1F94A

The 0.97 resolution structure of bucandin, a novel toxin isolated from the malayan krait
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
MECYRCGVSGCHLKITCSAEETFCYKWLNKISNERWLGCAKTCTEIDTWNVYNKCCTTNLCNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BUCANDIN
publication title The atomic resolution structure of bucandin, a novel toxin isolated from the Malayan krait, determined by direct methods.
pubmed doi rcsb
molecule tags Toxin
total genus 15
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1f94A00
1DRSA 1CVOA 3U73U 1QKDA 1V6PA 2FD6U 1JE9A 1CODA 2GOOC 1KU6B 3NH7A 5EBXA 1YWHA 1ABTA 2L03A 3BT1U 2MJ0A 2BTXA 1F94A 1I02A 4P7UA 3HH7A 1IDGA 1KS6A 4LFTA 1HC9B 2H64C 1FASA 1H0JA 2MHYA 2H62C 1ZADA 2H8UA 1NORA 1NYSA 2CDXA 1IJCA 5IMYC 1LX5B 2CTXA 2X8BB 1IDHA 1FSSB 1KBAA 1HOYA 2I9BE 2QJBC 1CDSA 2JQPA 2VLWA 1CB9A 1KBSA 1HAJA 1S4YA 2NBTA 5DO6A 3KFDE 5DU1A 4QTIU 3U74U 4RUDA 1CRFA 1FFJA 3KFDI 1JGKA 1KXIA 1M9ZA 1ERGA 2L5SA 2K3GA 3EBXA 2HLRA 2QC1A 1L4WA 1CXOA 1XT3A 1MAHF 1BXPA 2OFSA 1KFHA 4BIKB 1IQ9A 2QJ9C 1QM7A 2H5FA 2CCXA 1LJZA 2H64B 2PJYB 1TXBA 2UWRA 4OM5A 3ERAA 2CRTA 3QB4B 1CDRA 1MR6A 6EBXA 1CDTA 1LXHA 2LCRA 4AEAA 1RL5A 1KTZB 1ERAA 2MUPA 1NTNA 2CRSA 1QKEA 1REWC 1G6MA 1CTXA 2HLQA 1NYUA 1BTEA 1UG4A 2UX2A 1HAAA 2GOOB 2H62D 3BT2U 3NEQA 1COEA 1IDIA 1TXAA 1IDLA 2ABXA 1B41B 2MJ4A 2MJYA 3FEVA 3NDSA 2MUOA 1W6BA 2N99A 1RGJA 1CHVS 2LA1A 1FSCA 3EVSC 4DO8A 1TGXA 1NEAA 1JBDA 2H7ZA 2JVEA 1CXNA 1NTXA 2H7ZB 1ONJA 1VB0A 4OM4A 2MFAA 1LXGA 1FRAA 2BHIA 4FAOE 1CREA 2QJAC 1LSIA 4BDTB 1CDQA 1TFSA 1HC9A 5DZ5A 1NXBA 1KBTA 1F8UB 1FF4A 2PJYC 1KL8A 4UY2C 4ZQYA 2J8BA 5IMTD 1IKCA 4HQPF 3PLCA 1CCQA 3VTSA 3LAQU 1IK8A 4XJJA 4EY8B 4IYEA 2ERAA 1ES7B 1PLOA 4FAOC 1KC4A
chains in the Genus database with same CATH superfamily
