1F9BA

Melanin protein interaction: x-ray structure of the complex of mare lactoferrin with melanin monomers
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFKSTPEEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lactoferrin-melanin interaction and its possible implications in melanin polymerization: crystal structure of the complex formed between mare lactoferrin and melanin monomers at 2.7-A resolution.
pubmed doi rcsb
molecule tags Metal transport
molecule keywords LACTOTRANSFERRIN
total genus 210
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1f9bA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1f9bA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1f9bA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1f9bA03
1D9VA 3TTLA 1AL3A 3ZKKA 3GXAA 3KJ7A 3K6VA 1DMBA 3HO7A 1UTHA 1LB9A 4ISUA 5FTIA 2OJTA 1N3WA 3LC8A 4GIZA 4EXKA 4DDDA 1UIUA 2I48A 1N76A 3ZKLA 4JB7A 4OQOA 2V3TA 4N6PA 3TTRA 1EZPA 1JW1A 3FXUA 4R9FA 4ZZEA 1B51A 4JWXA 1KWHA 4OVJA 1LB8A 2B65A 4KQPA 1NNKA 1PDAA 2YLNA 4X1BA 3S2VA 1B46A 3KJTA 3P7IA 1IQ7A 4JBZA 1A8FA 4KR5A 1FTJA 2UVHA 2DWHA 4LUBA 2X7QA 1AIVA 2R6GE 1MXUA 5JTYA 1YTVA 1PB8A 3TUSA 3UP9A 5CMKA 1NKXA 3TCGA 1Z7NE 2DWIA 4PP0A 1IZ1A 2NXOA 1SVXB 4QHQA 5JTYB 5L9SA 3FATA 3CG3A 2RKMA 1J1NA 1P1OA 3HHGA 4ELQA 1MDQA 3T9XB 1URDA 3H7MA 4R6KA 4F29A 5I2NB 1L5TA 4I1DA 3VXBA 3MC2A 4YKIA 3TQWA 4OMBA 3M3FA 2UVIA 2ZNSA 4Q30B 1O64A 4O3AA 2RCAA 4QSDA 5DVIA 4PQJA 3A09A 3WAEA 3ECRA 3QUFA 4KFQA 3I6VA 4LZ8A 2O1LA 4MF3A 5FHMA 5HBCA 4RY1A 5L8DA 2KLFA 1B3EA 2XXXA 1USYH 3KZGA 2THIA 3QXMA 1QKBA 2P2AA 3R7XA 2O68A 1IITA 5I84A 2NUVA 4H0WA 3N6UA 1SW4A 3O9PA 4DXBA 4G68A 2DVCA 1UTBA 3N94A 4ZE9A 2F8DA 2QS1A 1MXVA 3F11A 3TYHA 1AH5A 3JV9A 3BFUA 4YZZA 5H8QB 3OSRA 1LBBA 4Q5TA 4TLMB 3ZS6A 2F7CA 1M5DA 5A5XB 1QUKA 2Y7PA 1LAFE 4X1DA 3VE1B 3MZBA 3FVNA 3LSLA 1QVSA 4ELPA 2Q8JA 3PPNA 1MRPA 4MLQA 5AA3A 5I58B 1B2HA 1B5JA 1JVYA 2OK2A 3KBRA 3O28A 2DSFA 4U1OA 2OZZA 4WEDA 2HEUA 3IX1A 4Z7EA 1FQDA 3S9LC 1B05A 2E0SA 4F18A 3G3IA 4UA8A 4XTCQ 2I3VA 4OERA 4PFYA 2Z23A 3BKIB 3EN3A 4QFOA 4NWCA 5H8FB 3U94A 4F1VA 1D4NA 4POWA 2R9JA 4WEPA 3K01A 4F2OA 1FTKA 3V83A 1B4HA 2XXTA 2YPNA 2O84X 2RF1A 4F39A 3IR1A 5H8FA 5LOMA 3KN3A 3IAZA 4POXA 4G8MA 4JSDA 1YPNA 2A5TB 3C4MA 5EYFA 3FV1A 5TP9A 1NL5A 1MY4A 1NH7A 3O97A 4E0WA 2CZLA 3PPPA 4YB5A 3FV2A 2ABHA 1AMFA 1B5IA 1O63A 2WKYA 1GGGA 3PPQA 4U4XA 5TP9B 2VGQA 3L6GA 4F3BA 1JVXA 3QSLA 4NF4B 4YU0A 1H76A 1TFAA 2O7IA 3EHUA 4P11A 3PPRA 4FEBA 1B3LA 3TELA 4F3GA 1LAXA 1QUIA 1UQWA 3DLNA 3H3GA 4N13A 5DT6A 1QW0A 2ZYKA 1LAHE 3H03A 4TLLB 2P0SA 3T9HB 1FQFA 4R72A 1QULA 2F97A 3CSGA 4H8JA 4QRZA 5J1DA 1CE2A 4EQ9A 4R75A 3HPIA 2ZXTA 4OTEA 3H4ZA 4JXIA 3SETA 1ATGA 1DTGA 2XX9A 2AL5A 3EF7A 4LATA 4Z0IA 5K2YA 2I58A 5CM6A 5IKBA 4U23A 1ZLQA 2VHAA 2XX7A 4ZEDA 2H25A 4FORA 1SI1A 5F1QA 2DXRA 3OD7A 1SI0A 1PBQA 1PEBA 4IY6A 1SYHA 4DIGA 1LFGA 2B3FA 3CG1A 2UYFA 1IXHA 4FECA 4IO7A 5H8QA 3GLBA 5JEIA 4R9GA 4FE8A 1XOCA 3U93A 1CB6A 3LSFB 3G3JA 4L17A 4LONB 2CMOA 5CI5A 3MP8A 2IA4A 4G77A 3TFLA 5CBSA 2I49A 1IXGA 1SW5A 5TU0A 3MVYA 5CMCA 5KCJB 2H9BA 4R6YA 3MVXA 2QMXA 3OEKA 3T96B 2ONKE 2XXWA 2F6GA 3PV0E 3QAXA 1MQIA 3UORA 3Q27A 5CBRA 5I59B 2R71A 1JW5A 4NF5B 4GLIA 2HXWA 4P0IA 3E4RA 5AA2A 5CMBA 1MXWA 3K02A 3MJNA 1MY2A 3OEMA 3PPOA 3VVDA 3C31A 5BUUA 3N26A 5I2NA 4NF5A 4BDMA 1SQYA 1OQHA 1R9LA 3PMWA 3BBRA 4GVOA 1OIBA 1Q35A 1JQFA 3C33A 4NEDA 1I6QA 3IJXB 3OO9A 4KD5A 2A5TA 4RPOA 1JEUA 3VFJA 3VXCA 3OXNA 2HCAA 4R74A 3CFZA 3RT8A 3VLUA 1JEVA 3G7WA 4RJZA 4IO5A 2GFEA 2QMWA 2Z8EA 4F31B 3Q28A 1IIWA 1M5EA 2XXUA 3DELB 2P1SA 3C36A 4G68B 3T66A 1UTBB 4R73A 2Q2CA 4HCWA 1NNPA 5L9OA 1VR5A 4YKKA 3S9NC 2OCUA 4JSOA 1DTZA 1H43A 3JYRA 3OO6A 4OFLA 4BDLA 2I4CA 4ZEBA 5L9MA 3R6UA 3RN8A 4MFIA 4U21A 3AXFA 1DPEA 5DTBA 3B7DA 5ITPA 4IO2A 4OEUA 4BDRA 3VLVA 1VFEA 3IOVA 1H3DA 1Z7ME 2OBGA 1B40A 1XT8A 1TWYA 2I0BA 1MY3A 1FQCA 3CVGA 5H8NB 