1F90L

Fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
b'DVQMTQTPLTLSVTIGQPASISCESSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGVYYCVQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT OF MONOCLONAL ANTIBODY
publication title Crystal structure of an anti-interleukin-2 monoclonal antibody Fab complexed with an antigenic nonapeptide.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f90L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f90L01
2AQ2A 3BKMH 3T2OA 1BD2E 3V5HB 5E2TH 1AFVH 5JPNB 3CLFH 3K2UH 4I77L 1C1EH 5D6DC 5M94B 3H9SA 2ZOLB 2YPLA 2JJTA 5JW4Q 4J3OC 1FNGB 2EDBA 5IQ9B 3ARPA 43C9B 5JW5A 5MEQB 4MJ5B 4FMFA 5FGBA 3O45A 4H5SB 4LVNB 1XCTB 4HULB 1I9RL 3UZVB 5I1HL 1Q9WB 2L0DA 2V9TA 5FM5M 5HYJA 3MJGX 3GSNB 4M1DH 4F7PA 1DUYB 3EYSL 5FYLE 1FC2D 3S37X 3D48R 4UU9B 1RU9H 4KUZH 3MRQB 2Z35A 4D2NA 4Q9RL 4OTXL 4GFTB 4OM0H 1QFWH 4JFEE 4WEBH 4PREA 3UYRL 4ZTOL 2H9GA 1BZ7A 4GAGL 1WBXA 4E41A 1TVBB 4WI8A 4I18A 2MCG1 2A9NL 3MXVH 1LO0L 1YEJH 4RAUA 4OKVB 1I7ZB 4U0QB 5C08E 1GHFL 2OMBA 3Q5YA 4QOKD 4X80H 4XWGH 1MI5D 2FHBA 3CCHB 1AC0A 3FQWA 1UA6L 3UTOA 5F8RC 3MLZL 1CQKA 4L8CA 2O26U 3VMPA 4D9RD 4AYFA 4D9QD 3IJYA 3NABH 4DGVH 7CGTA 4NWTH 2A0LC 3QQNA 3B8YA 3QCTH 5C0AB 4MNHA 4PJAF 1X4XA 3KPLB 1FO0L 5J0BA 2ADGA 2BSSA 1U2HA 3UTSA 4D9LH 1WFUA 3SDCC 1JGEB 3F58H 5IMOA 3W2DL 4UT6H 3MV8D 2NY1D 4L8DA 2AJYL 4Z95L 4WHDA 5FUOL 2ARWA 4PJIF 3T0EA 1QRNA 3HC4H 3O4OC 3QEUB 2HKHL 4JY5H 2DL9A 3WJLC 3GMQB 1IGJA 2EIEA 1B0GA 3BKYH 1U8JB 3DLQR 5C2UB 1IARB 1Y18B 3R06A 3HE6A 1S7WA 4FFYH 5BXFA 4JY4A 1CL7L 4UQ2B 1NGZA 2EC8A 2VAJA 1FRGL 4YUEH 2PW2A 3BOVA 3VFSA 1Q0YL 4ZUWB 1CFVL 1R3KB 2NY7H 3HG1D 4PRDA 5D5MA 1HSBB 1DVFD 5DA4A 2Y9RT 1YECH 4RZCA 5DZOA 2VR5A 3HRPA 3U2SB 2GFBA 3R8QA 4XXCA 2I60H 3H8NA 2KZWA 2OL3B 1UC6A 2QTEA 3MLSH 3QG6B 4HX1B 5HYQB 4R97C 1T2XA 1P4BL 2XPGA 4FZEL 3CVHA 4ZAKA 3ARGC 3G04B 3IF1B 3VXMD 3BQUB 3NFSL 1UWXK 5C6PB 4Y5YC 2YN5A 3WHE1 5ABDE 4C4KO 5J57B 1AO7A 5HVGB 2PW1B 4LSRH 4P2OB 4RGMB 4X6EB 3VD5A 2D7TH 4UT9H 4M8QB 1ZKAA 4Y8AA 2NY0B 1OW0A 3G5XA 4HUVB 1JL8A 1MCLA 3RIAK 2A73A 3OKDA 4BQ8A 3SJVB 2DQDH 5HGBB 1FPTH 1NUGA 5GS1B 3V6OA 5M95B 4M7LT 1MFEL 2DM2A 1IGIL 2VQUA 4M6OH 3C5JB 1RFDH 3I6KA 4LF3A 4X5WA 2O5XH 5EUOE 3IETA 1QP1A 3CFJA 2PUQT 1A7RL 1NFIA 4R0LC 3MV7A 1KCUL 3MO1B 5JORB 2AXFA 2R0LH 3VDAA 3DYPA 4OGZA 3RAJL 1CG9A 2OK0L 5D72L 1KELL 2P8PA 1G9MC 5BJTB 5IVNA 4QXGL 1LWRA 1DBJL 5BQ7B 4RMRA 1ZT7B 4YDVA 3DI2B 1GGCL 1BOGB 4LLMB 5DD5H 4PJ8C 3CMOH 4KQ4L 4OIIH 3U4EB 3V4PH 3ALWA 3J8F7 3QPQD 3GK8H 3MRJB 4OUUA 3GNMH 3FB7B 1CD1A 5DEGA 2ZSWA 4GW5A 3QI9B 4NQUA 4U1HA 4JRYD 3LEXB 3L3GB 3H7BA 3BDYH 2X9XA 4UTBH 4IDLA 2YWZA 5D71L 4ZYKB 5DD6A 3HZKB 1JI2A 4Z7VA 1CXKA 5F6IB 3GGWB 3ZKND 3RWHB 2DMKA 3FTGA 3S36H 2X7LB 3OPZH 4GKOA 1G7IB 5L8KB 3H6JA 1CGSH 4OUOA 3QAZC 5HDLA 1V7ML 5K9OA 3MFFA 3WHE0 4OZFH 2V2TA 5DA0B 3RDTD 1FE8H 1A4KB 4M6NH 1BP3B 1D6VL 4R96A 4JHBA 3CC5A 1VSCA 4PGZA 4PLKD 1B6DA 1YY8A 3AREA 3FFCA 4G9FE 3H2WA 5D1XA 4OZGB 1OLLA 1F2QA 2XN9E 1T5WA 5IROA 2K7PA 1XMWA 3ZHLA 1CICB 4HWBH 3ZLQC 4GBXD 4AL8H 1FQ9C 4OCLC 4K7FB 1F4XH 1LDPL 1YQVH 3CFEA 3O2DL 5CJ5A 1LEIB 1I7TB 3U0WL 2UWEF 3DJ9A 4Q2ZA 1JV5A 5BRZD 5E6ID 1P9MA 1IAKA 5IHUL 1K8IA 3ZO0A 4LKCB 4NM8L 6CGTA 3VFMB 1V8HA 2QQNL 5ENWA 3TGXA 2JIXB 1KFAL 3V7MA 4LSPH 3T0WA 5FUZH 3O2WL 4MAYD 1FL5B 1CI5A 3T4AA 2EC9T 3BGFC 5GGTL 5E00A 2P48B 3KGRA 3QEQE 5F7LB 4JFPB 1NUDA 4LCCB 1IC1A 1FORH 4YFEA 1FH5L 4LLDB 3VRJA 1KJ2L 4XTRC 4LMQI 2DRUA 4FABL 4FQCL 4GRLB 2VL4A 5GSRA 1MJUH 2KL6A 1A8JH 5ITBH 2Z92B 5MHSE 3SE3A 1U3HC 2JCCE 3B2UD 1U3ZA 1OAYL 3RL2A 1OAUL 4K07A 4O2CA 4HUWA 1S9XA 1MPAL 5E94A 4JRXE 3PHOB 4YHYB 4JVWA 1EGJL 1IEBB 3V0AC 4LSTL 1KPVB 1FAIH 3FRPG 5DMIH 4XNMA 3OKOA 4P3CL 3BD4A 4QRSB 1MCWM 3KYMB 1TJIL 4H0HB 3RUGE 1NGQH 1EERB 3UYPA 2APVA 2NW2B 4Y4HD 5IR1B 1W72B 3GMLB 3QXUA 4EXKA 1BAFL 4IS6A 3MRIB 3FRPA 1I1YB 3T1FB 2BC4A 4YDLB 5CAYB 4HUUB 5BMFL 5C0DA 3ILQC 3ARQA 1IGCH 1N26A 1FL6B 2QSCH 5E5UB 5CJQH 5C0BB 5AD0A 3VG0L 4JDZB 3UDWA 4HQQL 5DSCA 3OKLA 3P73A 3QWRD 1UXWB 5K9JL 1OPGL 3DX6A 4PJFF 4I3SL 4JM2D 4G6AC 4P49A 1JNNL 2DQEH 2I9LA 3VMNA 2P5EE 5T1MB 1ZHLB 3QXVA 5DJCA 5HXMA 3BWAA 3DV6B 4S0TD 4P23D 4GQ9L 3P9WB 4LCYB 1A6WL 3QQ3B 3RWCB 4M1CC 4K3HA 1U41A 2BSTB 2E27L 1NH6A 2IJ0C 4RGNC 4NCDA 3G5ZA 1CDJA 2EIZB 3CSPA 3K3QA 5I71C 2EYTA 1P2CA 4IMLA 1EO7A 3DXAA 3L3KA 2CK0H 3MC0A 5GIRA 3V0VA 3MODH 1U91B 5GJSL 1U6AL 2HWZL 4Z7UF 1IQWL 4ZXBC 3U7WL 4CVXA 2DQJL 4OT1H 1NCCL 5HHMD 4DN3H 4ZQKA 5F93C 25C8L 1CBVH 3HCVA 5IB5B 2VN7A 1YN6A 3IFLL 3C8HA 3QDJB 3WSQL 4QRUB 1FP5A 3BPOC 3C87A 2ATKB 4M6ML 4P9HL 2NTFA 3IDMA 3QUKB 5IG7A 1X5IA 2YBRA 2GEEA 5BZWA 4AEHL 2DQUH 1S7XA 1ZT1A 4Y2DD 3SQOH 4LDOB 2EYSB 4APQD 4OLXH 5IT2L 3VXRE 4FNLL 1MFNA 4N0CC 3GUTB 1MAJA 4AH2A 1CGTA 3IFPB 3IXTA 4AM0A 5IFJA 3TO4B 4BKLA 2CLRB 1WFOA 1ZSDA 3IU3A 5DZLA 2QJDA 4QRRE 3QUYB 5LKNA 1LO3L 1NCDH 4RIRA 2BJMH 4DW2H 5IM7A 1WTGT 1EZVX 5D2NE 3ZKSD 3MGOB 2NXZD 4Y2OA 4BK5A 4M7JL 1YC8A 1T03H 1IEHA 3OF6D 1WICA 1MWAA 4U3XA 2MQCA 3X13B 1ITBB 2V6HA 1ZLSL 5T3XL 4JKLA 4MJIB 5GZND 4UTAL 4HH9B 4I77H 