM5A 2ZIWB 3GRRA 2HHLA 4FHDA 4RHUA 1KTIA 2QMEA 3PNQA 1ZSVA 5IKPA 2WU4A 3IL2A 1JWBB 1WQ4A 3AEQB 3DDZX 3GGOA 4TKVB 2J85A 3UPTA 4S2UA 5J2TA 4KXUA 4F92B 4B7XA 1JEQA 4J16C 3L7AA 2BDEA 3WHIA 2AZDA 4AN1A 5LYJF 2LKCA 3FTQA 4XPIB 1J8YF 3OIYA 3SHFA 2ZI4A 4JKYA 1GFSA 4WJZA 3FW1A 1ILWA 5K3FA 1WXEA 1M1NA 5IT0A 4O3MA 2Q3CA 4QLAA 5CBKA 1S9HA 3S55A 1NMSA 2IU4A 3H9QA 1LGYA 1TEHA 3A6DA 1IN7A 5KSOA 4DMLA 1Z63A 4KN5A 5ICCA 1PG5A 2LE0A 2R6R1 3O0TA 3GAFA 4DW8A 4RULA 2AYXA 3PP8A 1TNDA 4PBSA 5BVHB 1GA1A 3AKDA 5BQXA 1F0KA 5TMBA 1O94D 5BUCA 2PRYA 4JGIA 3LPNA 1LUAA 5JBIA 1F2TA 3MINB 3A3YA 3OKAA 3Q3HA 4ERXA 5IZCC 3QUTA 1FL9A 1NT2A 2VRBA 4A1OA 3ZLVA 2W2VA 3G7NA 3HB0A 2RCNA 3V7YA 4M9RA 4QODA 3NM4A 1P9LA 4FQ5A 4XIJA 2W4IA 3UMGA 4GPEA 2RDMA 3WLIA 1E7YA 2V7QD 2AOTB 5COAA 2FY8A 1P6XA 4I0WB 4ITVA 4M1YA 1YIOA 2QSUA 3HKDB 1A5TA 1REQA 2YVKA 4NZ9A 2ANBA 5JD3A 1MBZA 4ZAGA 1UPAA 1K7YA 4JNCA 1YC2A 1MO2A 5DHPA 2C2MA 4TTPA 2X8AA 2POCA 1MAUA 3BZWA 3L46A 4G86A 3CNBA 3CNLA 3CRW1 5EIBD 3E15A 2I76A 2TRSB 2IYEA 3PQ3A 3BA1A 3Q8WA 4KUHA 4PZLA 3RV3A 4U7PB 3NEJA 4HH4A 2ZRBA 4BVAA 1LS1A 4LXQA 4F21A 3U4MA 1Z82A 1ZD3A 4KO4S 4G63A 5FPPA 3JAWB 3TZCA 3HXTA 4ZCQA 4O29A 3UKJA 4HLNA 3FNBA 3CVWA 5AHRA 5HRUA 3E27A 1WXDA 2E4XA 2DXIA 3GLRA 1U5CA 3C5WP 3VM6A 4DB4A 4KR6A 1QB7A 5ITZB 1PQYA 4UOQA 1KI1A 3LQRA 4OHMA 3UK2A 2WPDA 5HKLA 4HO1X 3VV3A 3W2TA 1NVMB 4B5KA 3VR3A 4PLFA 2CY0A 2I4MA 4GOMD 5IDVA 1J0DA 3LA8A 1FPQA 3Q0TA 4CU5A 2I99A 2P5TB 4CLDA 2D2IA 2HMYB 1KPIA 3HL4A 1XZJA 1W6RA 4FHGA 3ZU5A 2ZUSA 3C6ZA 3D02A 3TIIA 1H05A 4C3ZA 4F7DA 1PJ4A 1TC2A 3FG9A 3F6EX 5IDYA 1EFPA 4FD3A 3HVIA 1X7XB 1ECJA 2DHCA 2WU3A 4LYGA 5ADHA 3NR2A 1UJ4A 1KRWA 2H54A 2JIPA 2C99A 1W25A 2O2YA 3KJFA 3LX6A 3CB2A 