1LBCA 3FXQA 3IJOB 1SDXA 3ILTB 4ZDMA 2FA7A 4U4SA 5FTHA 3VV5A 3TZAA 2UVJA 4X48A 4IO3A 1NMUA 3PD8A 2QL3A 1DOTA 1GVCA 4U1ZA 2ZNUA 1PB7A 3MUQA 1B3FA 2NOOA 2V3QA 3MBPA 4LA9A 5H8HB 3SEVA 1B6HA 4DXUA 2HQ0A 5I59A 4PFUA 3EPEA 4EQBA 2GRVA 2QJEA 2H4IA 3UN6A 2XXQA 4YKJA 3UIFA 1A7LA 1MH4A 1S50A 1SD3A 3K00A 2UYEA 3CIJA 3LUYA 1MM6A 3FVKA 1P1QA 1A8EA 3CFXA 1B0HA 3K6XA 4RXLA 3FD3A 4G2ZA 4WXJA 4X9TA 4DZ1A 1VFDA 4M4GA 4HCYA 1N0TA 2W7YA 2ZYNA 3FGSA 3E13X 4I62A 1N3XA 3H6WA 4FIMA 2I0CA 1T0KA 3TTMA 2F36A 5KDTA 3MP1A 5AA4A 1Y9UA 3IO6A 2I6EA 1PC3A 2LAOA 3C9HA 3O6HA 4AQ4A 5I57B 1B1XA 1UIVA 1A99A 1PBPA 2OWTA 5AE4A 3M3LA 1Y3QA 3MQ9A 1POY1 3FZVA 5CRYA 4ELOA 4RYAA 2REJA 3V5AA 1BTJA 2ONRA 4F19A 4QSEA 3TKDA 3TTNA 3QIMA 3G3KA 2F6PA 1H44A 3DP4A 3RPWA 2G29A 4YMAA 2HAVA 4ZS9A 3M3KA 2Y7KA 2O7UA 3K2DA 4KHZE 4MLVA 4H8IA 1JW4A 4NMYA 1M5FA 3CR9A 4LZ5A 4UACA 3IL1B 1A54A 3C34A 4LQ5A 1I69A 2G93A 2GH9A 2H5YA 2M8CA 4H67A 1EH3A 2B3BA 3IB1A 3SEYA 2Z8FA 2DYXA 3HHFA 3ODBA 3OELA 2XX8A 4NWDA 4RPNA 5CMMA 1FQAA 3D4GA 3U92A 5JK4A 3PUYE 4PETA 1B7UA 5I58A 1NH8A 1TFDA 3IORA 1BIYA 1LCTA 3KN8A 3K1MA 4KPTA 1QJMA 3H06B 2PYYA 4QFNA 2O51A 1SYIA 1MPDA 5H8NA 4DXCA 3S9MC 1POTA 4H1XA 4RK9A 1B52A 1R9QA 3TODA 2QS2A 1US5A 4NF8B 3KSJA 3O6GA 4EUOA 3ILUB 2DS9A 1FW0A 1HSLA 2Y7IA 2ZMBA 4HS7A 1URGA 4IY5A 4FATA 5BWJA 4RK2A 4LQ2A 4XKNA 2Y7WA 1XS5A 3C32A 3OOAA 4OWDA 4TQUQ 4NF8A 4F2QA 4OETA 2ESNA 3SDFA 1GTKA 5AA1A 3SERA 4QF9A 5H8HA 2QS3A 1TXFA 1A40A 2RC7A 3RQTA 1TT1A 4GQOA 3B6QA 4ND9A 3MZ9A 2OLBA 5ELVA 5TPAB 1MY1A 2IEEA 2RCBA 4ZZAA 4F22A 1B0LA 3TQLA 4AB6A 5B7DA 2GHBA 3RUMA 1IUDA 4U2RA 1B7ZA 4F1UA 4LZ7A 1BP5A 3PUXE 5TPAA 2NWJA 4IGTA 5ICTA 1D3KA 3HCQA 4GWOA 1LGBC 3RTFB 1ANFA 1Y1MA 4MBPA 2V93A 3VDFA 4F3PA 4YICA 1LSTA 3IOTA 1EU8A 3IB0A 3KOTA 1SW2A 3DP8A 1P1NA 1UTHB 2F78A 2AL4A 3FJGA 1RYOA 1QUJA 1LFIA 3IOWA 2DP8A 4IO6A 4G8HA 3SKPA 2E1SA 3FUZA 3I3VA 3K6WA 4GF8A 3MAMA 4NF6A 1B7HA 2XXYA 1VE4A 1ZJLA 2PBWA 3KN7A 3PMXA 4NE4A 3RTWB 4DCXA 5AA2D 1XVYA 5ICQA 2H98A 4OENA 4NF6B 3O66A 3GBBA 1FTOA 4KYSA 3LBSA 3RGYA 1DSNA 3OSQA 4IB2A 2VOZA 4KCCA 4RNSA 3D4CA 3W9VA 4O3BA 3LR1A 4PFWA 3EHTA 4QFLA 2HZKA 2QS4A 3HN0A 4ESWA 2V84A 4O3CA 2D3IA 5I2KA 2D5WA 1ZMGA 2DXYA 2HAUA 4ZE8A 3A3UA 5DYHA 1NFTA 1IXCA 4JWYA 4QFPA 1MS7A 3KEIA 1ZBMA 2F7BA 3B6WA 4I9DA 2VP1A 1I6BA 1FQEA 1MG1A 4JDFA 3MZ1A 4GRKA 4GXSB 2HFBA 2ZYMA 1SW1A 3MW0A 4K3FA 5DEXB 3A3CA 3IB2A 4YB7A 4AB5A 2PVUA 2PT2A 4ZECA 3RY3A 5AA2B 4YAHX 4BDQA 2DQVA 1B5HA 1NNTA 1H45A 2DE3A 3C35A 4IO4A 5DEXA 4C1UA 3EHSA 4H5FA 3FVOA 4RA1A 3RT6B 3TDJA 2Y7RA 1HSJA 3GBAA 2A5SA 1MQHA 4QFKA 4C1TA 3K1PA 5AA4B 1F9BA 5I57A 3IO4A 3Q25A 3U1OA 3KSXA 1OMPA 1Y4CA 3FIRA 4P0GA 3KOSA 3IK6B 2PMSA 2REGA 1P99A 4ONYA 5KDTB 3N6TA 4KI0E 1P1WA 3FVGA 3OO8A 3TCHA 4ZEKA 1OLCA 1R1NA 3VLWA 3PUZE 2XD3A 4YKPA 1ELJA 4THIA 3H6VA 4LP2B 1JETA 2FYIA 1OQGA 1MXYA 3TAJA 4TOZA 4GOTA 4GL0A 4OYVA 5A5XA 4LVQA 1B32A 1MY0A 1RYXA 4E0XA 4ELRA 3THIA 3O2AA 5DVJA 3KFMA 1Q1KA 3WAFA 1Y4TA 1N84A 3QK6A 4EXLA 1LLSA 2V25A 1XC1A 1P1UA 1URSA 1I6AA 1MM7A 2Q89A 1B9JA 2RC8A 3RNNA 2XXRA 3PD9A 5HPQA 3Q26A 3CSBA 4FEDA 2ONSA 5KZTA 1ZIUA 2Q88A 4ZEFA 4OXVA 3U8QA 3VVEA 4G4PA 4DCYA 3K0VA 4ECFA 1RKMA 2I4BA 1US4A 2ALUA 3H6TA 3OMBA 4R2BA 1N04A 4OESA 3RLFE 5I56A 1MXXA 4OFJA 3T9VA 3PMVA 4C0RA 1MXZA 3SEWA 1XVXA 5I56B 5IAIA 3MPKA 4OZ9A 3FJMA 2RC9A 1B4ZA 2AYSA 4Q8RA 1EZ9A 1GR2A 3CRBA 5I2KB 2DE2A 1A55A 2QSXA 3VVFA 4ESXA 2H99A 2F7AA 1IEJA 1OVBA 2DWJA 2F5XA 2QRYA 4H65A 4XKQA 4EF1A 2XHDA 1B3HA 2Y84A 2F34A 3O6IA 2RINA 4NTLA 4U22A 4XKPA 5M2VA 1B3GA 3QYTA 1AOVA 2DE4A 4Q0CA 2HZLA 2Q9TA 2XXVA 4KYEA 3M8UA 5ITOA 3QUJA 4IGRA 4OFOA 5F7VA 3HV1A 4HTGA 2DVZA 1HSEA 2O1MA 2O6AA 1B58A 5EHSA 3SESA 1MQJA 3U72A 1JNFA 1DPPA 1OVTA 3K6UA 3KG2A 3EQ1A 1MQDA 4EQ7A 4F3SA 1LFHA 1D9YA 3TEPA 3MVWA 1MDP1 2XD2A 3W15C 4BDNA 1GV8A 2F35A 2XXPA 2GHAA 4N07A 4QSCA 3S4UA 3PU5A 1QKAA 1MPBA 3LSXA 4XIGQ 3N5LA 3LSWA 3UGWA 3O29A 1Y1ZA 1YAEA 