1F90H

Fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
220
Chain Sequence
GVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGSTGYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCASYDDYTWFTYWGQGTLVTVSAAKTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an anti-interleukin-2 monoclonal antibody Fab complexed with an antigenic nonapeptide.
pubmed doi rcsb
molecule tags Immune system
molecule keywords FAB FRAGMENT OF MONOCLONAL ANTIBODY
total genus 43
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2000-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f90H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f90H01
2H26A 2XA8H 4RGNB 2COQA 3FQWB 3QUZA 2VL5B 4DZ8B 3STLB 5BRZE 4PJHA 1BM3L 4AEIL 2L4OA 2QKIB 3K4ZA 5AG8A 1PX4A 1RZFL 5J3HC 2NY0B 1U92A 3O6FA 4WW2B 3PWLB 3D3VB 4MHHI 2VDKL 5GS0C 1VGEH 3DTXA 1D6VH 3D39D 3JWOC 2FO4B 3LN5B 3VG0H 4HF5H 4MDIB 5I75B 5KZCD 5E4EB 3FRUB 1MNUL 3OR7B 3V7AG 3VGHA 3O45B 4JY6A 1DCLA 5DD1H 3CPLA 3FFCB 4DN3H 3D0LA 3L3KA 1A4KA 4HIEB 1INDH 3MFFB 4EXKA 4JFFD 4UQ2A 5CMAA 1UM4H 2FGWH 4MD0B 2VAJA 4FNLH 3FQTA 3O2DH 1AJ7H 1MEXH 4Z8FL 5D1XB 3QDGD 4RMVA 5L0QB 4RMUA 4FQJL 3BIBX 1BREA 3GNMH 4NKQB 1AKJA 1QD0A 4U1MA 2JB6B 4F33B 2VDNL 5J6HA 2LAGB 4OZHB 2GAZB 4OTXL 5C9JA 1G0XA 5CZKA 4EQ3A 3JVGA 1W0WB 2E7CA 1E28B 2FIKB 3EDKA 4JFFE 2Q3ZA 1L7IL 3D5OF 3KPPB 3CSYA 3MLRL 2B5IC 1G9MC 4XP1L 5GGTH 1KEML 4HV8A 1FRGH 2PYFB 1XH3A 2APTA 3EO0B 2A2QT 5CUSH 1UXSB 1UCBL 4LF3B 1YQVL 1AXIB 5SWQA 5A2KH 3HE7A 1DEEB 5KSAD 3Q2CA 3SGJA 1PKOA 3QCUH 4KHTL 5IM7B 1QNZH 2JCCF 4OLWL 1I1FB 2Y07L 5FYJE 1LO0H 4JGJA 4MA7H 3FRPG 1N6VA 4FQXD 4NM4L 3V4VH 3CH1A 3H2WA 3I02B 3OKKB 1QLFB 1CT8B 5T1LA 4IRSA 2B4CL 2BY3A 3OZ9H 1OTSC 1ZA3B 3B43A 1FFNB 1P6AB 4U31A 1OPGH 4X6FA 2D03H 3CSPA 3LQZA 2AJUL 4FQ1L 3MRLA 3GK8H 4G7VH 4TUJA 2IQAB 5GS0D 5E9DA 3DV4A 4N9GB 2O5ZL 1IAKB 1T0NB 4BH7A 1R3IL 4YXLL 1IBGL 4MQXD 5JXAH 3VMNA 1HE7A 2VR9A 1BOGB 2W38A 1BFSA 2ICEB 3HFML 1C8PA 3JWOL 1E27B 2HTLD 5DJAB 4XGZA 1SMAA 2ARJQ 3V4VL 1X4XA 4U1KA 4WI2A 2W92A 2MHAA 5TDNA 3ZDXE 2LVEA 1P4LA 4B53A 2CRZA 4TTGA 4F57H 3A6CL 4YBQC 1NC4D 3QCUL 1DLHB 1NLBH 3ARRA 1PW3A 1H5BB 1MI5E 5L8LB 2FDBP 1PFCA 4ZS7H 3NABH 2FWOA 4QGYA 4NRXA 2X4SA 3MLVL 3MRHA 4WENB 5C0JB 1BVKA 4Q58C 1GC1L 1W8NA 4U6HB 3MFGB 3VFUA 4ZFOA 5DQDH 2W91A 1X5YA 4UUJB 4FQXA 5DJ0B 4OBSA 4LLQA 4HJJL 2YWYA 3NAAH 3BKJL 3ZT5A 3EKCA 3GRWA 4CVWA 5KJRL 4OV5B 2N56A 5F7DB 1CD8A 4OIIL 4P5TB 5KSAA 4PJHB 1XCTB 1MFAL 1HXYA 1F42A 2IQ9L 3G9AB 1R3HB 3T3ME 1JN6B 4HUUB 1MLBB 4OGAD 3WKML 3HE6A 5DJCA 3VXUD 4X6DF 4ZFFB 3ARBB 3QHZL 4ZXBA 3QIUA 4S1RH 4ZPVB 4PLNC 3ULVH 4X4ME 1NPUA 2OL3A 4HPOL 3T4AA 1NEUA 5TH2A 4RFNC 1N0XH 1WWCA 4APQD 5C7XL 4BFBD 1QKZH 5JQHC 1JHTB 4JFHD 1QSVA 4NHCH 3RAJL 1RHFA 4RX4A 2BHYA 3ZTJG 1AHWA 1ZLUK 4V2BA 2OMNA 2XG5A 4R4ND 4WI8A 1JPGA 5B39G 1JPST 2ZOLA 4MNGE 2VQ1B 2VZ1A 1ZANL 3IJYA 5INCA 3RGHA 3NA9L 4CL7A 5JPMA 3CLFL 4JM4H 3EUUA 4C56E 3UMTA 1P4BH 4POZD 5MERB 3V8OA 4O5LH 5ID0B 2HVJB 4NN5B 1CXFA 1WF5A 2BVQA 4Q9BA 3U7WH 4N1EA 3PDOB 5JUEH 4Q9RH 5E9DE 4LSSH 4O4YL 1JRHI 3KLHC 3JTSB 4PY7A 2BFVL 1S78D 4WW2F 3QUXC 4ZNEA 5JIIA 1UJ3A 3NN8B 2AS5M 4KMTL 5IWLC 1ZS8B 3ECBA 4OD3H 2HH0L 2Z91A 5DVNA 1EZVX 4XXCA 1PQZA 3LQAC 4JVWA 1QPXA 3FQUB 2XN9D 4JFPB 1FGNL 1OAQL 2AAVA 3KPRB 5FOJA 2VLRE 2P4AB 3D1MC 1CFVL 4OKDA 2GAZA 1MREL 3QRGL 3MRGB 4DOHB 4K94L 1N5AB 5JHLL 1MFAH 1K5NA 2OMBA 3O6KH 3WLBA 1MFEL 4K3EH 2EICA 1PG7L 4KK6C 3X14B 5F88A 5T1DH 4JPKH 5I1KH 3P9LB 1T0MA 4LCCC 2JJTC 2I9LA 4P3DA 3T3PF 3ARUA 5J6GA 2FJFA 5FM5O 3D39E 3P0GB 3SDAC 1XGTA 1QSZA 2ZP0T 4MJ4A 3FZUC 1C5DB 1J88A 2EYSA 4H1LG 2HMIC 3WKNA 1C12A 7FABL 3MLTA 1OF2B 3AY4A 4JFDD 5F9OL 3TN0D 4H1LB 3MXWH 3TNMB 4G5ZH 3VFNB 3UPAA 3VFSA 3DPBA 5C8JA 2VDLH 1PAMA 4N8CH 5DI8A 1DQLL 3RJQB 1CN4A 4OI7A 1DTUA 2GUOA 3UBXB 5DS8A 1AXSA 4YFLF 4FQXB 1ZEAL 4BFIA 5DTFA 4QRPB 1D6EA 3MO1B 4PGDA 1W0WA 4MA3B 1T6VN 4AJ0A 4PJ9A 5F7DA 5D6DC 1FNAA 1KFAH 3AM8A 3PWUA 4BZYA 1W72B 2EDTA 3WS3B 2R0KH 2O5ZH 4OCWH 2EE6A 1SBBA 3MXWL 1MJUL 1ZT7A 4PJHE 2XZZA 2EZ0C 4JRXE 2ZPKL 1FNGB 3D69B 1T89C 4GS7C 4NN6C 4IJ3B 4LLAA 2FATH 3KPSA 3EOAA 2I25N 5IFJB 3ULVE 5ESAB 3L7EA 2EECA 3H3BC 4QF1B 3K2UL 3WHXB 2OL3B 4POYA 1R5WA 3LHPL 3G6DL 2E7MA 2P49B 4UT9L 3C5ZD 5EZOH 1EHXA 2QADD 3LQMA 3MLVH 3CH1B 4YE4L 1FPTL 4JO3H 3MNVA 1GOFA 4RGNC 4XAKD 3STBA 4D9RD 2VDQH 3RUGE 5IF0A 3TH2T 3O2VH 5IW1A 4L5FH 4JVPA 4J3OC 3UPCA 3ZE0E 4K7PH 5J1TC 5DD6B 4ONFH 5C09A 1SM3L 2HFFB 2Y6SC 4UDUB 4QRTB 3GSUB 5IBUG 1DZBA 3QPQC 5ENWA 5D8JL 4QHNB 5JNYA 5HYEA 3OAYK 2X4QA 2VQ1A 3K4DA 5DUML 4XBEL 2BVEA 5INDA 4HK0A 3LZFL 4KV5F 5K9OB 2UZXB 4OTXH 3W39B 2Y7QB 1OOAA 2V5SA 3PP4L 2R0LH 1GPOH 1G84A 1A7NH 2X1XR 1YMMD 1A6AB 2HWZH 1MEXL 3GSVB 4G7YL 5T1MA 3TVMD 5F7NC 1WBXB 2B1AL 4FQ2L 5JHDA 3L5XH 4Q7DA 3SEPA 3MREB 3BGMB 3F7PC 2AXGB 5F9JA 2WNGA 1KIQA 2NXYC 1A6WH 3GBMH 5EU7E 2F54B 4AEFA 3PWPE 3W9EB 3GMNA 4BKLB 5C0BA 1PQZB 5JW4M 1CGSL 3F12B 4D0CB 1AE6H 3JUYA 1A1OA 2I5YL 1J1PL 2XY1A 1NMAH 2FX8H 3V6ZB 2NY2B 1GGTA 3DMMD 4JFDE 2MJWA 1ED3B 4RQQB 3SE8L 4PLJC 1K3IA 2NX5D 5FYJL 2HJLB 1AXTH 2AJ3A 3VXRE 4EI6A 