5T64A 1Z36A 3WLJA 1GTZA 4DCMA 3ZQJA 1GA6A 4LJKA 5HGJA 4RTOA 4Q1FA 5DYGA 4NX2A 2C2YA 2HCBA 2G7MC 4L8LA 4Y3UA 1ZBDA 1D09A 3C7KA 1S9DA 4DR4B 2HLHA 4IMIB 3UVEA 4WDRA 1DC4A 4MINA 2GT1A 5CM9C 3BF8A 2MDTA 4M1MA 1J24A 2QENA 2RIPA 2QUIA 4QUHA 7AT1A 1LQ2A 3SNKA 4YC7A 4RJIA 4PZ9A 1TD9A 1E2EA 1QCDA 1QYWA 2P67A 4EY3A 1SBTA 3PHHA 3QLTA 1I36A 4KK4A 1HTBA 2R44A 5CIWA 4BX2A 5DTQA 4DAOA 1AHNA 3UWOA 2ZT8A 1Z29A 3ZDBA 4KE7A 4UJ3A 4JQYA 2E7ZA 4LFBB 1DQPA 2IUUA 4DIFA 3B6JA 4RO0A 4EW1A 5B64A 1ZAYA 2HA2A 5FULA 4HDRA 1UXOA 4D3SA 3HZRA 3RAJA 1RPNA 1XZMA 4JBGA 2HZ7A 1XCJA 4RVOA 1AT1A 4PS0A 3OA0A 5FPSA 5TT1A 3A0RB 1V11B 3MGBA 4FT2A 4JA0A 2PMDA 3ZU4A 4AZWA 4UEWA 1M67A 4EY6A 2UYQA 4QJBA 4K87A 3W7VA 1Q22A 1V95A 1P0QA 1NQTA 1NUTA 2C04A 4G85A 2HAEA 2CWDA 4D98A 1C1XA 5JZBA 4DSAA 2JHPA 4TWJA 1A77A 5CYFA 5KYUA 3ZWMA 3DV9A 4TXJA 3U61B 1DP4A 1P1KA 4XFDA 5EJ5A 1EK6A 3UOAB 2IHZA 4US0R 5I7SA 3GLHB 3P0IA 1PAUA 1PI3A 2AUMA 1PVDA 2GJKA 3A6GA 2HU8A 2IZ7A 2NVOA 4WOBA 5J40A 3IT0A 4QDOA 4CLXA 3GZNB 1LVGA 3IUEA 4CLHA 2DLCX 1ZCFA 3UT0A 1IJBA 3KDSE 3I5XA 4YI3A 2IH4A 2FZ4A 4FU0A 4OLBA 3KL2A 4GBGA 1SKBA 2WUEA 2QXTA 2AMJA 4LMPA 2O1EA 5EJAA 1ZK3A 1S0UA 1M66A 1U2GA 4GPTA 2H3EA 3V00A 2HSGA 1CERA 1WZIA 3OSUA 4ND1A 2XYRA 2G08A 3CIOA 1ZP6A 2Q45A 4G84A 1G42A 4H31A 3B5EA 1DXQA 1ZO8A 3QBTA 1FFEA 4BHTA 5I3CA 1E6KA 4KMRA 1J33A 5C37A 1GYPA 2RB4A 3WZMA 5M5BA 3D5EA 3ROQA 1DEKA 4DR5B 4PHGA 3VNSA 2DHQA 5BMOA 4QUKA 3L0SA 3N87A 2E37A 2HRQA 3L18A 3IR7A 1U04A 4I8IA 4JBYA 5B3KA 1KJIA 3HLKA 4ER7A 2ZJOA 3UF0A 1YVEI 2CNBA 2LBPA 3BMOB 3LFHA 2G1UA 2DT5A 3NPMA 4Q4HB 1BHJA 3QJ5A 3SVZA 1VB3A 2EFHB 2ANCA 1N7JA 2Y0BA 4XXHA 5CT6A 3DUWA 2IOHA 3WMRA 2IBSA 4LSGA 4QDKA 1HH4A 1C3VA 4KVZA 4BZXA 4UQPA 5IUKC 