3OENA 3PUWE 3ONMA 4I8CA 1SBPA 4R6HA 5B70A 1XHYA 2V3UA 1Y3NA 4R2FA 3ZSFA 3K4UA 3BFTA 3CI8A 4FAJA 2OWSA 1II5A 2ZYOA 1ZTYA 2I3WA 3E9XA 3IOUA 4FJPA 4M1VA 5ISUA 5K2XA 1NNFA 4DE8A 4JWOA 3T22A 3TCFA 3TTKA 1R6ZA 4HW8A 5KCJA 2DOJA 2YJPA 5FHNA 2BJJX 1MH3A 1FTLA 1EZOA 2NVUB 3PGFA 1LCFA 3I5OA 1FQBA 1USYE 1M5BA 1ZKBA 2UVGA 3G3HA 1WDNA 3B6TA 1WODA 3G3GA 3JZJA 4GFRA 4PE5B 3T9UA 3TPAA 3UA8A 3V89B 4PFTA 3E3KA 2DWAA 2AIXA 2ZNTA 2Z8DA 3MPLA 4XXUA 2X26A 3H6UA 4EF2A 3PUVE 1VSOA 5CC2A 3USDA 4YMBA 1OLAA 1PB9A 4G8NA 1M5CA 2FNCA 2PT1A 1S7YA 3OO7A 4H5GA 3KGCA 2UXAA 3MVZA 3V8XB 1YCJA 3FASA 4GL8A 3T93B 2D21A 2ANJA 2X7PA 1S9TA 3FJ7A 1O7TA 1ZU0A 3SEUA 1LAGE 4MH5A 1MPCA 3R26A 3S9EA 5EHMA 4OHNA 3TMGA 3HSTA 1N7XA 4DLDA 5HM4B 4OEVA 1MQGA 4G68C 1BKAA 1FCKA 1IXIA 2XXIA 3FXRA 5FHOA 4GD5A 1Y3PA 3Q29A 2PX1A 3K1NA 1B1HA 4F1YA 3L6HA 4BDOA 1FTMA 2Z22A 4KYDA 5H8SA 3GZGA 3SEXA 4GXAA 4KCDA 3W9WA 4WKMA 3G3FA 5DVFA 3CFLA 4NF4A 3DM0A 2VD2A 4EDPA 3MP6A 2QPQA 3MWBA 4XKRA 3DP6A 2VD3A 2O69A 1Y20A 2XXHA 4ZEIA 1WVJA 2Q2AA 3UK4A 4YB6A 1N7WA 4H6DA 1BLFA 4BLAA
chains in the Genus database with same CATH superfamily
1D9VA 4PFRA 3GXAA 4G61A 3K6VA 1DMBA 3HO7A 1LB9A 4EXKA 1KZ8A 2I48A 3TTRA 1EZPA 4ZZEA 3VVEA 1KWHA 1LB8A 2QVUA 3S2VA 3P7IA 1A8FA 4KR5A 1FTJA 4FBPA 2DWHA 5JTYA 5CMKA 1NKXA 3TCGA 1FPBA 1SVXB 4R6KA 4F29A 3FBPA 3VXBA 3MC2A 4YKIA 1LBZA 4PTKA 1O64A 3ECRA 3QUFA 3I6VA 5FHMA 1B3EA 1FBCA 2CEXA 2P2AA 2O68A 1IITA 1NI9A 2NUVA 3T0JA 1UTBA 4ZE9A 5H8QB 3OSRA 1RDYA 1LAFE 3MZBA 1QVSA 4N91A 1MRPA 4MLQA 1B2HA 4U1OA 2HEUA 3IX1A 4F18A 3G3IA 4NWCA 1D4NA 4POWA 2R9JA 1FTKA 1B4HA 2XXTA 2O84X 2RF1A 4F39A 5LOMA 3E79A 4JSDA 1YPNA 5EYFA 1MY4A 4PF8A 3PPPA 5TP9B 2VGQA 3L6GA 1JVXA 1H76A 1TFAA 4FEBA 1B3LA 3DLNA 2ZYKA 4TLLB 2P0SA 3EF7A 5K2YA 4U23A 2XX7A 1DCUA 1NUZA 2H25A 5F1QA 3OD7A 4IY6A 1LFGA 2B3FA 3CG1A 3GLBA 1EYKA 4LONB 4GBWA 5TU0A 4R6YA 3MVXA 2QMXA 4GWYA 2ONKE 5IGAA 5I59B 1JW5A 4NF5B 4NG7A 5CMBA 1MXWA 3C31A 1NUXA 1Q35A 1JQFA 3IJXB 4KD5A 4RPOA 2HCAA 3G7WA 1M5EA 1FPGA 3T66A 4G68B 4R73A 1NV2A 1VR5A 3S9NC 4OFLA 4ZEBA 3RN8A 2ZZWA 3AXFA 5DTBA 5ITPA 4IO2A 1Z7ME 2OBGA 5H8NB 1LBCA 4AS4A 3FXQA 1SDXA 2FA7A 3TZAA 1SPIA 1NMUA 3PD8A 5EYGA 1GVCA 2ZNUA 4LA9A 3MBPA 1B6HA 2GRVA 5DW8A 1MH4A 3FVKA 1P1QA 4UABA 3CFXA 3K6XA 4WXJA 3FD3A 2XWOA 1VFDA 2W7YA 2ZYNA 2PFYA 4P3LA 3H6WA 4FIMA 2F3DA 2I0CA 1INPA 5AA4A 3IO6A 5I57B 2OWTA 5AE4A 3FZVA 4RYAA 1BTJA 2ONRA 4QSEA 2F6PA 4OVSA 2Y7KA 1JW4A 4LZ5A 4UACA 4LQ5A 1I69A 2M8CA 3IB1A 1FQAA 3PUYE 4PETA 1LCTA 3TDJA 3K1MA 4QFNA 4DXCA 1SYIA 1MPDA 1XI6A 4H1XA 1R9QA 4IY5A 1FW0A 4RK2A 4XKNA 2Y7WA 4OETA 1GTKA 2QS3A 1TXFA 3B6QA 3MZ9A 1DBZA 2RCBA 4HE1A 4LZ7A 1BP5A 5TPAA 5ICTA 1D3KA 3HCQA 1ANFA 2V93A 4F3PA 3IOTA 3IB0A 4NF0A 4G8HA 4HXVA 1NV3A 1B7HA 1VE4A 1XVYA 1DSNA 3OSQA 2VOZA 4RNSA 4O3BA 4ESWA 2FVZA 3EHTA 4QXDA 1ZMGA 2DXYA 4ZE8A 5DYHA 1ZBMA 3B6WA 1MG1A 5DEXB 4YB7A 4ZECA 4NGUA 5AA2B 4BDQA 1H45A 3C35A 1NV1A 2Y7RA 1HSJA 3GBAA 4C1TA 1MQHA 1F9BA 2GQ1A 3KSXA 5I7IA 1OMPA 1Y4CA 2PMSA 3N6TA 3TCHA 1OLCA 4THIA 2FYIA 1OQGA 1MXYA 4LVQA 1RYXA 4ELRA 4X04A 3THIA 3KFMA 3QK6A 1URSA 4MX6A 3U8QA 4OXVA 4G4PA 1NV7A 3K0VA 2ALUA 3T9VA 3SEWA 5I56B 4OANA 5F24A 1RDXA 1EZ9A 2QSXA 3VVFA 4ESXA 1YXIA 2F5XA 2QRYA 4EF1A 3ZSFA 4NTLA 5M2VA 3M8UA 2HXRA 4IGRA 2QVVA 4OFOA 3HV1A 1B58A 5EHSA 3U72A 1JNFA 4EQ7A 3TEPA 4BDNA 1MDP1 2XXPA 3IFAA 3S4UA 3PU5A 4QBAA 5EQAA 3OENA 4PGNA 1Y3NA 2MKZA 2OWSA 2WEFA 4FJPA 1NNFA 3T22A 3TTKA 2YJPA 3PGFA 4F1VA 4OZ9A 1WDNA 3B6TA 1IMBA 3T9UA 2X26A 4KXPA 1PB9A 2PT1A 2UXAA 1IMDA 2ANJA 2X7PA 1S9TA 3FJ7A 1MPCA 5EHMA 4OEVA 2XXIA 1IXIA 4GD5A 1Y3PA 1B1HA 4BDOA 1AWBA 3KC0A 3SEXA 4GXAA 3G3FA 3CFLA 1Y20A 2XXHA 2Q2AA 1AL3A 1UTHA 3LC8A 1N76A 3ZKLA 4JB7A 1JW1A 1FPDA 1NNKA 2YLNA 4KQPA 4PAKA 2CZKA 1AIVA 1MXUA 3UP9A 4PP0A 1IZ1A 4QHQA 4HE0A 5L9SA 3FATA 3T9XB 4PBHA 1L5TA 4OMBA 3M3FA 2ZNSA 4Q30B 4O3AA 4QSDA 3A09A 4LZ8A 3A29A 4RY1A 1USYH 3KZGA 2THIA 