1DRSA 1CVOA 3U73U 1QKDA 1V6PA 2FD6U 1JE9A 1CODA 2GOOC 1KU6B 3NH7A 5EBXA 1YWHA 1ABTA 2L03A 3BT1U 2MJ0A 2BTXA 1F94A 1I02A 4P7UA 3HH7A 1IDGA 1KS6A 4LFTA 1HC9B 2H64C 1FASA 1H0JA 2MHYA 2H62C 1ZADA 2H8UA 1NORA 1NYSA 2CDXA 1IJCA 5IMYC 1LX5B 2CTXA 2X8BB 1IDHA 1FSSB 1KBAA 1HOYA 2I9BE 2QJBC 1CDSA 2JQPA 2VLWA 1CB9A 1KBSA 1HAJA 1S4YA 2NBTA 5DO6A 3KFDE 5DU1A 4QTIU 3U74U 4RUDA 1CRFA 1FFJA 3KFDI 1JGKA 1KXIA 1M9ZA 1ERGA 2L5SA 2K3GA 3EBXA 2HLRA 2QC1A 1L4WA 1CXOA 1XT3A 1MAHF 1BXPA 2OFSA 1KFHA 4BIKB 1IQ9A 2QJ9C 1QM7A 2H5FA 2CCXA 1LJZA 2H64B 2PJYB 1TXBA 2UWRA 4OM5A 3ERAA 2CRTA 3QB4B 1CDRA 1MR6A 6EBXA 1CDTA 1LXHA 2LCRA 4AEAA 1RL5A 1KTZB 1ERAA 2MUPA 1NTNA 2CRSA 1QKEA 1REWC 1G6MA 1CTXA 2HLQA 1NYUA 1BTEA 1UG4A 2UX2A 1HAAA 2GOOB 2H62D 3BT2U 3NEQA 1COEA 1IDIA 1TXAA 1IDLA 2ABXA 1B41B 2MJ4A 2MJYA 3FEVA 3NDSA 2MUOA 1W6BA 2N99A 1RGJA 1CHVS 2LA1A 1FSCA 3EVSC 4KSNA 4DO8A 1TGXA 1NEAA 1JBDA 2H7ZA 2JVEA 1CXNA 1NTXA 2H7ZB 1ONJA 1VB0A 4OM4A 2MFAA 1LXGA 1FRAA 2BHIA 4FAOE 1CREA 2QJAC 1LSIA 4BDTB 1CDQA 1TFSA 1HC9A 5DZ5A 1NXBA 1KBTA 1F8UB 1FF4A 2PJYC 1KL8A 4UY2C 4ZQYA 2J8BA 5IMTD 1IKCA 4HQPF 3PLCA 1CCQA 3VTSA 3LAQU 1IK8A 4XJJA 4EY8B 4IYEA 2ERAA 1ES7B 1PLOA 4FAOC 1KC4A
chains in the Genus database with same CATH topology
1DRSA 1CVOA 3U73U 1QKDA 1V6PA 2FD6U 1JE9A 1CODA 2GOOC 1KU6B 3NH7A 5EBXA 1YWHA 1ABTA 2L03A 3BT1U 2MJ0A 2BTXA 1F94A 1I02A 4P7UA 3HH7A 1IDGA 1KS6A 4LFTA 1HC9B 2H64C 1FASA 1H0JA 2MHYA 2H62C 1ZADA 2H8UA 1NORA 1NYSA 2CDXA 1IJCA 5IMYC 1LX5B 2CTXA 2X8BB 1IDHA 1FSSB 1KBAA 1HOYA 2I9BE 2QJBC 1CDSA 2JQPA 2VLWA 1CB9A 1KBSA 1HAJA 1S4YA 2NBTA 5DO6A 3KFDE 5DU1A 4QTIU 3U74U 4RUDA 1CRFA 1FFJA 3KFDI 1JGKA 1KXIA 1M9ZA 1ERGA 2L5SA 2K3GA 3EBXA 2HLRA 2QC1A 1L4WA 1CXOA 1XT3A 1MAHF 1BXPA 2OFSA 1KFHA 4BIKB 1IQ9A 2QJ9C 1QM7A 2H5FA 2CCXA 1LJZA 2H64B 2PJYB 1TXBA 2UWRA 4OM5A 3ERAA 2CRTA 3QB4B 1CDRA 1MR6A 6EBXA 1CDTA 1LXHA 2LCRA 4AEAA 1RL5A 1KTZB 1ERAA 2MUPA 1NTNA 2CRSA 1QKEA 1REWC 1G6MA 1CTXA 2HLQA 1NYUA 1BTEA 1UG4A 2UX2A 1HAAA 2GOOB 2H62D 3BT2U 3NEQA 1COEA 1IDIA 1TXAA 1IDLA 2ABXA 1B41B 2MJ4A 2MJYA 3FEVA 3NDSA 2MUOA 1W6BA 2N99A 1RGJA 1CHVS 2LA1A 1FSCA 3EVSC 4KSNA 