5F7OA 3DQZA 3FVVA 2HLDD 3FUTA 4EQ6B 1QAQA 3EEYA 1T34A 3LHDA 4Q82A 4R98A 1EKXA 2I80A 4HAVA 5B7NA 1ZA2A 4X8LA 1RWNA 3RVDA 3LUDA 1UMBA 4L4RA 4DIOA 4TQ9A 2UU9B 3TZKA 2C7RA 1QGUA 5FL7A 5I9BA 5FI1B 4UCXA 1IY2A 3L9WA 4O4LB 2D0OB 1OLOA 2J3MA 3ESRA 3OT4A 5IAAA 1XRSB 5GJCA 4GE3A 1JVSA 3OZBA 2GM3A 4TTJA 3AFMA 1VHQA 4OJQA 2HDOA 4WY5A 3WQHA 3NG1A 2PKRA 3H4MA 1WBDA 5ALXA 5EMNA 3ZXIA 4JUFA 1X86B 1CUEA 2FN8A 3K9NA 3PGJA 3VDNB 2FSHA 1LSJA 3DEFA 3RUCA 3WYBA 3V46A 5JV5A 3EZLA 3FPLA 2X23A 3QY9A 1N6NA 1TD1A 1MGOA 3OBIA 1J2JA 1DTWA 3IBTA 4BLRA 2PX5A 1I6WA 1B41A 1HA3A 2X1MA 1T24A 5HZGA 2DKNA 2WQ7A 3KJHA 3F5QA 1FTYA 1FBNA 3ENZA 1WVMA 5FQNA 1KBOA 2OO7A 4B0OA 1IU9A 4I50A 1E3MA 4HH1A 4MPDA 3FPFA 4LVOA 3R0IA 2EFYA 3L07A 1BYUA 3QOYA 4RH0A 521PA 3FYUA 1SD5A 1YRHA 2FUG1 1TZBA 3GOQA 1FVFA 1W30A 4M1ZA 4CG1A 4IH1A 2I4OA 2PT5A 1KJJA 3QVTA 3JWPA 4IR7A 4MRPA 1HM5A 2ZRHA 4J0GA 5CFOA 4FBGA 5I6DA 4DG9A 5J59A 3RK0A 2ZBGA 3MFYA 4XGQA 5BSMA 1EU1A 2PANA 4O3FA 4UFPA 1X80B 2V8OA 3H5WA 1T2AA 5EZYB 1V3VA 2EXXA 2CNNA 2G82A 4BV3A 1TM5E 3GNQA 1T1RA 4MQEA 3CLRC 2VUHB 1EFCA 1I2BA 3HBNA 4FHZA 1K1EA 3QUBA 2JBWA 3SZUA 3U4AA 3CEJA 3IEUA 1L4UA 4WSOA 4ARSA 5JNTA 2BKUA 3LUAA 2P2SA 2HHCA 2TMDA 1X0VA 3QJGA 1DIRA 3ZK9A 4AJEA 3KKNA 4EHJA 1DELA 4M88A 2CLOB 2J48A 1I3MA 2UV8A 5AESA 1UANA 3H1PA 3GLGA 1ZM9A 4AG5A 3BRWA 3NZEA 4IWXA 2J9YB 2IV7A 3QX7A 4PR0A 3NHUA 3ZZNA 1O0CA 1O95D 1C1DB 2YYYA 2GBCA 1YAJA 5IKEA 1DQSA 1UK7A 3F2IA 4FFOA 1V8DA 3WJAA 4J1SA 3BHMA 1KDTA 1KO5A 4W8HA 3RBVA 2H07A 1ZN9A 2X7HA 5AIAA 3RKUA 1MUUA 1WMDA 4MQLA 4GOND 1NXVA 3EVAA 4ER3A 3IR5A 3GFPA 1SG6A 1M0EA 1FW6A 1KKLA 1OYWA 2EDAA 1UPBA 4TYNA 5DSXA 5A5VA 1PE0A 4B7AA 4WA7A 2GN8A 2WW8A 4N5HX 5KOIA 1DWQA 3NP9A 1ENZA