1QKBA 1RDZA 2CEYA 1SW4A 2FBPA 3D1RA 3N6UA 3F11A 3ZS6A 3BIHA 2F7CA 5A5XB 2Y7PA 3FVNA 4ELPA 1JVYA 1BK4A 4PF6A 1FQDA 3S9LC 2WYKA 2HPGA 5EQ9A 4UA8A 4XTCQ 2I3VA 3BKIB 5H8FB 4PFIA 4F2OA 2YPNA 3KN3A 4POXA 3C4MA 1NH7A 1B5IA 4U4XA 1EYIA 4YU0A 4NF4B 2O7IA 4MHFA 4F3GA 1LAXA 1QUIA 1UQWA 4N13A 5DT6A 3H03A 5J1DA 1CE2A 3HPIA 4Z0IA 1DTGA 4LATA 2I58A 2VHAA 2VPNA 2DXRA 1FBFA 1PEBA 4IO7A 4FECA 1IXHA 5JEIA 4R9GA 3U93A 4PBQA 5CI5A 2BJIA 1SW5A 3T1BA 5CMCA 2H9BA 3OEKA 3T96B 3UORA 4GLIA 3K02A 3MJNA 3PPOA 4BDMA 1OQHA 3PMWA 3NOHA 3BBRA 1OIBA 3C33A 3VFJA 1JEUA 1YZ0A 4X8RA 4R74A 3RT8A 4IO5A 2GFEA 1IIWA 1UTBB 2Q2CA 1NNPA 1FJ6A 4JSOA 4OVQA 3OO6A 4BDLA 3MYUA 4U21A 4MJOA 4OVRA 1VFEA 3IOVA 1H3DA 2I0BA 1FQCA 4DI3D 4NX1A 3VV5A 5IZ3A 2UVJA 4X48A 4IO3A 1DOTA 2NOOA 3SEVA 4PFUA 4EQBA 3UN6A 2WBBA 4YKJA 3K00A 3CIJA 1B0HA 4X9TA 4GX6A 3E13X 1T0KA 1PC3A 3C9HA 1B1XA 1PBPA 3M3LA 1FBGA 4ELOA 4H6DA 4F19A 1H44A 2G29A 1QGXA 2HAVA 2O7UA 4H8IA 3IL1B 1A54A 1EH3A 2Z8FA 3OELA 3HHFA 2XX8A 5I3SA 5CMMA 5JK4A 1B7UA 5I58A 1TFDA 4XFEA 3IORA 3S9MC 2PYYA 3TODA 3EKIA 4O8MA 3KSJA 4EUOA 2DS9A 1HSLA 2ZMBA 1URGA 4LQ2A 5ET5A 4NF8A 3SDFA 4H46A 1VDWA 3SERA 1A40A 2RC7A 4GQOA 4ND9A 1MY1A 2IEEA 4ZZAA 5B7DA 2VPOA 2GHBA 3PUXE 3RTFB 1EU8A 1RYOA 1QUJA 4IO6A 3FUZA 3I3VA 4AB6A 3RTWB 1ZJLA 2PBWA 5AA2D 1LBXA 5ICQA 4OENA 4NF6B 1FTOA 4IB2A 4MCOA 4PAIA 3LR1A 3HN0A 2D3IA 2F7BA 1FQEA 4JDFA 1SW1A 3MW0A 1LBVA 3RPLB 3RY3A 2DE3A 4H5FA 3RT6B 1G0HA 5AA4B 4N4UA 4QFKA 5KDTA 5I57A 3K1PA 4N81A 3IO4A 4JVCA 4MAGA 2REGA 1P99A 1P1WA 3OO8A 4ZEKA 3PUZE 2XD3A 1G0IA 3H6VA 4LP2B 4GOTA 4GL0A 1B32A 4E0XA 1KA0A 2XWIA 3O2AA 1Q1KA 1Y4TA 4EXLA 1NV6A 1I6AA 3RNNA 5KZTA 2XXRA 3PD9A 2V4CA 3CSBA 2ONSA 4ZEFA 2PCRA 2I4BA 1US4A 3H6TA 4R2BA 4PGPA 4OESA 3RLFE 1FBEA 5EQ7A 1MXZA 5IAIA 3FJMA 4Q8RA 2AYSA 2DE2A 2F7AA 1IEJA 1OVBA 4XKQA 4GWSA 1B3HA 2Y84A 3O6IA 1B3GA 2DE4A 3QUJA 5F7VA 3HFUA 2VT5A 2DVZA 1HSEA 4HTGA 3SESA 1LFHA 1D9YA 3W15C 1QKAA 4XIGQ 3LSWA 1Y1ZA 1YAEA 3BFTA 4FAJA 1ZTYA 3E9XA 5ISUA 4MNIA 4GBVA 1FTLA 1LCFA 3I5OA 3PPQA 1M5BA 4GFRA 2UVGA 3TPAA 2AIXA 2ZNTA 4EF2A 5IZ1A 4G8NA 4H5GA 3MVZA 1YCJA 4GL8A 3T93B 2D21A 1ZU0A 1LAGE 2CZHA 4OHNA 3HSTA 1N7XA 4GWUA 5HM4B 1MQGA 1BKAA 3FXRA 2Q74A 4KCDA 4WKMA 4I40A 2VD2A 3MWBA 2VD3A 4ZEIA 3UK4A 4YB6A 4XXUA 1N7WA 4BLAA 2XWKA 4ISUA 5FTIA 1N3WA 4OQOA 1B51A 3TQWA 2B65A 1LBYA 1PDAA 1B46A 4JBZA 2WYPA 2UVHA 4LUBA 2X7QA 1PB8A 5JTYB 2RKMA 1J1NA 1P1OA 3HHGA 4ELQA 1MDQA 5I2NB 4I1DA 3PTYA 5I5PA 2UVIA 3WAEA 4KFQA 5HBCA 5L8DA 2DDKA 2XXXA 3KBZA 2B4MA 2F3BA 4H0WA 3O9PA 3N94A 1MXVA 1AH5A 3JV9A 3BFUA 4TLMB 4Q5TA 1QUKA 3LSLA 2Q8JA 5AA3A 1B5JA 3O28A 2OK2A 4P1EA 4WEDA 4Z7EA 1FPIA 1B05A 4QFOA 4PFYA 2QVRA 3IAZA 4G8MA 5TP9A 1FSAA 4E0WA 4YB5A 3FV2A 2ABHA 1AMFA 2WKYA 1O63A 1GGGA 4F3BA 2PFZA 3QSLA 3EHUA 4P11A 4DI4B 4O7MA 4O94A 4R72A 2F97A 3CSGA 4QRZA 4EQ9A 2ZXTA 4OTEA 3H4ZA 4JXIA 1ATGA 4PCDA 1ZLQA 1K9YA 4FORA 5ESYA 4N8GA 4DIGA 1FBDA 2UYFA 3G3JA 4L17A 4G77A 3MVYA 5KCJB 2XXWA 2F6GA 3PV0E 3QAXA 1MQIA 3Q27A 2R71A 4P0IA 3E4RA 5AA2A 3OEMA 5BUUA 3N26A 1IMCA 4NF5A 1SQYA 1FBHA 1I6QA 3OO9A 2A5TA 1IMEA 1JEVA 4RJZA 2Z8EA 4F31B 4N17A 3BIGA 4HCWA 5L9OA 2OCUA 1H43A 3JYRA 1K9ZA 4NN3A 1LEVA 2Y5LA 1IMFA 1MY3A 4I3EA 4PFBA 3ILTB 4ZDMA 4JVDA 2QL3A 2V3QA 2QJEA 2XXQA 1A7LA 1SD3A 1S50A 1D9QA 4RXLA 1MM6A 3ROJA 1A8EA 4DZ1A 4M4GA 5EQ8A 3FGSA 1N3XA 3TTMA 2F36A 3MP1A 1Y9UA 3O6HA 2LAOA 3LV0A 1UIVA 1Y3QA 1POY1 1NUWA 3TKDA 3DP4A 5ET6A 3RPWA 5LDZA 4YMAA 3K2DA 4KHZE 4MLVA 3C34A 4HE2A 2GH9A 2H5YA 3ODBA 2P3NA 3U92A 3KN8A 3TCFA 2O51A 1POTA 4RK9A 3O6GA 4FATA 2Y7IA 4HS7A 4OWDA 3C32A 4TQUQ 2ESNA 5H8HA 3RQTA 4H45A 1TT1A 3QMFA 2OLBA 5ELVA 5TPAB 3TQLA 1LBWA 1B7ZA 4F1UA 2NWJA 4IGTA 4GWOA 3SZPA 1LSTA 1SW2A 1P1NA 1UTHB 4GWWA 3IOWA 4GF8A 3MAMA 3KN7A 2XXYA 4DCXA 3ISPA 3PMXA 4NE4A 2H98A 3O66A 3GBBA 4KYSA 3LBSA 3FXBA 3D4CA 3W9VA 4PFWA 4QFLA 4GWXA 4O3CA 3A3UA 1NFTA 1IXCA 4JWYA 4QFPA 1MS7A 3KEIA 4I9DA 