4DO8A 1TGXA 1NEAA 1JBDA 2H7ZA 2JVEA 1CXNA 1NTXA 2H7ZB 1ONJA 1VB0A 4OM4A 2MFAA 1LXGA 1FRAA 2BHIA 4FAOE 1CREA 2QJAC 1LSIA 4BDTB 1CDQA 1TFSA 1HC9A 5DZ5A 1NXBA 1KBTA 1F8UB 1FF4A 2PJYC 1KL8A 4UY2C 4ZQYA 2J8BA 5IMTD 1IKCA 4HQPF 3PLCA 1CCQA 3VTSA 3LAQU 1IK8A 4XJJA 4EY8B 4IYEA 2ERAA 1ES7B 1PLOA 4FAOC 1KC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRS A;  1CVO A;  3U73 U;  1QKD A;  1V6P A;  2FD6 U;  1JE9 A;  1COD A;  2GOO C;  1KU6 B;  3NH7 A;  5EBX A;  1YWH A;  1ABT A;  2L03 A;  3BT1 U;  2MJ0 A;  2BTX A;  1F94 A;  1I02 A;  4P7U A;  3HH7 A;  1IDG A;  1KS6 A;  4LFT A;  1HC9 B;  2H64 C;  1FAS A;  1H0J A;  2MHY A;  2H62 C;  1ZAD A;  2H8U A;  1NOR A;  1NYS A;  2CDX A;  1IJC A;  5IMY C;  1LX5 B;  2CTX A;  2X8B B;  1IDH A;  1FSS B;  1KBA A;  1HOY A;  2I9B E;  2QJB C;  1CDS A;  2JQP A;  2VLW A;  1CB9 A;  1KBS A;  1HAJ A;  1S4Y A;  2NBT A;  5DO6 A;  3KFD E;  5DU1 A;  4QTI U;  3U74 U;  4RUD A;  1CRF A;  1FFJ A;  3KFD I;  1JGK A;  1KXI A;  1M9Z A;  1ERG A;  2L5S A;  2K3G A;  3EBX A;  2HLR A;  2QC1 A;  1L4W A;  1CXO A;  1XT3 A;  1MAH F;  1BXP A;  2OFS A;  1KFH A;  4BIK B;  1IQ9 A;  2QJ9 C;  1QM7 A;  2H5F A;  2CCX A;  1LJZ A;  2H64 B;  2PJY B;  1TXB A;  2UWR A;  4OM5 A;  3ERA A;  2CRT A;  3QB4 B;  1CDR A;  1MR6 A;  6EBX A;  1CDT A;  1LXH A;  2LCR A;  4AEA A;  1RL5 A;  1KTZ B;  1ERA A;  2MUP A;  1NTN A;  2CRS A;  1QKE A;  1REW C;  1G6M A;  1CTX A;  2HLQ A;  1NYU A;  1BTE A;  1UG4 A;  2UX2 A;  1HAA A;  2GOO B;  2H62 D;  3BT2 U;  3NEQ A;  1COE A;  1IDI A;  1TXA A;  1IDL A;  2ABX A;  1B41 B;  2MJ4 A;  2MJY A;  3FEV A;  3NDS A;  2MUO A;  1W6B A;  2N99 A;  1RGJ A;  1CHV S;  2LA1 A;  1FSC A;  3EVS C;  4DO8 A;  1TGX A;  1NEA A;  1JBD A;  2H7Z A;  2JVE A;  1CXN A;  1NTX A;  2H7Z B;  1ONJ A;  1VB0 A;  4OM4 A;  2MFA A;  1LXG A;  1FRA A;  2BHI A;  4FAO E;  1CRE A;  2QJA C;  1LSI A;  4BDT B;  1CDQ A;  1TFS A;  1HC9 A;  5DZ5 A;  1NXB A;  1KBT A;  1F8U B;  1FF4 A;  2PJY C;  1KL8 A;  4UY2 C;  4ZQY A;  2J8B A;  5IMT D;  1IKC A;  4HQP F;  3PLC A;  1CCQ A;  3VTS A;  3LAQ U;  1IK8 A;  4XJJ A;  4EY8 B;  4IYE A;  2ERA A;  1ES7 B;  1PLO A;  4FAO C;  1KC4 A; 