1CXIA 3BPCB 4X9IA 1DFBL 3CFBA 1ZHNA 5BS0B 3GHBL 3NCCB 3I02A 1YQ2A 5DHYB 1T0NB 3SDAC 4NC2B 3EYSH 4GAJL 3O8XD 1S9VB 3GZKA 3HR5B 4HK3J 1LK3L 2DYPB 5C0IA 3ZYJA 5I8OL 1F4WL 1C7SA 4Q9RH 1BQHB 4OTXH 4ZTOH 1JNHB 3UYRH 2CH8A 3B3IA 4KKBD 5JOEA 1A7QL 3CXHJ 1YEKH 4HIEB 1F00I 3W9EB 5GS3A 2A9NH 3AU1A 1LO0H 1ITCA 1DEEB 4GAYB 4RGOH 4FQQA 2VMFA 1GHFH 2VLJA 4ORGA 3PL6D 4FTVE 1T0MB 3SKOB 1QSEA 2ZCHH 5FYLL 3R1GH 3PV6B 1ZGLP 3A67L 1UA6H 5FOBB 2N1KA 3MLZH 1U8HA 4OFPA 2XTJD 5I1EL 1K2DA 1ES0A 3BQUC 4HC1A 2AJ3B 2PXYD 4GG6E 1JHTA 1HSAB 4YBQC 2X4OA 4ONHA 5C3LD 1E6OL 4M03A 1I9IL 2XXMB 3W2DH 4ZFOA 1BLNB 2DLHA 4QRQA 4J6RL 1X6NA 1HHKA 2AJYH 4NKDA 4Z95H 5FUOH 2NY0C 1FO0B 1B3JA 5EFIA 2VR4A 2HKHH 4B7LA 3MV9D 2XA3A 1U42A 2HVJA 1UH2A 1KUMA 5F89A 5I1LB 2X89A 3MV8A 1FRGH 5EU6E 5D2LE 2IQ9L 1FYTB 3MREA 4Q6IB 2P8MB 1Q0YH 1CFVH 1LP9E 3KPSD 2I5YL 2Q3AA 1H3TA 2AKRA 3PQYD 4KZDL 3D3VE 1M7DA 5DRNA 5GRVL 3OX8A 3DYOA 4PR5B 3VCLA 4K3DL 1K8DA 3R0MA 4HUNB 4U4BA 3WFBL 1NGPH 4PGDA 1INQA 1LK2B 2ENYA 4KROB 1F4AA 5E2VH 3ZL4L 5CILL 4MJIE 4LCIL 2NQCA 3D18A 4FZEH 4WTWA 5DJ8A 5F6HJ 3IFNL 5HY9B 3HUJF 3BPLB 2F53D 3NFSH 1DJSA 4MJ6A 4PV8B 4HIHB 4U1NA 4OD1L 4XPBL 4JFYB 5HHOB 2WIMA 4OF8A 2QR0A 4PV9A 1K5NA 1ACZA 1UH3A 4M7LL 3QEHB 3IGAB 5C9JA 4HDIA 4PRNB 5IMKA 1AC6A 5FV1L 5EU3B 3MRNB 3VXMA 2FZ3B 2IPTL 3LEVL 5E56A 1M7IA 1MFEH 5JR1L 4J12A 1IGIH 2MKWA 2F19L 3M07A 4OZIB 2VDNL 3UMTA 3JTTB 1IM9A 1A7RH 5TDNB 4KJQD 1KCUH 1ZS8A 1R3LB 4JKWA 1KTDA 1YUHB 3SY0B 4WI7A 5EO9A 1ND0A 3RAJH 4BK4A 1R5VB 1KELH 4NBXB 5EZJA 4QXGH 1W0VB 1DBJH 1FCGA 4Y0GA 4IRJC 3LQZB 1OAXL 1YPZF 4QXTA 3B9KC 4KQ4H 1MCQA 4LFHD 4LKXA 4R2GB 4PJEA 3BO8A 2VIRB 1RJZA 5DJZB 1ZHKA 1NANI 1JF6A 4ZD3L 5DI8A 5F88B 4KGLA 2ED9A 1C5DB 3A0OA 1QSFD 1YEGL 5EZOH 5DVOA 3LQAL 4FQXD 2VLRE 5KSUB 2GCYA 3TNNA 5EN2A 1F02I 4HUXB 1KLGB 2XZAL 2OXHA 3SCMA 1NCUA 5J11B 3AB0C 2E7BA 3VA2C 1U8OB 1VEMA 3L9RA 4X83A 3H3BC 4NKMA 4HEPG 1V7MH 2BY3A 1N8ZB 1VPOL 4MQSB 1KJVA 2A6JB 1QPPA 5DQ9B 2VJXA 4M62H 4YZFE 3BZFA 4N0UA 1I1FA 2BHUA 2HN7B 4MQXC 3LAFA 5I1JL 3GRWA 3EO9L 1T4KA 2OBGA 3DV4A 5T5NG 4N8PA 5LBSL 4NKIL 1KIPA 4QGYA 1ONQA 3EGSA 4QYOB 2AJVL 4L3EB 3EJZD 5CIPB 5ITFB 4GKSB 3B9EA 1LDPH 4H25B 4UNTA 3O2DH 3KPMB 4WFGD 3U0WH 2F54A 3K4DA 2YD5A 5JOFB 4X4ZA 4NM8H 4XB8A 4GRWE 3E6HA 1UT9A 3WMSA 4DKFL 4F7CA 4HF5L 2A6IB 1KFAH 1U8LA 5IKCA 1YC7A 5GS0D 5DHVB 3O2WH 4OGXL 5TGBA 4BH7A 2FHFA 2Q87A 4RWYL 2ICEB 1X5XA 5E6IA 1ZWIA 2DQFB 3ARFA 2I9TA 1FH5H 1KJMB 3DYMA 2YD7A 4FABH 4FQCH 4L8SA 4UDUA 1Q9LB 3IKCA 4NO0D 4XNQA 1KJ2B 4MAYA 4MD5B 2R0ZL 4KWUA 2D4DA 1OAYH 5I66B 4HJGA 3X11B 2FEDC 3BZEB 3OKEB 4FP8L 4WVRA 1A2YA 1S7RB 1MPAH 4KZEH 1ADQA 1NJ9A 1EGJH 1R3HA 4LSTH 1GJIA 3QFJE 5KTEH 3FN9A 1ZLWH 2XKSA 3FHAA 1BIIA 4PJ9C 1ZA3B 4YDKL 1TJIH 1F2XK 2Y6SD 5B4MD 1LNUA 3VRLF 5ACLA 3WL9B 2P7TB 1PQZA 3ETBF 4TTDC 1HKFA 4ZS6C 5CD5C 3I50H 1L0XA 2AV1A 1BAFH 2Q76A 4HV8A 3Q3GB 1HOCA 2D31B 4NP4L 1I3RA 2YUXA 3N1QC 3MBEA 2ADIA 4JANB 5BMFH 4LL9A 5L2JA 1BM3L 2OI9C 1JYWA 3VG0H 4CUCA 3LY6A 3U4BL 2ZKHL 4HQQH 4ZO9A 2CKBA 3VW3L 5K9JH 3K74B 1OPGH 3O6FB 5B3JF 2GT9A 1E4XI 3FO9A 4I3SH 5HYSB 3NCFB 4OIBA 4G8FB 4JM2F 1JNNH 1DE4A 1FJ1A 1M4KA 2R2EB 4LHJB 1I3VA 2JK5A 3UAJC 3IXAA 5I30H 3CVIH 2NNAA 4RAVA 5GHWL 4C55A 3LN5A 5KVFL 1OWRM 3GSOA 4GQ9H 3O6ML 3DMMA 1A6WH 1FZKB 5T3ZD 1R5IB 1YA5A 3MYZA 4AENB 4BFEA 3QULA 2E27H 2B5IB 2LAAA 3DX7B 4XCFL 1RD6A 4G43B 2H2PD 4P2QD 2EDQA 5GJSH 1BFOA 2HWZH 3ZE0E 1IQWH 3HAEB 5LXGL 2OP4H 3RNKA 2DQJH 3FQXB 3BFOA 1NCCH 3IAQA 1VACA 3Q1SL 4TUOA 25C8H 1XGPB 2V17L 1UB6A 3SOBL 2X1WL 3F7YB 3IFLH 3WSQH 3GJEB 2FECL 3X14B 4OV5A 4RCAA 2EDKA 5EOCL 4M6MH 5FO7A 4P9HH 3GSQA 1KN4L 3DUSA 1BD2D 3KDMB 4PJ5D 4AEHH 1TXKA 1QBBA 4KDVA 2HFTA 4XC1H 4UILL 4M5ZL 4LPYA 3VJ6A 5TPWL 2DIJA 1OGTB 3MR9A 5IT2H 3QIBD 3DO3A 4PJ7E 3X12A 5I19L 1JGUL 5I74B 3SDXE 2XKUA 4XVSH 5M7QA 2GKIA 5SX5K 1NDMA 1N0XL 1W0WA 5FYLD 4ALAH 1WFNA 4PGBA 4Y2DA 3C5SA 4LEXL 3D39A 1B0WA 5FEBA 3QXAB 1GOHA 4Q74A 1LO3H 1T5XA 4APQC 3O3DA 3QDGB 2HLFC 4JFED 2EE9A 3VFRA 4M7JH 2DQGL 1J8HE 3Q6GL 4ZO6A 2FR4A 1AD0B 2HTLC 1VEOA 1NGWA 1KJ3L 1U8MB 4TTGA 1DP0A 5T3XH 2Q86B 4NRXB 3BYYA 4UTAH 5KS9A 2DI9A 1A3QA 1H0DA 5IGXL 3WNLA 4LCWB 5CJBA 1AGFB 1DFBH 2X70B 4HKBA 1FVDA 3GHBH 5DS8B 4HWEL 2LTQB 3E6FB 4GUPB 4KMQA 3T3MF 4OV6F 4XCNB 2ZUTA 5CBEB 1A9BB 1KGCE 4LNRB 3O3EA 1H8NA 4CBPA 3ORJA 4LCUB 4AG4L 4U1GC 5L0QB 4NNYB 3BPNB 1LK3H 2WIIA 3THML 3P0YL 4ZUTB 4NYLB 3JTSB 1KTLA 1H15A 2E8YA 4FXGA 2E7MA 2LU7A 1A7QH 2CDFA 2HT2C 3PWVA 5K9KB 3CK0H 1IAII 4P46C 4YX2L 5EBWA 3O8XA 1XGYL 4Z5RB 1XEDA 4QRTB 1M71A 2VLLA 1J86A 4JGMA 3WLBA 5FYLH 1QBML 3RVWD 4JZOA 3C6LD 2NZ9D 3A67H 4PJCF 4O51A 3HMXH 1E28A 5E2UL 3L7EB 1NL0L 2EDTA 3ARBD 1NC2B 4V1DE 1Q9OA 5KAQG 5I1EH 1E4KC 4Z7WB 1BZ9A 3ARWA 5ERWB 3UTTB 5KSVB 4YDJB 3HE7B 2DAVA 4B0MM 1NQBA 1E6OH 1S7UB 5C0RL 3PL6A 1I9IH 3OJDB 5C07B 4J6RH 5MENA 3GSUB 1FG9C 1IFHL 4OZHF 1C16B 1CFTA 1D5XA 3LZFH 3S5LG 2ZUQB 2PXYA 5SWZA 1JP5A 4W70A 4OF3A 4PJBA 5D7LE 5B21A 1MREL 1HI6A 1VEPA 3LKQA 4ZNCD 2IQ9H 2GAZB 3C60B 1ZLVK 3DETD 3OG4B 4WO4B 3S5LA 5KSBE 2CXKA 1GAFL 1LEKB 3MV9A 1NSNL 3ZE2F 4C59B 