1I6BA 4K3FA 4P47A 3A3CA 4AB5A 2PT2A 4YAHX 5DEXA 3V5AA 3FVOA 4PDHA 3Q25A 3FIRA 4P0GA 4ONYA 3FVGA 1R1NA 1JETA 5ET7A 4TOZA 5A5XA 1MY0A 5IZZA 1N84A 1NV5A 1XC1A 1FPLA 1MM7A 2Q89A 1EYJA 3Q26A 4FEDA 1ZIUA 4XF5A 2Q88A 4ECFA 1N04A 5I56A 4OFJA 4OVPA 4C0RA 1XVXA 2RC9A 2JJKA 1B4ZA 1GR2A 3CRBA 5I2KB 2H99A 2DWJA 2XHDA 4U22A 2RINA 3QYTA 4Q0CA 2HZLA 2Q9TA 5ITOA 4N8YA 2O1MA 1MQJA 3K6UA 1DPPA 1OVTA 3KG2A 5EYHA 3EQ1A 1MQDA 2XD2A 1GV8A 4QSCA 3LSXA 4MMPA 3O29A 4R6HA 3PUWE 3ONMA 1SBPA 2V3UA 4R2FA 2I3WA 3IOUA 4M1VA 5K2XA 4DE8A 1R6ZA 5FHNA 1FQBA 1USYE 3G3HA 3TAJA 3V89B 4PFTA 3E3KA 2DWAA 4O7IA 3MPLA 1VSOA 3USDA 4YMBA 1OLAA 1M5CA 1S7YA 3OO7A 3FASA 1O7TA 4N15A 3SEUA 4MH5A 3R26A 3S9EA 2ZZXA 4DLDA 4G68C 1FPEA 1FCKA 5FHOA 2PX1A 2WX9A 4KYDA 3GZGA 3W9WA 5DVFA 3DM0A 3MP6A 2QPQA 1WVJA 1BLFA 3CHGA 3TTLA 3ZKKA 4PDDA 3KJ7A 2OJTA 4GIZA 4I3YA 5J16A 1UIUA 2V3TA 4N6PA 3FXUA 4R9FA 4JWXA 4OVJA 1YYZA 4P56A 4X1BA 3KJTA 2FHYA 1IQ7A 3IFCA 3KC1A 4PAFA 2R6GE 3TUSA 1YTVA 1FPFA 1Z7NE 2DWIA 2NXOA 3CG3A 1URDA 3H7MA 2R8TA 2RCAA 5DVIA 4PQJA 2O1LA 4MF3A 2KLFA 3QXMA 3R7XA 5I84A 4DXBA 4AS5A 4G68A 2DVCA 4N6DA 2F8DA 2QS1A 3TYHA 4YZZA 1LBBA 4GX3A 1M5DA 4X1DA 3PPNA 5FBPA 5I58B 4MNPA 3KBRA 2DSFA 2OZZA 2E0SA 4JVIA 4OERA 2Z23A 1NUYA 3EN3A 3U94A 4WEPA 3K01A 3V83A 3IR1A 5H8FA 2A5TB 3FV1A 1NL5A 3O97A 4XEQA 2CZLA 3PPRA 3TELA 3H3GA 1QW0A 1LAHE 3T9HB 1FQFA 5LTCA 4OVTA 1QULA 4H8JA 4R75A 3SETA 2XX9A 2AL5A 5CM6A 5IKBA 1DK4A 4ZEDA 1SI1A 1SI0A 1PBQA 1SYHA 5H8QA 4FE8A 1XOCA 1CB6A 3LSFB 2CMOA 3TFLA 3MP8A 2IA4A 5CBSA 2I49A 1IXGA 2KR0A 4GWZA 5CBRA 1Q9DA 5A5LA 4OA4A 2HXWA 3VVDA 1MY2A 5I2NA 1R9LA 4GVOA 4NEDA 3VXCA 3OXNA 3CFZA 3VLUA 4LN5A 2QMWA 3Q28A 2XXUA 3DELB 2P1SA 3LUZA 3C36A 1DTZA 2I4CA 5L9MA 3R6UA 4MFIA 1DPEA 3B7DA 4OEUA 4BDRA 3E78A 1B40A 1XT8A 1TWYA 3CVGA 3IJOB 4MEVA 4U4SA 5FTHA 4NQ8A 1CNQA 4U1ZA 1PB7A 3MUQA 1B3FA 5H8HB 2L5VA 4DXUA 2HQ0A 5I59A 3B50A 3EPEA 2H4IA 3GYYA 3UIFA 4NAPA 2UYEA 3LUYA 4G2ZA 1NV4A 4HCYA 1N0TA 4I62A 2XA5A 2KQZA 2I6EA 4AQ4A 4N6KA 1A99A 3MQ9A 1FPKA 5CRYA 2REJA 3TTNA 3QIMA 3G3KA 4MNCA 3B8BA 4ZS9A 3M3KA 4NMYA 1M5FA 3CR9A 2OWZA 2G93A 4H67A 2FIXA 2B3BA 3SEYA 2DYXA 4RPNA 4NWDA 1JP4A 3D4GA 1NH8A 1BIYA 4KPTA 1QJMA 3H06B 5H8NA 1FPJA 1IMAA 1B52A 2QS2A 1US5A 4NF8B 3ILUB 5BWJA 4P1LA 1XS5A 3OOAA 4F2QA 5AA1A 4QF9A 4F22A 1B0LA 4GX4A 3RUMA 1IUDA 4U2RA 2ZZVA 1FBPA 1LGBC 1Y1MA 4MBPA 3VDFA 1FRPA 4YICA 3KOTA 3DP8A 2F78A 2XWVA 2AL4A 3FJGA 1LFIA 2DP8A 3SKPA 2E1SA 4DDDA 3K6WA 4NF6A 2B4LA 3RGYA 4KCCA 1FTAA 2HZKA 2QS4A 2V84A 5I2KA 2D5WA 2HAUA 2VP1A 3MZ1A 4GRKA 4GXSB 2HFBA 2ZYMA 2HHMA 3IB2A 2PVUA 2Q8MA 2DQVA 1B5HA 1NNTA 4IO4A 4C1UA 3EHSA 4RA1A 1KA1A 2A5SA 3RPLA 2XXKA 4P8BA 3KOSA 3IK6B 5KDTB 2P3VA 4KI0E 3VLWA 4YKPA 1ELJA 5ET8A 4OYVA 4PC9A 5DVJA 3WAFA 1LLSA 2V25A 1P1UA 1B9JA 2RC8A 5HPQA 4DCYA 1RKMA 3OMBA 3RYDA 1MXXA 3PMVA 4P9KA 3MPKA 4IR8A 2CZIA 5IZ3B 1A55A 4H65A 4XKPA 2F34A 1FJ9A 1AOVA 2OX3A 4KYEA 2XXVA 4PE3A 4NHBA 5T3JA 3U1OA 2O6AA 4F3SA 3MVWA 2F35A 2GHAA 4N07A 1MPBA 3N5LA 2WBDA 3UGWA 4I8CA 3U65A 5B70A 1XHYA 3K4UA 3CI8A 2QFLA 1II5A 2ZYOA 1NV0A 3MSTA 4JWOA 4HW8A 5KCJA 2DOJA 1EZOA 2BJJX 1MH3A 2NVUB 1ZKBA 4PE5B 1WODA 3G3GA 3JZJA 3UA8A 2Z8DA 3H6UA 3PUVE 5CC2A 3VE1B 3VLVA 2FNCA 3V8XB 3KGCA 3TMGA 4F1YA 3Q29A 3K1NA 3L6HA 5IM2A 1FTMA 2Z22A 5H8SA 2FIEA 4NF4A 4EDPA 2Y5KA 4XKRA 3DP6A 2O69A 4MIJA 4YKKA
chains in the Genus database with same CATH topology