3RX8A 5L2JA 4PJ5B 4HS3B 2IAND 4DKDC 2A73A 3P9LA 3G08B 1G7MB 1LP9A 1IGIL 1M05B 5JXED 3D6GA 3QUMA 1KTDB 2HKFL 5FA3A 4XI5C 2VDNH 4GG6A 5JIHA 2CDGA 3BH9B 4ZPVA 2WWMD 4H1LH 5BO1L 3VWKC 4U1IB 2IAMC 5DRXA 4LBEA 3EO1A 3RFZC 1T7ZA 4LCUA 4F15C 2VITA 3E2HC 4PJXB 4ZSOB 1UG9A 5BV7L 3RRQA 4YDVB 3KPRA 1GSMA 3FOMA 4JRYB 5EU6B 2FHCA 3V52H 4U1LB 2Z8SA 1A6UL 4XBPB 2V2XA 3IJHA 3BWUC 1L9MA 3QEQE 1CXLA 3QDGE 5DS8B 4ERSH 2EDJA 1B6UA 3PUCA 1RZKC 5ABDE 3M1BA 1YY9D 3QJFA 4PGCA 3O9WB 4ODSL 1A14L 2GEEA 3CDCA 5EIVA 5J6GB 5JW4N 4XVTL 3WIHA 5I1LA 3DLQR 4NQTA 3X11B 1F3RB 3DURB 5C71A 1JGVH 1XGTB 3SGKC 5EPMA 3PQYB 1JGUL 4D9LH 2N7BA 5BS0A 3W9DB 1JI2A 5DT1H 1A5FL 1OP9A 3PV6A 3KPSB 4Z7QE 2PTUA 5C0CE 3V4UH 5EOCL 3TV3H 1JK8A 3FCTB 3SDYH 3OX8A 3BT2L 3DIFA 1A6ZA 1IM9B 3S35L 3SKUD 3WO3B 2PO6A 2F5BL 1YJDH 2UVEA 3QIWC 4PB0L 5ICXB 1I1AC 1JRHH 4OLVH 1RAMA 1FHGA 3VMOA 1WFUA 4OFPA 4N0YL 1EEZB 3B9KD 2BVTA 3WNKA 2VDOL 3PIQB 4DW2L 5ALBH 3PWPB 5AUMA 5ERWB 3GMQB 3BW9A 1D6EB 3SO3B 2ZPKH 5HYFA 1MCFA 1TZGL 4J4PA 5ENWB 2X4TA 4Y7MA 1L6XA 3V7MA 4F7TB 5C2BL 3D85B 2E8YA 4A6YB 5C07D 4U6TA 1K8DB 1BZQK 2BERA 4GRLB 5I1GL 1DQML 4TSAH 3FT4B 4CW1B 3OZ9L 2YK1H 1HINL 1KSRA 4HWBA 1JYWA 4PJEB 1T2JA 2UUDH 4FQQB 1S9VA 3S34L 5F6HI 2CIIA 5E6IC 5ESAA 3MC0A 1IQDA 5ISZA 1CR9H 1FL6B 4NKOB 3P0YL 2CLZA 3RX7A 4DTGL 5SX5H 1IE5A 3DUHA 2GT9A 4PG2A 1QQDA 1I3UA 2CUIA 2A6DB 2JELH 3L3IB 4KMQA 2R8SL 1V8HA 4NC1E 4IRSC 4XPFL 1OARL 3O3AB 2BDNL 2EC8A 3S36L 1JBJA 2IEPA 3OV6A 4GAGH 4XPAH 1KNOA 2XN9B 3SJVB 4LVNC 2IGFL 3EBAA 1JYNA 4NQEB 4BM7A 2ZZUT 3F58L 4BELD 1S3KL 5JORA 5TFSH 2V2TA 3RVWC 3MRNA 1WBYA 3QFJE 4XHQA 1DQDL 1J8HA 1TTGA 1AGFB 2W59A 4ORGB 4Z76B 3ARFD 4JLRB 1U8QA 3D69A 3BEWB 1OARH 3G6JA 3V5HB 3CMGA 2JJSC 4LOUD 3ZT6A 4XAWH 1KOAA 1NCAL 4JFOB 4IRJC 4X99B 1XH3B 4M4RA 5DK3A 2XTJB 3A0OA 2YA0A 5MHSE 1UXSA 4LF3A 1KIQB 2Z93A 4G6FB 1UJ3C 1WFTA 3BVNA 3DX7B 4P46A 3UBXI 5IM7A 1NGWB 4LSUH 4XP6H 1OSZA 1GOHA 1OAYL 4LL9A 2XKSA 3S5LA 1FGVL 1LILA 2NPLX 3VGAC 3L3HB 4ZXBD 5ID1B 5IR1A 1U8LA 4XVUC 4HLZG 3IETB 2Q76B 3MTRA 3VG9B 5KW9L 3EYUH 3BX7C 2YR3A 4TUJB 1FH5H 4HS3A 4X4XA 1FIGH 4HK0B 3MQIA 5K9OA 3PWLA 3MRRA 1G7MA 1OP3H 1UB5B 3WFCL 1ACYH 5DFWH 4JFQA 4P2OB 2XTJD 4ALAH 2J5LC 2YN5A 4OF0A 4OZGB 5EPMB 5IW3A 8CGTA 1CIUA 3WL9B 2LU3A 2EZ0D 5E8PB 3EO1B 4I0PA 5KTEH 5C7XH 4DAGL 5DD5L 2HT4D 1QSFB 3BP4A 1UM5H 1U58B 3KNBA 5DHYB 2UWEF 1GAFL 1MJUH 5DMGC 1AIFB 3HMXL 4Q6IA 3SQOL 5FO7B 3I6GB 4QHUB 1A4JB 4K8RH 3X13B 5HGAB 1MAMH 1IAIM 2JIXA 1XMWA 3B6SB 4NQED 4QHLB 3QHZH 4G43B 3HE6C 3QIBA 4NN6B 1INQB 4X4MA 4HH8A 3IDYC 4ZFOB 4QCIA 3L7FB 4F7TA 4IRJD 4WI5A 4YWGL 2FJGB 1TVBA 5KS9F 4NZUL 2VLRB 5C0FA 5CJXC 3Q3GA 1EAPA 4HUWA 4EVNB 5GRVL 4RX4D 2ESVB 3V9FA 2RQ8A 3HKFA 3INUL 2H1PH 2B0SH 1CQYA 4RAUB 3ULUL 1XCTA 4OQ1A 1XR8A 2ZJSL 1FE8L 1I8KA 2DJUA 3CJJA 3GSOB 1S9VB 1T2XA 5E4IA 1IGYA 1VGKA 4PRNA 4CVUA 4XCFH 4FQCH 1XF4B 4PJ7F 4PLKD 1I75A 2YD5A 4JHZA 2ZWLT 4EUPG 2GT9B 4U33A 3QIUB 2VXQH 1MF2L 4LSPL 3H7BB 1N64H 3RBSA 4Z77A 5LVEA 5DRWB 1T1WB 5FO8A 4X6BB 4Z0XB 3ZE2E 5F44A 3VI3F 1BIIA 2IALA 4GRLA 4P4RB 1I7TA 1IRAY 4JZNA 5I1GH 4UNUA 1J0IA 3CUPB 4PRAB 3NMEA 4CW1A 2BXZA 3RP1A 4UOW1 3OWEA 4ORGA 4L4TB 5C0EB 4YXLH 1CXIA 3BKCL 4HCRL 1AR1C 4P2QD 3V6OA 4XP9L 1T03H 4AEEA 3SDAD 4RZCA 1FFRA 1OB1A 4YEFA 3HNTH 4X80L 3KPLB 4IMLA 5BV7H 1Z0MA 4MJID 1PEWA 5FGCB 4YDIH 1JPTH 3CU1A 5CSZB 4KRPB 5HVGB 3HI1B 3D18B 4Y4KB 2GTWA 1UKSA 5IB3B 4TNVF 3T3PE 4WTWA 3TBYA 3AU1A 4P9HL 3A6BH 4D9RE 3QEUA 3EDEA 32C2B 3PHQB 4Y4FB 3SGKA 2X4TB 2PYED 5GISH 5AAWA 1XCQA 3B9KB 3BJ91 2BVPA 2QSCH 1EMTH 2QQKH 2HP4A 3PF2A 1B4RA 4PGEA 3VWKB 2XZAL 5DFVC 1GRWA 3S96A 1K5NB 3ARYA 1F97A 1EFQA 4OI9A 3HE6B 2CKBA 1KIUA 3L5HA 3MUGB 5E2WL 4FS0A 5FM4A 1S9YA 3HZVB 3PJSB 2APBA 3R0NA 3RUGB 4XH2B 3CH8A 1HN1A 4WW1A 1ZE3C 1T7YA 2ERJC 4JHWL 2ATKA 4NCC2 4JFZH 1INDL 4PG9B 2XWJA 3QQNA 3D25A 3L3HA 2IAMA 4M5ZH 4MAUH 1IKFL 1U3HD 4W68A 3I6GA 4QHUA 3ZO0A 2V7NB 3LKSB 4PS4H 3WSQL 2Z35A 3G5ZB 3BKJH 3SGDI 4RMWA 2CR3A 3NIGF 3KDMB 3EZJB 4GAJH 5INCB 1A47A 4NPYA 5GIRA 3GO1H 4BA8A 2JJWA 3L3DB 1NEZG 1QFWH 3D3VA 1CZ8L 3VXSE 4M61A 3PP3H 4KTDH 2FO1A 4YHMH 1S78C 5I0DA 3LN5A 4XXDA 2XA8L 5D8JH 3GSWB 1P1ZB 4JB9L 2YD9A 4L9DA 4EVNA 4ZUSA 3MRPA 5EOQL 4KTEL 4RAUA 3RI5F 4E0RB 4K7PL 4M9PA 4WFFD 4MS8D 4OBRA 1J1OL 3ZTNL 3HPLB 1PZUB 1QR1A 3WS3A 4HIEA 4TOYH 2KKQA 3QPXL 3R4DA 3PGCA 4X99A 1FV1B 4G8EA 1FNGA 1GGCH 1T04B 1M7IA 1ZWIA 1OP3K 1GOGA 5TGBB 5ICYA 3HNVH 4U1HB 3QCVL 3ARDB 1HHJA 1EVUA 2DI7A 4JDVB 5CJ8A 2R56L 3GBNH 2V2WA 2EH7L 4J4PD 3TJHD 3BKML 1I9RL 5DVOA 3SDXB 1RZKL 2NY2D 5DLML 4HUXA 5SWZA 3LS5H 3WD5L 5IV2A 1MQKH 3ARTA 1E28A 3L3GB 5E24E 4OCMC 4ZDHA 3FTGB 5CD3B 3VDCA 4F37K 1WWWX 2YXMA 5F88B 2RR3A 4H0HB 2VLRA 4UNVA 5C0FB 5JPNB 5L2KB 2DL9A 3NBNA 5DURB 1OT1A 3RWDA 2IADB 2F5AL 2UWEA 1L6ZA 1NC4A 5J8OA 1KENL 1U36A 3RVWD 3FQNA 1NGQL 2HH0H 2QQNL 4LHQB 3QUMH 3DX9B 1UH2A 1RJZB 1XF1A 2VLKA 2ENSA 4K2UH 1QYGH 1QSFA 3Q6GH 4FG6D 3EYFA 3VD5A 4PTUB 1UCBH 2EDEA 4P49A 3GGWB 4X9GA 3QFJA 3VFNA 5E8OB 3N1GC 4KTYA 1NDMB 2VSDA 3VA2C 4P2OC 3N50A 1CDGA 5AZ2H 1OVZA 3MLRH 3IKCA 3QDME 2IPTL 3F7VB 4HS8H 1QACA 4WHYH 2VR5A 