4KZDH 4HK0B 1G7LA 4W68A 1G0XA 3DOSA 2DLEA 4ZFZA 3RGVA 1CDGA 3GIVA 2DDQL 5D7JA 3EHBC 4LEOA 3WFBH 5EZLA 3FRUB 3ZL4H 3NAAL 4LCIH 1SMAA 3F12A 3TA3D 4NUJA 1WZLA 1M05B 1MCWW 3KPSA 2DWEA 4C56A 5A2KH 3OMZA 1WITA 4JPWH 3IFNH 3PQYA 5SWQA 1I7UA 3CFCL 4WUUA 3KNBB 2WUCL 3QUMB 2FL5B 2AQ1A 5I18L 5C0AD 4OD1H 4XPBH 2CDEA 3C8KB 2BNRA 2VZ3A 4GT7A 4X4XA 4M7LH 4DGIL 5DJ6B 1F5WA 2G2RB 2BOBB 3MPCA 4NO3A 4XVTL 4HXBL 3L5JA 2W9DL 1FIGL 4ZSOA 5HDQL 3LEVH 4ZPVB 2C3VA 2F53A 1OD7A 2YA1A 3VWKB 1YEDA 4LPCA 2F19H 1OSZA 1KLFA 4UIMB 1A7PL 5J6HA 1W8OA 3MRKA 5HHXL 3CFIC 3VXUB 3P9MA 5EWIL 3V8OA 1EA9C 3SO3C 2LFGA 2EDOA 2X4NB 4LK4A 4B41A 4NO5B 5TDOA 2AXHA 3I2CL 4IOFD 1CS6A 1QR4A 1DZBA 4P59L 4YR6A 4XPHL 4L4VB 3Q0HA 3FZUD 3VFVB 3GSVB 2MKLC 4NPYA 2F5AL 4O2FB 2M8XA 4OF6A 3GJFA 5B38G 1JWSB 4Z77B 1OAXH 4G9FD 1D5ZA 3RWIB 3A6CL 5GGVL 5I17A 3X3GL 5DT1L 4LFHG 3G9AB 3VH8B 3NVQA 1K3IA 4ZD3H 4WI5A 4JVUA 1S78D 1DTUA 2BNUB 5CWSA 5HHNB 1N6VA 2OJEA 1JHKL 3MUHL 4LSDA 4P2OD 1YEFL 3LQAH 3TYGL 1ZHBA 5B38A 1HHGB 1T3FA 3BIKA 3MJ8B 3LKRA 2LVCA 5SWSE 3ULSB 2WP3O 1GL4B 3FONA 4KI5F 1I8KA 1OB1A 4MQTB 1CDHA 4WI9A 2XZAH 3NGBB 1K9TA 3CFDB 2G9HA 2AJXL 3QT2A 1NCAL 4ZNEE 2HT4C 4C57C 4HLZG 2VABB 4FQHB 1VPOH 2JJWA 4MQ7A 5ID1B 1QSFA 1BVLB 3QH3A 3TIDB 4U1JA 1NCNA 3EOYG 4JAMB 4FQXA 4RBPK 3DGCR 1T1XA 4KI5C 4OCSL 3GJFK 5EC1A 2V5YA 4WI6A 3EO9H 3WJLA 2OXGA 3L3JA 3QIWC 4CRPA 3BGMB 5DEFB 5LBSH 1RZIB 2OR9L 2AJVH 3WUWB 1JMZA 2IQAA 4YK4C 1DBBL 3B6SA 2YC1A 3TZVC 1B0RB 4U6VL 4KQ3H 3DRTA 1DUZA 2OL3H 2WV3A 4HF5H 4LSQL 3HC0B 2FJFA 4ETQA 3QI9D 5FO9B 3QNXA 2BVEA 5FF6A 3DTXB 3VD7A 4LBEA 3QNYA 3BH9A 3RTQD 4RWYH 2RR3A 3UPRA 2VDQL 2QSTA 4Y5YA 5KOMC 4QO1A 1MCBA 1BVZA 3LKSB 3ULVD 3UTZA 4YFDB 5E8EA 4CU6A 2IH3A 1TITA 3FAWA 4RFNC 2ADJA 3OXSA 1E6JH 4XRCA 3QJFA 2EXYD 3TM6A 3VWJB 5DMGD 4HK3N 5DD0L 3ZKMD 3CSYB 4JG0L 5D7IA 4MNGA 5DJDA 1MY5A 4JZJB 4PJXB 2GSIB 4GKZA 4K7PX 43CAA 4WHTB 1CICD 3W11C 4MA7L 5C3TA 4YDKH 4NO0A 1XF5B 1GSMA 4OF0A 1L7IL 2W9EL 2AK4A 4HBCL 3KXFB 2Z91B 1AE6L 1ZVSB 1PZUB 3V6FB 4KV5E 4U1KA 4I9WE 3I6GB 1EBPA 1IKFL 2GSGB 35C8L 4NP4H 5L6YL 1VGKA 4P3DB 4WU7B 3TJEL 2JIXD 1X3DA 2IH1A 1JZ2A 3HA0A 4YNYA 4PY7A 1OAZL 1SY6L 4WFFD 3U4BH 2QL1A 4HCRA 3G08A 2ZKHH 4UBDD 4FFWC 4P9HC 5IJKC 1O0VA 3QDMA 3VW3H 4L3AA 3P4NA 4WUKL 3H9SB 4KK5D 4YO0B 5K59E 2YPLB 5E8DL 1LE9B 1WAAA 5I74C 4KDWA 1WC7A 3O45B 4GRLD 3NTCL 4Y89A 2EH8L 3PG2A 4TOYL 3T8XA 3MCG1 5GHWH 5HYJB 2UYLA 2IPKB 4LHUG 1PX4A 4F7PB 2H45A 4JQXA 1MJ8L 4EUPB 1TCMA 3DI3B 2H2SC 4ZPTA 1KB5A 5IW6A 4X4YB 2EDFA 2F74A 5DJXA 2L7JA 4J1UA 4XCFH 2FJGB 2JB6A 4NT6B 4ZOEA 1NFDF 1TVHA 5C0NC 4BM7A 5HGDA 4P2RE 3CUPB 4LHUA 3G6JF 3M17B 4I18B 5AYQA 1U0QA 2GYSA 3IRPX 5LXGH 1J0ZA 1NMCB 4LVHB 4RAUB 4R8WH 2P42B 3D9AH 3Q1SH 2FSEB 2EDRA 3S37H 3SOBH 2J4WH 4R4FL 3FQWB 5FHAL 5EOCH 5GGSB 5HHVH 3VDBA 4W4OC 2VAAB 4LPTA 5HI5D 1KN4H 5DUPH 4BQCA 1RK0A 2P47B 3IJYB 4P2QA 4U6YA 4O58L 5FKPB 4O9HL 2H2PC 3TVMA 3BZ4A 4UILH 4GG8B 2DD8L 2E8ZA 1UZ6E 3IU4H 1A02N 5TPWH 3MRHB 2BSSB 3UTSB 2XWBB 2CMRL 3F5WA 5IMOB 2ICES 5I19H 1SVCP 5IEKA 3CDGB 3T0EB 2G75B 1QRNB 4D3CL 4C83A 1CFSB 3MJ9L 2R23A 4QCIA 1N0XH 4PJ5A 1G7PB 4WW2F 3O2VH 1KYOJ 3V5KB 4LEXH 3R06B 3W9DA 1UM4L 3HE6B 5D6CB 1HH9A 4WTZG 5BXFB 4JY4B 4KJWD 2Z9TA 1U3JA 2UV3A 1S7TB 3NBNA 1J1OL 4JFFE 4Z9KB 4HLJA 4PRDB 3Q6GH 1ETZB 1DDHA 4HS3B 3STZA 4WW2C 1KJ3H 4NQEA 1U3HA 5C0CE 3U30C 4LAJH 1U2CA 2GFBB 4G9DA 4QT5A 4WTZA 1CFBA 4F15C 2EDLA 3HE7C 3C2AH 2ZUVA 3JXAA 2J6EL 2B0SL 5ETUA 4O02L 5TH2A 1T1YB 4Y19B 4DAGL 2QQLL 4M02A 1CXFA 2VZOA 1JE6A 4R4NC 4HWEH 3DWTA 3CVHB 2YPLE 3MRCA 4G42B 2ZUQC 2X5PA 3NA4A 1W72H 3JV4A 1A9EB 1IMHC 1T1ZB 3TH4T 4AG4H 5DEZA 2B20A 1KIQA 1RHHA 3FFDA 3I84A 4OQTL 5JQ6H 2R8SH 1NEZA 3BD5A 2J2ZA 3THMH 3P0YH 4CDHA 5FYKD 3NZ8A 1N0LA 5J12B 2A73B 3OKDB 5J3HC 1YMMA 1JF5A 4XI5C 3TO4D 4OGAD 2IADA 5ICYA 1N7ML 3P2TA 4YX2H 3RVXC 4MJ2A 1XGYH 3NFPA 4X5WB 5EU6D 3I6KB 4LF3B 2X09A 3QUYD 4E41E 3WO3B 3KPOA 4OFKA 3IETB 1QBMH 3NH7L 1T2QL 1I9JH 1NFIB 5EO1B 2E7CA 3D3VD 1YEEH 1NL0H 1UWGH 3SBWC 2FLRT 3DGGA 3STLA 2AXFB 4HMEA 3RWFA 4JCLA 5ECJE 4NOBA 4X6CA 1TZGL 5CLWA 1CG9B 2E9IA 3Q5OA 4MJID 4CVWA 2OLDA 3M8OL 2D7PA 2BVPA 2ZG3A 4W6XB 4X6DA 5C0RH 1WTLA 4WI4A 3C6LA 1CCZA 4MDIA 3N50A 4ORZC 3SGJC 1IFHH 4JFHE 5BS0D 2VC2L 1A6AB 4WWKC 2IALA 4NKOB 3FB5B 3T0EE 2CIIA 3VWKC 4LARL 4OUUB 2K1MA 4QRPE 3S35L 1CD1B 5DEGB 2ZSWB 1MREH 3H3KA 3WLWD 4EI5C 2ICCA 2VLKA 3H7BB 3LKPA 4J2XA 3QIUB 4V2CB 1CIDA 2ZOLA 4EN3C 5IFAL 1F58L 5DD6B 1CXLA 4Z7VB 5IQ7H 3VXNA 5IQ9A 2A6KB 43C9A 5MEQA 4PS4L 1DQJB 1XCTA 1Z0NA 1YDPA 5D5ME 1JK8B 4LQ1A 2ESVA 4WTXA 4KK9D 1DUYA 3ZDYE 5I6XB 5EUOF 1PKQB 5INDA 3MFFB 2PYEA 2V2TB 1FDLL 2FD6L 3NAAH 2HJFB 2Q1EA 2EDJA 1QSVA 1G1YA 3KYOB 1RIHL 5C0FA 4CU7A 3L3HA 4KTDL 3H0TA 1R3IH 3AREB 1YY8B 4G7VL 3FFCB 5D1XB 4EJ1C 2MMXA 5I18H 1DLFL 4JKKA 5C09B 2W38A 5IHBA 3RKDC 5F9AC 4DGIH 1SVZA 1AO7E 4JO1L 3CCHA 5DFVC 5ESQB 1VERA 4HXBH 4Q2ZB 1FIGH 1JV5B 5HDQH 1S5IL 1A21A 1IAKB 1UACL 2DJUA 3LQAC 4PJHE 1X5HA 5ENWB 5C0AA 5JO5A 1A7PH 3V6OE 3KPLA 4J4PD 2WSKA 1DQLL 1VDGA 5HYFA 2H8PB 2BERA 5HHXH 1JGEA 3P30L 4Q9BA 4XPFH 5EWIH 1FYTD 