#chains in the Genus database with same CATH topology
 1DRS A;  1CVO A;  3U73 U;  1QKD A;  1V6P A;  2FD6 U;  1JE9 A;  1COD A;  2GOO C;  1KU6 B;  3NH7 A;  5EBX A;  1YWH A;  1ABT A;  2L03 A;  3BT1 U;  2MJ0 A;  2BTX A;  1F94 A;  1I02 A;  4P7U A;  3HH7 A;  1IDG A;  1KS6 A;  4LFT A;  1HC9 B;  2H64 C;  1FAS A;  1H0J A;  2MHY A;  2H62 C;  1ZAD A;  2H8U A;  1NOR A;  1NYS A;  2CDX A;  1IJC A;  5IMY C;  1LX5 B;  2CTX A;  2X8B B;  1IDH A;  1FSS B;  1KBA A;  1HOY A;  2I9B E;  2QJB C;  1CDS A;  2JQP A;  2VLW A;  1CB9 A;  1KBS A;  1HAJ A;  1S4Y A;  2NBT A;  5DO6 A;  3KFD E;  5DU1 A;  4QTI U;  3U74 U;  4RUD A;  1CRF A;  1FFJ A;  3KFD I;  1JGK A;  1KXI A;  1M9Z A;  1ERG A;  2L5S A;  2K3G A;  3EBX A;  2HLR A;  2QC1 A;  1L4W A;  1CXO A;  1XT3 A;  1MAH F;  1BXP A;  2OFS A;  1KFH A;  4BIK B;  1IQ9 A;  2QJ9 C;  1QM7 A;  2H5F A;  2CCX A;  1LJZ A;  2H64 B;  2PJY B;  1TXB A;  2UWR A;  4OM5 A;  3ERA A;  2CRT A;  3QB4 B;  1CDR A;  1MR6 A;  6EBX A;  1CDT A;  1LXH A;  2LCR A;  4AEA A;  1RL5 A;  1KTZ B;  1ERA A;  2MUP A;  1NTN A;  2CRS A;  1QKE A;  1REW C;  1G6M A;  1CTX A;  2HLQ A;  1NYU A;  1BTE A;  1UG4 A;  2UX2 A;  1HAA A;  2GOO B;  2H62 D;  3BT2 U;  3NEQ A;  1COE A;  1IDI A;  1TXA A;  1IDL A;  2ABX A;  1B41 B;  2MJ4 A;  2MJY A;  3FEV A;  3NDS A;  2MUO A;  1W6B A;  2N99 A;  1RGJ A;  1CHV S;  2LA1 A;  1FSC A;  3EVS C;  4KSN A;  4DO8 A;  1TGX A;  1NEA A;  1JBD A;  2H7Z A;  2JVE A;  1CXN A;  1NTX A;  2H7Z B;  1ONJ A;  1VB0 A;  4OM4 A;  2MFA A;  1LXG A;  1FRA A;  2BHI A;  4FAO E;  1CRE A;  2QJA C;  1LSI A;  4BDT B;  1CDQ A;  1TFS A;  1HC9 A;  5DZ5 A;  1NXB A;  1KBT A;  1F8U B;  1FF4 A;  2PJY C;  1KL8 A;  4UY2 C;  4ZQY A;  2J8B A;  5IMT D;  1IKC A;  4HQP F;  3PLC A;  1CCQ A;  3VTS A;  3LAQ U;  1IK8 A;  4XJJ A;  4EY8 B;  4IYE A;  2ERA A;  1ES7 B;  1PLO A;  4FAO C;  1KC4 A; 
