1F90L

Fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DVQMTQTPLTLSVTIGQPASISCESSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGVYYCVQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT OF MONOCLONAL ANTIBODY
publication title Crystal structure of an anti-interleukin-2 monoclonal antibody Fab complexed with an antigenic nonapeptide.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f90L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f90L01
4N8VB 5SWSB 1E6JH 5I17B 1FL6A 3VXTA 2KZ1B 3ULVE 4FFWC 2OJZL 4K7FA 4P57A 5DQJA 4NO5A 3WFHA 5IB5B 4WO4D 2VLLB 2EDLA 4WENB 3WNLA 2WAHA 1LO5A 3VG0H 4YHKH 5E2WL 1I9JL 4OZIA 3O6KL 2H2SD 3TO2B 1KB9K 3HNSH 5EOQH 3T4YA 5DMIL 4GAYA 4M7LT 1MIML 4JRXD 2XNAB 3EGSA 4F7CB 3DGCR 5MERB 5DEGB 3QIBC 1JPFA 2O93L 4I3SH 2DM3A 3KYOA 3VFVA 3CFCL 4U3HA 3EYQD 5LXGL 3B2UC 1KLFA 1BZ7A 1HZHH 5D9SB 4O51A 2J3SA 3HE6B 4N0YL 2X4TB 5J1SC 1CF8L 3K4DA 3QPQD 4P2RE 5KSVB 1AQDB 4JFFD 4NQXB 5I18L 3REVA 3A6BH 3QEQE 1AJ7H 3MNVA 4PJCF 1Q0XH 4M4PA 4U0RB 3TWCH 5I15L 1DN0B 1UCTA 2DLTA 2E8ZA 4JHAL 4P4RA 1JCKA 3KS0H 3UEZA 1L7IH 3NAAH 1ZHBB 1UC6A 1MAML 2CDEB 1RK0B 2W91A 5DJ0B 4ORZC 1KFAH 4XBPA 4Z0BH 3RDTD 1H5BC 3VFSB 1L7TL 1WZKA 2F54E 1J10A 1KCUL 3U4AA 4ORGA 2BCKB 1IEHA 4UUJB 4PV8B 4JVWA 1EXUA 4KTDH 5E1AB 5CGYD 5DD0L 1IGTA 1NLBH 1JTOA 3MLVH 4JZJB 3U79A 3UTTB 4XZUB 5EZLA 5HHPB 5JHLH 2AERT 5I1DB 3TBSB 3GKZA 3V0AC 2PCPA 2X9XA 1WF5A 2HTKD 3QRFM 1QSFE 3IB4A 4KK8D 4AIOA 2EEAA 4OFIA 1NAMA 4M43L 2W0KA 3HG1D 3KPNA 1JPGB 4XXDB 2N7BA 1FORH 3ARFB 1C7TA 3EOAA 3K80A 5F1NA 4IMLA 3EBAA 5DJDA 5E8NA 5IG7A 1Z0MA 4PJIA 4MA3B 1JGDB 2ZG3A 3RU8H 1A6UL 1RZKH 5C7XL 3SDXF 3CFKA 3LQMA 4PUBL 3JTTA 1JNJA 4YFLI 1G7MB 1LK3L 2A6KB 3ZTJH 3L6FA 3WHE0 4AT6A 5TE4L 1NEUA 5I1GL 4N5EC 1AKJA 5I71C 1EJOL 5BV7H 3RPKA 3VFPA 4B41A 4HV8B 2C3VA 3QUMA 3SE4C 1CFSA 3CGTA 4U1HA 4ZUVB 2ZP0T 3T1WA 1AD9B 1DVFA 4Z95H 5FHBH 5DVMA 5FFLA 3KS0J 1AXIB 2QBWA 1H3WM 1BFOB 4PJHF 3BIKA 3OAZH 1TIUA 3W9DB 2JCCA 1FYHB 5EA0H 3QO0B 2QSVA 2FX7L 4YFLF 1MCCA 3D3VB 2XZQH 4U2ZA 4RZCA 4GQ9H 5F9WC 2AXHA 1GYAA 5DK3A 1JGLH 3P0VL 1U9KA 2VZ3A 5HSFA 4LVOC 7CGTA 2C3XA 3PWVB 3MTRA 4WHTA 1Q38A 3JWOH 3JV5A 2A74B 5LAXA 1A47A 2VN7A 2EDEA 3E2HB 3QUKA 4JHZA 2VXSL 6FABH 1RUKL 2DLGA 2OTUA 3MNZA 3SKNB 2A1WL 3VFWA 1WBXA 4OZGE 1FV1B 3IFLL 2KPNA 4YHOH 2E27H 3FO1A 3U6RA 1F4AA 3QQ4A 5HHOD 4O9HL 4UB0H 2VLRB 2XRAH 5CBEA 2Z9TA 1MEXH 4Z7VA 4TVPH 5ADOH 1AGEB 1E27A 1CZ8L 1L4IA 1CBVL 5CFHA 2WBJA 4MYWB 5E2TH 4JHBA 3D25A 3SKMA 3F6LA 3PWPB 1WJ3A 2YSSB 5C08B 1C12A 1LEKB 2VXVL 2M1KA 4N5UA 4KK5D 4YC2B 4OD3H 4LAJH 3SJVB 1WWBX 3WDHA 4FOMA 4D3CL 1IM9A 2OP4L 4CVXA 2YZ1A 3WXWH 3EOTH 4XNUL 2X9YA 3DIFA 4P9HC 5FIEA 1AC6A 3S5LG 4M5ZL 4XMPL 4U6YA 5E5MB 1FFOA 1M7DB 1C5DB 3ZE2F 1J0ZA 3W2DH 4FQLL 3VI4F 5IVXF 1AGBB 2VSDA 4XNMB 5TDOA 1UJ3A 4KQ3H 4P5TD 1B0RB 4S1SL 4QHLA 3D5OF 1T03H 3OJMB 4GMTH 5IJVA 1IQDB 5HHXH 5IFAH 4TYUA 1BBDL 3I6GB 2YXMA 2NY1C 4ZS6C 2WZPD 3KYKL 2F5AH 4JEGB 3SKOA 2Q6WB 2MCPH 1SEBA 2ARJA 3ARDC 2OTPA 4NNXB 1JTPA 2BFVH 4LF3B 1U3HC 1HK6A 3NCCB 4PREA 4HIJA 5F9DC 3VGAC 2DWEA 5GGVY 3SGDH 3WLBA 4K2UH 5CD3A 4MA1B 4IIQB 4XPBH 3RZCD 3OR6B 1OW0A 3SKJL 2ITDA 1WT5A 4HC1H 2VXUL 5IB2B 3LDBB 4PGZA 5D5MB 3FO0L 3H9SA 5IFJA 1UXSB 2DF3A 4QTIH 1GPOH 3TVMB 5J3HC 1G7JA 4IOIA 1QP1A 2Z93B 2JF1A 4P48A 1T89A 1PYWB 1RJCA 4GRWB 5I8KL 3WS3B 2WBWB 3BZ4A 1NUDA 1G6RA 4R4ND 4FNLL 4WW2F 4H0HB 4UZGA 5EN2B 4G43B 3FHAA 1FG9C 1S5IL 5JW4N 2VDMH 4S1DD 3QWQB 3VCLA 1ORQA 1S7SB 4YZFF 1RJYA 4P46C 5F1KC 2H1PL 4OB5H 1NGWB 3VGGA 3CFJA 1X5ZA 2VLJB 4XVUC 5GHWL 3UBXB 2QQNL 5KBNC 3BWAA 4HKBB 2VDNH 3C5ZC 1Y0LB 4FA8A 1ZA3B 2NXZB 2RQ8A 2VH5L 4QF1A 2JIXD 3J8F7 2AXFA 2IFFH 3O6FA 2E7HA 4M1DL 5J0BA 1NCWL 4C57C 1VFBA 4U4BA 1CU4L 2AW2A 1T7VA 4Y4KD 1WFOA 1AXSA 2J12B 5C0CA 1F6AB 1I7UB 4WUUB 3QNXB 1CICA 3VRLF 4BH8A 3WUWB 1DEEB 4FG6C 1J1PH 4HJGB 2DQDL 4NWUL 5D1QA 2CDGB 5D7JB 1J12A 4HLJA 4U1LA 3MBEC 2UWEE 5I19H 4LSVH 5DC0A 5C09A 3DSNA 4XP5H 1T20A 4M1CC 1OTSC 3RKPA 3NCYS 4WU5B 4UV7H 2NY4D 2P8PB 5CIPA 43CAB 3U9UA 2HKHH 1H3VA 5FK9B 2HTLD 2IADB 4JM2B 3PQYE 1Q9KA 2O5XH 2FB4H 5E99L 1VFMA 4R4FL 4RBPK 4MA7L 3TJHD 2PUQT 1EO7A 3MJ9L 4BZ1L 1YNTB 1S9XA 2CLZA 2H2PC 1RY7B 4PJ5D 4EN3D 1MCSA 2IBGA 4Y2DD 5HHVL 4NZRH 1N3NA 2KZWA 4MXQC 3MROB 5C0DA 2BSTA 2UVFA 1DQQA 4OM1H 2QTEA 3IDXL 1MRFL 2M26A 4UDUB 5SWZD 5FXCH 3BUYA 4JRWA 2B4CL 1JV5B 2DJ4A 2G2RA 2GSIB 4M1GL 4TRPL 3TO4A 1NC2B 4LCCC 3IVKB 1BJ1H 3BP6B 3G5VA 4NIKB 4KKCC 4JCMA 5JMOC 4X98A 2VDOL 4G8GA 1MCIA 3CVHH 3V0WL 1KPVA 3T1FB 4CU8A 4UOW0 1P5UA 4GRLC 4D0BA 3B9KA 3OHXA 1IL1B 2DI7A 3QNZB 3OGCB 1W0YT 3FCTA 5D2LF 3FOMB 4LLYB 5C6TL 3W5MA 5BO1L 4C83A 3KR3L 2VOTA 3SY0A 2FL5A 1Q72L 4HH9B 1A1MB 5HDLA 3K3QA 4QXTA 4N0FB 5FGBC 2ZWLT 1U8HA 1N2RA 3PNWB 1YMHA 3MGTB 3VFTB 1HH9A 1WCBA 1BJMA 5DJ6B 1I1FB 5C92A 5I1EH 1ZHKA 5I1IH 1JZ7A 1PBYA 4GOSA 3GNML 1KJ3H 2CD0A 3RVVC 3WN5A 4JY5H 3D85B 3S9DB 1KENH 4JKPH 5MENB 3GB7B 4GQPH 4HMDA 1SJHB 2BP3A 4WI8A 1I3GH 4G9DA 4ODVL 5TDPB 3MUGA 3QBTB 5ID0B 4E0RA 2X2YA 2MQ3A 3VGHA 5B8CC 2IJ0C 1IKNC 4B0MM 4GRWH 1SY6H 5D1ZB 3DBXB 1DE4A 