1UM5H 3CH1B 3VFOB 4MXVE 2EZ0C 5LAXA 3I2CH 1KOAA 2QQQA 3QEUA 3VFNA 3ELAT 4P59H 3GMQA 3MV7E 1U8JA 3SDAA 3VRJB 5F3BA 3TPUA 4LSUL 1Y18A 1S8DB 5JNYB 5GSRB 4X9FA 4KROD 4UQ2A 4TVPE 1VGEL 4S1DC 3C08L 4ZUWA 3A6CH 4O2CB 5GGVH 3X3GH 1S9XB 3RI5F 1KCVL 4HZLA 2P5WB 1L7TL 5IIEA 3EAKA 4XNMB 5AAWA 1QFUL 1QBLH 3U2SA 1JHKH 3BP6B 5HHOD 1DANT 1WIPA 1YEFH 3TYGH 2KPNA 3DVFA 1MFDL 1G9NL 3WNKA 4HX1A 3VGHA 4GKNB 4I2XB 1CZ8L 2EE3A 5HYQA 2FBJL 2RCSL 1QSZA 5BVPL 3G04A 2FIRT 1NGXB 4IS6B 4Y4KC 1IQDB 2AJXH 3BQUA 3DECA 2BC4B 4NQXB 5KZCB 5DVMA 3QB7C 1X6LA 3OTTA 3B4NA 5C0DB 1P53A 2PW1A 1ED3B 2WINA 5KVEL 4KJPD 4LHQB 4X6EA 3U1SH 5AD0B 3UTPD 3VWJC 4M8QA 5FOJA 4OCSH 5DSCB 3OKLB 2WQRA 5I9QC 3SJVA 5HGBA 3DX6B 1YY9D 2Z93A 5GS1A 1Z9LA 3BMVA 4HJJL 2OR9H 5FDWB 1ORSA 4EVNA 2JCCF 3FQUB 1DBBH 2WBJC 1A6TA 1IM3A 3L1OH 2EDWA 4DUWA 3MCLL 3NACH 3TBSB 4U1SB 4PJDB 3QFJD 3IDNA 3MO1A 3QCUL 4U6VH 1XZ0B 4R2GD 3DUHA 2B1AL 4JO4L 3RWJB 2BVUA 2M2DA 4LSQH 5HPMA 3L3OA 3RUGF 2EYTB 2WANA 4IMLB 3DXAB 4PRBB 3L3KB 1B4RA 1M6OA 1ZT7A 3O3BA 4XAKD 1BF8A 12E8L 3WKML 2IMMA 1BOGA 3NFNA 4LLMA 2IMNA 2AABL 4GXUM 1MAML 3BX7C 4ODHL 4GSDL 3U4EA 2VDQH 2D7OA 3LN9A 3BIAX 3MRJA 3PXHA 1Y6NR 3FB7A 1DL7L 4H0GA 2NTFB 1E4JA 1J5OL 3QWOA 1UYWH 5IG7B 4GRWH 2G5BA 3LEXA 4NC1E 1J0KA 1S7XB 2ZG1A 4UV4L 3SDDC 3RTQC 4XMPL 5DD0H 2VWEE 2W0LA 3GGWA 4J3XA 4JG0H 3RWHA 2PTTB 4HS8L 3QP3A 4AH2B 5FYJE 1GZQB 4IMKC 4NZTL 3ZSTA 1OTTC 4POYA 3MV01 3IXTB 1A4JB 1NFKA 5IFJB 2VXVL 4MA7H 1PW3A 2H6PB 1JPFB 3MRBA 3QSKB 1L7IH 2W9EH 1A4KA 4PJGB 1KPUA 4HBCH 4XP5L 5I0ZA 2XWJB 1NLDL 1AE6H 3B5HA 4LVHC 4OLUL 2Y07L 4RIRB 5ELIA 3LN4B 35C8H 5L6YH 2DTSA 1Q9KA 1JZ8A 1DN2A 4KVCL 4DVBA 4HXAL 3TJEH 1XF3B 1H3PL 1MWAB 4E0RA 1OAZH 4K7FA 1BQSA 3QXDB 1LEIA 3B9KA 1Z3GL 1KIRA 5FA3A 4G80B 1GOFA 4WUKH 4N8VA 1KYOK 2CLVB 4LIQE 3PIQB 3ZZ1A 1B4JH 3VFMA 5E8DH 5EORL 1ZHNB 1RZFL 3F65A 4YHOL 3NTCH 2EH8H 4YHLL 4BJLA 4TOYH 2NMSA 3O4LE 3NPSC 4OAWB 5GISL 1OLZA 1MJ8H 3U82B 4OCNC 2B39A 5EOTB 4PRPE 1P5UA 5BO1L 2NY2B 3C2SA 4JFPA 2UZYB 3LS5L 1O7VA 1BJ1J 4Y4FC 1NAMB 2IAMC 3JV0A 4CJ0A 4JCMA 3AU1B 3IRZA 3MUZ1 3BMWA 5IBLD 1DBKL 3GDBA 4FQQB 5A2IH 2VLJB 3TBTA 5CEZE 3KLHD 4UDTB 3QUZB 1BEYL 1QSEB 3PHOA 1IEBA 3VFPB 1KPVA 5FHAH 3ZDXE 1U8HB 2BRRH 4QRSA 1INDH 3FT4B 3KYMA 5GGQL 2PO6C 3N0PB 4O58H 4O9HH 1S7QB 1DQDL 2QHRL 2DD8H 3TH2T 4ONHB 2NW2A 5D2NC 3GMLA 3QRGL 3GIZH 4ZFOB 3O6FD 3MRIA 3T1FA 1HHKB 3OWEA 3JV5A 4WNQA 3QUXC 5EFIB 3MJ9H 4XP6H 1KGCD 4D3CH 3QPXL 1DBAL 2VB5A 5FHBL 5ISZB 2VDKL 5I73B 2ZOKA 4MGXA 1AGBB 5C0BA 3TLRA 3LPWA 1UM4H 3VGAB 1MEXH 1UXWA 3C5ZC 4PY8J 1L9NA 2YKLL 1J1OH 3MREB 3T04D 5GZOC 1CGXA 1QPXA 4N8CL 4U1LA 3U7AA 1YNTA 4QXWA 5T1MA 4ZFFA 1UCBH 1M7DB 3DV6A 2YRLA 4X7TA 3VCLB 3WO4B 4AEIL 5BV7B 3LB6D 4NQDE 3KJ4B 4BQBA 4LLYB 3RWCA 5KSAC 1INQB 1FL3B 3WUZA 2J6EH 2B0SH 1UB5B 4HPOL 3HB3C 4DAGH 2ZUSA 2QQLH 3D18B 2EIZA 1AXTL 5H37H 1L6ZA 1PYWB 3BXNB 4PJ9A 4GG6F 4MJ6B 1U91A 4U1NB 1KB9K 3TN0C 4Y7MA 4OQTH 2HT3D 1OT2A 4PV9B 2UY6A 5B8CC 3QDJA 4XNZC 4JJHA 1BX2B 5IMKB 5DD1L 3FB6A 2ZUWA 3N85H 3QUKA 5DJAA 5CP3A 4GJTB 3MNVB 1N7MH 3ULUD 3O3AB 4LU5H 2A9ML 1A6VL 3KPQB 1WIOA 1ZT4B 4G8IA 5IWLA 1CL7I 1J12A 2CO7B 2VRAA 3PWUB 5I6XC 3ESVF 5D2LF 3BKCH 3HR6A 4R9HA 1LP9F 1VB9A 3NH7H 3QDGD 4AIOA 1T2QH 4WEMB 4I5BA 2EEBA 5DD3H 5GSVA 4F7TB 3D0VB 1KTDB 2V5MA 1TZGH 5EZJB 3IDGB 3M8OH 2R56L 4TYUA 2X42A 4DN4H 1AY1H 4LCWD 5GRYA 3MGOA 4QXTB 3VFTB 3RIFF 1JRHL 3HAEH 2VC2H 2Z8SA 2WBWB 4MNQA 4PLJD 3VGBA 1G9EA 1RJZB 4FRWA 3X13A 4LARH 3RZCC 1IKNC 4FQ1H 4MA3B 1MHPL 1NBQA 2F8OA 1QRKA 1TQCB 1IC5L 4D9RE 4TNWF 1F6LL 1T83A 1MCNA 3JWDH 4HH9A 3BPCA 3TNNB 5IFAH 4MDJA 1F58H 4ONFL 2APBA 3MRGA 3WS6C 1BQHG 4U3HA 2HA1A 3MV8E 1MVFA 4PS4H 4PRAB 3SCMB 4MCYA 2Z31C 2EH7L 5DHYA 4L4TB 5J13B 1T0NA 3L9RB 1MCKA 2NYYC 1S9VA 2IG2L 3CMGA 3WLWC 4CGTA 2DYPA 1FDLH 4LOUC 2FD6H 3BZFB 1Z2KA 1F42A 4N0UB 1I1FB 1BBJA 1BQHA 4NN5B 2EIDA 1SJHB 1OP3H 4AMKL 1QHPA 1JNHA 4KTDH 3W39A 1NC2D 4HIEA 2F5BL 4NN7B 1FN4B 2MHAA 5JLZB 3GFUA 3HG1E 2YRPA 4AEEA 1KIPB 4WU5A 1DLFH 5D93C 1ONQB 3EGSB 4XXDA 1DEEA 2VLME 4GAYA 5T1KB 1EAPB 1EJOL 2YOCA 5HGAA 1E27A 1JF1B 1T0MA 4HH8A 1JN6B 4P9ML 3SKOA 4JO1H 1CQYA 5C07D 3PV6A 3QZWB 1MNUL 2F54B 4TVSa 4PB0L 1AQDA 4NRYB 3E6HB 2NX5A 4F7CB 2AJ3A 4G8EB 1HSAA 5LCVL 3VXME 2R1WA 2OTWB 3KPTA 5I8EB 1DQLH 2HKFH 3NIGE 3P30H 4UIKL 4R7DA 3C60D 3U6RA 3MUJA 2NW3A 1FO0A 1UJTA 1P84J 2VISB 4QEGA 3LSOA 4NZJA 3ARFB 2I9TB 1NMBL 1WZ1L 3LRGA 3M1BA 4LSUH 4YHKL 1I8LC 4W6WB 4YZFF 4L8SB 3PUCA 2ORBL 1DLHB 5I1LA 4XNQB 5IV2B 1P6AB 2OS7A 4I48B 3C08H 3IDXL 5F7WC 3WV0A 4H20L 1A2YB 4HIJB 1FLRH 1T66D 2BNQA 1KCVH 4KAQL 1L7TH 1QFUH 2WWKT 2UUDH 4PJEE 2JB5L 4R26L 4F33A 4JREB 4X7DC 2CSPA 5EULV 1LNUB 1LK2A 1MHHB 1MFDH 1PQZB 2Y23A 3K4AA 1G9NH 4P48A 1XIWC 1CZ8H 1I4FA 3GI9L 4JZNB 4U6HA 2FBJH 2RCSH 1AR1D 4GRWF 5BVPH 2RIKA 1FNSL 3NCJL 2AV1B 5HY9A 4HV8B 1I3RB 4MD0A 3IFOB 4J3VA 3MBEB 4HIHA 2ADIB 3RVUC 5HHOA 5L2JB 3UPCA 4K55A 5KVEH 1OAKL 5JHLL 3VXUD 3QEHA 4JRYE 4PJCA 4NUGH 2CKBB 1HWGB 3MRLB 1LVEA 1UZ8B 3PABB 4MS8D 5I15L 1CN4A 5EU3A 3MRNA 2GT9B 3FO9B 4NNPL 1IJ9A 4L4VD 5HJ3A 5IBTH 1U8QB 2J5LB 1B9ZA 4OZIA 