1ORSA 3IDMA 3HCVB 3C6SB 4HXBL 1FBIH 2H1PL 3FJTA 4I2XB 4FZ8H 3V8CA 1Y18B 1AGBB 4I3SH 3L3OA 4Y19A 4Y4FA 4I77H 4P46D 3LEYH 2BNQE 4UV4H 5FCUL 1A6UH 3V52L 1CDHA 1T2QH 4YDKH 1EAPB 4HUWB 4BH8A 1KFAL 2EDQA 5E8NB 3ZMRA 2RBLA 2IWGA 4N0FA 4U3CA 3BAEH 1C7TA 2LU4A 4OFDA 3MUGA 1DANT 3S3PA 1Q0XL 4GKNA 4PIRF 2AXHA 1B2WL 3SDAB 3LEXB 5HVHB 2KL6A 3A6BL 3DTXB 5EBGA 3X17A 2WUBH 4LQFH 4HKJB 4YBLC 1IEAA 4TTDC 4O02L 3T0BA 2IC2A 3F8UB 3W5NA 1NGQH 5I1AB 4BUHA 3RX5A 2J88L 3QH3A 4NFDA 1N3NB 3UP1A 3C5JB 2AABH 4HIXH 4Z77B 5DRXB 3TBYB 2F5AH 4WUKL 2PCPA 5F7EL 2VLJA 3SDXE 2VMFA 2XNAB 4ZQKA 4JAMB 1RFDL 35C8H 5GRXG 1HXYB 1ZAGA 1U3HA 4F2MA 1YEGH 1Z0NA 4HUUA 6CGTA 3UTSE 1ZANH 1KJVB 1JL8A 4JPKL 3QBTB 3HC0B 3SDCD 5DEFA 3TO4A 3AROA 4DGYH 3UTSA 5ALBL 5B4MC 4KPHH 2FX9L 1U8OB 3QJFB 2E6QA 2FX7H 1MIEL 2ITCA 3GSRA 4XRCA 4FZEL 3MBEB 4JQXC 4Z7OE 5CEZH 4YHYC 2C1PB 4HGWA 2V17H 1A7QH 4WCYH 5E94A 1H3WM 4PJAA 2W0FB 3RVTC 2DIAA 3W9DA 1W0VB 1JHTA 1KB5A 3EDDA 3HE7B 2NW3B 4KTEH 2BOCB 4QXUL 5IK3B 2RHEA 2XKNB 4OT1H 4KGLA 3M45A 3U1SH 2DS4A 1BD2D 2QR0B 4GQPH 5ICXA 1IQWL 4QTHB 4NJ9L 2W9EH 3T2OA 5C0AD 1RZFH 3TN0C 1J0YA 3GMPB 3GSNL 4CDGC 3BZDA 4XPHH 2ARJA 2FSEA 5EWIH 1CT8A 3GMRB 2HFEB 5T1LB 5BXFA 2CIKA 1NBVL 2IQ9H 5T1KA 4MX7B 4N8PA 3X3GL 4HHAA 3LMJL 4WEBL 3NGBC 3VMPA 2A73B 5BQ7B 2DQGH 1BMGA 3RU8H 3G08A 4N5ED 4NZRL 3K46A 3UYOD 1N4XH 4XX1E 3QUMB 4O2EA 3MRFA 4R6UA 1CICD 1DE4A 2WINB 5JW4R 2FB4L 2GW5A 3K3QA 2R1WA 3LKOA 1NLDH 5FK9B 5KSBA 3HI5H 4RFEB 5CP3H 2VABB 4G9FD 3S7GA 4U1SA 4E5XB 2F53D 2CKBL 5C0AA 4OV6F 1A6VH 5DJ8A 4HKXA 2G75A 3ZDYE 1CBVH 5AD0A 4FTVB 4JRYA 1D9KB 3P3YA 1DVFD 1K8IB 1H5BA 1D5IL 2OZ4H 4IRZL 3QIUC 3IXAB 3L3IA 1G7QB 1QSFE 1OQOA 4JB9H 5MENA 5GGTL 1G9NH 4XP5L 4HUMB 5I9QB 3QWRA 4LAJH 2DMCA 4S1QH 2PETA 5BCAA 1FYHB 4PJ7E 3FO0L 2K7PA 1XF5B 3RWDB 1UFUA 5ISZE 1EUTA 3TVMC 1KPVB 5BZDB 2J8UE 5F7FA 3O41A 3QQ9D 2J6EA 1Z9LA 3KLAA 3TIDB 1IEHA 1AD0A 4M7LH 3HE7D 1CLZH 2P5WA 5DK2A 5C6WH 4YHNB 3BQUA 5KVFH 5IJKC 1X6LA 2AJSL 1QR1B 4JY4A 4BSWA 1ZSDB 2JK5B 3IDXH 3H0TB 5D71H 5GHWL 5E1AB 1R3KB 2V5YA 5LGHH 2H2PC 4JLRA 4G3YL 4OB5L 2HT2C 4GXVH 1L7TH 5T3ZH 3VGEA 2B1AH 4ONHB 5E8OA 5SWZE 3S36X 1A3LL 3BH8A 5JO5A 4IHOB 2P8MA 5J7CC 5EZLB 1OAYH 5ITFA 1LEKB 2DF3A 5GGRA 4PRPA 2JTDA 1BFVH 3N0PB 4KKAC 4PV9A 3T8XB 4HF5L 1T5WB 1QFPA 4QRPA 1L4IA 1U8JB 5IV2B 3BVNB 3TYGL 2R69H 4MA3A 3IU3A 2VZ3A 3SJVD 1AD9A 2GHWB 2HTKD 3BPLB 2EDYA 12E8L 4GUPB 4B0MM 4ODVH 1SY6L 3TFKC 4EDXA 1MFCL 1H3PH 1KJMA 3HZKA 2D7PA 1V7NL 1UKTA 3QXDA 4QF1A 4I4WB 3F65A 2FEEI 2IPTH 1JZ7A 4AQ1B 4JRXA 4G8IB 2CRMA 4GAGL 1DBKL 2YSSA 2NY3D 4KI5F 1IM3A 2J4WH 4TSBH 5D2NB 1TJHL 5IFHH 1FE8H 4R96B 1JHLL 1CE6A 1MH5B 3DGGA 5KSVA 4UT7H 5CD5C 4F7MA 2P45B 2OJZL 2Q86B 5CIPA 4PJBB 3JTSA 5HHMD 5C09B 4G6FD 4M43H 4ORZC 3OG4B 3OHXA 1JNNH 4KDWA 1CLZL 1Q9OB 3NIDF 4FXGA 4JM2B 4KC3B 4NQVA 2CUHA 4YHPA 5EOCJ 1N6QH 4NO0B 3QULB 3P4MB 5IFAL 5HI5D 2DQFB 1HI6A 1RIUL 1D5ZA 4MA8H 4WNQB 2QLVB 1EAJA 4K9EL 5I66A 4RSVA 3ULUC 3O8XC 4QCIB 4JHAH 3FO1A 2NMSA 5EH1A 1BWWA 2A1WH 3KPSD 4Y1AE 3MBEA 3GSVA 5T1MB 1OGAD 1TPXB 1CXHA 3ZKND 1DBJL 1TXKA 2DQUH 3OF6D 4HWEH 5LXGL 4MB4A 1UKQA 4P4KB 1A9EB 4KVCL 1KB5B 5MHSD 1KB9J 3O4OB 1KXTB 1XR8B 1A6TB 2CKNA 1I85A 4K3JL 4U1JB 3DX7A 5D72H 3HNVL 3N1PC 4ZO9A 1I1AA 1BBJA 4GS7B 3KS0H 3QIWA 4DEPB 3VFRA 5FA4A 2G75B 1X7QB 1FN4B 3MJ6A 1HHHB 3RDTB 1I3VA 3OKYA 3T1WA 3C9NA 4P9HC 1T7VA 2L7JA 3FQWA 4X6CA 2CLRA 2JF1A 2CPCA 3KWWB 3K2MC 2WAHA 2CO7B 3VRJB 4PYHA 5TPWH 1I7RB 4EJ1C 1KPVA 4GSDL 2FO4A 1IT9H 4XPHL 1Q38A 2X4UA 4XNQA 4JFYB 5F7LB 1P7KA 1FL3A 3I3EA 4ODHH 4P4RA 1BGXL 4G8GE 1S7TB 3WL9A 1YDPA 5FF6B 3D0LB 1HHKA 1YN6B 3VG9C 4UTAL 5IQ9B 4XRCB 1R5VA 1X5GA 3CUPA 4PRAA 4BZ1H 1W72H 4YHLH 3I84A 3U9UB 4X7FC 4M6OH 3WUWA 3PWVA 3VGAB 4XI5D 5D7LB 1E4WH 3SGEI 1IEBA 3ROLB 4YXKH 1B4JH 2E27L 2YRZA 5FV1L 5LBSL 3IJHB 5DVMA 2MQ3A 3IXAA 3WHXA 1J1XH 3CAFA 3DXAD 2XN9E 4XC3L 2ICCA 5IEKA 3WXVH 5IG7A 1WUNT 3HRZA 2FEDD 3HI1A 4G6JH 2A1WL 4M5YH 3MA9H 5IF0B 4OCRL 2EIBA 3KPPA 1CDCA 4NN7C 5ESQB 1FH5L 2ZKHL 4RRPG 2F54D 4HIJB 3U46B 3GJFH 1O7VA 4NZJA 5J13B 5EORH 4J3TA 4PJGA 5TE4L 5D7IF 1HDMA 5DC9B 1XIWC 3H0TA 5L2KD 2XFXB 3H42L 4H25B 4BQ8A 3AMLA 1IGYB 2V5MA 1AGDB 3QNYA 1BQSA 3EW3B 4JY5H 4ZFZB 4CVZB 3BZEB 1TVDA 3RA7H 3IU4L 3GRWL 2I60H 3C6LC 3CFKA 1S8DB 4Q2ZA 1FNEA 3BGFC 2YD7A 4PV9B 5I19H 3FQRB 1G9MH 1M7DA 4WFEE 1KACB 4DZBA 4MSWA 3OJMB 5CIPB 3VFTA 3WUZA 4JO2L 1T83C 2VOTA 1DBKH 4Z7VE 1S9XA 2EIDA 5F9JB 3RWIB 1V7NH 3O3UN 2W0PA 4NKDB 1A8JH 3D85A 1NFDF 3WJLA 3CVHH 1M71B 3QQ3A 3RPKA 4Y4KC 3U30C 3QXWA 3IS1X 1YJDC 3MNWA 5D93C 1CK0L 5CKGA 3N1MC 4MLIA 5EUOE 4W81A 1MFCH 4D0DA 3FN3A 5TDNB 3F7YB 4FN0A 1BX2A 3L3DA 1I1FA 2KZ1B 5I18L 5CHNB 1YPZE 5FKPA 2YBRB 2X42A 5HPMA 3OAZH 1IFHL 1V05A 2JK5A 1W0YT 2NY5L 4NDMB 4EUPA 4UB0L 4P4KD 2B1HH 2LQRA 1QQDB 4M03A 4K7PX 5F7UA 1U3ZA 1ZTXL 2C5DC 2FBOJ 1A0QH 4JKLA 2DLTA 2F9BT 5ITBH 4PJ8D 3ARXA 3PL6A 3S37L 2D31B 4JY5L 2EE3A 1QRNB 1VADA 3T0VA 3U0PA 4G6ML 3O2DA 1NC2A 3NZHL 2DD8H 4APQA 1JPTL 4G8GD 1YN7B 1N2RA 3MLWH 1ZVYA 4LMQI 4G9DA 2F8OA 3U0TB 3RZCA 4OCSL 5HHVH 3I50H 3VFOA 5JORB 2VIRB 2Z4QB 3GSNA 1AC0A 4P5TA 1M1SA 