3DNKA 3T0EA 2A77L 1K5NA 4L3CB 3S35L 2WMPA 2BVYA 1N26A 4Y4HA 2A83B 3V52H 3I2CL 3JTSA 4J3VA 4YXLH 5CJXA 3TA3C 1OTTD 1QVOB 2RCSL 3RZWA 5I8EB 1QYGL 4KK6C 4R0LB 3GHEH 2XV6B 1PY4A 5BMFL 3FQTA 4TQEL 4ZPVA 4TULH 5GJTH 4PRNB 4P3CL 2CK2A 2X4RB 4TNVK 1H3PL 3O3AB 4KZDL 2GJ6A 3V7AG 1ERNA 5FYKL 2N4IA 3NCEB 3Q6FA 5BXFA 1B4JL 3BKMH 5DRNA 5D1XB 1BECA 5HJ3A 5GS0L 1ZOXA 2J6EH 5FM5O 3X13B 1JI2A 2JELH 3BEWB 3HZMA 3MRLA 5JZ7D 2QQKH 5JW4Q 1AKJD 3SKUD 5DURD 3T4AB 2ZUVA 1TVHB 5F9AC 1HDMB 3MNWB 5GSRA 1JZ6A 1JBJA 3QUYC 3HFMH 1NCTA 4P23D 5TE7L 1RUQH 4OCRL 2XG4A 1U95A 1DVFD 5AZ2H 4YAQA 2A9NH 1HI6B 4FQQB 1V3LA 4QXGH 1NFDF 3NFNA 4ZSOE 4AIZB 3UX9B 1X9QA 5EU6B 1W72B 1XFPA 2R0ZL 5FOBA 2AJ3B 3RWEA 3BQUC 4DKFL 5I74C 2FHCA 1D5ZA 1A5FL 1U8LB 3O4LB 1JPSH 1FRGH 4U6TA 1G0XA 4UOJA 4M9PA 4RIRA 3C60C 4HIEA 4XC1L 3EFDL 1GHFH 3H7LA 2R9HD 3F6IA 1BQUA 2ADIB 1AI1L 1RPQA 3B6SB 4NZDA 4UV4H 4ONGL 2MSPA 5EU7C 4MCZB 1CDBA 3GSRB 1F4YL 5H2BA 4Y19B 1V8HA 3ULVC 5EIIB 4DGIH 4F33A 3BO8A 1EEUA 2R2EA 3OR7A 4FHBD 2CH8A 5FF6A 2JTDA 4ODXA 1NLDH 2B8OT 1B0GA 1HHJA 1KEMH 4LEOB 5I9QC 3FTGA 3PHOA 3ES6B 4I18C 3VFNA 1XF2A 3GIVA 4KY1H 1KB5A 5L6YH 5C9JA 4TVSa 1AY1H 1Z9SA 2WBJD 5DT1L 1YNLL 2YD4A 3SDDC 4X5LA 2CRMA 1S5HA 3KXFE 3KPTA 3QCVL 4G7YL 4X7FC 1DQJB 3GSVA 1OT1A 1J18A 4X9HA 4LPUA 1X4XA 1U8OB 1NFIA 5FYJD 2HT3C 4PTTA 3GSWA 1T1YB 2XFXA 3G6JE 3C9NB 3O6MH 1QLRB 2XN9A 2I9LB 2A9MH 1WLHA 1C1EH 5E9DE 4L4TE 2MMXA 1A3QA 1NJ9A 3KLHC 5CINL 1TQCC 2M2DA 3KPRB 2VISA 1HINH 5JQHC 4NKMB 1MUJB 3LB6C 4UILH 1T5WB 1UCBL 2GSGA 4PGCA 4JVPA 5E5UB 5F88B 4PRDA 3WEXB 1RK1A 4OCWH 4YDLB 1OW0C 4WY7L 2FIRT 4JZOB 4JO3L 5FKAA 1YUHB 3ZDZE 5C0IA 1RIVH 2LTQB 5BS0B 2VIRA 4G6MH 4GKZB 4LVEA 4WJ5A 3MCKA 1YJDC 1ZK9A 1HH6B 2NY3C 5EH1A 3S37H 1R5VA 4LHUB 5HDBF 2QLVB 4O2CA 1CQKA 4HXBL 4OZIF 1A2YB 4AH2B 4HPYL 5CEZD 1YPZA 3H3PL 5JUEH 2NXYC 4RISH 3WFBL 4MQXD 4Z8FH 2Y06L 4BQBA 4X6BB 1SBSL 5ETUB 4DKDC 5T33H 3SDCB 4DAGH 2B1AL 4CMHB 3E6HA 2X4NB 3O0RH 4KKAC 4G8EA 2LU3A 1FG2A 1S7TB 3NTCH 2HT4D 3DHJA 3OKDB 1L0YA 4BA8A 3HE7B 4G6KL 4QLRA 1B6UA 3P30L 1KCVL 3PWUB 4OD1L 1VGEH 3I02A 2IMNA 1W72H 1BREA 3UTSE 1QFUL 1KPUA 3D39D 1BQSA 1IZKA 4GBXB 5D1QC 3C2SA 2YK1L 3QO1B 3UYRH 1CIDA 1KLGB 3ROLA 3X11B 1UT9A 2CLVB 5KS9A 5IGXL 4CVUA 5ICZA 4JKKA 3U36A 1A4KB 3K2UL 2WP3T 1NCBH 5ALCH 1PVHA 5JXED 2HJLA 2XICA 4D0CA 5IW6B 3T65A 1MCRA 4XNXH 1FNHA 4DCQB 4J1UA 2XZZA 1LHZA 4MAYA 1M05B 4EVNB 1PG7L 3DX8A 2M8XA 4IMKA 3KPQB 1MHEB 4NRZA 5C0BA 5T1LB 4F15C 1KTLA 3I85A 1YMME 4ACPA 4MD4B 3BZEA 4WFFE 1UB6B 5IUSA 4UT6H 1WIOA 2FD6H 4POUB 1YEKH 3GBLA 4GUPB 3RNKA 4MNQD 1QLEH 4IOSD 4JB9L 4PJIF 3BPLC 1D5IL 2X40A 3QG6A 3ALWA 5CJOL 2ESVA 2VLRE 1I9RL 3MREA 2GEEA 15C8H 2Q76A 5GGSB 4U1NA 4Y1AD 2I9TB 2QV2A 4HCRA 3GMPB 4IM8A 4OZHE 2UYLA 3HR5B 3C8KB 1AHWC 3D18A 3MJ6A 4QCIA 3F5WB 4JQVA 5SWSA 5I17A 3RY5A 2YUXA 1BEYL 1X5LA 8FABB 2WIMA 5BZDB 5I18H 4WGWB 2CGRL 4WI3A 2QKIB 5IB5A 3EO9H 2FEEL 2VLLA 2NY0B 3FB7B 1QZ1A 2I5YL 4XNYH 5MP6H 1KEGL 4CU6A 3EDDA 3MC0A 4JFZH 4X7DC 2JCCF 3TO2A 5HPOA 1MFNA 3HZYB 4KRPC 2X5PA 4YHML 5EPMB 4AK1A 5T1DH 2LU7A 3TESA 2R56L 1TQBC 1YY8A 1O7VA 3ZKND 3B9KD 4K8RH 5MERA 4LBEB 2O5ZH 1KIPB 5DEGA 4PLNC 4K9EL 3HR6A 3SHSA 4OGAD 1KXVC 1VEPA 1DANT 5D9SA 1A9BB 1JPTL 3UCRA 1EEZA 4ZS7L 2X4TA 2XTLA 2IAND 5KSVA 2XKNB 1AQDA 3VXSB 4S1QL 4NQXA 4TPRL 4R96B 4FQCL 1RZFH 1DN0A 3MLZL 4JKWA 2Q7NA 1SBBA 2ADFL 1CLZL 4GH7B 1ZHBA 1MCWW 4PPTA 2ZSWB 1UEMA 3QDJB 3DRTA 4QHMA 4IDLA 4X6CB 4Z7VF 1XIWD 3DX9B 2CDEA 5DJ0A 5DD1H 1T83C 2XQYG 2C3GA 3DYPA 2BCKA 4UUJA 4PV8A 5D5ME 3UROR 3ULVF 1QRNE 1N0XH 4JZJA 3UTTA 4XZUA 1SJVA 5HHPA 4FABL 8CGTA 4LSPH 1OF2B 5CSGA 4HXAL 3WSQH 5M94B 2DKMA 3WJLC 4Y4HD 3TBSA 1EBAA 2A0LD 3IKKA 1QFHA 3GK8H 4IJ3C 4KGLA 1R3LB 1ZTXL 4W4OC 1J11A 5TGBB 3IGAB 4Z6AT 1CD9B 3HUJB 2G5BB 4M62L 1JPGA 4XXDA 5EZIH 2V2XB 3ARFA 1DQTA 1P4LB 2DTSA 3IDNB 1X5HA 4F9PA 3QDAA 3P11L 2APXA 4BQ9A 1IJ9A 2AV1B 2DMBA 1JGDA 4MA3A 4LEXH 1SJEB 4HC1A 4E41E 2OR7A 2AJUL 4YHZH 1BJ8A 1B90A 2Q86A 1G7MA 2PXYC 2A6KA 5T1KD 4I0PD 1BF2A 1N5AB 1SEQH 2HA1A 1P84J 2FR4B 1MNUL 3O4OC 5LG1A 4HV8A 1ZEAH 4CN1A 3NIGE 1BZQK 3H3BC 1OLLA 3RIAK 5HHMD 1GXEA 3AY4C 4ZUVA 1R5IB 3OAZK 1AD9A 4JHWL 1W0WB 1YC7A 5ISZD 3QUZB 5IQ9B 3FO2B 3MLRH 3L3DB 2DLEA 1TJGH 1BFOA 4X7SL 2NY2C 3W9DA 2W07A 1AH1A 1KCLA 1AO7B 3GMNB 3QO0A 5CUSH 3G08B 3D3VA 5CILL 1M7XA 4BZ2L 5CZXD 5F8QC 5DLML 3VXNA 1OAUL 4IHOA 5JOFA 2AEPH 4XMKL 5IWLC 3PWVA 4Q2ZB 5D7IB 2VWEE 2A74A 2EXYD 4XWOC 4ZG1A 1JUFA 3HNTH 3F58H 3ZMRA 4U7MA 5FCUL 4M48H 1IQWH 4KROC 3SKNA 1VEMA 4HWEL 5K9JL 3WFDH 1FV1A 4PJXE 5GGTL 3BGAA 1CK0H 4JM4H 3UDWA 5GJSH 4LSRH 2VZ1A 2FX8H 4X4MA 2VLRA 3CMOL 4LLWB 1ZANL 4FTVB 3W82A 1AGEA 1NGQH 1QA9B 4OQTL 3EUUA 3RVWD 1ZA6B 4R4BB 3W0WB 2APBA 5D2NB 1EHLL 1LMKA 3PWPA 5C08A 4TNVF 1LEKA 1DQMH 3SJVA 3OAUH 3L7EB 1MQ8A 1YNKL 4OIAA 5L2KB 3IAGC 2XWTB 2IQ9H 4U6HA 2EH7H 5J06A 5E5MA 1LE5B 3RFZC 1M7DA 1C5DA 3QI9B 3FMGH 3HMWH 4OGYL 4Q6IC 3ZTNH 5DUML 5T3XH 1AGBA 3BJ91 4G6JL 4X8XA 4XNMA 2DQGL 4GRMB 4BUHA 1B0RA 1XR8B 2V17H 5E8EA 4G7VH 1OTUD 1BFVL 1BF8A 2OCFD 2VNCA 3FZUC 1IQDA 4UMGA 4DW2L 3SDAB 1BD2D 3I6GA 4OCSL 