5D96C 2FH6A 3IXAB 5CGMA 2NNAB 3JTTA 4XMKL 5FA4B 3E2HC 2GI7A 3LN5B 5TDNA 3DMMB 3MCLH 3T2PA 3QCUH 3V7AG 1R3LA 3K2MC 1RJYA 1YUHA 3SY0A 4ODWB 2B1AH 4JO4H 1KPRB 3MTRA 1R5VA 4U33A 5AZEL 1OOAA 3KPRA 1T6VN 1W0VA 1VFOA 2NXYC 4YFLF 4XNUL 5LGJA 1OTSC 1AKJA 4EDXB 12E8H 1AHWC 1A6ZA 4RRPG 1XR9A 2AGJL 2AABH 3RNKB 1MAMH 4MVBD 4NQCA 4ODHH 4GSDH 1NKOA 2ZCLL 1VACB 4TUOB 3TCLB 2VKXA 2MPAH 2DTML 5F71A 1WV7T 5BRZE 1T89C 1VESA 2GUOA 3OZ9L 1SBBA 5F88A 1CIUA 1J5OH 1C5DA 3EJYD 3DUSB 3ZKXB 5AUMA 4UV4H 1NC4B 2EDHA 5KSUA 4Y16C 3MRDB 3SGKC 4UT7L 4S1SL 4XMPH 1MCOL 1KLGA 3MR9B 3MV11 4C58B 3CDFA 2BSED 4HS8H 3MA7B 1HKLL 3VFGL 1U8OA 4NZTH 2O5ZL 2J7LA 4PGCA 2VXVH 1N8ZA 3LEYL 2A6JA 2C7UB 1W0WB 5DQ9A 4KJYA 2FX8L 1CR9H 3QG7L 4XAWH 2HN7A 2A2QT 1NLDH 3RVTD 4GAFB 2E6JA 4OLUH 1FGVL 3O3DB 4YBHA 4OI9A 1BOYA 2YUZA 4KVCH 4HXAH 1N3NA 2A74B 4Y5VB 1KEGL 2CUIA 4QYOA 5ESVB 2FR4B 4L3EA 3WIHA 1H3PH 3ZE0F 5FYJL 3INUL 5ITFA 5AYUL 1OQXA 4XCEB 1N64L 4H25A 4WJ5A 3KPMA 4ZUVA 5KS9B 3B9VA 4OD3L 5JW4N 4OM1L 5JOFA 2RHEA 1UVQA 5GRUH 3O2DA 5EORH 4PP2B 4HWZB 4RA0C 1RZFH 4KMTL 4PRIB 4YHOH 4YHLH 5DHVA 5DO2D 4QF1B 2NY4B 2O5YL 3O3EB 5GISH 3WXWL 4BELD 4PJ7F 4TQEL 2VH5L 2ICEA 3GMRA 2DQFA 1DQML 3SDXF 3IB4A 3LS5H 4IOIA 3VGEA 1KJMA 1YN7B 4RMWA 1KTLB 4P57B 4XHJC 5GGTA 4E5XA 2ZSVB 4FXGB 4ENEC 1YNKH 3LQMA 3BN3B 4E42B 4LIQL 2C9AA 1IC7L 1Q9LA 2CDFB 3G5YB 1B88A 1KJ2A 2EC9U 3OSKA 4XVUC 3LDBC 5DRXA 1EHNA 1EPFA 3HNSH 1DBKH 3KXFD 3BZEA 1QOKA 3K1KC 1S7RA 4FQ2L 3P4OB 3QCVL 1BEYH 1FG2B 4JZOB 4N0RA 5F9WB 2CR6A 5ACZB 4O51B 4P5MA 1E28B 4ZOBA 3P11L 1Q9OB 5GGQH 5GGSY 5FGCB 1BZ9B 5E7FA 1MRFL 1AGDA 3JV6A 1D3CA 4LDLB 4AIZB 2QHRH 2DQTL 4IOSD 2OR8A 3X17A 3QRGH 5DRWB 1VFMA 3TIEB 3Q3GA 3H9SD 5MENB 2YPLD 1WT5C 5HYSG 4QHMB 5CEZL 5F70A 1CXEA 1CGVA 1JGDA 3QPXH 1D5XB 4HIIB 1DBAH 4J23A 5FHBH 3TJHD 1S3KH 1T1WB 3SKUD 5SWZB 5HYJD 2JTDA 3BKML 4KC3B 2V5TA 1FNLA 1INEH 3VXOA 1HI6B 3K2UL 3LKQB 5D1ZB 1UKQA 3O6FA 3D39E 5HYSA 4U0RB 4OLZL 1TPXB 4G8FA 3SKJL 1EH9A 4M7ZC 4U1MA 1U92B 3FOMB 5DDHA 1A1NA 4E41D 1Y6MR 4AEIH 4M1DL 3RGVB 5D7JB 3O9WC 1FZKA 3HAEG 5EZLB 5IB2A 4AENA 3U4AA 4EOWL 4HPOH 1AJ7L 3EOTL 3F12B 3AMKA 1RUAL 4NUJB 5JOPE 4C56B 2HJKB 5HI4C 4TULL 4WUUB 4YC2B 4G43A 5E8OB 4WGWB 2P8LA 1TQCC 1G84A 5I1DB 4X4XB 4JFHD 3UTSD 4IIQB 4H1LB 2HVKB 5EDXA 2F15A 1CLOL 1HXYB 3GJEA 4POUB 5ANMB 3X14A 3T0ED 5J8OA 5DD1H 1GRWA 4ZSOB 5C71A 1QRND 3OAUH 2C3VB 2C1PA 1MRCL 3KDMA 2VERN 1EXUA 2A9MH 1A6VH 4UZGA 4MB4A 1YEDB 4L9LC 5LGHL 3P0GB 1QACA 5J6HB 5IJKA 3HE6D 3W0WB 4UOW0 1NBYB 1OGTA 1SJEB 4JFOB 1RZGB 1U58B 2YA2A 5ALBH 5E24E 3S4SA 3MRKB 3FT3B 3P9MB 4CN4A 1X5AA 5KSBF 3VFWB 2E7LC 1P5VA 5TDOB 3HC4L 4JDVB 4JY5L 2APTA 4NN7C 4YR6B 5D7SL 4LAQL 3DSFH 4QHKJ 3X3FL 4QWWD 1JYVA 5FGCE 3QXAA 3BZDA 2R56H 4NPYB 2J8UA 4K94C 4W81A 3ILPB 4LLVB 4YUEL 2A6DB 3B8SA 1UEYA 3AGVA 1OF2B 2Q3ZA 5L2KB 3V4UH 1A47A 4JRWA 1YECL 1MHPH 2C1OA 2Q86A 4HT1L 1P84K 4NRXA 1IC5H 2X4PB 2ARJQ 4M93B 1ZMYA 1ZA6B 4PJBE 4ONFH 1AGFA 1RULL 1OB1B 2X70A 4PP1D 3BP4A 4HC1L 1M7XA 2DI8A 3HC3H 5DYOA 1JPTL 1NFDA 3C09C 1MCFA 3ZYOA 3G6JA 5CBEA 1A9BA 3D5OF 4NHUA 4YWGL 3WNPA 3MV9E 4LCUA 3UBXI 1K4CA 1QFPA 2IG2H 4P4KC 1H8SA 1TNMA 4NNYA 5CLTA 3BE1L 2FJHB 3PGDB 4U1JB 3SDCB 3VXSB 1UWXH 2D03L 1EHLH 2KQMA 4QXUL 4I13B 4P5TC 3V52L 1JFQL 4UT9L 3JTSA 4AMKH 4AJ0A 3MV7D 1AP2B 3L3JB 1FPTL 1JNLL 5DMYA 2CUMA 5DK2A 2YD9A 3KPSE 3S98A 3PQYE 4PJAB 3UJJL 1S9KC 4TVPD 4AT6A 4Z5RA 1QQDB 3MLPA 2O5XL 1EJOH 4ZOCA 2AQ3A 4U6TA 4BZ2L 4P9MH 3HZVA 2IQAB 4IRSB 3B6SB 1XF4A 1IZKA 2HMID 1SEBB 4PJIB 2BNRE 2P24A 5A3IC 4L3CB 1HHIA 3L7EA 1X9QA 1H9VA 3DRTB 1DUZB 4PB0H 4MD4A 1G9NC 5ERWA 5JHDB 3UTTA 4O2EA 3HRZA 5LCVH 1XH3A 5L8LB 2F53E 4YDJA 4CMMA 3HE7A 2FO1A 3QNXB 2GJ6B 3P4LA 1KBGL 4FG6C 4UIKH 3OJDA 4RFEB 3QIUD 3BH9B 4R97B 3T08A 5DD5L 3QO1A 3GSUA 3GMOB 3ARGB 5HI3D 1C16A 3BP5A 1NMBH 1WZ1H 4F3FA 1XT5A 1WJ3A 1J18A 2VYRE 5C08A 1XGUB 3KS0H 2Y1VA 2IH3B 2ADJB 4XRCB 4FXLA 1D5BA 2GAZA 4NWUL 4WO4A 5ADOL 4LPUA 1JHLL 2QV2A 3ARED 3FFCD 4HK0A 4MNGB 5DJDB 4KAQH 5D1XD 5GXBB 2JE8A 4FZ8H 4GKZB 1U95A 4HG4K 4K2UL 1CGSL 2JB5H 4R26H 1MCDA 2XT1B 2MTPA 5J9PB 2V2XB 5GGVY 2HTKC 4JN2B 1WISA 2FIKB 1CDYA 2AP2A 3OKKB 3ROLA 4M6NL 4R0LB 1M05A 4TVPH 1FNSH 1TQBC 3NCJH 5C9KA 2VDML 5HD8D 3WDHA 3EDEA 3QUMA 2FL5A 2LU4A 1QFOA 4K7PH 3CZJA 3KHQA 4AL8L 1HIML 4PY7B 4PUBL 1OAKH 1F4XL 5DJ6A 2F9BT 3SGJA 1QSFE 4PJ8B 1FHGA 2BOBA 1EUUA 5GS2H 4WWKA 4G8GA 5I15H 6FABL 3OHXB 3IS0X 3P4NB 4ZPVA 1QBAA 4NNPH 4MLIA 5E1AA 3VWKA 1HYSC 1F45A 4EEEA 4UIMA 1A7BA 4PG2A 3T8XB 3EFFA 5FUZL 2UYLB 1OL0A 4EN3A 5SV3A 3TO2B 1Q72L 2X4NA 4ZPTB 4NO5A 5IW6B 3UBXA 1LQSR 4BSVA 5DJXB 2WWMC 4L4VA 4A2LA 2P5WD 3QAZB 5AZEH 3GSVA 2MJWA 2JB6B 3PGCA 1TVHB 2BX5A 1AXIB 5ID0B 4O2FA 1WBZA 4XNUH 5ITBL 4KV5F 1N2RB 5F1NA 4Z77A 2AGJH 2MCPL 5D1QC 2ZNXA 2OTPA 3ARVA 2DTMH 4WFGE 2XA8H 3TNMB 2FEEL 1JWMB 5C0EB 5HHNA 5GJTH 1HDMA 2HFEB 3K8KA 1HHGA 3EOBA 3MJ8A 3EO1A 3BZ4B 4UT7H 1MCOH 1MSPA 4MAUL 5K59F 3A6BH 4YEEA 3F5WB 3FO0L 3CFDA 1HKLH 3VFGH 1IAIM 4YQXL 2IWGA 5D7IE 2O5ZH 4XNYL 4FQHA 1FNHA 2R23B 4QCIB 5ID1A 3LEYH 3BGAA 1RQ5A 3WUWG 2BY1A 4Y1AB 2QSCL 1AR2A 2FX8H 