1D9VA 3TTLA 1AL3A 3ZKKA 3GXAA 3KJ7A 3K6VA 1DMBA 3HO7A 1UTHA 1LB9A 4ISUA 5FTIA 2OJTA 1N3WA 3LC8A 4GIZA 4EXKA 4DDDA 1UIUA 2I48A 1N76A 3ZKLA 4JB7A 4OQOA 2V3TA 4N6PA 3TTRA 1EZPA 1JW1A 3FXUA 4R9FA 4ZZEA 1B51A 4JWXA 1KWHA 4OVJA 1LB8A 2B65A 4KQPA 1NNKA 1PDAA 2YLNA 4X1BA 3S2VA 1B46A 3KJTA 3P7IA 1IQ7A 4JBZA 1A8FA 4KR5A 1FTJA 2UVHA 2DWHA 4LUBA 2X7QA 1AIVA 2R6GE 1MXUA 5JTYA 1YTVA 1PB8A 3TUSA 3UP9A 5CMKA 1NKXA 3TCGA 1Z7NE 2DWIA 4PP0A 1IZ1A 2NXOA 1SVXB 4QHQA 5JTYB 5L9SA 3FATA 3CG3A 2RKMA 1J1NA 1P1OA 3HHGA 4ELQA 1MDQA 3T9XB 1URDA 3H7MA 4R6KA 4F29A 5I2NB 1L5TA 4I1DA 3VXBA 3MC2A 4YKIA 3TQWA 4OMBA 3M3FA 2UVIA 2ZNSA 4Q30B 1O64A 4O3AA 2RCAA 4QSDA 5DVIA 4PQJA 3A09A 3WAEA 3ECRA 3QUFA 4KFQA 3I6VA 4LZ8A 2O1LA 4MF3A 5FHMA 5HBCA 4RY1A 5L8DA 2KLFA 1B3EA 2XXXA 1USYH 3KZGA 2THIA 3QXMA 1QKBA 2P2AA 3R7XA 2O68A 1IITA 5I84A 2NUVA 4H0WA 3N6UA 1SW4A 3O9PA 4DXBA 4G68A 2DVCA 1UTBA 3N94A 4ZE9A 2F8DA 2QS1A 1MXVA 3F11A 3TYHA 1AH5A 3JV9A 3BFUA 4YZZA 5H8QB 3OSRA 1LBBA 4Q5TA 4TLMB 3ZS6A 2F7CA 1M5DA 5A5XB 1QUKA 2Y7PA 1LAFE 4X1DA 3VE1B 3MZBA 3FVNA 3LSLA 1QVSA 4ELPA 2Q8JA 3PPNA 1MRPA 4MLQA 5AA3A 5I58B 1B2HA 1B5JA 1JVYA 2OK2A 3KBRA 3O28A 2DSFA 4U1OA 2OZZA 4WEDA 2HEUA 3IX1A 4Z7EA 1FQDA 3S9LC 1B05A 2E0SA 4F18A 3G3IA 4UA8A 4XTCQ 2I3VA 4OERA 4PFYA 2Z23A 3BKIB 3EN3A 4QFOA 4NWCA 5H8FB 3U94A 4F1VA 1D4NA 4POWA 2R9JA 4WEPA 3K01A 4F2OA 1FTKA 3V83A 1B4HA 2XXTA 2YPNA 2O84X 2RF1A 4F39A 3IR1A 5H8FA 5LOMA 3KN3A 3IAZA 4POXA 4G8MA 4JSDA 1YPNA 2A5TB 3C4MA 5EYFA 3FV1A 5TP9A 1NL5A 1MY4A 1NH7A 3O97A 4E0WA 2CZLA 3PPPA 4YB5A 3FV2A 2ABHA 1AMFA 1B5IA 1O63A 2WKYA 1GGGA 3PPQA 4U4XA 5TP9B 2VGQA 3L6GA 4F3BA 1JVXA 3QSLA 4NF4B 4YU0A 1H76A 1TFAA 2O7IA 3EHUA 4P11A 3PPRA 4FEBA 1B3LA 3TELA 4F3GA 1LAXA 1QUIA 1UQWA 3DLNA 3H3GA 4N13A 5DT6A 1QW0A 2ZYKA 1LAHE 3H03A 4TLLB 2P0SA 3T9HB 1FQFA 4R72A 1QULA 2F97A 3CSGA 4H8JA 4QRZA 5J1DA 1CE2A 4EQ9A 4R75A 3HPIA 2ZXTA 4OTEA 3H4ZA 4JXIA 3SETA 1ATGA 1DTGA 2XX9A 2AL5A 3EF7A 4LATA 4Z0IA 5K2YA 2I58A 5CM6A 5IKBA 4U23A 1ZLQA 2VHAA 2XX7A 4ZEDA 2H25A 4FORA 1SI1A 5F1QA 2DXRA 3OD7A 1SI0A 1PBQA 1PEBA 4IY6A 1SYHA 4DIGA 1LFGA 2B3FA 3CG1A 2UYFA 1IXHA 4FECA 4IO7A 5H8QA 3GLBA 5JEIA 4R9GA 4FE8A 1XOCA 3U93A 1CB6A 3LSFB 3G3JA 4L17A 4LONB 2CMOA 5CI5A 3MP8A 2IA4A 4G77A 3TFLA 5CBSA 2I49A 1IXGA 1SW5A 5TU0A 3MVYA 5CMCA 5KCJB 2H9BA 4R6YA 3MVXA 2QMXA 3OEKA 3T96B 2ONKE 2XXWA 2F6GA 3PV0E 3QAXA 1MQIA 3UORA 3Q27A 5CBRA 5I59B 2R71A 1JW5A 4NF5B 4GLIA 2HXWA 4P0IA 3E4RA 5AA2A 5CMBA 1MXWA 3K02A 3MJNA 1MY2A 3OEMA 3PPOA 3VVDA 3C31A 5BUUA 3N26A 5I2NA 4NF5A 4BDMA 1SQYA 1OQHA 1R9LA 3PMWA 3BBRA 4GVOA 1OIBA 1Q35A 1JQFA 3C33A 4NEDA 1I6QA 3IJXB 3OO9A 4KD5A 2A5TA 4RPOA 1JEUA 3VFJA 3VXCA 3OXNA 2HCAA 4R74A 3CFZA 3RT8A 3VLUA 1JEVA 3G7WA 4RJZA 4IO5A 2GFEA 2QMWA 2Z8EA 4F31B 3Q28A 1IIWA 1M5EA 2XXUA 3DELB 2P1SA 3C36A 4G68B 3T66A 1UTBB 4R73A 2Q2CA 4HCWA 1NNPA 5L9OA 1VR5A 4YKKA 3S9NC 2OCUA 4JSOA 1DTZA 1H43A 3JYRA 3OO6A 4OFLA 4BDLA 2I4CA 4ZEBA 5L9MA 3R6UA 3RN8A 4MFIA 4U21A 3AXFA 1DPEA 5DTBA 3B7DA 5ITPA 4IO2A 4OEUA 4BDRA 3VLVA 1VFEA 3IOVA 1H3DA 1Z7ME 2OBGA 1B40A 1XT8A 1TWYA 2I0BA 1MY3A 1FQCA 3CVGA 5H8NB 1LBCA 3FXQA 3IJOB 1SDXA 3ILTB 4ZDMA 2FA7A 4U4SA 5FTHA 3VV5A 3TZAA 2UVJA 4X48A 4IO3A 1NMUA 3PD8A 2QL3A 1DOTA 1GVCA 4U1ZA 2ZNUA 1PB7A 3MUQA 1B3FA 2NOOA 2V3QA 3MBPA 4LA9A 5H8HB 3SEVA 1B6HA 4DXUA 2HQ0A 5I59A 4PFUA 3EPEA 4EQBA 2GRVA 2QJEA 2H4IA 3UN6A 2XXQA 4YKJA 3UIFA 1A7LA 1MH4A 1S50A 1SD3A 3K00A 2UYEA 3CIJA 3LUYA 1MM6A 3FVKA 1P1QA 1A8EA 3CFXA 1B0HA 3K6XA 4RXLA 3FD3A 4G2ZA 4WXJA 4X9TA 4DZ1A 1VFDA 4M4GA 4HCYA 1N0TA 2W7YA 2ZYNA 3FGSA 3E13X 4I62A 1N3XA 3H6WA 4FIMA 2I0CA 1T0KA 3TTMA 2F36A 5KDTA 3MP1A 5AA4A 1Y9UA 3IO6A 2I6EA 1PC3A 2LAOA 3C9HA 3O6HA 4AQ4A 5I57B 1B1XA 1UIVA 1A99A 1PBPA 2OWTA 5AE4A 3M3LA 1Y3QA 3MQ9A 1POY1 3FZVA 5CRYA 4ELOA 4RYAA 2REJA 3V5AA 1BTJA 2ONRA 4F19A 4QSEA 3TKDA 3TTNA 3QIMA 3G3KA 2F6PA 1H44A 3DP4A 3RPWA 2G29A 4YMAA 2HAVA 4ZS9A 3M3KA 2Y7KA 2O7UA 3K2DA 4KHZE 4MLVA 4H8IA 1JW4A 4NMYA 1M5FA 3CR9A 4LZ5A 4UACA 3IL1B 1A54A 3C34A 4LQ5A 1I69A 2G93A 2GH9A 2H5YA 2M8CA 4H67A 1EH3A 2B3BA 3IB1A 3SEYA 2Z8FA 2DYXA 3HHFA 3ODBA 3OELA 2XX8A 4NWDA 4RPNA 5CMMA 1FQAA 3D4GA 3U92A 5JK4A 3PUYE 4PETA 1B7UA 5I58A 1NH8A 1TFDA 3IORA 1BIYA 1LCTA 3KN8A 3K1MA 4KPTA 1QJMA 3H06B 2PYYA 4QFNA 2O51A 1SYIA 1MPDA 5H8NA 4DXCA 3S9MC 1POTA 4H1XA 4RK9A 1B52A 1R9QA 3TODA 2QS2A 1US5A 4NF8B 3KSJA 3O6GA 4EUOA 3ILUB 2DS9A 1FW0A 1HSLA 2Y7IA 2ZMBA 4HS7A 1URGA 