2FSEB 3DXAA 1FNFA 1JHKH 5EULV 1NPUA 3OSKA 1ZLSH 3LZFH 1HYRC 1LQSR 2AGJL 5IK3B 4G6FD 3C6LB 4EDWL 5T3ZE 5L0QC 2Q6WA 3VRIB 3QHFH 4LQFH 4OSUH 3VA2C 1QSED 1H15B 5EU3B 5CS7A 4H25B 4NNXA 1PKQA 1D9KC 4XI5D 4LF3A 2A2QT 3QWRA 1KLUB 3DSFL 1GVIA 4CMMB 4Q9QH 3QXAB 4IIQA 1YEGH 5DYOB 4ZUWB 3HC4L 2C5DC 4QY8B 3VXPB 1DFBL 3WS6C 3HZKB 1A7OH 5IB2A 1N7ML 3BKJL 2XOTA 3AB0C 3BP7B 4X9GA 4LVHB 4PRPD 4M61B 1UXSA 3TVMA 5IR1B 2HT2D 1WTGT 3QCTH 3L3JB 4MA8L 2Z93A 3MBXL 4LPYA 3AS0A 4XCCL 1PYWA 3ULSB 1SY6A 3WS3A 4PY7B 5EN2A 4G43A 2G9HB 1UQSB 3EO1B 1S7SA 4AEFA 1CT8B 1RZKC 3F7VB 2ICEB 1IGCL 4IRSB 1J9CT 5EZOH 1NGWA 5DUPH 3UZQA 3RKDD 4GG6A 3TT1H 5GIRB 2VLJA 3MLWL 2DYPB 1ED3B 1H3GA 3UBXA 4KDTA 4IMKC 4CU7A 4M6MH 4HKBA 2X1PA 1Y0LA 4AEIH 1ZA3A 3ORJA 3STBA 2N1KA 4QHKJ 3U46B 4BQ8A 4AG4H 5EU6E 5IBTL 4BM7A 2P5WB 2NY6D 4C56B 2H8PB 4P4KC 1ZVHA 2HP4A 4LSQL 5ELIA 4X99B 4OLUH 2OR9L 3VGEA 2IMMA 5CLTA 4CBPA 1PAMA 1P1ZA 4DK6A 1F6AA 1I7UA 4WUUA 1NCNA 2YPVH 2EC9T 3WUWA 1DEEA 1UWEH 4ZFGH 1NCAL 5EOCJ 3BZFB 2IG2L 2A6DB 3TFKD 4MAYD 2CDGA 2CUIA 4FFWD 3RQ3A 2J6EA 5D7JA 3EJYC 4LP5A 4OZ4A 2QSQA 1FC2D 3FHQA 3MRMB 3MZGB 5D71H 3HCVB 4HAFA 2EKSA 5IBLC 1CGWA 2P1YA 2GFBB 2AJYH 4Y19E 4DN3H 1HYSD 1F8TH 3ETBF 5GRJH 1MCHA 2P8PA 43CAA 3UYPA 2IADA 4JM2A 4N1CA 1S9VB 2YD5A 1S3KH 1EGJL 1FAIH 2VLKB 3MRGA 4QHKI 2ESVD 1YNTA 3QIBD 2EE3A 1FQ9C 3L3HB 3F7RA 4D8PB 3G5XB 5K33A 3MROA 3B2UD 3IU4H 4NKIL 4UDUA 3REWB 4K3EL 2E3VA 1HQ4B 1BM3H 2IC2A 1Q1JL 5JIPA 3AUVA 4ZXBB 5ICYB 2GSIA 4H20H 2NY7L 4PJAB 1NC2A 3IFPB 4FQ1L 3BYYA 3BP6A 2DTMH 2VB5A 3HE6C 4UTAL 3V6OA 2ZNWA 3SBWC 3T1FA 1VFOA 2BNQE 3EOYG 4TSCL 3QWOB 1EUTA 4K55A 1IL1A 2D9CA 5I1AB 3OGCA 4NGHH 3QFJD 2LVCA 3FOMA 4LLYA 1LE9B 4Q9RH 1KC5H 2FATH 4HH9A 1A1MA 2VR5A 2EDQA 1V5JA 4N0FA 4TVPD 4K71B 3MGTA 3IXTB 2UWEF 1HKLH 5F7EL 5D70H 3VFTA 3OKLB 3V6ZB 1T7XA 5BS0E 5DJ6A 5IF0B 1I1FA 5B39B 2BNRB 1ACZA 3QXUA 1P53A 3BIAX 3U7WH 1TTGA 2OXHA 2RGSA 1CDGA 1OSPH 3JVGA 2W9LA 2HAZA 2UV3A 4F9LA 1NUFA 4RAUB 5MENA 4WTZG 1YA5A 1T1WB 3T0DA 3GB7A 1SJHA 5E6IC 4Z77B 2EDWA 3F12B 4EQ3A 2PYEB 1A14H 5TDPA 4F57L 4S1RH 1E4XL 2J88H 1JGVL 1IGMH 4OFDA 5D1ZA 3DBXA 5KW9L 2R2BB 1T0MB 1X5FA 3ARFC 2E7MA 4AMKL 4ZFOA 3KWWB 3MLTA 3E3QE 4MAUL 3QXWA 5IJKC 4L3CA 4N0UE 3ARVA 2A83A 3CX2A 1NEZA 4ISVB 3QIWD 3PDGA 2VZSA 4LCWB 3K0WA 3QCUL 4AL8H 5ILTL 2VXTH 1QVOA 1IGFH 5DRXB 5I8EA 1OQOA 3VDAA 3AREC 4R0LA 2Z8WC 3BKYL 5BW7C 1GC1L 5BVJB 3S97C 5KVGL 4EI6B 4KHXL 1CE1L 1X5KA 5AYUH 2X4RA 4N8CH 4O5LL 4RGMB 3O3AA 4NFCA 2YPLB 2XTJE 5DJXA 4P9HL 2KL6A 4ALAL 3DI2B 1X5GA 1DSFL 1P5VA 5FUOL 4G9FB 5D1XA 5A3ID 2WK2A 3X13A 2AJSL 3BEWA 1DP0A 5DQDH 1BLNB 2CUHA 1F00I 1H3TA 3LHPH 3GMLB 3MOBL 1CDHA 2X4UB 5ITBH 3L5XH 3T4AA 1C16B 5L88H 1TVHA 1NBYB 1U8MB 1HDMA 1RUPL 3MNWA 3VXRE 4FQJH 3HC0B 4FFZH 3VXMB 3WDJA 1PLGH 1YPZF 3E2HC 1JYWA 1HI6A 4FQQA 4AIZA 3STLB 2H32A 1E6OL 5EU6A 2ENYA 1FVCB 1W72A 4EXKA 3NCBB 1J5OL 2AJ3A 4HUNB 1U8LA 3O4LA 2O5YH 4XBGB 5H37H 1OARH 5JOPD 3RX8A 4KRLB 3TCLB 4D9QD 4F58L 2YWYA 3RAJL 1F4WL 3QR2A 3TZVA 4S0SD 5E94B 3B6SA 1BMGA 4PJ8B 2Z92B 4MCZA 5DWUL 1OD9A 3VW3H 3GZKA 3GSRA 4Y19A 2W65B 2XYCA 3ZT7A 5EIIA 4TN9A 4TUJA 1ZVYA 1YEDB 2RFXB 5A16A 2EXWD 2YBRB 3FQUB 5C0JB 4JREC 5DD5H 1T6WA 5C0NC 1JHLH 3CXHJ 4GKNB 5KS9F 4LEOA 3ULUD 5GGRA 2A73B 3ES6A 2WW8A 3JWDH 5B3JE 2XZAL 1MFBL 2FYYB 4K94H 4NKDA 3PL6B 4PB9L 3HI1B 4QRRB 4X4XB 1DBKL 3OXRB 3H42L 2RR3A 3MJGX 2QEJA 3PWPD 5C08D 4N0CC 1E4JA 2BVTA 3ZT6A 5J13B 1DQJA 4X83A 4MNHB 3ARDD 1U8OA 1T1YA 1P4BL 2CSPA 2QSCH 3C9NA 1V3KA 1QLRA 1WBYB 4LPTA 4UQ2B 1U3HD 5HGAB 4L8SC 3LQAL 1UYWH 2I9LA 1QOKA 1OD7A 1RZ7L 1P7QB 1ODAA 2AJVH 3WV0A 3ZO0A 4XP1L 1MY7A 3RIAF 3KPRA 5I1CL 1MUJA 1MVUB 4WV1B 3GI9L 1T5WA 3ARPA 2ERJB 1S7VB 5FYLH 4X6CE 2NCMA 4IIQC 3SPVB 5F88A 4FQIH 3WEXA 5BCAA 5DR5H 3FRUB 1G9NH 4JFEE 2VZVA 1ROWA 4XX1G 3BAEL 4F7PA 3DXAD 1YUHA 3BN9D 5D72H 3VH8B 3V5KB 1B9ZA 3DROA 4GKZA 4D9RE 2GIYA 3LKNB 5K59E 4OAWB 1HH6A 4V2BA 1GGIL 2D03L 1P7HL 4LHUA 1I1CA 1AC0A 4JFPB 4TUOB 1A2YA 4AH2A 3C5ZD 4JAMB 3HUJE 1NKOA 1JPST 4X6BA 5ETUA 3SDCA 4EQ2A 4XWGH 2X4NA 4QO1A 3TVMD 5HVFB 1TTUA 1S7TA 2NXZC 3GGWA 1OSZB 1RVFH 5ADPL 1TCRB 3OKDA 2J8UB 4J7RA 3G6JF 3HE7A 1OAKH 2X1OA 1KELH 2APTA 2LFGA 1MCLA 3PWUA 3U2SB 3NCJH 3RBGA 4FXGB 4FFVC 4ZOCA 5GGRY 4HS6B 4M6OH 4M1CD 2MTPA 1MFCL 4GBXA 1CXFA 4D9LH 2DM2A 2P5EB 2XI9A 1IC4L 3QO1A 5GGUB 1U3JA 4NM8L 1KLGA 2EIBA 1FE8H 3X11A 4MDIB 3CLEL 3K46A 1AO7E 4G6AC 4YEFA 3MV9B 5E2JA 3EJZD 3ZKQD 1FDLL 5KN5B 2UY6A 2W9EH 2H2PD 3MXWH 3QZWB 4HF5H 4YUEL 4BFGA 5IW6A 4DCQA 5KVFH 5EO9B 3GFUA 4EVNA 1M05A 2VWEC 3TH2T 5FEBA 1MHEA 4XT1C 2VDKH 4I8DA 5T1LA 5KSBB 4FP8L 3P40A 4MD4A 1MJ7L 1NAML 4I2XE 4JFHE 1UB6A 4XBEL 3C09B 4XAKD 3V7MA 2ICWB 3E8UL 2GHWB 4GUPA 4F37K 1F11B 4GSDL 2HRLA 2APWA 1IEBB 2YKLL 2P47B 4IDJH 2W9DL 4YX2L 3O3DB 1AFVL 2ZOLB 2VITB 5J6GB 2MKLC 5GGSA 1ZLWH 2DS4A 2I9TA 1S9YB 3V7AE 4TSBL 3GMPA 3JWNC 5D2NE 4YXKH 3HR5A 4YNYA 4JGJA 3GUTB 3F5WA 3QHZH 4H8WH 8FABA 2HH0L 5BZDA 3U7AA 1LDSA 2QKIA 1RZJH 3AROA 3R0NA 3FB7A 4X6DB 5HYQB 1XGPB 5K93A 4HUXB 3KPOB 1W2KT 1Q8MA 3D9AH 5AD0B 2HKFL 2Y1VA 3WE6B 1CGXA 3QFDB 5H94B 