3QG7H 4F7MA 3B83A 3UXFA 3W9DB 4CJ1A 3OGCB 5CZXD 5ICXB 4PGEB 2AK4E 1FGVH 2F58L 1OGAB 2XG5A 5DEFA 1P1ZB 1TJHL 4Q58C 5GRZA 1RZIA 1HNFA 5FECA 3WFHA 1KEGH 5F72S 1F4HA 4F37K 1UFUA 3RWEB 5FYJH 4XBEL 3DXAD 3STZB 5DFTA 5AYUH 3AAZB 1QLFB 5ALCL 3CU1A 4G9DB 4OD3H 3MUY1 4OM1H 1I1AC 1LEGB 2FECI 2FBOJ 1D9KC 1VKXA 4UMGA 1I85A 1RUML 3ARDC 3QDME 5IBUB 2ZUXA 4KMTH 3UEZA 3MRCB 5FO9A 2CK0L 1UZ6F 3N9GL 1WAAE 3JV4B 5HGHB 1RZKL 3WXWH 5DURD 2AEQL 1KIQB 4TQEH 2VH5H 1RHHB 3JWNC 4Y4KA 4DN3L 3SE4C 1NEZB 1RIVL 1CBVL 2R39A 3SE9H 5KANI 3JVGC 3NZ8B 3LKSA 1CXHA 4LIQH 1IC7H 3H9YA 2FX7L 2B2XH 1U36A 1EEUA 1H5BC 3VWJA 4Z7NE 4H8WL 3NFPB 5DHXB 4F9LC 4WDIA 4S1QL 3ZTJG 4D0DA 1HH6B 3MZTA 2NY6C 3O11A 1XFPA 3QCVH 1IGFL 5T3ZE 2R1XB 5KOVC 4JZJA 2GSIA 1IL1A 3FN3A 4WHTA 3P11H 2B7DT 2XNAB 2BVYA 3NCYS 3STLB 5E4IA 3TESA 3WKNA 2DF3A 2AS5M 1FAKT 1XF5A 3PWPB 1NEUA 2WBJA 3QEQA 2DQTH 3KXFA 2Z91A 1KCRL 2LE9A 4IJ3C 3V6FA 2VQTA 4P2QE 2RB8A 3U48A 4PJFB 4RGNB 4MMXC 1VFBA 1EV2E 5CEZH 2ED8A 4P3DA 4WU7A 3N06B 3RU8L 3WFCL 5I71B 3LD8C 1CTOA 2IALB 2JCCA 2X44D 2R9HC 4FHBD 5FUCC 4RA3A 4ZXBB 4JRXA 4PJ5E 4N5EC 4EUPG 2VLKB 4XPGL 3LKPB 2NY2D 4YO0A 1YJDH 3BPOB 1KCSL 1S5HB 1LE9A 4OLZH 1YZZA 3SKJH 1OD9A 1KXVC 3WD5L 3VXNB 4RFOL 4KTEL 2FDBP 2VXSL 2DWDB 3BWUC 3AXLB 1YDPB 2HAZA 4N68A 4MA1B 2ESVB 2IPKA 4Z7UB 3RBSA 3WIFB 3FN0L 2OSLB 3MUGA 3KG5A 5INDB 4EUPA 2PYEB 3S9DB 3BJ91 2JLLA 3K7UA 4NQEE 4EOWH 2VLJD 5C0GA 4X4YA 1AJ7H 3B2VL 1QSED 3QUZD 5EC2A 3EOTH 3LHPL 1RUAH 4HWNA 2YXFA 5C0FB 1EK3A 3OAYK 3L3HB 3H0TB 2FJGA 4NT6A 1YEKL 4TULH 1MLBB 2BHYA 4YHIA 3CUPA 3M17A 4KU1A 2VOTA 3T77A 3SDYH 4RGOL 3VXPA 5IEHA 2Y5EA 5DVKA 4M93C 2FSEA 1ORQB 3BN9C 4NQSA 2ZCHL 1Q0XL 2P5EA 3R1GL 1CLOH 3E3QC 3H7LA 3RHWK 3ZKQD 2HYMA 5GGSA 1LILA 2W07A 4GXVL 2VAAA 1JYXA 2GIYA 1GGIH 1MRCH 4HUMB 3HKFA 4MA8L 1DN0B 5ISZD 1CFQA 5IB1B 2QADC 3EW3B 1YMME 5FKPA 5LGHH 4BSJA 2RFXB 2DOCA 4GG8A 4XX1G 1J88A 5CJXC 5JO5B 4NO2B 1BPVA 3MRHA 4Q9QL 5JXED 2XWBA 3QBTB 2X89D 5F96L 3CDGA 3RIAF 1OP5K 2GTWB 2G75A 2HG5B 5LAXB 1CFSA 5D5MF 3VFNB 4LGSB 3ZDYF 1G7PA 5D7SH 3SDAB 4JE4B 4LAQH 5F3BB 3T0BA 3TPUB 3V5KA 3X3FH 5D6CA 1XR8A 1KENL 4M61B 3O6KL 3EFDL 4X6CE 2A83B 1S7TA 3P77B 2MQ3A 4IRSC 2DB8A 2WBKA 4G6KH 4X6DE 4DKDC 2IAMA 1FVEB 1JUFA 1ETZA 4NRZB 4RX4A 1T22A 2X1XR 1P7HL 4HJ0D 1GIGL 4HS3A 5F9DC 3EYQD 3MJ7A 2VLMD 4HZLB 4ETYA 3SHSA 5IIEB 4I0PC 2VE6B 3QO0B 4HT1H 3ROOA 3RX5A 1NGPL 1YYML 4XXCC 5IOPB 3PE9A 5E2VL 1T1YA 4GO6B 4P5KA 4Y19A 1RULH 5BVJB 4HC1H 4K8RD 2BMKA 2NCMA 4PJHF 1JPTH 3EO0B 4ZAKC 4G42A 3CPLB 4KKAD 2PO6A 2DKUA 1A6PA 4XZUB 4YWGH 1A9EA 1T1ZA 3BE1H 3O6LL 2WINB 2ESVE 2D03H 3MMEB 4MXVF 4QOKB 4QXUH 3P9LB 1MI5B 3V52H 1JFQH 1HHHA 1IM9D 5E95B 3QUXA 4EQ2A 1JNLH 5T33L 2Z93B 1A64A 2B8OT 4XWOC 2Q7YB 3GM8A 3UJJH 2ZPKL 3T3PE 1ORSB 3C5ZA 5EH1A 4EVNB 4BZ2H 4WV1C 3AY4C 1A6TB 1H3UA 5EO1A 1IM3B 4Q0XL 4O5LL 2JJSC 3OJVC 3IDNB 3OXRA 1MCHA 3HFML 5FAAA 4KXZH 3UC0L 5HPMB 3L3OB 4QNPE 5KSAA 1AGEB 2IBZY 1M6OB 3DVNB 1PG7W 1KBGH 3O3BB 5C0AE 4FQLL 1A3RL 1NCBL 3NFNB 2R0KL 1GCFA 5MI0C 1XCQA 1A6AA 5CKAA 3SCMD 3D2UB 4NKOA 3FB5A 5B22A 4L4TD 3FAXA 5IVXA 4FTVA 3TN0A 3QWOB 1QR1B 2APXA 3C6SB 2G5BB 5EZOL 1DQTA 2R4SL 1F6FB 1G7MB 2CDGA 3QIUA 2AVGA 4BQ9A 2HH0L 3MGTB 4NWUH 1JYNA 5ADOH 5IVOA 4GG6A 2A6KA 3HUJB 1JHLH 1BBDH 3GMMB 4PBWD 1DQJA 2CR3A 3MFGB 2ZNWA 4FS0A 4EKXA 3DIFB 1JK8A 2X1QA 4K2UH 4LGPB 1PKQA 4UUJB 1KACB 5T1KD 4K3EL 2NR6C 3MRBB 4H88L 1RVFL 4QY8A 2X05A 4M62L 2HJFA 4JFQA 1KPUB 2OZ4A 3KYOA 2FGZA 1TLKA 2F54D 4OZFB 5CSZB 1MRDL 1MY7A 1QG3A 2VDMH 4BSWB 3HZYA 2GJZB 1Q9KB 4DVBB 5IROC 3GKZA 5C09A 1IAIL 5J1TC 1HIMH 4KGJA 4IRJB 4E0RB 1LP9A 4PUBH 2V9RA 4HKZA 5JPMB 4JR9L 3B9KB 5ESQA 1GXEA 4TUJA 2VXQL 1TTFA 1NBZA 4D0CA 1KIRB 6FABH 2VO5A 5FA3B 4A6YL 3MRRB 3ARFD 4KRPC 1P9MC 4N8VB 3RZCA 1IKNA 1TIUA 4DTGL 2AXJA 3SJVE 3MOQA 4N0YL 5F7EL 2QEJA 3U83A 3BAEL 4NJ9L 5FM8A 1FNEB 4FN0A 4F58L 1JVKA 2H8PA 4KKLD 1Z9OA 2V7NB 1L0YA 4G7YL 3MLTB 1YPZB 3PJSB 3LRHA 3CH1A 3VFOA 1Q72H 1JMXA 5ADPL 2WQ8A 1IGTB 2Z31A 3AB0B 1UM6L 1FFQA 4XCYB 1A1OB 3WJJA 3VFUB 2OQJB 4NC1C 5AWNL 3QDHA 1S8DA 4JGUA 5JNYA 5DJ2A 4X7CC 1F90L 4JPIA 3GRWH 1EEQA 1RUPL 2FH8A 2VWEC 4ONGH 5IK3B 3SEPA 3SE3C 2MCPH 5MEOB 2BVQB 4LP4A 3TBTB 5JMRA 4KZEL 3RVVC 5ESAA 2XKNB 2P5WA 1JPGA 5KTEL 3MBED 3TBWB 5F7FA 1QEWB 3BP6A 4FFVD 4DCQB 4YAQB 4XP4L 4WFHE 4GKNA 4I2XA 3T2QA 3CLEH 4MAUH 4YFLI 1OWWA 5T1LA 3I50L 4IDJL 1F3DH 5EB9A 2UZXB 3FO0H 1NGXA 1IQDA 1CWVA 4PLOB 4NQXA 2NY3C 1T0PB 4N5UA 4X5XA 4YQXH 4WNQB 4XNYH 3BH8B 5F9JB 1HCFX 1ED3A 2ZOKB 3ULVE 2KDGA 3UDWC 2H32H 3DMMD 4LPVA 2XXCB 2F58H 5GS0L 1TJHH 1I8LA 4ZFGH 2O61B 4U1LB 5E8PB 3GO1H 5FDWA 1YNTB 4OZGE 5E6ZA 4QKXB 4ZFFB 4XBEH 3DHJA 5HGGS 1FFPA 5I30L 3AS0A 1ADQH 3CVIL 4X7TB 5B39B 5ALCH 3FQUA 4BA8A 1CE1L 5SX4H 1CD0A 1UQSB 5TJWK 3OJMB 3MX0A 4U1SA 4PJDA 3TBSA 1XZ0A 3ZDXF 4JO3H 3ARXA 3RWJA 4F2MA 1RUMH 3QHZL 1P4LB 1U8NB 4PJ9B 4PRBA 3N9GH 1RZKH 3QQ9D 1EFXA 2XQBL 1MHCA 2AEQH 2OTUA 2OP4L 3KAAA 4WFFE 15C8L 2JF1A 1K85A 1RIVH 4KUCF 1F3DJ 3OKMA 3NCEB 5CGYD 1CFNA 1MAKA 4KPHL 1U8IA 3FB6B 3SGEI 1T6WA 2OI9B 5DJAB 2CKBH 2FX7H 3QHTC 2MSPA 4MA1C 4G8IB 