5FHAL 1HYSD 1FYTA 4QYOA 2H3NB 1D5ZB 4X8JB 1R3IH 4Z76A 3MMEB 4LHUA 4OZGF 5F3HA 5DXWA 1ZHLA 1X5JA 4GH7B 1G6RB 1PX3A 3FO0H 3V5HA 5HVFB 5SV3A 5F6IC 8FABB 1ZLUH 3VXMB 3O9WA 1NKOA 3AC0A 4Z7UA 2UWEB 3JBG7 2X4SB 5A2JH 1EGJL 2A77H 3I9GL 3BN9D 3SDDC 1JGLL 2A9NL 5D1XC 4WI3A 1YJDL 1IM3B 5D2NA 15C8H 3CSGA 1EVTC 2X7LB 1WBZB 4U1NA 1RJLA 1NDGB 4NQDB 3RZCD 1BBJB 4HFWB 4BFGA 1EJOL 1D3CA 1RUMH 1X44A 3F62A 3PV6B 4HZLB 2HT2D 1KLUA 4UTAH 1J1OH 3C8KA 4JO4H 4OIAA 4PGJA 4TNVK 3SCMC 4Y16B 2UVFA 1WVZA 3G5XA 2GITA 5JLZA 3QZWB 3VXTA 3SO5A 4QKXB 4RGOL 4LLWB 2VQTA 3IDGB 1MCOL 2YD2A 1E4KC 3RIAF 4ODTH 4N8VB 2ORBL 1F8TL 3GMQA 1IC5H 5HDBE 2X4UB 2AJZB 1Y6KR 4I2XA 1NCCH 3ZDYF 2X44D 3LB6D 3VDBA 4YK4B 9CGTA 2UYLB 1ZLSH 3WHE1 1NJ9A 3PWJA 5K33A 3OKOB 1S9WA 5D96B 2XPGA 2NY2C 2R2BA 4UU9B 3ZE1F 3PQYE 5I76B 3GM0A 3ROLA 1TJIH 1AQKH 4HEPG 4YBLB 1MAJA 2B8OT 4MXWH 4FMKA 4HPYL 2R0ZH 3CX2A 3U6RA 5IESL 1M6OB 1J05A 3HLAB 3CCHB 5HGAA 1NAKH 2AK1H 4NKOA 4LVEA 3WFEH 3C60C 4HULB 3OB0H 2OM5A 5EU7C 5HHXH 4J8RA 1JTOA 5FGBC 3AREA 4XBEH 3EFDH 1S9XB 1ND0B 1MJ7H 5GGSY 2NY3B 3RWIA 2YEZB 2AEQH 4TVPH 4X8XA 2RFXA 2Q87A 3TZVA 5BS0E 3BPCA 1KUMA 3F5WB 3VRJA 2Z92B 2ED7A 1IC7L 2P24B 4LGSB 2ESVA 1I7RA 1IVLA 2IPKB 4PJGB 1NGYB 1WCBB 3O2WH 4ZUWA 5E00A 3OKNB 4R7NB 3UTQA 2VL4A 4C55A 1P4BL 1P7KB 1ZGLM 5C0IA 2XFXA 3KYOA 3WIIL 4EKXA 4PRIA 3LH2H 2FEEL 3ARZA 2F15A 3OKEB 3TT3H 2D9CA 4YXHH 2D7OA 4PY8I 5IQ9A 2PNDA 4JO2H 5JDJA 3AS3A 1UZ6E 2YUVA 1SJHA 4X7SL 4WDIB 4DUVA 2UZIL 4TNWK 1SQ2N 3QISA 3DROB 3HNTL 4X80H 2XXCB 3OR6B 2DDQL 3DUSA 2A6IA 4LP4A 3DMMC 1QR4A 1J9CT 4M6ML 1T7XA 3FQXA 4JGUA 4YK4C 2GJ6B 4N5UA 3MGAA 4P2RA 4NO5B 4KUCF 1K6QH 5F1OB 4IIQA 2X4NB 3PV7A 2D7TH 1DBBL 5CGYD 4ISVB 1UYWH 5D9SA 3EOTL 3OGCB 5IMMA 1VFBB 4UQ3A 1FVCB 1VEPA 4M7JL 4LVHC 3C09B 1J0JA 4KUZL 2BOBA 1A7RL 1FDLL 3QI9B 4TSCH 3QEGL 3QA3B 2BVYA 5JR1L 2AXFA 3P4OB 1QHPA 5BV7C 1P4IH 2P5EB 5TF1L 4YHOL 5HYQA 3BP5B 2BP3A 2CIKB 2AXJA 3RUGF 3RIFK 2XACC 4Y88A 3D0VB 4KI5D 5CEZE 2QBWA 2H8PB 3LEYL 4UV4L 4IMLB 3QZWG 5KAQF 5C07A 1I3GH 5AEAA 2X89A 4I48A 2DLIA 1PSKH 1J8KA 4H0GA 2VLME 3DX8B 2X70A 2G60L 1NDGA 2ZJSH 3VFWA 4KV5E 2VXSH 3TLRA 1FNSL 1I4FA 3MV8D 1MRCL 5IB3A 1XFPA 4YC2B 2I9TB 5JTWA 3QWQB 2Y9RT 4MXQC 2IBBA 2VABA 4UILL 3ARWA 1GJIA 4BZ1L 1P9MA 1MUJA 3MBXH 2XQYK 1W72A 3S9DB 3HTLX 5INDB 1NEZB 4PGEB 2AKRA 2X5PA 1IAOA 4MNQA 2DMKA 3RWGB 4FP8L 3GIVA 5H35A 1FCGA 2IH1A 4AT6B 4P2RE 4FQLL 1J0KA 3GIZL 1Y6NR 3QCTH 3S8WA 2VDLL 1A6AA 1MQKL 3QDJB 4ODUA 3B3IB 3IFNL 2HKHL 5CAYB 2DJSA 3MLPA 5C09E 1LO5B 1A7QL 4QRQB 1D5XA 4L9LB 4PJIB 1JHKH 4UI2A 5F1NB 5IW1B 3O3EA 5I71C 4BSWB 1IKNA 4AYFA 1I8KB 3W9EA 2R0WL 1Q72L 4R90H 4LMQE 1NBZB 4MZ2A 3VFVB 4PRNB 3B2UC 5D6CA 5I16B 4QRSB 3RZCB 1WLHA 3SGJC 4HGMA 2AI0H 2X9YA 2VIRA 4X9IA 1W72L 1X3DA 1U3HC 3ZHDA 2WIIB 2VZOA 1CWVA 4X0KA 4YHZH 3O6KL 4DVRL 2HJKA 1FZOB 4LKXB 3MV7D 1UCTA 3KS0J 2P7TA 2W65A 1EEYB 2ZUWA 5FYKD 4GMTH 3TWCL 3TJEL 1QSEA 3VXOA 4X4ZA 1JF1A 3SGDH 4HV8B 3D85D 2OL3L 2VLLA 3QI9C 5I8EA 1ZT1B 2ZUQC 5J1SC 4H8WC 1NCBL 1VACA 3IRPX 5LGJA 5F1IB 1T6WA 4K55A 5T5NF 5HYJD 2V6HA 4RFEA 3MCLL 3ULVL 3NIDE 5IUSA 1DP0A 4J23A 5T33L 4PJ5E 3MUZ1 4PGBB 4YDJB 5I71B 2DL2A 4MXWL 3S35X 3CCHA 2W0KA 4K7FB 2DBLH 3H3PH 4KQ3H 5C0BD 1K8IA 2YSSB 5D2LE 1YEIL 3L1OL 4LOUC 4MA1B 5BMFL 2Q6WB 2EXYD 4U3HA 4D3CH 4NNXB 4RGND 5JHDD 1VFBA 5JOEA 2HJLA 4J1UA 1JTTA 3EYVB 4HAFA 4NFBA 4HWEL 4HQQH 3NPSC 1GGBH 2BOBB 2DQTH 3BSZH 4Y4KA 3MCKA 2IADA 3FRPA 3PQYD 4NIKB 2AJZA 1I8LC 5DQDL 3RWCB 3CDFA 1ZHKB 5C0DB 2A6JB 4U0RC 3QUZC 5DEGA 4L8SC 2FYYB 3PWJB 4OD2A 3VWJD 3GJFA 4PJ8A 3CC5A 4TUKL 1QSED 4PFEA 1CS6A 3AMKA 1QBMH 1RIHH 2FX8L 4S2SA 4ZO8A 3VXPA 5B4MD 4M1CC 3C60B 3U83A 4KKLC 2BNUA 3RKDC 1HILA 1J05B 4JPVH 4PJIE 5HPOA 3SKNB 5DZOA 4KY1L 2I9TA 5AUMB 4MJ5B 3VD7A 2MCPH 3VFGL 3EO9L 4EDWL 4S0SD 4J8RB 3GSXA 4UV7L 3L3OB 1AFVH 2A9ML 4GKSB 4WWKB 5T3XD 3O3BA 3LH2L 5TE7H 1T03L 2R9HD 3NIFF 4YHIB 1KLGA 1OAKL 3MLUH 4I18B 3VXUE 1H8NA 1TJGH 4FOMA 4S1SL 3BZ4B 5I1EH 4YFLI 2XKUA 4YX2L 4DUXA 1EA9C 4PRIB 5DMGD 4WW2C 3O4OC 2OJEB 2PO6B 2GJZB 4OKVB 5B8CA 4N5EC 1P1ZA 4OLVL 4WY7L 1C08A 3SCMB 4PB0H 3WHE0 3DROA 3MRPB 3JV4A 1QBBA 4WFED 3OMZA 3TV3L 4TUKH 1CL7I 1DN2A 2DRUA 5JOPD 3DXAB 2ZUTA 5TDOA 1REIA 5C08A 1A7OH 5D7LA 5C86A 3EDJA 1L7IH 4A6YA 5CZVL 4KDTC 1JV5A 5CEZD 1KJVA 4JFHE 3UTZA 2B0SL 3ES6A 5TDPA 4K3EL 2EXWC 3L3GA 5L8JB 3NOIA 2CIIB 5F6HJ 3RKDD 2HG5B 1K2DA 4PJ9C 2XRAH 4QRUA 3AVEA 1VFUA 3HA0A 1BBDL 1OPGL 5AYQA 3RY6A 5ID0A 1GHFH 1T1YB 4U0RB 4WUUB 5E94B 3SO3C 1XF3A 3QQ9C 5I0ZA 1MCBA 3UTPE 4OJFH 2AJYH 2X4RB 3KXFB 5BO1H 3ZTJH 4LHUD 2E9WA 4TPRH 1RV6X 3U4AA 1EZVY 3IYLW 3P0VH 4NUGH 5IIEB 4YHKH 3WBDA 3VFVA 3VG0L 2HLFD 3QIWB 4F3FA 1KELL 3VXME 3HR5A 5HHQA 4QRSA 4I0KA 1MRFL 5F9OH 5FIEA 5D70L 1KBGL 2AGJH 4P59L 3TWCH 3WV0A 1KT2B 4A6YL 1YPZF 5IVXE 2WIIA 3ZE1E 1Z5LB 4YO0B 3MOQA 3ILQC 3KWWA 5ACMA 2ERJB 3IKCB 4LFHG 2NXZC 2AJVL 5FO9A 1BJ8A 1JTPA 1C1EL 3MYJB 5IROC 1RULL 3GO1L 4G80A 1GZPB 3MUHL 3CFEB 2EKJA 2AI0L 1I1RA 5IMOA 2CRYA 3VXSD 1J1PH 5A3ID 1YYML 1SJEA 1JMXA 1E6OH 5F9DC 5EO0B 4NQDE 1HSAB 5HHVL 2BCKB 2HTLC 5A2FA 2A6KA 3MXVH 3F7YA 4KQ4L 4QRPD 4GW5B 