3VD3A 1ZT4B 4LBEA 1KIPA 3V79C 1P84K 5C2BL 3ARQA 1OVZA 4XPTL 4Q58C 2R29H 2AP2A 3DGGB 3KPSB 3IDMA 2NY5H 4NZTL 1A9BA 3QXTA 2OK0H 3V2AR 4BQCA 2L7JA 4JG0L 1CGUA 2XKNA 3VXSA 5GPRA 4F3FA 4R7NB 4YO0B 5GRXG 1NL0H 2VDPH 3GSNB 4KK6D 4R96A 1MJ8L 1I85C 2OL3B 1BGXL 1R3KB 2HG5B 2YEZB 1V7NH 2D7OA 1NSNL 3ZE0E 3CDGB 4Q0XH 3DX6B 1IGIL 2ZSWA 1JF1A 3QDJA 3MGOB 1OT2A 1JNNH 1X6NA 2VL4A 1DCLA 3DX9A 4K3JH 4X6CA 3DVNA 4JRXB 5EDXA 5I16B 4URTB 3L3OB 3ZKXB 4Q97A 3LKSB 1BVZA 4KH2A 1J1XL 3MA9L 2PO6C 5D1ZD 3ULVL 5ACMA 1NGPH 1CXHA 1G0DA 4GXVL 1OF2A 4PJ9C 4ZNCD 2YD7A 1CFNA 5FYKE 2BVOB 4JFFB 1H3UA 1HIML 4OGXL 5L8KB 1F6LL 1INDH 5D7SL 1FGNL 5D1XC 2WUBH 3PWLB 1R24B 1B6DA 3QUYD 4PYHA 5FDWB 4NRXB 4Y16D 5TGBA 3IGAA 5DZNA 5E4EB 1QBML 3HUJA 2G5BA 2V2XA 1UADC 1P4LA 3IDNA 4L5FH 5FO9B 4ETYA 2DQHL 3VXQB 4HQQL 1JNLL 2YUZA 1KTRL 4R90L 3VRJB 1KCRH 1SJEA 1U0QA 1YEEL 1KPRB 3HN3A 2GK2A 4NQDB 2F8XC 2PW2B 1O7SA 2P5WE 2BY2A 2FNBA 1A4JB 1FYTD 3K8KA 2FR4A 2APVA 5D6DA 4NJAL 1CL7I 3ZHDA 2VL5B 4TOYL 4Z7UB 4H26B 3S34L 4MCYB 5HD8C 1IILE 1UH3A 1R5IA 2W0PA 2R8SL 1W0WA 2DQFB 1YYML 2GAZB 5C07B 3FO2A 4NO3B 1KXTB 3L3DA 3HG1B 1U8PB 2VERN 3KGRA 1AO7A 3GMNA 4LLUB 5D5MF 4EUPB 1JWUA 5FKPB 3WMSA 1T7WA 2QADD 2AVGA 2I25N 5E4IA 4CVZB 2VTFA 2YR3A 4XB7A 1B88A 3S37X 4GRWF 4LRNH 1G1YA 1G6RL 4Q2ZA 5D7IA 3HZVB 3S8WA 2XWJB 2NX5E 4X4ZA 4QGTA 2V5TA 1A7NH 5IQ7L 3QDME 5SX4H 4ZDHB 1TFHA 2IGFH 3DLQR 5KOVC 2PR4H 4HHAB 1AXTH 3TZVD 5FHAL 3LCYA 1IT9L 3IDIB 4EOWH 2BY3A 2HT3D 1WISA 2J5LC 1VPOH 2FBJL 4U1MB 1GL4B 3OKNB 4LU5L 4GLRH 1I8LA 3QEQD 3TN0C 3R0MA 4Y4FB 2Y5TB 1PFCA 4LPVA 2I60H 3ALPA 1MLCB 1UM4H 4LLWA 4FTVA 1QA9A 1ZA6A 4ODHL 3W0WA 1ZT1B 2R4RL 3LEXB 4AYFA 3JXAA 4OV5B 1NUGA 3X3FH 4JFDD 1LO4H 3INUH 5TF1L 3UJTH 1PEWA 4M7KH 2F54D 2R4SH 4NP4L 5ICXA 1DBBL 1GGBH 2ATKB 2FJFB 1QFOA 3VFUB 1T5XB 5GSVB 3MACH 2X4OB 3WKML 3GBNL 3SCMC 3L7EA 5B38B 5L2KA 3IDJB 2MJWA 2XWTA 2OL3H 2ICWJ 3C6SB 4PBWD 4G5ZH 4K7PY 4FQHB 1LE5A 3TJEH 3MJ7B 3QI9A 4QRUB 3ZLQC 1FZMB 2DQEH 2P24B 3W39B 1D6VH 5D7LE 4ZOBA 5KANG 4GRMA 2HJFB 5HHOB 4Y5YB 3IDYB 1XR8A 1QSFD 2NXYD 2MOVA 4JM2F 3K81A 1MCWM 1LO2H 5JHDE 3S4SG 3KPRD 3SDAA 4W70A 2FSEA 4DQOH 3PDDA 3UPRA 1YN6B 3WL9B 3PWJB 1OP5H 1MVFA 5IK3A 5DMKB 3C6LA 4K8RD 3WKNA 1MCJA 3E3QC 5CWSB 3SDCC 5JR1H 5FYLE 3VRIA 3F7PC 4O02L 4W68A 1YEHH 1UA6H 4RMUA 5EU3A 4H25A 3MO1A 5EBMB 5AG9A 3CUPB 1KLUA 3ESUF 4ODWB 3QXAA 5J12C 3VJ6B 1LWRA 5DYOA 4ZUWA 4QY8A 5GZNC 5JW3L 4LSSL 5LGHL 3VXPA 1WTLA 1URLA 3GSOB 3HZKA 4NPYA 5GRVK 1EEQA 3BP7A 4M61A 4GBXC 4NT6B 3SGKA 5JW4M 3MUJA 3L3JA 1CD8A 4KVCH 4DGVL 2XTJC 3P73B 3O8XC 5JMRA 1QFWL 1I3RB 1FO0B 1BOGB 1FJ1B 2WANA 3TT3H 3NA4A 5HYSG 2G9HA 5DHYB 2Y36H 4PJGB 3HE7D 1UQSA 1WGOA 3C2AH 3EO1A 1CT8A 1T2QH 3F7VA 2ICEA 4IRSA 4UIKL 1RIHL 4GKSB 2H26B 3JV6A 2E7LC 2JJWA 5GIRA 4EUPH 1ED3A 3RZCB 1MCQA 4XVJL 1A3LH 5DGQA 1H0DB 1ZWIB 3U46A 2OX5A 4C56A 2F19L 4U6XB 2CMRL 4X99A 3RP1A 4M7LH 1UACL 2EC8A 2LAGB 5IMOB 1KCKA 3OMZA 3QIUC 2AJZB 2X42A 1LEGB 3S36L 1XGRB 3KLSA 2A6DA 3MRDB 4DVRL 4YHLL 1C5CH 2A6IB 2NY7H 2P46B 1SM3L 3HCVA 1QFWM 3NH7L 4NDMA 5T1LD 1QPPA 2HVKB 4PLJC 1E4KA 1HNFA 2D4FA 5E8DL 4KUCF 3ZDXE 5I8OL 3CLFH 4Z0XB 4LSTH 2AS5M 5INCB 4P2CG 3UTQB 2B20A 2E9BA 3QEHB 3X3GH 2JIXB 4NCDA 4DVBB 1S9VA 4WTWA 3T0XA 4KPHL 2VLKA 3QG7H 3SDYL 3FAWA 4Y4KB 3RNQB 4M8VA 3L3HA 4D8PA 3VGDA 1VFAB 4MXWL 1E0OB 3G5XA 4DOHE 5I66B 5HYJA 1RULL 2AV7B 4NN5B 1HSBB 2EECA 3REWA 2EDKA 5L7XL 1HQ4A 4NJ9L 2H3NB 1UVQB 2R0WH 4ZXBA 5ICYA 3U48A 5JA9A 1XGYH 2BJMH 4WFEE 4KI5D 2VABA 4PJAA 3BPNB 4AY0A 3IFPA 1PD6A 4LOUC 3ECBB 4MNGB 3BZDA 1QR1B 2QQLH 5EU5B 1MHPL 1P4IL 3GMQB 4J6RH 2NY0D 2X4SB 5F6IC 4HGKC 2NY4B 2UZIH 5DZLA 1PJ9A 3QWOA 2ZUYA 3FFCE 1NCCL 4KJQC 4QRQB 3QH3B 1JRHL 4LCUB 3GKWH 5I1AA 4BJLA 7FABL 5EWIL 1LE9A 1IAIL 3CX5J 1VGKB 4PJ5B 3TF7C 4JN1L 4EN3B 5IVZB 2FEDC 3KPMB 4Y2DB 3SE9L 3IXTA 3PIQB 3OKLA 4U33A 5FB8B 3V6ZA 3O2DL 5IF0A 2HFTA 5B39A 2BNRA 2VZTA 5DQJB 5FDYA 2F8OA 1I3UA 4KVNH 3VXSD 3MLUH 4U6VL 4RAUA 3P0YH 4DTGL 5I75C 2ZPKL 1T1WA 4V1DE 2C26A 2JJVA 3QP3A 3RY6C 3F12A 4Z77A 2WSKA 2PYEA 3V4PL 3QDJD 1FIGL 1KB5L 1LP9A 5T3XD 4Q74A 4ZD3H 1FO0H 5JQ6H 2R2BA 1T0MA 3ARBC 1MJUL 3I6KB 3S98A 2MQCA 3KWWA 5GS1B 4F37F 2PXYD 2VQTA 4OI9A 1IC1A 4U31A 3WUZA 1MREH 2YZ8A 3U0WH 2F74B 4M6AA 4LCWA 1ZV5A 4P59H 1IAIM 1A14L 2J8UE 5I8CB 4PJ7A 1MFEH 3MODH 1E6JL 5DRXA 4HUWB 1IEAB 4NN7C 4I5BB 3CXHK 4G8FB 5BVJA 5D6DC 3PV6B 3MV7A 3ARSA 5DK0B 3VG0L 4EI6A 4XNZB 4YHKL 2NY2D 2R0KH 2WUCH 1F6FB 1AGFA 2Z91B 4R26H 1HQRB 5EU4B 3BD5A 3HNSL 5EOQL 2RB8A 3QUZC 2YPLA 3T09A 1G7LA 3CDCA 2YOCA 3BKCH 4QXUH 1PW3A 2HN7B 5TQ0H 4G9FA 1EXUB 4M02A 4N90D 3RWCA 4I3SL 4UIMA 5TF0A 5KJRH 1BLNA 2NTFB 1HZHL 2AK4D 3H8NA 1C16A 5JORB 4X7CC 1NBYA 4KROD 4R2GB 3A6BL 1AJ7L 3HC0A 1Q0XL 4QEGA 3VXMA 3N0PB 2AKRB 2F58H 3TWCL 1JGUH 3STLA 1L7IL 3OB0H 3NAAL 1FVCA 3VMNA 2B4CC 1GOHA 1I8LC 1NANH 5DVOA 1KFAL 4ODBD 4XBGA 4XVTH 5FAAA 4Z0BL 3P77B 1FH5H 4PB9H 2Q7YB 4WHYG 5IESH 5DD3H 3PG2A 4I9WD 4MVBD 3TCLA 3B83A 4KTDL 1NLBL 3MLVL 2B2XH 4U0QB 5SWQB 5JHLL 5E94A 4KFZC 1MH5B 5D2NC 4PJ8A 5DURB 2Z92A 3QDGE 5HGBA 4JPKH 2W65A 4P23B 1BWWA 4U1HB 