4H8WH 4XC1L 2CQVA 4DOHB 4S1QH 3D39D 4KK6C 1MUJA 5E5MA 4DZ8B 1R3JA 2PTTA 1IGFH 1T04A 4I5BB 1KNOB 1GZQA 1G6RL 3LKOB 5GSVB 3FB8B 1SMOA 4MXQD 4X6FA 4DKEL 4ELMA 1A4JA 4XVSL 2H6PA 1JPFA 1KB5L 1A1MA 4ALAL 1UKSA 4PJGA 4LASL 4RDQG 2XWJA 5I2IB 4TPRL 4Q97A 3UP1A 1KCRH 2R2BB 5SX5H 3RRQA 5JOPD 5EPMA 4LLWB 3LN4A 4WIQA 3DBXB 4JM2B 3RU8H 3WFCH 3SQBA 5T3ZL 1XF3A 4MNQB 5FM5O 4PYGA 3OR6A 5DLML 1F6AB 2NY4D 4LLUA 4P23B 1A14H 3QXDA 5DWUH 5L8JB 5C0BE 4XPGH 4G80A 1SY6A 2CLVA 3PIQA 4MDJB 1T89A 2ZG2A 3MRGB 1KCSH 4XMLL 1V3JA 3TBVB 5IB3B 5JIIA 2QKIB 3WD5H 4RFOH 1HE7A 2GW5A 4KTEH 4QHUB 3LVEA 2VXSH 4MCYB 2VSCA 2EDYA 4Y16A 3PWLB 4CAGA 5FKAB 3FN0H 4OAWA 4UOJA 2IANB 5EOTA 2VZ1A 3O41B 1UXSA 3B2VH 2DL2A 3LHPH 1BBJB 4EDWL 1SYVA 1ZE3C 4PRHB 3U7YL 4ZDHB 1NAMA 3Q5TA 1XGQA 3W39B 1PBYA 4WI2A 2MHAB 4Y5XC 1G1CA 3CK0L 1DEDA 4WU5B 4LGRB 3WEXB 4XXDB 4JM4H 3BESR 4PTTB 1FGNL 3RZWA 4APQB 5HGAB 1E27B 4UDTA 3QUZA 1Q0XH 3VFPA 5MEND 3MLWL 3HMXL 2WUBL 1K3ZA 4GXVH 3UO1L 2EDEA 3GHEL 5CKGA 3FT4A 3QDJE 4MA8H 1AQDB 2NX5B 4KRNA 2X1PA 1S7QA 5SWZD 4NDMB 4RMSA 2R1WB 4R90L 2AW2A 4HGWB 4Q9QH 5D7KD 4I0CC 5D1ZD 5F96H 4XGZB 5JIHA 2YK1L 4R7DB 3TFKD 3U6RB 2NW3B 1IRAY 4GMSL 1NDGB 4ODUA 3LSOB 2JELL 3LZFL 5FYKE 4Z8FL 5ISZA 4M1GH 4GMTL 1AGBA 4BFGA 3M1BB 5JW4M 4U1GB 3RGVD 3KR3H 5D7JD 1Y0LB 3KWWB 1KENH 3BIBX 2X4RB 3C8DA 2HJLA 3O6KH 3EFDH 5JXEA 3F6IA 4KKCD 3EZ8A 2PYFB 1HEZA 2NY1C 4Z7OE 4C56D 4XVJL 2I07A 3HS0A 4M4PA 5D70L 1GIGH 2BNQB 3L3DA 4G6JL 2KKQA 4NN6C 4NZRL 4GXUN 4OD2B 4WUUD 4P46B 4TSAL 1ZLVH 1YEHL 4PJ7A 4F33B 4LLYA 1YYMH 1FL3A 1ZTXH 2VKWA 2BNRD 1UB5A 1MF2L 3MROB 3KYNB 1FSKB 1I4FB 3WNOA 4U6HB 1PYWA 3BXNA 2J6EA 4JPWL 2VSDA 1OTUD 3PHQB 4JHWL 1DVFC 1I3GH 4MD0B 4HMCA 5BS0E 1WWCA 2YA0A 3BT2L 4NFCA 3NIGF 3O6LH 3QQ4A 3W0WD 5JW4R 3R4DA 2V5RA 5EBGA 1RZ8B 1QHOA 4PG9A 1WIUA 5EU7E 4PJCB 4L1DA 1BX2A 4TNVK 3K80A 4Q7DA 5E5RB 5CMAB 1G7QB 4QHLB 2XTJB 5T33H 1CTNA 3T09A 3MNVA 3O3AA 2W0PA 3KPQA 5HJ3B 1ZT4A 2ZPKH 1RY7B 5AAMA 3PWUA 3AMLA 3LPGA 4XP9L 3U9UB 1REIA 5E2JA 3L5WA 4Q0XH 4O5LH 1HK6A 2IGFL 3GSNL 4OZHB 4YHNB 1F3JA 1LO4L 2ERJC 3VGFA 4F7TA 1U9KA 3D0VA 1RJYB 4PJEF 1BWWA 5C7XH 3GMNA 5L2KD 1D5MB 3HFMH 1P6FA 4X7FC 3UC0H 3MRMA 3O9WA 3LIZH 5E4EC 3NN8B 4RSVA 3IDGA 3L5XL 4XCCH 4ESKA 3KPRB 1WGOA 3VD3A 3AC0A 5LGJB 4FQLH 1AKJB 1A3RH 1NCBH 1A6ZB 1HILB 1XR9B 2R0KH 1H3WM 3VFTA 1C8PA 4NQCB 1IZJA 4OSUL 2Y06L 1PZ5A 1V7NL 4OFDA 1I75A 2A0LD 3CSBA 4MA3A 2GUOB 3P4MB 4ODBD 5AUMB 2R4SH 3SDCD 2WLYA 1FFRA 2HH0H 4V1DA 3QRFM 5IMLB 4PRAA 5IJVB 4CVZA 1FYTE 4L4TA 3QPQC 4MMZC 3BEWB 4PGCB 4UQ3B 4K3EH 4H88H 1RVFH 4KJYB 3SO3B 1NUNB 3VXQA 1U8PB 2YD2A 2ATPA 2E7LA 1SJHA 4U1IB 4WHYG 3QZWG 3S97C 3ARTA 4DEPC 3W5MA 1EUTA 1MRDH 3ZKNC 3DROA 2C4FT 5TDPA 4RBPH 1FN4A 1I9EA 5D7LA 1KC5L 5T5NF 1D6EB 5JLZA 3PWJB 4EZMA 1WCBA 3GJFH 5TF1H 5JHDD 1N3NB 2XOTA 3IJSA 3S88H 2BY0A 1IAIH 5T1KA 1EAPA 2GJ6D 1JF1A 5A40E 1JN6A 1X4ZA 5F44A 3RDTC 4WJ5B 4JR9H 5HHOE 1ERNA 3GKWL 5JDJA 3P3YA 3QZWA 5CZKA 2VXQH 4ZUVB 3ARGD 2ZZUT 4A6YH 4PLKC 4KQ3L 1UVQB 1GPOH 2OL3L 4NRYA 4KRLB 4DTGH 2VXTH 2DQIL 4G8EA 4RQQA 3OB0K 4N0YH 5F7EH 2OTWA 3BAEH 4NJ9H 5I8EA 3UZQA 4BH8B 2FGWL 4GBXC 5FK9B 3HPJA 4F58H 1HNGA 3V5DB 4G7YH 2FO4B 1YYLH 4I4WB 2L4OA 4OZIE 3EYVB 1Q94A 4AZ8A 2ZJSH 5ADPH 2VISA 3AS3A 3UTPE 3GMRB 5E6IC 4YXLL 1UM6H 4IOIB 4JVPA 4E5XB 1AGCB 5AWNH 2VDRL 3EBAA 4ZODA 1CD8A 4NGHL 3FO2B 1F90H 1DLHA 2FLBT 4LVOC 4UNVA 1RUPH 1UJ3B 1E6JL 1A6UL 2H26B 3JSSA 4P5TA 5IV2A 2CXGA 2AK4D 4I48A 4MAYC 5B3NA 5DRXB 4HLZH 3U0PB 1T7XA 1KIUA 4HIJA 3QIWB 5A16A 3V7AE 1WZMA 2P49B 4P5MB 1URLA 2CRYA 3ZT5A 1XF2B 2YD6A 5D8JL 1M1SA 1MHHA 4YK4B 2RGSA 4XP4H 1AGDB 1SBSL 3JV6B 4M6AA 3B2UC 3BI9X 4PJ8D 4JZNA 3TZVB 4XAKE 4IDJH 4OGYL 3QDMD 5DJ0A 1RZKC 3MSPA 3IFOA 1ROWA 2Z8RA 3IDYB 5CSBA 3V2AR 1JGDB 1DANU 3BISA 4M9OA 3B9DA 1N5AB 3KVQA 1CE6A 5CINL 5CEYA 3VXOB 3MRLA 1TETH 1UZ8A 3PABA 4Y4HC 4MB5A 5GS0H 2CKNA 1L9MA 5L7XL 5DMJB 2BHZA 4H8WC 1FZOA 2APWA 4U1MB 1U8QA 4RFNB 5EO0A 1TZHA 2D7QA 5DDHB 3JUZA 1A1NB 3HLAA 4LHUD 5FA4A 1CE1H 4L3EE 5DUBA 3ULVL 2QSQA 5IB2B 1KT2B 3QHFL 1RJLB 1MCIA 3PF2A 3TT3L 1IILE 4ODWA 1KPRA 1ZV5A 3QHZH 2CRZA 2NTSP 4JM2C 1UG9A 3NPZB 3OB8A 3O81A 4G6FB 3F7QA 3WE6B 4XB7A 1UENA 1YEIL 3TVMD 2XQBH 4P23C 4EDXA 2P8LB 3D69A 1RK1B 5CS7A 4R8WL 15C8H 1G9MH 3D9AL 3TCLA 3KYKH 3S37L 2J4WL 3GBML 3PP3K 3VG9C 5I8CB 4HCRH 4KPHH 3NIDE 5L9DL 5HHVL 4N0FA 2C1PB 5DUPL 4XH2A 1EXUB 4Y1AD 1NC4A 4N90D 3MRDA 1FBIL 3IU4L 3VI3E 1OT1A 2XICA 3S4SB 5J89A 3MA7A 3DX8A 4XTRD 1G6RH 4DKEH 1PY9A 4OLYL 1KB5H 2C7UA 3O2VL 2F8XC 4LASH 4NQED 1U3HD 4TPRH 4Y2DC 3BW9B 1X7QB 1RZJL 3FMGH 5FB8A 2J8UB 3S6CA 3EZJB 4CW1B 1YMHA 1QTYT 5GGUB 4HZAA 2A74A 4Y5VA 5T3ZH 3UJIL 5ESVA 4QHNA 4CN1A 1OARL 5DLMH 4WFED 4MYWB 2GQHA 4XCEA 3SGDH 2C1OB 3VD9A 4DQOL 5D1QA 3C2AL 5KN5A 5A43C 4XMLH 4PP2A 3BP4B 2NXZC 3E8UL 4OFIA 4HWZA 5CJOH 5DYOB 1NFDB 1YMMD 4PRIA 3ILQD 4UINL 3OKNA 1OCWL 3G6JB 1W72L 1QKZL 3JBG7 4QF1A 4NHUB 3V6BR 1K4CB 1KLUA 3KJ6L 5GZNC 5FYJU 5JQ6L 4HS6B 2R8SL 4EDWH 2W59A 2YSSA 4Z78B 1YN7A 1MFAL 4G6AD 4P57A 3U7YH 2ZSVA 3B5GA 3LH2H 3RNQA 4E42A 1BD2B 5DK2B 3G5YA 4WY7L 1AI1L 3PWPD 3D6GA 