4JREB 4FABH 4NP4H 3B9KC 3LPFA 2AW2A 1GL4B 4J3VA 3VXPB 1DFBL 1T7WA 4JN2A 4K7FA 5EUKA 1HHIB 3N1QC 2C1OA 1KELH 5KS9E 4RWYH 1HILB 3V0VA 3E8UH 1NAML 4PD4K 5IB1A 3W5MA 5DUBA 3MCLH 4PJCF 2F74B 5CS7A 4TPRL 5D6CB 4Y4HB 3P30L 2G2RA 4AMKL 1RIHL 4DVBA 1A1MA 4PYGA 4OAWA 1R0AH 4MAYC 1OP5K 1N3NA 4Q9RL 5CEZL 1TIUA 3OXSA 1UB5A 1FO0H 1A21A 5A2IH 1ADQA 1FZOA 4P9ML 3U0TA 5IMLA 5GRYA 1D9KC 2DTML 4P23B 1AD0B 4M1CD 3AUVA 5DK2B 4ENEC 1U42A 5SX4I 2MMXA 1JZ2A 1YYMH 1WISA 3VH8A 1P69B 4EN3A 4Z9KB 3RWJB 3GB7B 2VLLB 1IC5L 4HG4J 5HI5C 2ORBH 3VD3A 4UT9H 5EZOL 4MJIA 4RMSA 1G6RA 2VXUH 4NOFA 5D5MB 1FPTH 1JWMB 3S36H 1N6UA 1MCQA 5CWSB 4R4FL 3HAEB 3ZKXB 1U8NA 1CXKA 3QO1B 1O5DT 2DN7A 4M3JA 3U0WH 2K9UA 4LSTL 2R8SH 5HDBF 3V79C 4NC1C 2MKLC 5F1KC 4YPGA 1F2XK 4OZIF 3MNVB 2VJXA 1BHGA 1CD9B 5ANMA 1C5BL 4RBPH 1CFSB 4Z0XA 4F9LA 1JZ5A 2NW3A 4XNUH 3JZ7A 4KKAD 3T4YA 4JQIL 4ELMF 5IQ7L 1I7TB 3FT3B 3OKMB 5ICZA 1HQ4B 3T65A 5GGSB 1Z9OA 1S7XA 2LABA 5DVLA 5E5UB 5F7WC 1BWMA 1ZEAH 2HTKC 4NKMB 4KK8C 2VYRE 4AEHL 4NUJA 2GJ6E 1UXWA 5IMKA 3HG1D 4D2NA 5HD8C 1LO2H 1T1YA 1KCUL 3CX5J 3I85A 2P5ED 3NFNA 1IAIH 5M7QA 1ZHNA 5CLTA 1G9NC 3QI9D 5CZVH 3CFJA 5TF0A 5JZ7D 1H8OA 1X4ZA 2GQHA 2IPUK 1RZ8B 4CMMA 4MD0A 5D7SL 1JCKA 5HI3C 5GJTH 1U8IA 1VENA 1SBSH 3WDJA 4NQCD 2VLJD 3WE6B 1BFOB 4FQIH 2VUYA 4HUNB 4FXGB 3O11B 3QUXD 3ULUH 1A0QL 4MXVF 1M6OA 3HLAA 4NO0A 7CGTA 1HOCA 5I2IA 3S3JA 3T0EC 5C9JB 3TZVC 5EU3B 2E3VA 1CU4L 2XI9A 2YEZA 5D2LF 1TQCB 3T2QA 5KS9A 1A14H 3TO2B 5LQBH 2E5EA 1MCIA 5FHBH 2R29L 5CJQL 3SOBL 2X4OB 1RZGA 2A83A 2V7HA 3LV3A 4F7PA 2PXYA 4QXUH 1OGAE 1T3FA 4RIRA 2GJZA 4OKVA 4U05A 3V7AE 2NXYB 3GHEH 1EFXA 5HVHC 1YECH 1UM6H 1WEJL 3FRUA 3KPQB 4PV8B 3BH9A 4XX1G 3KYOB 5HGDA 5J06A 1N7ML 4J3XA 4NQDA 4FQ1H 2AJUH 1EDQA 3LS5L 1B0RA 1E4XH 3IS0X 3JWDC 3PP3K 4Y5XA 5J3HD 1LD9B 2E7LA 4OLXL 2NXZD 1KLUB 4HZLA 4OB5H 3MRJB 5CMAB 3QEUB 1CD1A 4PJXA 2KQNA 1FFPB 4MDJA 3DETC 3DVIA 4FA8A 4EIGB 1U8PA 3LQZB 1RI8A 2Y07H 4P2RB 2DM3A 4NPYB 3WFCH 4ETYA 1OAUH 4Q9CA 3EOBB 5IVXA 4H8WH 4OLYH 3F58H 5FO9B 4TRPL 3T0ED 5HHOB 3ORJA 4JRYE 1E4KA 4KGJA 1RULH 3LVEA 2M1KA 1U93B 3QEQB 1UA6L 4BZ2L 2UYLA 4Y1AA 2E7LC 5FKAA 3SPVB 3EFDL 1LVEA 5IHZA 1J86A 1DDHA 2VXTL 3ZKSD 1LK3L 1BP3B 2GSIB 2I5YH 3REWB 3H9SE 2DQTL 3BSZL 3UTTE 3VXSB 5EUKB 1NFIB 4L3AA 1KJMB 1VEMA 2E6PA 2YUZA 4G8FA 5KBNC 3FB8B 3S5LG 5IB1B 4P4KC 4G9FE 1IM9A 4M5ZL 4MAUL 1HINH 1FAIH 3MRHB 3V2AR 3HS0B 5SWZB 4URTB 4WV1B 3REVA 2DM4A 2E8ZA 1KYOK 3T0EA 4NQDD 3MZTA 1FFOB 5H37G 3MRLB 2IJ0C 1F6LL 1KCVL 3BPCB 2CSPA 3F5WA 1RZ7H 3OAUL 4HLZH 4Y4FC 2A74A 1JPSH 2G5BB 2IPKA 3BHBA 4PJFF 1A22B 1QBAA 4HCRA 2V5TA 5IMOB 1CTNA 2D4DA 1G1CA 1K8DA 4J6RH 3RZCC 2ICEA 1DJSA 1B90A 1IL1A 3NZHH 1T22B 1BM3H 1MHHB 1X9QA 3BP6A 4K7PY 4PJAE 1NL0L 3EHBC 5TPWL 1JWMA 3NABL 1B88A 1ZVSB 4PRHE 4N0UB 3ARBA 4PJ9D 1P4LB 3QHTC 4GW5A 2ZCKL 4GW1B 1CGYA 3OJVC 1XIWD 3LDBB 4NOBA 2RCSH 4WY7H 3WEXB 4M8VA 4KKCD 5DUBB 4CRPA 4NRXB 1BFOA 3HRPA 3IDMB 4ZDHB 1PEZA 1F6AB 1S5IH 4GW4A 5D7KD 2YPLA 3UTPD 4YEEA 4Y5YC 5IBLD 3BO8A 5GRUH 3T4YB 4QOKA 3QQ3B 4LCCB 4J12A 4L29B 4HJGB 3EDFA 4LSVH 3ESVF 3SCMD 4PJDA 4LLQB 4OGXH 2OX5A 3CSBA 3MLZL 2FECL 2BHZA 4HMEA 2BZDA 3OF6A 1ADQH 4BQCA 5IMKB 1R3HA 1CF8H 2HJKB 3BP7B 4I2XE 4XT1C 3DIFB 3MR9B 1VKXA 2HVJA 2NTFB 1P84J 5EBMB 3VFGH 1T3FB 3QFJB 5LJYH 5ADPL 3QFJD 3MLYH 1IMHC 2QQLH 1RZ8A 1V7MH 3MBXL 4XNUL 3MGTB 1S7TA 5KANG 1DL7L 3ZLQC 1QRKA 1Q8MA 5I8OL 1NBQA 5ERWA 4LCWE 1TITA 3MV9D 1YN7A 3TP4A 4PUBL 4WWKD 5F72S 3GJEA 4LVOB 3PGDA 2BRRH 1TJHH 3NFPB 5L6YH 1JF6A 3VCLB 3E2HB 5I1JH 5EIQA 4NQSB 4ZAKB 3DSFL 4X8JA 4ODXA 3QDAA 5IR1B 4DCQB 1MRDH 4GAJL 5L7XH 2WANA 5H35B 2DQEL 4R26H 4CAGA 4UIKH 5C92A 4J1UB 3E6FB 5E2JA 3X3GH 3W0WE 3UC0H 2IBGA 2Z8WC 1MY7A 4NZUH 4KRPD 4Z7UB 3GKWH 2ARWA 4KMLB 1MHPH 1C5CL 1R5IA 5CGTA 3RWCA 3O6ML 3B3IA 4PJAB 1JNLH 5HGDB 5H2BB 2E9JA 4NNYA 1CE1H 5D7KE 3DMMB 3PXHA 4OD1L 4M62H 3WXWH 3CFCH 3UJJL 1LD9A 4L4JA 4I0PB 4MQ7A 3H9SB 1BOYA 3UTTB 2MQ0A 3MRKA 2ZUYA 2ICES 3LOWA 3SKJH 1FNFA 2R0ZL 4HDIA 4KMTH 4ZFZA 3BZEA 1KNOB 4QTHA 1NAMH 2P44B 3REVB 4GMTL 4JZJB 1A4JA 4FRWA 5C1MB 1JZ3A 5JDSA 4HHAB 4X0KB 5KVMC 4HC1A 2FD6L 3UX9B 4KROD 1IGMH 1XGRA 4S1SH 2AJSH 1U8OA 1FVEB 1LP9F 4PJ9B 5SWSD 4HIIA 2UZYB 3WLBB 3MRFB 4YDLB 5TFSL 3OKOA 1QPPA 4Y0GA 3QUYD 4YR6B 3STZA 1BEYH 4OUOA 4TNWF 2PW2B 4MCZB 1XGYH 2P46B 4OCXH 1OAZH 3ULUE 3VXNA 2AEPH 4HFUH 4KZDH 1NUFA 5D1ZC 3BKMH 4A6YH 1JUFB 5E5RB 2IANA 1QHOA 3LD8B 3N85H 3BPNB 3NTCH 4OFVA 4YDJA 4LHJB 3KHQA 1KJ3L 5D70H 1JVKA 1HSBB 4I13B 5C0RL 4KK8D 4JPVL 3R1GL 5FYKL 4B7LA 4O2CB 5ID1A 4XWOD 1G7HA 5AYUL 2NQCA 4GBXC 4TOYL 5ETUA 1ZLWH 15C8L 1SVCP 3T0EB 1IC4L 3O8XA 4NNXA 4YHKL 1QBML 3VGDA 2EYTB 3THMH 5E4EC 4L3EE 5C8JB 3WKMH 5KSUB 4KDTA 4Y1AD 4LFHD 4LCIL 4Z7VB 4AENA 1NGYA 1WCBA 2NY6D 5IQ7H 4PJDB 1QFWL 1N2RB 2O5YL 3CMOL 5C0DA 4GQ9H 2IALB 1ZHBB 4M7ZB 1T22A 1F2QA 5BJTB 2C9AA 3QDJD 4I3SL 4OCRH 2FHBA 3E0GA 1SJHB 4PLOB 3ES6B 1F8TH 3LKQA 1CD0A 3BD4A 5LCVL 1ZHLB 4PJFB 5T3ZE 1WAAE 2A38A 5BRZD 1FL5B 4FTVA 3R0MA 3FB8A 1EV2E 5HJ3A 4K8RD 5EZJA 5FUZH 2EEAA 3LRSB 1KPRB 4NZTL 1RIVL 4EI5D 2KUTA 3LRGA 4QHKI 2YPLB 5HHMB 5C09D 3RVXD 5DGQA 4MJ6A 