4IY5A 4FATA 5BWJA 4RK2A 4LQ2A 4XKNA 2Y7WA 1XS5A 3C32A 3OOAA 4OWDA 4TQUQ 4NF8A 4F2QA 4OETA 2ESNA 3SDFA 1GTKA 5AA1A 3SERA 4QF9A 5H8HA 2QS3A 1TXFA 1A40A 2RC7A 3RQTA 1TT1A 4GQOA 3B6QA 4ND9A 3MZ9A 2OLBA 5ELVA 5TPAB 1MY1A 2IEEA 2RCBA 4ZZAA 4F22A 1B0LA 3TQLA 4AB6A 5B7DA 2GHBA 3RUMA 1IUDA 4U2RA 1B7ZA 4F1UA 4LZ7A 1BP5A 3PUXE 5TPAA 2NWJA 4IGTA 5ICTA 1D3KA 3HCQA 4GWOA 1LGBC 3RTFB 1ANFA 1Y1MA 4MBPA 2V93A 3VDFA 4F3PA 4YICA 1LSTA 3IOTA 1EU8A 3IB0A 3KOTA 1SW2A 3DP8A 1P1NA 1UTHB 2F78A 2AL4A 3FJGA 1RYOA 1QUJA 1LFIA 3IOWA 2DP8A 4IO6A 4G8HA 3SKPA 2E1SA 3FUZA 3I3VA 3K6WA 4GF8A 3MAMA 4NF6A 1B7HA 2XXYA 1VE4A 1ZJLA 2PBWA 3KN7A 3PMXA 4NE4A 3RTWB 4DCXA 5AA2D 1XVYA 5ICQA 2H98A 4OENA 4NF6B 3O66A 3GBBA 1FTOA 4KYSA 3LBSA 3RGYA 1DSNA 3OSQA 4IB2A 2VOZA 4KCCA 4RNSA 3D4CA 3W9VA 4O3BA 3LR1A 4PFWA 3EHTA 4QFLA 2HZKA 2QS4A 3HN0A 4ESWA 2V84A 4O3CA 2D3IA 5I2KA 2D5WA 1ZMGA 2DXYA 2HAUA 4ZE8A 3A3UA 5DYHA 1NFTA 1IXCA 4JWYA 4QFPA 1MS7A 3KEIA 1ZBMA 2F7BA 3B6WA 4I9DA 2VP1A 1I6BA 1FQEA 1MG1A 4JDFA 3MZ1A 4GRKA 4GXSB 2HFBA 2ZYMA 1SW1A 3MW0A 4K3FA 5DEXB 3A3CA 3IB2A 4YB7A 4AB5A 2PVUA 2PT2A 4ZECA 3RY3A 5AA2B 4YAHX 4BDQA 2DQVA 1B5HA 1NNTA 1H45A 2DE3A 3C35A 4IO4A 5DEXA 4C1UA 3EHSA 4H5FA 3FVOA 4RA1A 3RT6B 3TDJA 2Y7RA 1HSJA 3GBAA 2A5SA 1MQHA 4QFKA 4C1TA 3K1PA 5AA4B 1F9BA 5I57A 3IO4A 3Q25A 3U1OA 3KSXA 1OMPA 1Y4CA 3FIRA 4P0GA 3KOSA 3IK6B 2PMSA 2REGA 1P99A 4ONYA 5KDTB 3N6TA 4KI0E 1P1WA 3FVGA 3OO8A 3TCHA 4ZEKA 1OLCA 1R1NA 3VLWA 3PUZE 2XD3A 4YKPA 1ELJA 4THIA 3H6VA 4LP2B 1JETA 2FYIA 1OQGA 1MXYA 3TAJA 4TOZA 4GOTA 4GL0A 4OYVA 5A5XA 4LVQA 1B32A 1MY0A 1RYXA 4E0XA 4ELRA 3THIA 3O2AA 5DVJA 3KFMA 1Q1KA 3WAFA 1Y4TA 1N84A 3QK6A 4EXLA 1LLSA 2V25A 1XC1A 1P1UA 1URSA 1I6AA 1MM7A 2Q89A 1B9JA 2RC8A 3RNNA 2XXRA 3PD9A 5HPQA 3Q26A 3CSBA 4FEDA 2ONSA 5KZTA 1ZIUA 2Q88A 4ZEFA 4OXVA 3U8QA 3VVEA 4G4PA 4DCYA 3K0VA 4ECFA 1RKMA 2I4BA 1US4A 2ALUA 3H6TA 3OMBA 4R2BA 1N04A 4OESA 3RLFE 5I56A 1MXXA 4OFJA 3T9VA 3PMVA 4C0RA 1MXZA 3SEWA 1XVXA 5I56B 5IAIA 3MPKA 4OZ9A 3FJMA 2RC9A 1B4ZA 2AYSA 4Q8RA 1EZ9A 1GR2A 3CRBA 5I2KB 2DE2A 1A55A 2QSXA 3VVFA 4ESXA 2H99A 2F7AA 1IEJA 1OVBA 2DWJA 2F5XA 2QRYA 4H65A 4XKQA 4EF1A 2XHDA 1B3HA 2Y84A 2F34A 3O6IA 2RINA 4NTLA 4U22A 4XKPA 5M2VA 1B3GA 3QYTA 1AOVA 2DE4A 4Q0CA 2HZLA 2Q9TA 2XXVA 4KYEA 3M8UA 5ITOA 3QUJA 4IGRA 4OFOA 5F7VA 3HV1A 4HTGA 2DVZA 1HSEA 2O1MA 2O6AA 1B58A 5EHSA 3SESA 1MQJA 3U72A 1JNFA 1DPPA 1OVTA 3K6UA 3KG2A 3EQ1A 1MQDA 4EQ7A 4F3SA 1LFHA 1D9YA 3TEPA 3MVWA 1MDP1 2XD2A 3W15C 4BDNA 1GV8A 2F35A 2XXPA 2GHAA 4N07A 4QSCA 3S4UA 3PU5A 1QKAA 1MPBA 3LSXA 4XIGQ 3N5LA 3LSWA 3UGWA 3O29A 1Y1ZA 1YAEA 3OENA 3PUWE 3ONMA 4I8CA 1SBPA 4R6HA 5B70A 1XHYA 2V3UA 1Y3NA 4R2FA 3ZSFA 3K4UA 3BFTA 3CI8A 4FAJA 2OWSA 1II5A 2ZYOA 1ZTYA 2I3WA 3E9XA 3IOUA 4FJPA 4M1VA 5ISUA 5K2XA 1NNFA 4DE8A 4JWOA 3T22A 3TCFA 3TTKA 1R6ZA 4HW8A 5KCJA 2DOJA 2YJPA 5FHNA 2BJJX 1MH3A 1FTLA 1EZOA 2NVUB 3PGFA 1LCFA 3I5OA 1FQBA 1USYE 1M5BA 1ZKBA 2UVGA 3G3HA 1WDNA 3B6TA 1WODA 3G3GA 3JZJA 4GFRA 4PE5B 3T9UA 3TPAA 3UA8A 3V89B 4PFTA 3E3KA 2DWAA 2AIXA 2ZNTA 2Z8DA 3MPLA 4XXUA 2X26A 3H6UA 4EF2A 3PUVE 1VSOA 5CC2A 3USDA 4YMBA 1OLAA 1PB9A 4G8NA 1M5CA 2FNCA 2PT1A 1S7YA 3OO7A 4H5GA 3KGCA 2UXAA 3MVZA 3V8XB 1YCJA 3FASA 4GL8A 3T93B 2D21A 2ANJA 2X7PA 1S9TA 3FJ7A 1O7TA 1ZU0A 3SEUA 1LAGE 4MH5A 1MPCA 3R26A 3S9EA 5EHMA 4OHNA 3TMGA 3HSTA 1N7XA 4DLDA 5HM4B 4OEVA 1MQGA 4G68C 1BKAA 1FCKA 1IXIA 2XXIA 3FXRA 5FHOA 4GD5A 1Y3PA 3Q29A 2PX1A 3K1NA 1B1HA 4F1YA 3L6HA 4BDOA 1FTMA 2Z22A 4KYDA 5H8SA 3GZGA 3SEXA 4GXAA 4KCDA 3W9WA 4WKMA 3G3FA 5DVFA 3CFLA 4NF4A 3DM0A 2VD2A 4EDPA 3MP6A 2QPQA 3MWBA 4XKRA 3DP6A 2VD3A 2O69A 1Y20A 2XXHA 4ZEIA 1WVJA 2Q2AA 3UK4A 4YB6A 1N7WA 4H6DA 1BLFA 4BLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D9V A;  3TTL A;  1AL3 A;  3ZKK A;  3GXA A;  3KJ7 A;  3K6V A;  1DMB A;  3HO7 A;  1UTH A;  1LB9 A;  4ISU A;  5FTI A;  2OJT A;  1N3W A;  3LC8 A;  4GIZ A;  4EXK A;  4DDD