4X7EC 4AT6B 4KHTL 1FGNH 3O8XC 4M1CD 1NKRA 3P4OA 1PAMA 1FG2A 3HZVB 1JRHI 1ZGLA 4YJZL 1XF4B 4RGND 1H3XA 1I9JL 1FSKC 1K4DA 2DM7A 3MLWH 4Y8DC 1WUNT 2P24B 5ACZA 2WUBH 1YEEL 1HHIB 3UO1H 1UWGL 1LO2L 3ECBA 4MHHI 3GHEH 4KKBC 5E08L 4WW2B 5KAQF 4MD4B 3U30B 4O2EB 4AIZA 4F15B 3HRZB 1XH3B 4ZXBD 4CMMB 4R90H 4PJBF 1I1AA 2PR4L 4G3YH 1JZ4A 1VA9A 2VLKD 4JFEB 5FO8A 3PL6C 5DRWA 3TIEA 2DIBA 2EO9A 2YK1H 4V2BA 3FL7A 4QHMA 3QO1B 4GMSH 1TNNA 2JELH 4HIIA 4OBSA 3VE0A 4Z8FH 2XTJC 3BP5B 3BRFA 4F3FB 4GMTH 5C08B 1T1WA 2GJJA 4I3GA 4HGKC 5DQJB 2ESVD 2PXYC 3AM8A 3G9VA 3ULUE 3EKCA 2PYED 2EDXA 3OAZK 3SE4A 3RPIA 5D1ZA 1EIBA 4N0CD 3RWDB 4GH7B 1D5BB 4Y88A 3L3IA 2J8UE 1WWAX 4XVJH 5IQ7L 3QDGE 3WHXA 5D70H 3D85A 4G6JH 4NZRH 1U92A 3FOMA 5I1IL 1H5BA 1JPST 5HHQA 1RUKL 1WVZA 4TSAH 1U95B 1AD9B 1YEHH 5FYKL 2NLJA 3TP4A 4F9LA 1EMTL 3MACL 4UAOC 1QLRA 1UCTA 3KPPA 1MF2H 3GMPA 3ROLB 4H1LG 5C2BL 3FCTA 4MLSA 1MIMH 2HJKA 4NBYB 2MOVA 4LCWE 4JHWH 1R3IL 1SYSB 5HYIA 3QFDA 1BFTA 3QNZB 1CK0H 5E8OA 4CMHC 4P2YA 2GTZB 1ULVA 3BT2H 1EVUA 1WZKA 4JFFA 2LAGB 1C7TA 5I1DA 4IIQA 4H1LA 2HVKA 2Z4QB 1HXYA 5IF0B 4AK1A 3Q6FA 5ANMA 1PKOA 4WWKB 3ARBB 4G8GB 1MVUB 5C0CA 1OTUC 1C08A 4JJ5A 5E1AB 3SDAD 2ICWI 3SE8L 4EI5B 1QA9A 3W0WA 1NBYA 1SJEA 2YUWA 4XP9H 4JFOA 1RZGA 1U58A 5D6DA 3EFFB 3U36A 3U9PL 4HHAB 5H94A 3UCRA 5FDYA 3FT3A 4EN3B 2V7HB 3MGAA 4HGMA 4XPFL 3VFWA 1UM5L 2IGFH 3GSNH 1BZQK 5ACMA 1LO4H 4JDVA 3UBXB 2XFXA 5I16A 4BSVB 4XHQA 1FNFA 3KLAB 3L5XH 3I3DA 3PGCB 4Z7WE 3UTTE 3ILPA 1WBZB 4L5FL 4OLWL 4X5LA 1N4XL 4F8QA 4MHHG 4LLVA 4YBLC 5F1NB 2A6DA 4DFIA 4FQIH 5EUKA 3C9NA 3EDFA 4U3CA 2JJVA 4KJQC 4OSUH 2Y06H 5C07E 7FABL 2E6QA 1OF2A 5L2KA 1V7NH 3D0LA 3BQUD 5EUOB 4LRNL 1QBLL 4YBQD 3BUYB 2X4PA 3CU7A 4ODVL 1HDMB 2ITCB 2DLGA 4WRLA 5DK0B 3E0GA 1ZA6A 2YS4A 5DQDL 3T0DA 4UB0L 3EOBB 3EO1B 3TA3B 1VFAA 2NY0D 2YD4A 2EXWD 5E9DA 4KFZC 4X6BA 3S8WA 2J1KA 1SQ2N 3QYCA 3SJVD 5HDBE 3I75A 1A5FL 5DMKA 4KHXL 2GITA 4PD4K 5CJXA 2RQ8A 2W9LA 1Z5LA 2XQYG 3T0VA 1J0HA 2FJHA 3PGDA 3SDCA 3VXSA 3ZE1E 1UJ3C 3U1SL 4FQXC 4F7MB 4X7SH 4K9EL 1AP2A 5DR5L 1FV1A 4X99A 4QRPA 1F13A 1JGLL 1KC5H 3U46B 1TENA 4Z0BL 5FECB 3WFHB 5KW9L 1RIUL 4PJAA 1QQDA 4FMKA 3RY6C 3SKMA 4GS7B 2P44B 1R5WB 4IRSA 3D87B 3P40A 4GOSA 3BRDA 3GKWH 1J10A 1SEBA 3L1OL 4PJIA 1J87A 3NACL 1BVKB 4L3CA 1KXQE 3D2UD 4NKQB 1VKXB 1V5JA 2DQIH 4G8GE 4I0PA 5JHDA 4CKVX 5C6WH 3D25B 3IDYC 4WFHD 2OJZL 2FGWH 3T4YB 3AROA 3EJZC 5FCSH 2GJ6A 2A38A 5IVZB 4RFEA 4P4RA 1HN1A 4G9FB 2XN9B 3ARGA 3GMOA 2VTFA 3VXUE 4Y4KB 1DQQA 5D7IF 4YXLH 3DUUA 1A0QL 1J1XH 1MJ7H 5C70A 3UPAA 1XGUA 2VDRH 5GGRB 1QD0A 3GSXA 5IB4A 1NAKL 2X4SB 4NGHH 3OL2A 5C8JB 3TCXA 4BZYA 1UYWL 2XQYK 1JZ3A 4L4VE 5GS0C 1A6UH 5DTFB 1RAMA 3RBGA 1RJCA 1IGYA 3L95B 3NMEA 4WDIB 1KEMH 5I9QB 3ZDZE 4PJHA 4D0DB 2HFFA 4BZ1L 3O11B 2ICWA 1QO3A 2DMCA 2W92A 4PBVC 4HFWA 3MOBL 3PGFL 5EA0L 1IL1B 5D8JH 3HMWL 5J9PA 4WV1A 2V2XA 3AY4A 4IRJD 4PBXA 4JN2A 1MCJA 1T7ZA 2FIKA 2WBJB 1SBSH 3OKKA 3QEQB 1MHEB 2HFGL 5DFWH 1S9YB 4R0LA 3ALXA 4OCRL 2JJSA 3B9KD 4OGYH 5IHLB 3REVA 1EEYB 1Z9SA 1SJXA 1VFBB 4EXPX 1T80A 1WAAF 2JCCB 3L7FB 2Y6SC 5B4MC 1HXMB 1QVOB 4OFVA 3GI8L 4JRXB 5CINH 1EDQA 4PJ8A 3MLVH 4YXHL 4DWHA 2VXUL 4JDTL 3OHXA 4K23L 2IFGA 5L7XH 1B4JL 5J1AA 3RUGB 5MEPB 1V3MA 4WW1B 3TYFB 5CJ8A 4Z7NF 5I76B 3RJDA 5J6GA 2LABA 4JPKH 3SDDB 1ZEAL 3MUGB 5HDOA 4MQXD 3RTQB 3TO2A 3R8BB 3HHRB 3PHSA 3ULVH 4JQXC 3V6ZA 3QHFH 5C0GB 3TT3H 5EC2B 3HI5L 4GRMB 5H2BA 4URTB 3VA6A 3TEUA 3OR7A 2X4UB 4YHIB 5ID0A 2Q6WA 3I85A 3VMOA 4N9GB 2UZIL 1YEIH 1N2RA 4PIRF 3T77B 1QUNA 3VXPB 1D5IL 5IEHB 2R1YB 1J1PL 3OQ3B 2YZ1A 4HSQA 2BVOB 3WIHL 1N59B 4LNVA 4NQSB 2P5EB 3GBMH 3TNMA 5FCUL 1JWMA 5C0EA 2V2WB 5L9DH 1F3RB 2BRRL 5I1CL 1INDL 2HFEA 1ZLUK 1CFQB 1MCCA 3DRQA 3HZMB 1I3UA 5C0BD 3TVMC 1FBIH 5DRZA 3WFDL 5J7CC 5LWYL 4S2SB 3GIZL 4ZUSA 1S7SA 2EE6A 4XP6L 3CX5J 4OF7A 2PCPA 4OLYH 4PJXE 2ADFL 1W0YT 4Y1AA 3NPSB 5HBBA 2BDNL 3OGCA 2UWEA 1RZJH 2FEDD 4L8BA 1MEXL 5ICXA 1XR8B 1K6QH 4RISL 4X4MA 1P7QA 4PGEA 3QIBC 4M7KL 1OGAA 3IT8D 3RP1A 1QFWI 4B53A 3DNKA 3F6LA 3KXFE 1J9CT 4XPAL 1P1ZA 5EBMB 4LDEB 4Y4FB 1BFVL 3WN5C 2IAMB 2WW8A 1JUFB 3UJIH 5DVNA 1RURL 3EYFA 4PJ9D 5IBUG 1T22B 3RWEA 1UCBL 1JIBA 1OARH 3MJ7B 5FIEA 1EFQA 3AAZA 1QLFA 4TTDD 3ROOB 3GEWB 3VXRB 4DQOH 1F11B 4NM4L 5EIIA 4ZS6D 5CD5D 3O3UN 3MNWB 1LEGA 4G5ZL 4MJ4A 5A1AA 1NEZG 4P5KB 4X8XA 3QDJD 3E8UH 5CP7B 1F8TH 2BMKB 2X4TB 3H9SE 4HKXA 2XTLA 2OM5A 4UINH 2PO6B 1OCWH 1QKZH 1Z9MA 4QRRB 5HGHA 4KVNL 2XACC 2Y72A 4JFDA 2BSRB 3KJ6H 4PB9L 5D2NB 5HYJE 2FYYA 1JCKA 5TE6L 5KVDL 1I1RA 1HHHB 4NQVB 5DC0A 4K71C 1MFAH 3QUXB 2H41A 3N85L 3GSWA 3UAJD 4ELKA 1N5YH 4U7KA 4ODXA 4WY7H 5EIQA 4LU5L 1AI1H 3MZGB 4FQPA 4LVEA 4X6CF 4RMUA 4KHTH 2VZUA 3C5ZB 3BKCL 2ARJA 1HH6A 4X6DF 2DJ4A 2R1XA 1T20A 4GLRH 1TJGL 3O4LA 5DD3L 1G7JA 1LO2H 2XNAA 5E08H 3OXRB 2SEBB 4MNQD 1JTOA 1MLCA 3G5VB 4PRPA 2XIDA 3PWPA 3T1WA 1JGVH 2Z0BA 2YZ8A 5KSAB 2G60L 5BW7C 2PR4H 4DN4L 2I27N 4NSKA 5I8KH 3WNNA 1B6UA 4I3RL 4PJFA 1AY1L 3RVWC 3C6LC 3QJHB 2NZ9C 4YGVB 3UTSE 1XCQB 3NCYP 3ARBC 2PETA 2Q8BH 1QRNE 3BVNB 4FQ1L 5IVXB 4FTVB 4ZXBA 3TN0B 2IAND 2XZZA 1C12B 3T0AA 3JWDL