1YEDA 4RA3A 3T0VA 2RFXA 3MFGB 1MRDH 3RVUD 5K9QG 4I1NB 5H8DA 2YBRA 3FQUA 4JO1H 4P0DA 3H2WA 4GKNA 1EZVY 4RAVA 2P49B 3BIKB 1KULA 1FORL 3VI4E 4HK0B 3C8HA 4L3EB 2A73A 5C3LD 1BQLH 4U05A 3FZUD 1IAOA 4FTVD 4OQ1A 1RFDH 4JPVH 1EH9A 1CDIA 4LSUH 3RU8L 1A3RH 1RZKL 3PL6A 3W0WD 3HI1A 3B3IB 4QRRA 4X4XA 3PP4H 1D7FA 4YXHH 3OF6A 3UTPE 3WNMA 5F71A 1DLHA 2H6PB 2IF7A 4ELMB 4FQPA 2P8MA 4MNHA 5BV7L 1U41A 2YA0A 1HXYB 3QUKB 2EICA 4EI5C 1J0JA 1EFQA 2V6HA 1WBYA 4UQ2A 3BE1H 4QGYA 2RAMA 4NQCA 1IFHH 3QI9D 4Z95L 5FHBL 2BSSB 1P7QA 1CS6A 2GT9B 3O41B 4JG1H 1MI5E 3QQ4B 4OLVH 2GI7A 3FO9B 1MVUA 2IAMB 3LOWA 4WV1A 4JDZB 5EA0L 3OXSB 1S7VA 3SPVA 3VXUB 5J57B 1E27B 4KRNA 1JP5A 2G75B 2XZQL 3QYCA 4JQIH 4GQ9L 2WBJB 3FRUA 1YQ2A 1OY3B 4AQOA 2DDQH 1JGLL 1OAYH 4JJ5B 2XA8H 3HRZB 3VH8A 4HPOH 3V5KA 3CDFA 4POZD 1C12B 3JWOL 4RMSA 3LKNA 3C6LD 4OAWA 4CVXB 2DOCA 3KJ4B 1I8KA 5GRWA 2IALB 3QUXD 6FABL 2YD1A 5D93C 4JFPA 3LS5H 4TUOA 4PP1C 5GS0C 4WI5A 4X6FA 5B3JF 5IV2B 4YHOL 2E27L 1OLZA 4YZFE 4JAMA 5JIIA 4U1GC 4FRWA 1FBIH 4UB0L 3RGVB 5AYQA 2XRAL 1MEXL 5FA4B 3Q3GA 1X5JA 4TVPL 5ADOL 1N0LA 1KG0B 4HS8H 1YEIH 3EO0B 3HB3C 5E2TL 4FMKA 2Z8RA 1OSZA 1TCRA 2L4OA 2RJMA 3WYRA 2J8UA 2YRPA 1UG9A 3O11B 3OKMB 4OD3L 3ZTJG 1L6XA 2FRGP 3EJYD 2MNUA 2FH8A 1KN2H 3ARTA 3WXWL 3U2SA 3EOTL 3H9HB 4OF0A 4HMCA 43C9B 4FXGA 4OF3A 1N6VA 5IBLD 3GRWA 4IRSD 3L5HA 4HIJB 4HS6A 3IRZA 3W2DL 3O3EB 3KJ6H 4BFBD 2FBOJ 3B9DA 2P5EA 4X6CF 5GGUA 3HG1E 4KQ3L 5KSAC 4YX2H 4MDIA 1T03L 3S4SB 5CHNB 2BVEA 4GMTL 3VD5A 3QDHA 3MV9A 5KN5A 3EDJA 3QZWA 1HWGB 5HHXL 5IFAL 5CKGA 5K59F 3KDMB 4Y5XB 1ZT7B 2YC1B 5EO9A 3QUMH 3TNMB 5ANMB 3OAYH 4NFBA 3PGDA 4H1LG 1A7BA 2F5AL 3GJFB 5TH2B 2HMIC 4N9GB 1M1SA 3H7BB 4ZO6A 5TPWH 2MCPL 3KXFD 5KSBA 3FAXA 3LQZB 3BRGC 2APFA 4X7TB 3JUZA 1A1OB 2WLZA 2BFVL 3HUJF 3D39B 2ICWA 5GGVH 2ZCHH 4K2UL 1R6VA 3RWJB 1F11A 4GO6B 4XPBL 4P2OD 5E9DD 4NOBA 1IEBA 1A7QH 1ZLWK 4PJEA 4HC1L 3O2WH 2EDJA 5D8JH 1CFTA 1CLYH 1NDGB 2I26N 4HIIB 2VLKD 4L9LC 4KJYB 4QTIL 4F8QA 1GPOL 1S9YA 1EIBA 2ZUQB 3FQXB 5MI0B 4JANB 5HYJD 2OLDA 3GUTA 4BH8B 1HHKB 5HYSB 4AJ0A 1F5WA 1DQDH 2LQRA 1AIFB 2EO9A 2VDML 4ZXBD 2YN5A 1R5WB 1KNOB 4X6DA 4OF6A 3WLWD 2GQHA 1XGPA 2ZCKH 1U92A 3KPOA 4HUXA 4Q9CA 4OB5L 4HGWB 1T20B 4MNQB 3QB7C 5AD0A 4JZNB 3H9ZA 3WE6A 2VMFA 5E6ID 3U9UB 3QFDA 4OFVA 4BYHA 2VDNL 4CRPA 5H94A 1ZT4A 1QHPA 1XEDA 2IFFL 1N4XH 4Y1AB 3VFGH 5D7IF 3CXDH 1F42A 1EAPB 3DGGA 3HRPA 3KPSA 5FYJH 3SGJA 3UAJD 4Y2OA 1XF4B 2VDLH 4EKXA 5JIKA 1J1PL 1A6VH 2X9WA 4OCXH 3BW9B 4NO0D 5DJAB 4R7NA 2BDNH 4YO0A 1IGYB 3GSNA 3ARED 2BNRD 1N5YH 2CIKB 2OL3A 1R3KA 4BFEA 5I19L 4LIQH 3EZJB 2HG5A 2YEZA 4LSVL 4YGAB 4X98B 4XP5L 2GJJA 3CDGA 3CFBB 2C7UB 3MGOA 3NN8B 4PJFB 1RMFH 4UV7L 1OGTB 4JRXA 2HKHL 3RJQB 5I16A 3L3OA 1RJZB 1U8NB 4IRJC 3U82B 2O5XL 3EYVB 2FB4L 1NBVH 3MV8D 1A6ZB 2Q1EA 2DIJA 1IC5H 3O3BB 4NWTH 4NZRL 5A2KH 4OM1L 1KOAA 2BVOA 2IANB 4B53A 4JFFA 4LCWD 2EIEA 2J8HA 2VQ1B 5CEZH 1R24A 1XMWA 5FDWA 1S9WB 3I9GH 4NRXA 4WEBH 3RIFK 1ACYH 4KKLD 3MOQA 1I1YB 3MV7D 1XIWB 5J11B 3NZHH 5FO9A 1EHNA 5FUZH 3VXQA 1PX4A 4DUWA 3VRJA 4UI2A 4LVNC 4HUMB 1Q9OB 4NQDA 4RRPA 4LARH 2PW2A 1TJIH 2K7PA 1HOCB 2X4QB 1I8MB 6CGTA 4YK4B 5FO8B 1A4JA 3GJFH 5TFSH 1D3CA 2FGWH 3DMMC 1CG9B 3R1GH 4XX1E 3WNPA 3TYFB 5SX5H 3PXJA 3W9EB 2VL5A 4Z7UA 3K4AA 1G9MH 1CLOH 3BIBX 1T0PB 4H26A 4MCYA 5I1EL 5I1IL 3RWDB 4BELD 3LSOB 4PJDE 2DQFA 1NMCC 3FB5B 1T66C 2GAZA 5DMJB 3DYOA 5C07A 1PSKH 3P4OB 1ITBB 2A38A 4NO3A 4XP6H 3HG1A 1F02I 1KJ3L 1U8PA 4PJ8C 4JY5L 4ZPVB 1KENL 5C0ND 4FZ8H 4JKPL 4EUPA 4PJCB 1J8HE 3GDBA 5FKPA 2HFFA 4HZLB 1I3GL 2DQUH 3TPKA 4M7ZC 4ODHH 1V3MA 4GMSH 1SY6L 1MAKA 1N6UA 5I73B 5T1KB 4I0PB 1B2WH 5F44A 5ESVB 4OJFH 4PLOB 1WITA 4ZAKB 1TPXC 4NBXB 2YS4A 4ZDHA 3IFOB 4PRAA 4HHAA 4NQUA 5C6WH 1EK3A 4YXLL 4QHNB 3WIFB 3IDIA 4HIHB 3S7GA 1JMZA 3PF2A 5GSRB 3OKNA 5ISZB 4RFNB 3GHEL 5J13C 5LWYH 1P9MC 4Y4FA 5DZOA 2Y5TA 4NUJB 1DLFH 4TULL 5GJTL 1MLCA 2YRZA 3F65A 2D0HA 3RWEB 1I8IB 1ZT1A 3LEXA 4LK4A 4ONHB 1GZQB 3MYZA 3WXVH 1BX2B 1S78D 4WV1C 3PL6D 5IHBA 3UXFA 3BKML 5LGKA 1L6ZA 2FJFA 3VFUA 1T5XA 2J6EL 5GSVA 1QRND 2X4OA 3EDKA 5B38A 3SDXB 3VD9A 2JELL 25C8H 3G9VA 4QRPB 2X09A 1Z3GH 3C6SA 3NZ8B 5SWZE 3MX0A 2QQKL 4KDVA 1XR9A 4FQHA 4LCIH 4ZNEA 4KUZH 1JMXA 3MJ7A 2CPCA 4QRUA 4O58H 1EO5A 1CIUA 1ULVA 2P24A 3W39A 1S7UB 3HFML 4HGMA 3QQ9C 5BQ7B 5FYJU 1RUQL 2Q8BH 4J4PD 4NQCD 2HJFA 5HHOA 2NY5C 4Y5YA 5AZ2L 3NIDE 2A9NL 1P7QD 1E28B 5F3HB 5HDBE 4QXGL 4DEPB 4OZIE 4KJWC 3BSZH 5J9PB 3MLSH 3VFNB 1Z2KA 1XF2B 4LGRB 2ZG1A 5A43C 1FCGA 3EKCA 5IROA 1JPSL 1FRGL 1FN4A 1YN6A 2I24N 1MPAH 3PWJA 3QJFB 5TQ2H 1F2QA 4E41D 1T2XA 4MDJB 3FQNB 5DMKA 5BRZA 5CWSA 1GHFL 3V6FB 3F62A 4UV4L 4ZODA 5EBMA 4PTTB 3GSWB 2XFXB 3FN3A 1DUYB 4RSVA 3CUPA 4ODWA 4DGIL 1G9EA 1Z5LA 3UBXG 1DUZB 3VJ6A 1T2JA 2VLME 2GW5A 4LKCA 1NLDL 3GSOA 4NN6B 1KEML 1I9IH 2ADGA 4L4VB 3A67H 5AUMB 3BP4B 4G6AD 3L9RB 1BD2B 3GJEB 5E7BA 4D94A 4YDKH 4NT6A 4KY1L 1HE7A 4BH7B 5L6YL 3P73A 1I3RA 5CEXA 4G80B 1FO0A 1AY1L 1BOGA 4K07A 1FJ1A 4G6FB 1VA9A 3WUWG 2AABH 4YBQC 4CJ0A 4PJGA 5B4MD 1QSEB 2JK5B 4UBDC 1R3IH 1I4FB 4ZO9A 4LPCA 1X3DA 3DUHA 1N59B 4NNPH 3NH7H 4GKSA 