1XZ0A 5BVPL 1NBYB 1V5JA 4L3ED 4XVSL 3KJ4C 1J5OL 4M1GL 4R2GC 4NJAH 3NFPA 3VE0A 2B5IB 1YY8B 2XZAH 2R39A 3NACL 1EEUA 3C8KB 1QBLH 2JCCA 3GSUA 5I73C 3PHQA 4U4BA 4L8SB 4YHNA 4KVNL 5L9DH 5C08D 1H15B 1T80A 1R0AL 1KC5H 5IOPB 2X4QB 3LKNB 4XMKL 1EBAA 1IBGH 1SJXA 4AMKH 3IF1A 1I9IL 5IWLA 2CKBB 1KG0B 5EZLA 3NPSB 3TC9A 1MFDH 4L4VD 4GW1A 4GAYA 4WHCA 3EO9H 1YEEH 5D96C 4OCSH 2A9MH 3EAKA 3ISWA 2ZSVB 1BAFH 3BD5A 2XV6B 2VDMH 5DYOA 1DBAL 2GJJA 2R2CA 4HIXL 4ZOEA 5JA8B 4XMLH 4XPGH 3QHFL 3C2SA 4X7CC 4OCYH 4M7LL 3H3KA 4HKZB 3BE1L 3HAEG 4XP9H 4P2QE 3ZYZA 2PR4H 2V7NA 3LKSA 4HK3N 3MACH 5JDSB 4KJQD 2R2HB 3MLSL 3RQ3A 4L8CA 4O58H 2IH1B 3ARFA 1JGUH 4D9LL 3TBWB 1EO7A 4PJBE 3WFHA 2DLEA 1BVZA 1FIEA 1O0VA 4JFXA 3KPLA 3JSSA 1QKZL 2PYFA 1OD9A 3PQYA 5IBTH 1M05A 4G6JL 1OAUL 1CE6B 3DGGB 2DQHH 1YMME 1PGRB 3SN6N 5EFIB 4R7NA 5E08H 1CQKA 1RK0B 3UAJD 3G5VB 4NQXA 3D3VE 1J1XL 3GB7A 2DIBA 4M62L 1FV1A 4G8EB 3WNOA 1AGCA 5GGQH 3GI9H 2JJSA 2LVCA 1FN4A 4X9FA 1FAKT 3WNNA 1J18A 1E4WL 1TNMA 3MJ8A 3HUJF 3FFDB 2FZ3A 4KRLB 3PIQA 2DKMA 4GRLD 4GRMB 4JCLA 4YFDB 1MLCB 3VJ6A 1NMCC 3MJ9L 3UC0L 2EYTA 1E6OL 4ZPTB 5DR5L 4WU7B 3CGTA 2E7HA 3IU4H 4LKXA 4TN9A 2UY7A 3BESR 3RPIB 3QG6A 5FGSA 4OZFG 4JM4L 1XR9B 1K4DA 5LQBL 3NIGE 4O51B 4XNQB 5F96H 2DTSA 4RRPA 5L2KA 2C3WA 4NJ9H 3ARED 2PW2A 4MCZA 4RGOH 1YMMA 1HQ4A 4F58H 1U8KA 1LEIB 1IKNC 1G6RH 5FOBB 2FLRT 3VA6A 3CFIC 3K8KA 4K8RL 3JV5A 1GH7A 3FQNB 3VW3L 3Q5OA 1QP1A 2XZCH 4P9HH 5E8DH 2C3VB 4ETQA 3ARGB 2OTUB 1FL5A 1YY9C 2NY6B 3D0VA 4PJFE 3GJFK 4C4KO 2BNRA 3FMGH 1JYVA 1QFOA 1A6ZB 3SDDA 1RJYA 4Y16D 4K3JH 1B0GA 3JXAA 2FNBA 4YDIL 2CLRB 2CDEA 1BVKB 2HT3C 1PVHA 4Y4HD 2H41A 3PHOB 2XWBB 3QCVH 1ZMYA 4JZJA 3MJ9A 5J12B 3KYKL 4WFFE 3VE0B 3MLZH 5DVKA 4JQVC 1UVQB 2R2EA 5I8KL 1BQHB 3GSWA 3QIWD 5IW6B 2VDPH 2Z91B 5E70A 1P9MC 1Q9LA 1Z6JT 1G7PA 4AIOA 5HYSA 1H15A 4KUCD 5BJTA 1BGXH 1NGXA 1UT9A 2XA3A 2P5WE 4LRIA 3T3MF 5DJXA 3PGCB 4L3CB 1JE6A 5J11C 1Q94B 2YRLA 5C0GA 3UROR 4PRHD 3VXNB 4Z7VF 1ZA6A 1URLA 5EA0L 4U6VL 3O3DB 2PO6C 2YHGA 4C56D 4KRPC 4AH2B 1EHLH 4LGPB 1IQDB 2I9LB 3GMLA 4Z95L 2AV1B 5KZCB 2PXYC 4TULL 1J8HE 5TH2B 2JCCE 1ZTXH 4UAOB 1OD7A 3OKLA 4JDTL 1RIVH 5CIPH 4AIZA 4JKWA 4GT7A 3ESUF 3VRLE 1C5DA 2WIMA 5DUPH 3H9HA 1TZIA 4N0CD 2FX7L 1EH9A 4HKZA 4JJHA 4N90E 4NN7B 1IM9D 5KSUA 3K81A 5CINH 1LK2A 1Q0YH 1DQDH 5F96L 1S7SB 4H1LA 3N1FC 1D5MA 1KCKA 4ZUUB 4HXBH 3MPCA 5FCSH 3MRNB 4OCWL 1BPVA 5TF1H 2YBRA 3QNYB 5HDQL 1OAXH 5HHOA 4NDMA 2J3SA 4HT1L 2EO1A 1KV3A 4KU1A 2PO6D 3M8OH 1HYRC 1KCSH 3MA7B 4R0LA 2Z8RA 2RJMA 2PF6A 1XGPA 5EFIA 5DURD 3D2UD 3K1KC 5I19L 3B2UD 4KDVA 1SEQL 3RA7L 3WDHA 43CAA 1BZ7B 2X10A 2SEBA 1IGFL 4KHTH 3HCVA 1NFKA 5EG6C 4MWFB 5IBTL 4NKDA 3QHFH 3ULUF 3R1GH 5FYKH 4GXUM 1AQDB 1PD6A 4X7SH 4CU8A 1P2CA 1SY6A 2B20A 1GGUA 1I9JL 4V1DB 3BPOB 4WWID 4BK5A 4I0CC 4YDKL 1BX2B 1MFDL 5M95B 5GRVK 5GPRA 3QUKB 4GBXD 5IOPA 3RZWA 1AE6L 5IEHB 3TO2A 5HY9B 4YNYB 3VWJB 5I1IH 4N8VG 1DUZB 4X5WB 3CDGA 4LCWB 4HIHB 5C0CA 1MJ7L 1MI5A 1G9NL 4ZFOL 1UB6A 4LU5L 2X7LA 3MX0A 1T1XB 4OZGA 1IL1B 2EIEA 2R1WB 1CCZA 4QXWA 4I18C 4NWUH 4N0RA 2J88H 3IJSB 5KSBB 3QJHB 1X5AA 5J56B 3CC5B 4JFED 4D0BA 4HPOH 3BDYH 2WQ8A 4F7CB 1MLCA 5DZNA 1RZJL 4OFYA 1U3HB 2NY5H 4X6CE 4J7RA 1TJIL 3DX6B 3B6SA 1DVFA 3MOAL 2JJUA 5FUOH 1U91B 4ODSH 3TO4B 4QRRE 5IW6A 4XMPL 3L95A 3KPRE 4PLJD 4MD4B 4QOKB 1QEWA 2AJXL 3RVXC 5HYSB 4WWKA 5IHUL 2AP2A 3FAWA 2EDKA 1L0YA 3VXRD 3BQUD 4YGAB 4I77L 5FCUH 4UILH 3G6JE 5BVPH 2VUOA 2P5WB 1KLGB 4QXTB 3GSNH 4C56B 4DZ8A 4JQXA 3DNKA 3QAZB 4KVCH 3BP7A 1U92B 1PSKL 3ZYIA 3QG7L 4ZTPH 5L8KB 1PYWB 3U4EB 5JMRA 2H9GB 5EC1B 3QEQD 2NNAB 4K07A 4ELMB 3GMRA 1NGZB 4JY6B 3JV4B 4GRMA 1KTLB 1ND0A 4N8VA 4PRDB 2JKXA 5C0ND 1DSFL 1NANI 2DM7A 2F53A 4ZPTA 1U8JA 4C59B 3EHBD 3QNXA 1WC7B 1G6RL 4R4BA 1KIPA 2A9NH 3FQTB 3CNKA 3KLSA 4F8QA 4M6NL 1TQBC 2BVPB 1LQSR 4RAVA 2D3VA 4LEOA 1FCCA 4DJMA 2BXYA 2EEBA 3PHSA 3MUY1 3HR6A 3RWJA 4D94A 4WRLA 3MROA 4GJTB 1QFUL 1OGAB 3QQ4A 5T3ZD 5GS0L 3QFDA 5IHUH 3TESA 2LV4A 1KB5L 3GMMB 4KWUA 4WI7A 1G0YR 3ARGA 4H88H 5J11B 4UV7H 2ITDA 1XGPB 5C6TL 4L8BB 1CLYL 4JRXB 3ZYOA 2ATKB 3UO1H 4YHYB 2E27H 5GXBB 3MREA 1DUYA 1RJYB 2XQBL 1F6AA 4GW4B 2VDRH 3BKCH 4M7KH 3N9GH 3KXFA 2CDEB 3SDYL 4M00A 2RFXB 4M1DH 2Q86A 1ZGLB 4UINL 2YN3A 4EIZC 1X5IA 5J12C 3S88L 3DXAE 5B3JF 1NAMB 3HR5B 5HHQB 1Q9KA 5E00B 1IC7H 1S7XB 1IAMA 1BJMA 1AP2B 1BLNA 2DQCH 1QLEL 1RVFH 4I9WE 4Z7NE 3WFBL 5E6ZA 2W9LA 2NXZB 1ODAA 1MREH 4NKMA 1NC2D 1FFNA 1WZ1H 4X6FB 2OK0L 2DQFA 1C16B 2ILLA 2QSQA 1A7BA 1OTTC 1AC6A 4P3CH 1LE5A 3WFEL 1FVEA 1T0NA 25C8H 1IGCH 1RPQA 3DHMA 4FG6C 4JKKA 1A9BA 1EBPA 2ESVD 1GZQB 2VC2L 4NZTH 1FORL 1A3LH 5KVGL 1E27A 1BQLL 5I1JL 2AV1A 3DI2B 3K8MA 2F54E 4DWHA 2FIRT 1FVCA 4H26B 2Z31C 1MI5D 1WZKA 2CK0L 2OZ4A 4ZSOA 2V2WB 4BSJA 2MPAL 2XWJB 1RQ5A 1MUJB 3QA3A 4E41D 3DYPA 4PJ7A 3GDBA 3QIUD 4L4VA 4LLDA 5KVFL 4NKIL 4RGMC 1G7HB 2V2XB 2EDWA 1CDYA 1YYLL 5IT2L 4MNQB 1ZGLP 2Z35B 5I1DA 4X6CB 4Y5VC 5EO1B 1IZJA 2YKLL 4LGRB 5L7XL 1V3LA 3WIHH 4JG1H 4MLSA 2P47B 4LLYB 5HI4D 5K9KA 4I48B 2D7QA 1E4XI 4G8IA 4ODUB 1H5BC 3DX8A 1RJCA 5E7FA 1VFOA 1MCKA 4PV8A 4NJAL 2YD8A 5DMYA 3RGVC 1FC1A 2XIDA 4U7KA 4PRPD 