#chains in the Genus database with same CATH homology
 1DRS A;  1CVO A;  3U73 U;  1QKD A;  1V6P A;  2FD6 U;  1JE9 A;  1COD A;  2GOO C;  1KU6 B;  3NH7 A;  5EBX A;  1YWH A;  1ABT A;  2L03 A;  3BT1 U;  2MJ0 A;  2BTX A;  1F94 A;  1I02 A;  4P7U A;  3HH7 A;  1IDG A;  1KS6 A;  4LFT A;  1HC9 B;  2H64 C;  1FAS A;  1H0J A;  2MHY A;  2H62 C;  1ZAD A;  2H8U A;  1NOR A;  1NYS A;  2CDX A;  1IJC A;  5IMY C;  1LX5 B;  2CTX A;  2X8B B;  1IDH A;  1FSS B;  1KBA A;  1HOY A;  2I9B E;  2QJB C;  1CDS A;  2JQP A;  2VLW A;  1CB9 A;  1KBS A;  1HAJ A;  1S4Y A;  2NBT A;  5DO6 A;  3KFD E;  5DU1 A;  4QTI U;  3U74 U;  4RUD A;  1CRF A;  1FFJ A;  3KFD I;  1JGK A;  1KXI A;  1M9Z A;  1ERG A;  2L5S A;  2K3G A;  3EBX A;  2HLR A;  2QC1 A;  1L4W A;  1CXO A;  1XT3 A;  1MAH F;  1BXP A;  2OFS A;  1KFH A;  4BIK B;  1IQ9 A;  2QJ9 C;  1QM7 A;  2H5F A;  2CCX A;  1LJZ A;  2H64 B;  2PJY B;  1TXB A;  2UWR A;  4OM5 A;  3ERA A;  2CRT A;  3QB4 B;  1CDR A;  1MR6 A;  6EBX A;  1CDT A;  1LXH A;  2LCR A;  4AEA A;  1RL5 A;  1KTZ B;  1ERA A;  2MUP A;  1NTN A;  2CRS A;  1QKE A;  1REW C;  1G6M A;  1CTX A;  2HLQ A;  1NYU A;  1BTE A;  1UG4 A;  2UX2 A;  1HAA A;  2GOO B;  2H62 D;  3BT2 U;  3NEQ A;  1COE A;  1IDI A;  1TXA A;  1IDL A;  2ABX A;  1B41 B;  2MJ4 A;  2MJY A;  3FEV A;  3NDS A;  2MUO A;  1W6B A;  2N99 A;  1RGJ A;  1CHV S;  2LA1 A;  1FSC A;  3EVS C;  4KSN A;  4DO8 A;  1TGX A;  1NEA A;  1JBD A;  2H7Z A;  2JVE A;  1CXN A;  1NTX A;  2H7Z B;  1ONJ A;  1VB0 A;  4OM4 A;  2MFA A;  1LXG A;  1FRA A;  2BHI A;  4FAO E;  1CRE A;  2QJA C;  1LSI A;  4BDT B;  1CDQ A;  1TFS A;  1HC9 A;  5DZ5 A;  1NXB A;  1KBT A;  1F8U B;  1FF4 A;  2PJY C;  1KL8 A;  4UY2 C;  4ZQY A;  2J8B A;  5IMT D;  1IKC A;  4HQP F;  3PLC A;  1CCQ A;  3VTS A;  3LAQ U;  1IK8 A;  4XJJ A;  4EY8 B;  4IYE A;  2ERA A;  1ES7 B;  1PLO A;  4FAO C;  1KC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...