2H26A 1FZOB 1QHOA 4LFHD 3O6ML 5KVDH 3BESR 3EHBD 2K7QA 3RZCA 2A9ML 1C1EL 3CX5K 3BHBA 3FFDB 3OKOA 4KKBD 2EZ0C 4NQVB 3WFEH 1H0DA 5ERWB 1ZWIA 5C9KA 1FC1A 2B1HH 4PRPB 4DN4H 3C09C 1HINL 3NABH 2V7NB 5IVXB 4UILL 4HUVB 5IMOA 4YDIH 2IQAB 4OCWL 2JJSC 2AJZA 2XQBH 1LEGA 1EA9C 4ODUB 1HSAB 1U2CA 4OKVB 4WI2A 1XGRA 4P99A 3EOBB 3QQNA 1RIVL 2X6MA 1JWSB 1JNHB 4G6ML 3MRDA 2A6IA 1VDGA 3ARGB 2E9WA 1A21A 1DQLH 1J87A 2HVKA 3S37L 1XF3B 3WCYA 3G6AB 1YDPB 3VWKB 4Z0XA 4GAGH 5INCA 4JY6B 3UTQA 4LRIC 3AS1A 3QEHA 1EVTC 2JIXA 5JUEL 4DVBA 3QXDA 4RISL 2NY6B 1K4CA 4P49A 2JCCE 4Z8FL 5DJ2B 5DMGC 4HK3J 3N85H 4Y4KA 5T33L 4DAGL 1A8JH 3BGFC 4KMQA 3O0RL 1A02N 5I66A 4X9FA 4PYGA 3NTCL 3ARWA 4WNQB 2H3NA 4XRCB 3BDXA 4N1HB 1OGAB 3ECBA 4MNGA 3SGJC 1QR1A 4WFGE 5EU5A 3GMQA 1VGEL 1BOYA 3BISA 4EZMA 3KHQA 2X4SA 4ZUSB 3T0WA 4NUGH 5F70A 1W72L 3AMKA 4OLXH 4WO4C 4QRQA 2FEEI 3QH3A 1PY9A 4LCUA 2LV4A 2VKWA 3UYRL 1M7IB 2VN4A 4WHYH 2C1PB 2H2SC 3QIBB 2VZUA 4PJ5A 2R0LH 3NCFB 2J2ZA 3K1DA 5IVZA 3KPMA 1Z9OA 3H3KA 1NCBL 5ALCL 1T22B 5T5NG 4JPIB 3ZKXC 4PJ9D 2UYLB 3M17B 4XNXL 3PIQA 1CFVH 1NEZG 3KPSD 4H1LB 4TSAH 5FB8A 4QCIB 3GO1H 3O9WA 3U1SH 4AEHH 1LO3H 3JV0A 3ZDXF 3EYQC 2W92A 4YBLB 5ID1B 2XG5A 5IFHH 3QPQC 4WW2C 4EIZC 4UT6L 2QR0B 3RJDA 2FD6L 3WHE1 1YEKL 4JFXA 4EBQH 5HBBA 2Q3AA 1QLEL 3CSBA 3QFJB 4XTRD 1C5BH 4LIQE 2LABA 1YY8B 1KCSH 4J3XA 2BNUB 3I6KA 5GS1A 1W8OA 15C8L 2P4AB 3Q1SH 4NKQB 2EE2A 3TNNB 5JPNA 5FM5M 3RDTC 3LRSB 4NBYB 12E8H 2F74A 2NNAB 3Q5OA 2H45A 1JIBA 1EEZB 3MJ9A 3BMWA 4OCLC 5I8CA 4JE4B 5IB3B 4HUWA 5HD8D 3VG9B 1IEAA 5C71A 4I5BA 4G8FA 4O4YH 3EO9L 3PV6A 4XNYL 3MSPA 1MFAH 5MP6L 2BOBB 5DK0A 3I3DA 5L9DH 3CVIH 4OFPA 4JFZL 4NZUH 1ONQB 2HTKC 2Z91A 3SGEI 1WEJH 2PN5A 5C0RH 4KK8C 1HQRA 3DRTB 5EU4A 4QHMB 2B5IC 2X10A 4P3DB 5T1DL 2XZCH 2OZ4H 5GGQH 2HN7A 4K8RL 2O5ZL 4LDOB 4NQDD 4WI6A 1CXIA 3WO4C 1LD9B 3H9SE 1RIUH 1MRCH 2GY5A 2VXQH 1BIHA 1QLFB 3RRQA 1WFTA 5IB4B 4XP9H 3QIWB 4E9LA 5I71B 2AEWA 2CRYA 2NTFA 5KAQG 5DHVA 3WJJA 2ED7A 2JJTA 4RFEA 4FZEH 4R6UA 5JORA 4K3HA 5IEHB 3CFIC 2EDDA 2DQJH 5E8OB 3OB0K 5T5FH 4OM0H 4F7MB 2AKRA 4ZTPH 1RZFL 5C07D 4PJBB 4CDGC 3D39E 5IW1B 3DURB 3UMTA 4J3TA 1DANU 2BNQD 5F9WB 3O6LH 1F13A 5DD1L 3VI3F 3HHRB 3P77A 2Q7YA 4G3YH 1GH7A 2Q86B 4O00A 2J8UF 3U9PH 1N0XL 1MHCB 5SWQA 4LSPL 1MH5A 5C0CE 4U1JB 5DRZB 3SCMD 3WSQL 4LCYB 4I0CC 5EO1B 4PV9A 4P23A 3GK8L 5F7LB 2BY0A 1ZHNB 3DYMA 5C09E 1UM6H 3D2UB 2X1QA 4Y4FD 5EZIL 4A6YB 2AJXH 4HK0A 4L3EA 4KMLB 2NYYD 5FGCB 5DEFA 2FLRT 3RIFF 4HCRH 4Y5YC 4LEXL 1I3VA 1XH3B 3VXNB 4LPXA 4CVWA 3B3IA 4IHOB 3GI8H 4H1LH 2XY1A 5JOFB 4YHZL 4Y1AE 3TBVB 4YFDB 1IZJA 1SEQL 2H6PA 4ELMA 1JUFB 4MMZC 5JIHA 1Z9LA 4JQXC 4DUXA 1HXYA 2DM7A 1ZEAL 4LHUG 2P8LB 4YHYB 1A6PA 5C0AB 1GGTA 1PX3A 5F7KC 4I3RH 3TV3H 2BSSA 2GT9A 5M95B 3MLRL 1ZHLB 5E2UH 1TJGL 3O41A 2V5RA 1K2DB 3FO9A 2IAMA 4G8GE 4JDZA 3OXSA 4PGEB 4OD2B 5CUSL 2EDTA 3VXUA 4P5TC 2G75A 1U3YA 2NY1B 4CW1B 4KJPC 1CQYA 1GC1C 1NFDB 5EUOB 2XTJD 1Y18B 4JJ5A 2AEPL 3HMXH 3HRZA 4MD5B 4CN4A 3LKRB 5BRZD 3ARDB 3V5DB 4Y5VC 4KXZI 4KMTH 1PQZB 3HNTL 3F58L 2D7NA 4U6HB 5DA4A 4X6DF 2IALA 1U3HB 5GRUH 4M48L 1IQWL 35C8H 3VGAB 3WHXB 3RUGB 2NQCA 4K3DH 3WFDL 1OAQH 5IV2A 3HTLX 1GZPA 1CK0L 4JM4L 3VXRD 1A7PH 5GJSL 4LSRL 3LS4H 3MLYH 4Q7DA 3WFCH 2FX8L 5E8EB 4PY8I 3RGVA 1IC7H 4XPAH 5FA4A 1NGQL 1F3JB 4WCYH 1KG0A 3EO0A 1WFNA 5DF0A 3QIUD 4B7IA 3DXAB 1A7RH 4LP4A 2IH1B 4HWZA 1KTDB 3T0EE 1X5AA 4JFYB 2L0DA 4JJHA 3O11A 3OKMA 3N1FC 5DJYB 1QRKA 3DVGB 1K3IA 3CU1A 5AWNH 1DQML 1SHMA 2QSTA 3OAUL 3JBG7 1QR4A 1ETZB 3CC5A 2IQ9L 4M6NH 3H9HA 1X4YA 4HDIB 43C9A 2C4XA 2EH7L 4OLZH 1PKQB 3Q2CA 2R69H 5C8JB 3FMGL 2Z31C 3HMWL 3ZTNL 3O3EA 5T3XL 1Q0YH 3C5ZB 3OJDB 3STZB 1NGZA 3NIFE 2EDNA 2GJZB 2V7HA 4OF8A 4NQEB 3S4SA 2V17L 4NRYB 5CHNA 4YR6B 4G7VL 5HHNB 4JRYB 3OAYK 3SQOH 4PRHD 3LRGA 4WTXA 3KDMA 4Y5XA 1ZT7A 2GJ6E 4EDXB 1JHKL 2YC1A 1ZLSL 1AQKH 3LZFL 5HI4D 3TNMA 5ANMA 5E08H 3GJFA 4UOW1 5TH2A 4JO4H 5F93C 4N9GA 4Y4KC 5F9JB 3H7BA 5F9OH 3KPPB 3QHFL 4LQFL 3MBEB 3LQZA 4OSUL 3OX8B 4LOUD 4X7TA 5HHME 3MUY1 3TBTB 1A1OA 5GZOD 3D39A 1MHHA 4A6YH 4GG6B 4Q9QL 2BSRB 1CCZA 3RWJA 1YEGL 4TUKH 3BPNC 2Z4QB 2MWCA 1A7OL 1NDGA 4QRTB 4HIIA 1OQXA 5JXEA 3LQAC 3RVXD 5CJ8A 4KJYA 4ZYKB 1WCQA 4LLMA 2FEDD 3QCTL 2SEBB 4HBCH 5GRVL 3V5HB 1WZMA 1ZXQA 3FQXA 1P1ZB 1UM5H 4JANA 4JFED 3TJHC 4PRIA 3LD8C 1P6FA 4QWWC 3ISWA 5IEKB 4Z7UF 1HHKA 3I6LD 5HYSA 1D5BB 4EN3C 1AIFA 2XA3A 4Y2DC 4D9RD 4OZ4B 1UKQA 4GG8B 1R5WA 1KNOA 2BZDA 3EIFA 4LHQB 3ULUH 4OLWH 3E0GA 4FQXA 2EKSB 2F53D 5EZOL 4HGWA 3WNOA 5DUPL 4BK5A 5AG8A 1XCQB 4MNQA 3TT1L 1YZZA 4JZNA 1K6QH 5EG6C 4GRLB 4YIQB 5DXWA 4M6ML 1JYXA 3TBWB 1D5MB 4AEIL 4AG4L 3LKOB 1K8IA 3ARBD 2L7UA 4XNQB 1MCBA 3MRGB 1P69B 4Y1AA 4PTUB 1RU9H 3HC3H 4OLUL 1EAPA 5F7NC 5AZEH 2D7MA 2WWKO 1XF4A 2YPVL 1TETH 1UWEL 3GSUB 1A0QH 4ZFGL 3NA9H 4QOKD 3BW9A 1VSCA 5DJAA 1IGYA 1P6AB 3O9WD 2CIKA 5D71L 2FCBA 5GRYA 1RURH 2AJYL 4DN3L 3CFBA 2XN9E 1F8TL 5MEPB 2C7UA 1UWXH 5GRJL 4PJFA 3NN8A 4X9IA 1OGTA 5BOZG 2EDXA 2EC9U 1RJZA 5B8CB 4HK3N 5DRWA 1U8NA 3V6BR 1S3KL 3EYVA 2CKNA 1FAIL 3ZYZA 1A6ZA 4LLQB 5HGHB 1E4XI 2IEPA 3O3BA 3F7QA 4HKXB 3MCLH 