2NZ9C 4QRQA 3BIAX 1HHKB 5F89A 1VCAA 4F9PC 2F8VA 2IH3A 2W60A 4D3CL 1U8QB 2YMXH 3OKDA 1JGEA 2CK0H 5D5MA 2X9XA 1HHJB 1KXQE 5T3XH 3GFUA 1Z3GH 2Q7YB 3LIZL 1E4XL 1P5VA 2OSLA 2GYSA 3L6FB 4OFIA 4OLXH 4KZEL 2AKRB 3PWPA 1ORSB 3BT2H 4HUXB 4O2FA 2F53B 4PJXE 4ZYKA 4TVPE 1QFWI 1UADC 4WNQA 3CVHA 3SDCC 5BW7C 4LSVL 2FD6H 3ARBD 5FUOL 5ESQA 4C4KT 4JDZA 5J9PA 3CMOH 4RAVB 4MYWB 2YPLD 1OCWL 1FG2A 4OLZL 3IAQA 3QEHA 5I8EB 1FZMA 2VLMD 5EIIB 1U3YA 3QRGH 3T65B 3IFOA 1I85C 2EKSB 4P4KA 5F9WC 1OGAA 3B5GA 1DUZA 4X5WA 5C0CB 5GGVL 2UUDK 1A2YA 1IC4H 2BMKA 3P30H 4WFGD 4O58L 5DWUL 3CVIL 3Q5YA 2H9GA 2Z9TA 3ROOB 1F90H 4NO3B 3RNQA 3NFSL 5SX5K 5MEQB 1HHHA 3RDTA 5ADOL 1HZHH 2E9BA 3WN5C 1CVSC 1EIBA 1MQ8A 2NY3C 3RIAK 5JQ6H 4JHWH 4KPHL 1EXUB 4OGYH 5I18H 1WIPA 5F1SA 2J8HA 4WIQA 4LPXA 5FECA 1N59A 5DYOB 5JIPA 5MEOB 1DBJH 3WE6A 1NAMA 1EEYA 3BKYL 2FJHB 2LFGA 4NBYB 2VLJE 3GMOA 4CVXB 3VXQB 1AP2A 1BLNB 1TCRB 4LASH 3MBED 1P53A 5JIKA 4JFPA 1VFAA 5AZEH 5DEGB 1RUQL 5GSVB 4YHOH 4E9LA 5F1IA 4JN1H 5F7EH 1TQCC 3B4NA 2X6MA 3QIBB 1HXMA 1INQA 1CFQB 4BUGA 4KTDL 4OZFB 3PWVB 5GS3A 3NZ8A 4HKBB 2HFGH 2JELL 1DQLH 2N7AA 4N8CL 2NR6C 3SDCB 4G6MH 4OZHF 4L8BA 4TRPH 1Z9MA 4M48H 2WUBL 4LQFL 3RJDA 3KR3H 3NIFE 1XF2A 1UQSB 3VU2A 1K6QL 3MNZB 2Z93B 5E8DL 3PDDA 2CDFA 1EFXB 2EE9A 2D31A 2CH8A 2ZUQB 3BXNA 1KEMH 1B2WH 4IS6B 1VGKB 4RAHA 5CBEA 3MV9A 4HIJA 4ODBD 3BDBA 3ALWA 4NQEE 4YZFE 4AZ8A 3MRIB 3QNXB 1WC7A 4R4BB 4ZODA 4G9DB 2NY7L 4Y2DB 1PDKA 2JCCB 2MNUA 3O0RL 3I6KA 1J10A 4Z7UF 4KJWD 2FR4B 1GGBL 1HDMB 4HXAL 3BZ4A 1C16A 5DGRA 2H3NA 4N1HB 3TH3T 2DQEH 4R26L 2H32H 4PR5B 3P77A 4PGZA 2YD1A 3LN9A 5IJVA 2CJUH 1TCMA 4V1DE 5EUOF 2VTFA 3H9SD 3UTTD 3LEVL 5EWIL 4UOW0 4MAYD 4OQTA 4JFQB 4P2OA 2OXHA 2VLKE 2XT1B 2WINA 4UZGA 8FABA 5JMOC 2OK0H 4QRRD 1XEDA 1JRHL 4YXKL 4XBGB 1QLRA 4I8DA 3CU7A 2IBZX 5E99L 4KK9C 5F89B 5FKAB 4LLUB 4EZMA 2GSIA 1L9NA 1RURH 2K7QA 3QUML 3C5ZC 1EO8L 1DUYB 2NY6C 2UWEE 4DTGH 5DHYA 1FSKB 1EHLL 4XB8A 4Q6IB 3ULSA 2BOCA 2EEDA 4DUWA 3NA4A 5D7JD 3BFOA 1NGPL 2HVKA 1ITBB 3LHPH 3ME0A 1Y0LB 3LKRB 4JKPH 3ZKXC 1UWEL 2FEDC 5GJSL 3TFKD 2RB8A 4G3YH 3RIFF 4NP4L 3RWHB 1T21A 4ZNEE 4PJDE 1I1YB 3FFCD 4YGVA 1TJGL 4WJ5B 4JN1L 5F97E 4KI5C 4JDZB 5J9PB 2JJVA 3UYRH 3RL1B 4WHYG 4QNPF 3NGBB 1YZZA 32C2A 1K9TA 3RGVA 3O2WL 5H2BA 5GQBA 2Z0BA 3ET9F 5F93C 5EU4B 4Z7WA 1BJ1H 1GZQA 5GGUA 5DD0H 3VGBA 3VWKA 1JGEB 4PUBH 3HZYA 3RNQB 5ITFB 5MEQA 5JOFB 2D0FA 4QEGA 1TZHA 4MQTB 4KRMB 2XY2A 4NCC1 2OSLB 2FZ3B 4KK6D 3U6RB 2BNQB 5EBLA 2EDXA 1CBVL 4Y2OA 5E1HB 2APVA 3QPXH 3TCXA 1LE9B 4X6DB 1D9KA 5DRWA 1KCSL 4AIZB 3ARDD 1Q0XH 1XGRB 5JHDB 2WV3A 1B3JA 2R4RL 1GZPA 2HG5A 4MAYA 3TN0A 3SE8H 4U6YB 1PJ9A 3IDYB 1JGDB 1QBLL 1CZ8H 6FABH 5D7LD 3V6FB 1LHZA 2P24A 5ALCH 5GSVA 4OI8A 4M43L 5SWQB 4Q0XL 3G5YA 1EJ6A 5JXEC 1LO4H 2IANB 5I74B 5C0IB 4ETQB 2CMRH 4RQQA 1V3MA 2Q1EA 5D1QA 1OP5H 3Q0HA 4EI5A 4F3FB 4HS8L 4YBHA 4XXDB 3MSPA 3O2DL 4NO3A 4O2CA 2IH3B 2V5RA 4PRHB 4RFNB 5CBAA 3NCCB 5T5FL 1OTTD 3FQXB 4JDTH 4IHOA 2CDFB 1Z5LA 4YO0A 2KPNA 5JW3H 4NO5A 2CDGB 3CXDL 2XWBA 1FYTD 4PJBA 1GAFH 4OFKA 1RY7B 5IROA 2G5RA 1LO3L 3IFLH 4I3GA 3W2DH 4LCUB 1QTYT 5JUEL 4FZEH 4P2QA 4YDVA 1JJUA 3B5HA 1F4HA 4OCXL 4U1LA 5I1IL 5J4MA 4ODXB 4OSUH 3B2VH 2DB8A 4OFYD 4PR5A 3V0WH 2RAMA 1CDBA 5JXAL 2WMPA 3BP5A 3U9PH 2YD3A 3DYMA 1F3DJ 3LSOB 3S96B 1QUNA 3T09A 3CVHL 5CD3A 1HHIA 1NCNA 3L5WA 3CFDB 4WFHE 1KJ2B 1MCRA 2NY4C 4KK5D 4W70A 2BMKB 5E6IA 5C0RH 2DWEA 2OJZH 3LRSA 4Z7NF 5DJ6B 2O93L 1Q9WB 5E95B 4I4WA 3V6OE 2KZWA 3JWNC 4LRNL 1CL7L 4DVBB 4CJ1A 1A6TA 1IGJB 4PD4J 1R3LA 5FYLL 5I6XC 4IDLA 3TIEA 3VFWB 4OLEA 4ZOCA 2FBJL 3BPLC 4Y2DC 3MRBB 1CR9L 3SKJL 1RZJC 4C58B 5MEND 4EOWH 3X3FL 2WLZA 4PTUA 3HMWH 4GBXA 1S7SA 3PP4H 5ICZB 5TE6L 3RI5K 4P5KB 1KPUA 1Q9OA 1SEQH 1TENA 4GOSA 2OTWA 3C87A 3C09C 1YQ2A 3ILQD 4XB7A 5EULV 3C6SA 4XNMB 1PLGH 2ZCLL 1HXMB 3BEVB 5AG9A 2VN7A 1I7ZB 3ARGD 1LDPH 4KJYA 3DUSB 4OF5A 3DI3B 3CXDH 2NY4D 4FTVE 2C3HA 3QXTA 2HLAB 5GGUB 3IDUA 1WT5A 3SHSA 1DLFL 1F4WH 4UOJA 4P0DA 5T5FH 3RTQD 4ISVA 2J5LB 3WUWB 1UQSA 5ANMB 5ILTH 4U1HA 5EUOB 2BK8A 4MWFA 3QDJE 3U36B 2R4SH 4UQ3B 3EJZD 5IVZB 5JOFA 2C3GA 3ARPA 3AXLB 3RHWF 1WK0A 4L4VE 3SDAA 2YS4A 2NCMA 4NSKB 4HG4K 3T0AA 4HUVA 3OKMA 3LKPA 4X98B 4YHLL 3FONA 4NO2A 3RL2B 1WEJH 2QHLA 4QWWD 4DK3A 5CJXA 4YWGH 1T4KA 5HYQB 3WJLC 3GRWH 3AS1A 3KPOA 2DWDB 5DEZA 4GLRH 1U8MB 1MRDL 4R3SB 1SEBA 2AV7A 5CP7A 5CP3A 3BWAB 2ADFH 3VI3E 2QSCL 3ZT7A 5IGXL 4PBVC 5BOZG 3PXJA 3SJVA 4BZ2H 1PG7W 5KVEH 1Z2KA 4KXZI 4P57A 4ERSL 3VXOB 3G5VA 4NQXB 1O7SA 1NCWL 4PJXF 5E6YA 1QSEE 3SKMB 2IANE 5F9WB 3QUXA 4OF6A 3P9MB 1J8HB 3W0WD 4X7TB 5FDYA 4XPGL 2D03L 4FQIL 4MDJB 3KPTA 5ACZB 2DOCA 4DGVH 3PNWB 3ULSB 5DD0L 4KY1H 3FN0L 3RVUD 4MNQD 3VFPB 1I8LA 1W8OA 2NR6D 1ZVHA 4CMHC 2FATL 3EYQD 1HNFA 4MCYA 4OLWH 4M6OL 4U6YA 1I8MA 2HKHH 1NKRA 3A67L 3CVIH 4MJ6B 2XTJE 1U93A 4MQXC 3EYUL 4L3EB 1XZ0B 5DT1L 3RKPA 1YQVH 1RZGB 3HG1E 4WEBH 4FQLH 5JA9A 4JVUA 3MUJA 1AFVL 2P1YA 2JIXD 1AHWC 4XCYA 5IFAH 3BN9C 1FO0L 1WICA 3U7AA 4EI5B 3PE9A 4XCEA 1FGNH 2VE6A 3RTQB 1OHQA 2O5XH 3CFDA 4OD2B 4YBQD 3WSQH 5BRZB 4LLVA 3IVKA 5BQ7A 4PY8J 3SJVE 2FRGP 2IG2L 5CZXC 4FMFA 5DQ9B 2C7UA 