1UKTA 2NLJB 3BDBA 4HX1B 1REIA 3IU4L 2EYSB 2IANA 4XXCA 1I1AD 3TA3B 1BM3L 2VQ1A 2PYFB 1HCVA 4OCYH 3WD5H 4ZUTB 4P2QB 4XP4H 4H20L 1S9WA 2A6JB 5GISH 1KJ2B 3BVNB 2ZUUA 3IDUA 1OTTC 2DTML 5KVEH 5DFWH 1I1YA 5DHXB 4JFHD 4LASH 4M5YH 1XIWA 4WUKH 5DJCB 2BVUA 3GJFK 2VO5A 1CWVA 5JDSB 3NFSH 1YPZE 4N8PA 2B39A 1C08B 2AAVA 1Q9OA 4NGHL 4PFEA 5J8OA 3ZE1E 3FN9A 4Q9RL 1HOCA 2X4QA 5SX5K 1I8MA 4Y88A 5FO8A 4ZFOB 1IBGH 1KC5L 2FATL 2G60H 3MLTB 2J7LA 2ORBH 1IE5A 1CG9A 1CVRA 1I75A 3TYFA 1NEZB 3W9EA 1HKLL 5D70L 1MELA 3QUYB 3RWDA 3LSOA 5ITFB 4Y16B 1T1XB 3FB5A 3AMLA 4D2NA 3U7WL 3LIZH 5JZ7C 3P4OA 4R2GD 1OSPL 3Q6GH 3TIDB 5FM4A 2X70B 2VUOA 1HHGB 3THMH 1MIEH 2CJUH 1WICA 4PJCA 3BQUB 4L8DB 1DVFC 4HZLA 3UTZB 4S1RL 2J88L 4M3JA 3F7YB 1IGML 4PS4H 5DJXB 5KS9E 3C60B 1U93B 1J86A 1FYTB 4UAOB 5T1KA 4I0PA 1C7SA 4XGZB 5I1JH 5ESVA 4ZAKA 1MCOH 3FB8B 2ZUTA 2DKUA 3IFOA 4XC3H 4OI8A 4HWBH 3P9MB 4QHNA 3WIFA 1RHFA 4JO2H 4EI5D 4HIHA 1F3DH 4AL8L 2VXTL 4GAJH 1JF5A 1IGFL 5ISZA 1X5XA 3B43A 3IS1X 5C0BE 1F97A 4I77H 4IOFC 1T80A 4NUJA 2E6QA 2H32B 2NPLX 5D6CB 4GAFB 4RNRB 5AYUL 2QADB 4N8CL 4L3ED 1I8IA 4ONHA 1GZQA 4MB5A 1CYGA 2X1WL 1BX2A 5EBLB 2ESVE 3SDDB 1DJSA 1FPTH 5EUKB 2HFEB 1TZGH 1N64H 5I1HH 1HEZA 1CVSC 3TZVB 3SDXA 4PJDF 2WBJC 4QRPA 3ARZA 5DQDL 3CZFB 5DO2D 3NZ8A 1H3XA 3LHPL 4MGXA 1ZKAA 4RGNE 4I4WB 5ITBL 5FYKD 3L5XL 3SOBH 1KBGH 3L3IB 5SWSE 1T6VN 4P2RB 5L88L 4XCNB 4TUJB 3KNBB 4APQA 1S7UA 2RBLA 3QEQB 5TE6H 1NBZB 2QL1A 4PP1D 4DGYH 5BQ7A 4NM4H 2MKWA 4FQJL 5A16B 5BVPH 4FFZL 1TQCB 5HVHC 1PLGL 1E28A 1KGCE 2YD2A 4GXUM 5F3HA 1DZBA 5GGRB 1GGCH 5J9PA 1WWAX 3S35X 2IAMD 3EAKA 2O26U 3QFJE 4JFDB 3VXUD 1UJ3C 2O5YL 3HB3D 2F54B 3K7UA 4NKDB 3QJFA 5CJ5A 2D7TH 3T2NH 1OARL 3RTQD 1LNUB 1INEH 4MDJA 3FQNA 3V6FA 4TVPE 1MFDH 2CKBB 2VYRE 5F6HI 4R9HA 3VFOB 1JN6B 3QNYA 1KJ2H 1F3DJ 3X14A 3VW3L 3MUHL 1DUYA 3EYOB 5CCKH 4JGUA 4R3SA 1DUZA 4KZEH 1FLRH 4XCFH 4NHUB 1QSFB 2NXYB 1QPXA 3C8DA 5DD5L 4NFDA 4LNVA 1JHLL 2OI9C 2Q3ZA 4L4VA 5AUMA 4XPFH 1RAMA 3BPOC 3BP4A 4Y89A 3GJEA 1BD2A 3L9RA 3BH8B 3RGVD 4BQ6A 3JWDL 4X80H 1A9EB 4BH7A 2E6PA 1HHIA 1QBLH 4G80A 4K94L 1WT5C 1QBAA 4F7PB 3CAFA 3I50H 1BVLB 4GKOA 4OLYH 3UTTE 3DROB 4C54A 2B0SH 1QSEA 2JK5A 5J6HB 1I4FA 4Y5XC 1UEYA 1N59A 1AR1C 1T89C 3N1QC 1RZIB 3NIDF 1FZOA 1MCKA 2QSCL 1IARB 3RVTD 1UYWL 5E00B 4ELKB 3MRPB 4Y0GA 3FFDA 4NQVA 5ERWA 5EC1B 2AJVL 5E56A 4PRPA 2FX9H 1G9MC 5JW4R 2V7NA 5IVXA 4PLKC 4HUVA 4BSJA 5FYLL 2IQAA 2MPAH 4FQIL 2VR9A 2OZ4A 4ODUA 5DR5L 4OKVA 1G9NL 1HSAA 4F7TA 1T04B 3GGWB 5HDQH 3EOBA 5D72L 5H37G 3O6FC 1JWSA 1JNHA 5JXEC 3FQRB 4YEEA 1GRWA 3LEVH 4L3AA 2ZUQC 2DB8A 3EYSH 3ARGA 5F8RC 5I1KH 1WZ1H 2YHGA 2VZOA 1CICC 1XF3A 5K9KB 1OCWH 2H32H 3ZSTA 3G6AA 1YDPA 3VWKA 2NR6D 4OZGB 3MLXH 2IBZY 4HKJA 4JY6A 3BPLB 1QKZH 4FFYH 2FIKB 4ONFH 4WWKA 1AP2A 1JTTA 3CH8A 5DJ2A 1DDHB 1FSKC 3GM0A 5JHDD 2V9RA 3D3VE 5AEAA 1YECH 2EE9A 4XWGL 1UXWB 3MRIB 1TITA 4MSWA 1AHWB 3L7FB 4MJ2A 3V4UH 1N6QH 3SE3A 1RVFL 1G0YR 3EW3B 4WNQA 4PRID 4XRCA 1OAKL 5AAMA 3EFFB 5B39G 2Q8AH 1OGAA 2K1MA 3GMRB 1KELL 1OPGH 1J05B 5DA0B 2EDRA 1A6WH 4JLRA 1N8ZB 1UWGH 2ZZUT 3NCJL 1KIRB 1OM3H 1QEWA 4ZUSA 4C4KO 4FQXD 4KRPB 4M6OL 2ADJB 3KAAA 1M71B 4D9LL 3TO4C 4U2YA 3GBMH 5LBSH 1M7IA 3ULUE 1FE8L 4IBLT 3DI3B 3TYGH 2C1PA 5I30H 4IRJD 4X4ME 4OT1H 3QIBA 2X05A 3L1OH 4MJID 3KG5A 1YJDH 2CKBH 4XPHH 2W9EL 3MXWL 4HF5L 1T22A 3ZKNC 4JPIA 3B9KC 2ARWA 3M17A 4ZO7A 4LQ1A 5KVFL 3PWPE 4H1LA 4YNYB 4NQSA 1NFKA 3LPWA 1BAFH 5C08E 1A1NB 3VWJD 4OGAC 3SJVE 1M6OB 2F15A 2VDKL 4ODTH 5LCVH 5ID1A 4WFHD 1MY5A 3BI9X 1A22B 2JLLA 4IS6B 2QR0A 4V2CB 4Z76B 5CZVH 2X7LB 2GUOB 3QFJA 4EEEA 3O2VH 3WN5C 1P2CB 3RHWK 4IDJL 3MLPA 3OV6A 2BNUA 5J11C 2DBLH 3WDIA 3TEUA 1G6VK 3TNNA 3LRSA 2DI8A 4L8BA 3DXAE 3IDMB 2NNAA 4YXKL 2ZSVB 3HMXA 3QHZL 4H8WL 3T0EC 5IB3A 3LKPB 5FM8A 4FXLA 4F3FB 2BSED 1RZJL 1T66D 4Y4HC 2BOBA 2I27N 3TBYB 4HH8A 1PKQE 3BEVB 2HRPH 5CJXC 4QNPE 3DX7B 1MCPH 5HHQB 3LN5B 1ONQA 5JO5B 3D9AL 1EO8L 1JF1B 1INQB 1Y6MR 3S3JA 3DVNB 3HI5H 4P3DA 4RWYL 4PB0H 5F72S 1GIGH 1NUNB 5L2JB 2PXYB 3MRHB 4PG2A 1LD9A 3QEGH 1QLFA 5A1AA 5IB4A 3RL2B 2JJUA 3QIWA 2R29L 3O4OB 2VC2H 2NY5L 4GRWE 4AENB 2AXGB 4MWFB 3SE4A 1CFNB 2OK0L 4I13B 1LO0H 1MCEA 5HGDB 1FCCA 5I73C 5IEHA 3VE0B 1U3ZA 1JI1A 5E8OA 3FONB 1NL0L 2VDPL 4WFED 2UWEB 4F7MA 5CMAB 2NY2B 4PJBA 1V7NL 3GM8A 5IW1A 4GG6E 3DURA 4Q0XL 2VLJE 4RFNC 4KTEH 4K3JL 1JNNL 3MOAH 2Z8SA 1E4WH 3PQYB 3RX5A 3HS0B 2FO1A 2GKIA 2AEQH 4R97B 5CZXC 1NGPL 1TZHA 2VAJA 4Z7NF 1MHCA 1IRAY 4ZAKD 1PZ5B 2AK4B 3MPCA 4U1JA 5DRZA 5CSBA 4LCYA 4WUUE 4H88H 5DK2B 3IDGB 4KROB 5EO1A 1MWAB 5D96C 3KPLB 1INDL 3ZDYE 3CSYB 1WBZB 2WUBL 1DBJH 4HMEA 3QQ9D 1ZHNA 3D0VA 4XAKE 2ZG2A 5IBUB 3D2UA 4A6YA 4LAQH 5ECJE 1CDYA 4L5FL 4D0DB 1JWUB 4V1DD 3PGFH 5C0GB 2PW1A 2ZJSH 4P9MH 1CGYA 4BUGA 1XH3A 4OF7A 1KCRL 1FVEA 4ONOA 1CR9H 4DEPC 1EERB 3TBVA 3VH8G 2OMBA 3EZ8A 3RVWC 3CNKA 5E2VH 2CR6A 4XHJC 1LGVA 4QRPD 2P8LA 1DL7H 3ILQC 5HY9B 4Q6IB 5C0AA 2X89D 3AM8A 4WEMB 3QISA 4OTXH 5ALBH 2DLIA 4APQD 4R8WH 1ZHLA 3ELAT 1K2DA 2CO6B 3BPCB 5BZWB 3V6OE 4WDIB 4PGEA 4OD2A 1FNSH 1XF5B 3OPZH 1F4XH 1EFXD 4CW1A 1BFSA 5INDB 1NFDA 3ALXA 5EUOA 1V7MH 1Y18A 1OTUC 4G8IB 4OUUB 4LRNL 2CK0H 3BH9B 4MD5A 5ICXB 5L0QB 1Z6JT 3LKRA 1A7NL 3ARDA 3D1MC 3V5DA 2E9IA 2IGFL 1PQZA 2PR4L 1U91B 1AXTL 4WI9A 1U3HA 4EOWL 4CADB 4EJ1C 1PEZA 4MJ4A 3WHXA 1VPOL 3RUGA 1OHQA 4AEEA 2P48B 2H41A 4W4NA 2Y9RT 3N50A 1RUAH 3KYNA 5C70A 4NC2B 4XI5C 1EMTH 2EZ0D 5T1MB 2ZUWA 2HLAA 4DZBA 5MENE 2I60L 3LRHA 3QAZB 1UM4L 4L4VD 1F3JA 3WBDA 2Y07L 4M7JH 4ZPTB 3QZWG 4GS7B 3X3FL 2IH1A 1LO4L 3UPRB 3INUL 3L5JA 4LHJB 3UJTL 1KTDA 3QRGL 4M7KL 4MQSB 4WGVB 2R4SL 4JFYA 4Q6YA 1R3HB 2HT2C 2GK0B 3LEYH 3C87A 2YPKB 5DJYA 2UUDH 1GGBL 3DVGA 1KV3A 3MACL 5EOCH 1QFWI 1ETZA 3QUXB 2OL3L 3R8QA 5F89B 4G5ZL 4HDIA 2VJXA 4K7PH 3MO1B 3AC0A 3QDGD 4KKNA 3TJEL 5C8JA 4ZOAA 5DFVD 3QXVA 2DQEL 4OZFB 3QULB 1D6VL 4PJFF 2YMXH 3C5ZA 3OJDA 3STZA 3UJJH 4UTBH 32C2B 2GJZA 4NYLB 5FO7B 9CGTA 4NQEA 3CPLB 3RKDC 5LQBH 4NPYB 1LO2L 4NRYA 4ZOEA 5HHNA 4YR6A 4P4KB 4JRYA 2R23B 2OR8A 4CNIB 1J1OH 4DQOL 4EDXA 4JPWH 4RWHA 5HXMA 5D7KD 1MWAH 2HVJB 4MXVE 3IF1B 5F9JA 4HIXH 5JR1L 3KPPA 3CIQA 3AFLA 3MBEA 4FMFA 3HPJB 3OKEB 3OX8A 3EDFA 4I0KA 4MD0B 1JZ5A 1YEHL 1UA6L 5C0FB 4PD4J 4K23H 3TBTA 3ARGD 2V9TA 3TFKC 4MAYC 1MCNA 3JV6B 2IH3B 2BSRA 5EZJA 2DIAA 3S88H 3VWKD 1J0IA 2PTTB 2Z4QA 2XKUA 1CE6B 4XAWH 5BV7C 1HYSC 4YPGB 4QRTA 1MI5D 4WWKD 2OSLB 4ZYKA 3OQ3B 1TJHH 2SEBA 1QTYT 3OJVC 4KVCL 3O4LE 3V5HA 1OAZH 3TT3L 3MXVH 1TVBB 5IEKA 1D5BA 2DD8H 1FFRA 3KXFB 3AGVA 1BVKB 2VUYA 2Y36L 2XXCB 4LCCA 4GG8A 4NC1E 3C2AL 1NMAH 1T2QL 4HWBA 1OGAD 3NIFF 1TNMA 1WZLA 4NDMB 3G6JB 4RGNC 4JQVC 1XCQA 3JWOC 3ZHKA 5HPMB 4P2OB 5E9DB 4GRLA 4YIQA 2UZYB 4L4TB 4YBLC 1A3LL 1GGUA 3TBWA 2WQ8A 1KIQB 1D5MA 3NCYP 5IHUH 4ETQB 1Y6NR 4KU1A 3LKOA 4RFOH 3DRQB 3TGXA 2CIIA 1OP9A 3UP1A 1G84A 4XNQA 4PTUA 2DLFH 4M7LL 1JRHI 5FGBA 3Q5YA 4JFDE 1IAII 5HYJB 3NPSB 2YXFA 3GSUA 4M03A 3KHOA 3V0VB 1C5CL 5JTWA 4HFUH 2FH6A 4OLEA 2VABB 1UWXK 4YWGH 4RCAA 5IMMB 4Y7MA 2D31B 2W0FB 2NW2B 4O2EB 4RGOH 4CDHA 4OBRA 5E6IB 3CLFL 3IFNH 3VG9C 4LSTL 5MEPA 4XPGH 3EYUH 4LLDB 1HN1A 5FECA 3NACH 5B8CA 5DFTA 1IKNA 1BIIB 4UU9A 3X3GL 1YEJH 4U0RC 3ARYA 4RRPG 3KPRE 3QG7L 1K3ZA 1NAKH 4LLQA 5HGHA 4CUCA 1FNEB 5IHZB 1I7RB 4ERSH 1CDJA 1GAFH 4GFTB 4HKXA 1S8DB 2NLJA 3M1BB 2MCG1 5J4MA 4HX1A 2EYSA 5EC2A 3TA3A 4NO0B 4HJJH 4PG2C 4GW1B 2PYFA 4OZFH 2R0WL 3AREB 4ZUTA 4JZJC 4P2QA 1XGYL 2BJML 4J2XA 3QIWC 4YHNB 2A6JA 3UYOD 1KJ2A 5A2FA 3BVNA 3ZHLA 2QQLL 4GW5B 4J6RL 4UT9H 5B3NA 1S7WB 3UTSB 2UZIL 1Q9WB 5DJCA 5K9QI 1NMBH 4JCLA 4EUPG 3KVQA 5JDSA 1LP9B 3GKWL 1C08A 3LKQB 1L0XA 4YHIA 3MV8B 1CI5A 1CDUA 4F9PC 1WIUA 3MMEB 4DK3A 4HJ0C 3OZ9H 4KGJA 4N5ED 1FGVH 4H5SB 2ZUXA 3MRCB 2LU4A 5DJZB 4JR9H 3LMJH 4PJ7B 5A3IC 2QQQA 4LPWA 3QUYA 4B5EA 2EH8H 5ITFA 4Y16A 1T1XA 4ZTOH 5FV2A 1JE6A 1YMMB 4KVNL 4XCYB 3MLUL 3MRKB 5IT2H 3FT2A 2AQ3A 3TIDA 3MV7B 2X70A 4UT7H 1HHGA 3P0YL 1LVEA 1AGFB 3BQUA 1SQ2N 4L8DA 2DQTH 5HVWA 3UTZA 3TLRA 2UZXB 3F7YA 4ZD3L 4CJ1A 1G7LB 1R3JB 1FO0L 3C60A 5JQ6L 1U93A 3DV6B 2DWDB 1FYTA 3P4MB 1K4DB 4XGZA 2HJKB 3RWCB 2WM0A 1MF2H 4L29B 4UIMB 3FB8A 3T2QA 4OZHB 3RHWF 1T21A 1MREL 1NCDH 5B38G 1OB1B 3P9MA 3U0WL 4LKXA 4P59L 4L9DA 4DKAA 2AI0H 1J0HA 1MFEL 3MODL 4ZUUB 3G9AB 4LLAA 3QEUB 2EDBA 5C6PB 2X41A 2V2TB 4JREB 4M3KB 3IAQA 1AGCB 3BWUC 2WUCL 2R0KL 5D6CA 3ZE1F 4Z78B 4YHYC 4I18A 3D2UD 4RNRA 3AM8C 3ARXA 2EXWC 4R26L 4EXPX 3UDWC 2BRRH 1F58H 4KJPD 3ULUC 1A6AB 3BKCL 4QXUL 5EBLA 3WIHH 3CVHB 3SDDA 5I0ZA 5EUKA 2HFEA 5TQ0L 2EEDA 1IM3A 3KYMB 3GIZH 1B3JA 3QPXH 3ZT5A 3T2OA 5KJRL 3CFDB 3CZFA 3TH4T 4W81A 2EIZB 4I4WA 5HGBB 3L3IA 4P2RA 4L8SB 4XCNA 4KI5E 3KNBA 3QEQA 1NBZA 3G04B 4YC2C 5C0AD 5FUCE 4U1SB 2HFGH 3N9GH 2F58L 5CGTA 2ICCA 1JGUL 1QNZH 5CP7B 4RAVB 4DKEH 4J23A 4XCEB 4UINH 3R4DA 1WUNT 3X17A 2UY7A 3DHMA 1IAOB 1TNNA 1UZ6E 1JZ4A 2ATPB 2CO7B 4JFDA 4XVTL 4RDQG 2F54A 3B8YA 1FH5L 3B4NA 2BHYA 2N7AA 2NY1D 4ZS6D 3IU3B 5IESL 2BMKB 1LNUA 3PGCB 5DD3L 3K2MC 1F45A 1MLBB 1QRNB 3UZEA 5CJQH 2CKBA 2B2XL 1DLHB 3VFOA 4NC0B 1JN6A 1U6AH 2P8MB 3BN9C 1CFQB 1FZKA 4MB4A 1RV6X 4R7DB 2BY1A 3EYOA 4JPKL 1KF9B 3VXSE 2Z31D 4NQCB 3FOLB 4NHUA 1MRDL 1QSFA 3A6OA 3M07A 4KV5E 4LLVB 4KWUA 3CZJA 4JO1L 2WINB 4HULB 1S7XA 1CGTA 3G6DH 1D5XB 2F9BT 3BH8A 3QDJE 5T3XE 1BQLL 4MA1C 5E8PB 1J8HD 3B8SA 2NW3B 1A9EA 5J3HD 1RFDL 1OWWA 3T3ME 4JPVL 4E41B 4LSUL 1A3RL 3V4VH 1BVLA 3LDBC 3PP4L 2GTWB 4NBZB 2EKJA 4YXHL 1K9TA 4HS3B 4YQXH 3TVMC 5IMKB 4X9BA 4ODSH 5J6HA 1I8KB 1GOGA 2JE8A 1RZIA 5EOTB 3ZL4H 4P46D 4KQ4H 2OYPA 1XGTA 5C86A 1G1CA 3BE1L 1FNGB 5E00A 1IFHL 4JKMA 4ELKA 4XVUD 1EPFA 3MRPA 2K9UA 4X6FB 1YQVH 3FN0H 2W1NA 5IIEB 5EC1A 3LY6A 1GGYA 4JG1L 4OLVL 4X5XB 2FECL 4NQED 5FGRA 4XHQA 5FGSA 3Q3GB 2GTZB 4KDTC 4JRYD 1ZSDA 4JQIL 5F7DB 3JUYA 4GW4B 2DDQL 1OAYL 1T04A 2E7BA 1OAXH 4N90E 5IKCB 2XA8L 3EJZC 4KHTH 3W5NA 4HPOL 2GYSA 3BN3B 4QWWD 4FG6D 2ZCLL 3FQRA 2AK4E 3UC0H 3O45B 3N1PC 1KSRA 5LKNA 3MBED 3U7YH 4YDVB 3HAEB 2DQIH 3MRQB 4YE4H 5K9KA 2WWKT 1JFQH 2XXMB 3GMMB 3DUSB 3LS5L 1OTSD 4OZGA 4PJXB 5JW5B 2WWMC 5D7JC 4CN6A 1J7VR 3PJSB 2FIKA 1KTKE 1NGYB 3SGDI 1FBIL 1DDHA 5ACZB 2Q87A 2P42B 4QT5A 1FVDB 4Z7WB 4HS8L 1YEIL 1UXWA 3MRIA 4JM2C 4DFHA 3DECA 1AHWA 3L7FA 4I9WE 4BZYA 4MXQD 1RUMH 2ARJQ 5C3TA 3PGDB