3MRRB 4W6WB 3SDDB 5TQ2H 2YUXA 4CU6A 3OG6B 4MB5A 3E8UL 2ZCKH 2HN7A 2NX5A 2Q8AL 3TBVB 1A7PH 1IGJA 2F53E 5E99H 3CFKB 1JIBA 4OM0L 5ANME 4WI4A 1JPFA 3LKOB 4OM1L 4KQ4H 2RIKA 4U6XB 2VXSL 4OF8A 1ETZA 3EYSH 4APQB 1KN2L 4RDQG 5HDQH 4RA0C 2WP3O 4OZHE 4R97C 1U58A 1WIUA 3LS4L 2P7TB 2W65B 4P5KA 1AIFA 4Y1AB 1S3KH 2M8XA 5DRZA 2D2OA 1U41A 1YA5A 4Y89A 5DJXB 4F2MB 3MROB 3V6FA 4DFIA 1MHHA 1AGEB 3MNWB 1G7QA 2VXTH 4GQ9L 1Q1JL 4F7EB 3JTTB 3S4SG 1H0DA 3ARFB 3L1OH 4OGAC 3WLWC 4YIQB 3QEGH 5TJWK 4YZFF 4B41A 5ACLA 4JRXD 4OM1H 3VXMA 1YNTA 5FKPB 5DMJB 1GYAA 3L7EB 4I3RL 1Q9WA 4M7JH 1ES0A 1HH6B 3K74B 3CD4A 2VSCA 3MLXH 5CZXD 1FDLH 4LSDA 3NCFB 5KSBE 4XP4H 4ZO6A 3P0YH 3V6OC 1C08B 2FCBA 5EOTB 4YE4H 5EO9A 5A3IC 1F13A 3PGFH 1MWAH 5T3ZL 3C2AH 4N0UE 3PDGA 4OJFL 2HFFA 4UDUA 3TCLA 3TEUA 2R0WH 4R90L 1T66D 4NO2B 3RL2A 2PYEA 1CGVA 1XF4A 3R8BB 5IFHL 3BH8B 5JO5B 2GITB 5JLZB 3GMPA 1KJ2H 3WNPA 4XNXH 1PKQE 1RUQH 3TO4D 1WSST 5C6PB 4QOKE 2VO5A 3FOLA 3GHEL 3H7BA 4DN4L 1TZGH 4R3SA 2APXA 3RWFA 4XNMA 4J4PC 5DRNB 1FYTB 3TJHC 5DJDB 3T08A 3BKYH 4PJ8B 1T1WA 4LHUB 5F8RC 2I27N 1YEHH 5F7KC 3I75B 5D7LE 3AY4C 1XR9A 1MJJA 4R7DA 4F8TA 4O51A 1MCCA 2VZSA 3MRCA 1WZ1L 1S9KC 4TUOA 2DWEB 3TT1H 5EIIA 1BZ7A 1HZHL 1SMOA 3U2SB 4HWZA 4KH2A 1KCRL 3SBWC 1AO7A 3NH7H 4IDJL 3TIEB 3P4NB 5IIEA 4LCCA 4E42B 5EOCH 3S4SA 4M1DL 1NCWH 1RUAL 1RHHA 5AD0B 5I17A 1AI1L 4F57L 4QOKD 2ADIB 4NQSA 4ZAKA 1WJ3A 1NLDL 1T66C 4DCQA 4KRNA 1DQQA 4GBXB 2DYPD 4FQPA 3C6LD 2K3TA 4B5EA 4PTTA 4ZFGH 1T1ZA 3JVGC 4LLWA 2HLFC 3E6FA 5D1QC 2HFTA 4S11A 3L9RB 4QY8B 2BNQD 3MGOA 1BQHA 2ZUSA 5ALCL 5CFHA 5J89A 4FFVD 4G9FA 3GK8L 3MODH 1H3XA 2DMBA 4R9HA 3DMMA 3QR2A 3ZDZE 3L3KB 3QNZB 4JY4B 2R4RH 1LWRA 3H9SA 1UWGL 2OCFD 3UTTA 1OAQH 5ECJE 1YNLL 1S7VA 4XPFH 3DBXA 3KG5A 4AQOA 3GJEB 1LP9E 4R2GB 4CUCA 3FO1B 4JN2B 3PGDB 2P8MB 1MNUH 2DQUL 3FOMB 4LIQE 4QXGL 4CN1A 5I8OH 3O4LE 2YC1B 2P48B 3GSQB 3RVVC 2CLVA 4ODWA 4PP1C 3GMLB 3V4PH 1E6JL 5J6HB 3TVMA 4K9EH 2G2RB 4QT5B 2DQDL 4WW1B 4JFDA 4DOHE 4TYUA 3MRMB 3S3SA 3L95B 2FIKA 5ADPH 2QJDA 5KVEL 1BFTA 2R23B 3DUUB 2DWDA 4R4FH 5I15L 1HIMH 4DVRH 4YHZL 1JNHA 5LAXA 4FQHB 1MVUB 3L3JB 4C83B 4Q6YA 2HA1A 2GIYA 5I1LB 4XPTL 3TZVB 3LQAL 4CN6A 1AY1L 4WUUA 2VXVH 1BBDH 3FL7A 5KN5A 1AGEA 3NA9H 4OV5A 4M6AA 3WMSA 5JHDE 1H3GA 1EPFA 4EOWL 4H8WL 1H0DB 4PJHF 5D7IA 2E6JA 4P57B 2EDNA 2V9QA 4M3KB 4DQOL 1M7XA 3TNNB 1YNTB 3OX8B 2C7UB 3PABA 4ZXBC 1YEFL 4M61B 1DBAH 4KXZH 5FYLH 1YEIH 4YQXH 2HN7B 2NX5B 3TBVA 4ENED 3MOAH 2CO6B 3P73A 2NNAA 2DBLL 1MJ8H 5GSRA 5GRJL 5ADOH 5IB2A 5EO9B 4HH9A 4R0LB 1IZKA 5C70A 3TT3L 4F9LC 5E9DB 3C5SA 1N59B 2GCYA 2X05A 1IGCL 2BSSB 3D48R 3OHXB 5CCKH 2FJHA 2P43B 3LZFH 5SWSA 4AENB 2ZSWA 3RGVD 4LCYA 4HWBH 5ESVB 4P3CL 4NQVB 2XWTA 2Z31A 1KN4L 1PY4A 2DYPB 3IB4A 2H6PA 1MPAH 4PJEE 4Q9QH 1IAOB 2AXFB 2X1PA 3JTTA 3IT8D 4NWTH 1UENA 1T21B 3V0AC 1WT5C 1J5OH 1ERNA 1XGQB 4WJ5A 4PG2C 1NCCL 5CEXA 3V5DB 1FL6A 4R7DB 1ES0B 1HH6A 4JO3L 2VE6B 2NY1C 5JPNA 5IHLB 5E2UH 1MRCH 5D2NC 5EZJB 4DN4H 1LEGA 4OCYL 1XF2B 4JZOB 5TE7L 3T1FA 4RGNE 1MJ8L 1FO0A 1G7JB 4XNXL 2ED8A 3V5KB 3K2UH 4NHUB 1YC8A 4RMRA 5IBUB 4WTXA 4LEXH 4OCLC 3S4SB 3ARSA 3C2AL 3S6CA 1MWAL 3QIBD 4NO0D 2PYEB 4Z7VA 5GS2H 5DJ0A 1BIHA 4JPIB 3P11L 4Y4FD 1UEMA 3DVNA 3KR3L 4RISL 1NSNL 4NQEA 3BI9X 5EZIL 4O02H 3C9NB 3ZZ1A 3FQRA 3FOLB 2O5YH 4FFWC 5H37H 1LE9A 2NW2A 3S34H 3D9AL 3CK0H 4LIQH 3DV6B 4HMDA 3EYQC 5JOPE 4Y8AA 3BMWA 5F7MC 5EU3A 5DJCB 1JFQL 2OZ4L 4K23L 4JRWA 1U91A 5IP4A 4LDOB 3D2UA 4JPWH 1QEWB 3IFLL 4L1DA 1FVDB 2VERN 2B2XL 4D9QE 5EZIH 1R5VB 4XWGL 5MEPB 3HE7C 3QDJA 3NVQA 1UZ8B 3U0WL 3U9UA 1RZKH 2BSRB 2W0LA 4IOSD 3QYCA 1NGWA 4PGBA 4XTRD 4XC3H 3FN0H 2UZIH 3O6LH 2LTQB 3FB5A 3MOBH 3O3EB 2ZG1A 1F58L 4EUPB 3VH8G 3LEXA 1S5IL 1CD1B 1EGJA 4KQ3L 1NBZA 4JM2D 4J3WA 3WN5A 4NCDA 1ONQA 4Z5RB 2LU7A 2ZOLB 3ZYJA 4JFDB 3DSNA 1U95B 3DVFA 1PBYA 1ZKAA 1MIML 3HRZB 4LVHB 1MCWW 4ELMA 5LKNA 3BISA 3MV8B 2B1HL 4ODHL 2CD0A 2ZCLH 4OIBA 4M4PA 5MERA 4NUJB 1MVUA 4FQHA 4JE4B 5GGVH 1IARB 4BFIB 1KG0A 4BYHA 3TA3C 1V3JA 2LE9A 3VDAA 1KTRL 1ZHKA 2W9EL 1UWEH 1OCWH 4P2QB 4G6KH 1CDUA 5IBLC 3WFBH 3EZ8A 3D87B 1BJ1J 4J6RL 4OT1L 1LDSA 1H3VA 1S5HB 4NQCB 2R69L 5D7IB 4LSUL 2VZTA 4XP6L 3K8LA 3BIKA 1DDHB 1NAKL 2AK1L 2X09A 1RUAH 3EOTH 3HUJA 4N0CC 3SDDD 1RZJH 5BW7A 4RCAA 2CXKA 1W2KT 1TZHB 2YUWA 3UTSB 3QO0A 5FV2A 3FFDA 4Y5YB 5FYKU 4E42A 3G6DH 1KIRB 2ZOKA 3OJDB 1WWBX 2JIXB 4O4YH 4RMQA 3ULVF 1R5WB 2G60H 4L8CB 4QT5A 4YUEH 1D5BA 2C1PA 5DMKB 4WUUE 1A1NB 2C26A 2QSTA 4U1NB 1DQQB 4QWWC 3ZL4H 2W0FA 3W81A 4RA3A 1KCUH 2ESVE 1JZ6A 5B22A 3X14A 1OY3B 4YLQT 3IFNH 5IK3A 3ZE0F 3Q3GB 1C1EH 2VDKH 3BRFA 4XVJL 1C7SA 3QEHB 2GJ6D 1AY1H 4ZUTB 3G5XB 3OAYH 5KW9H 4Y8DC 3ILPA 2AEQL 4W4NA 1AXTL 2CQVA 1R24A 4Z18A 4YHML 4UIMB 4WW2A 5CEXB 3LY6A 2ADFL 3QNZA 3OAZK 3BUYA 3T2PA 2MSPA 3RNKB 2EDHA 1N6QL 1YYLH 3GJFB 1E6JH 3MJ8B 5BZWB 1QG3A 2BC4A 2DLFH 2ADJA 5JZ7C 1TFHA 4Z0BL 3W82A 1OM3H 4M48L 5IESH 2BX5A 3KGRA 4DKAA 4HD9A 3MJGX 4NT6B 1S9WB 3ETBF 3CFBB 3H9ZA 4M7ZC 2YK1L 1A6WL 3TA3D 4UU9A 4RMTA 1NC2B 5LBSH 5I76A 4FTVD 5DTFB 1UVQA 3DVNB 2ZSWB 3MRMA 4NZDA 4XAKE 2VXUL 3RY5A 1CTOA 2HT3D 3UTOA 1GGIL 4ZSOE 2VKWA 3PWUB