A;  1UIU A;  2I48 A;  1N76 A;  3ZKL A;  4JB7 A;  4OQO A;  2V3T A;  4N6P A;  3TTR A;  1EZP A;  1JW1 A;  3FXU A;  4R9F A;  4ZZE A;  1B51 A;  4JWX A;  1KWH A;  4OVJ A;  1LB8 A;  2B65 A;  4KQP A;  1NNK A;  1PDA A;  2YLN A;  4X1B A;  3S2V A;  1B46 A;  3KJT A;  3P7I A;  1IQ7 A;  4JBZ A;  1A8F A;  4KR5 A;  1FTJ A;  2UVH A;  2DWH A;  4LUB A;  2X7Q A;  1AIV A;  2R6G E;  1MXU A;  5JTY A;  1YTV A;  1PB8 A;  3TUS A;  3UP9 A;  5CMK A;  1NKX A;  3TCG A;  1Z7N E;  2DWI A;  4PP0 A;  1IZ1 A;  2NXO A;  1SVX B;  4QHQ A;  5JTY B;  5L9S A;  3FAT A;  3CG3 A;  2RKM A;  1J1N A;  1P1O A;  3HHG A;  4ELQ A;  1MDQ A;  3T9X B;  1URD A;  3H7M A;  4R6K A;  4F29 A;  5I2N B;  1L5T A;  4I1D A;  3VXB A;  3MC2 A;  4YKI A;  3TQW A;  4OMB A;  3M3F A;  2UVI A;  2ZNS A;  4Q30 B;  1O64 A;  4O3A A;  2RCA A;  4QSD A;  5DVI A;  4PQJ A;  3A09 A;  3WAE A;  3ECR A;  3QUF A;  4KFQ A;  3I6V A;  4LZ8 A;  2O1L A;  4MF3 A;  5FHM A;  5HBC A;  4RY1 A;  5L8D A;  2KLF A;  1B3E A;  2XXX A;  1USY H;  3KZG A;  2THI A;  3QXM A;  1QKB A;  2P2A A;  3R7X A;  2O68 A;  1IIT A;  5I84 A;  2NUV A;  4H0W A;  3N6U A;  1SW4 A;  3O9P A;  4DXB A;  4G68 A;  2DVC A;  1UTB A;  3N94 A;  4ZE9 A;  2F8D A;  2QS1 A;  1MXV A;  3F11 A;  3TYH A;  1AH5 A;  3JV9 A;  3BFU A;  4YZZ A;  5H8Q B;  3OSR A;  1LBB A;  4Q5T A;  4TLM B;  3ZS6 A;  2F7C A;  1M5D A;  5A5X B;  1QUK A;  2Y7P A;  1LAF E;  4X1D A;  3VE1 B;  3MZB A;  3FVN A;  3LSL A;  1QVS A;  4ELP A;  2Q8J A;  3PPN A;  1MRP A;  4MLQ A;  5AA3 A;  5I58 B;  1B2H A;  1B5J A;  1JVY A;  2OK2 A;  3KBR A;  3O28 A;  2DSF A;  4U1O A;  2OZZ A;  4WED A;  2HEU A;  3IX1 A;  4Z7E A;  1FQD A;  3S9L C;  1B05 A;  2E0S A;  4F18 A;  3G3I A;  4UA8 A;  4XTC Q;  2I3V A;  4OER A;  4PFY A;  2Z23 A;  3BKI B;  3EN3 A;  4QFO A;  4NWC A;  5H8F B;  3U94 A;  4F1V A;  1D4N A;  4POW A;  2R9J A;  4WEP A;  3K01 A;  4F2O A;  1FTK A;  3V83 A;  1B4H A;  2XXT A;  2YPN A;  2O84 X;  2RF1 A;  4F39 A;  3IR1 A;  5H8F A;  5LOM A;  3KN3 A;  3IAZ A;  4POX A;  4G8M A;  4JSD A;  1YPN A;  2A5T B;  3C4M A;  5EYF A;  3FV1 A;  5TP9 A;  1NL5 A;  1MY4 A;  1NH7 A;  3O97 A;  4E0W A;  2CZL A;  3PPP A;  4YB5 A;  3FV2 A;  2ABH A;  1AMF A;  1B5I A;  1O63 A;  2WKY A;  1GGG A;  3PPQ A;  4U4X A;  5TP9 B;  2VGQ A;  3L6G A;  4F3B A;  1JVX A;  3QSL A;  4NF4 B;  4YU0 A;  1H76 A;  1TFA A;  2O7I A;  3EHU A;  4P11 A;  3PPR A;  4FEB A;  1B3L A;  3TEL A;  4F3G A;  1LAX A;  1QUI A;  1UQW A;  3DLN A;  3H3G A;  4N13 A;  5DT6 A;  1QW0 A;  2ZYK A;  1LAH E;  3H03 A;  4TLL B;  2P0S A;  3T9H B;  1FQF A;  4R72 A;  1QUL A;  2F97 A;  3CSG A;  4H8J A;  4QRZ A;  5J1D A;  1CE2 A;  4EQ9 A;  4R75 A;  3HPI A;  2ZXT A;  4OTE A;  3H4Z A;  4JXI A;  3SET A;  1ATG A;  1DTG A;  2XX9 A;  2AL5 A;  3EF7 A;  4LAT A;  4Z0I A;  5K2Y A;  2I58 A;  5CM6 A;  5IKB A;  4U23 A;  1ZLQ A;  2VHA A;  2XX7 A;  4ZED A;  2H25 A;  4FOR A;  1SI1 A;  5F1Q A;  2DXR A;  3OD7 A;  1SI0 A;  1PBQ A;  1PEB A;  4IY6 A;  1SYH A;  4DIG A;  1LFG A;  2B3F A;  3CG1 A;  2UYF A;  1IXH A;  4FEC A;  4IO7 A;  5H8Q A;  3GLB A;  5JEI A;  4R9G A;  4FE8 A;  1XOC A;  3U93 A;  1CB6 A;  3LSF B;  3G3J A;  4L17 A;  4LON B;  2CMO A;  5CI5 A;  3MP8 A;  2IA4 A;  4G77 A;  3TFL A;  5CBS A;  2I49 A;  1IXG A;  1SW5 A;  5TU0 A;  3MVY A;  5CMC A;  5KCJ B;  2H9B A;  4R6Y A;  3MVX A;  2QMX A;  3OEK A;  3T96 B;  2ONK E;  2XXW A;  2F6G A;  3PV0 E;  3QAX A;  1MQI A;  3UOR A;  3Q27 A;  5CBR A;  5I59 B;  2R71 A;  1JW5 A;  4NF5 B;  4GLI A;  2HXW A;  4P0I A;  3E4R A;  5AA2 A;  5CMB A;  1MXW A;  3K02 A;  3MJN A;  1MY2 A;  3OEM A;  3PPO A;  3VVD A;  3C31 A;  5BUU A;  3N26 A;  5I2N A;  4NF5 A;  4BDM A;  1SQY A;  1OQH A;  1R9L A;  3PMW A;  3BBR A;  4GVO A;  1OIB A;  1Q35 A;  1JQF A;  3C33 A;  4NED A;  1I6Q A;  3IJX B;  3OO9 A;  4KD5 A;  2A5T A;  4RPO A;  1JEU A;  3VFJ A;  3VXC A;  3OXN A;  2HCA A;  4R74 A;  3CFZ A;  3RT8 A;  3VLU A;  1JEV A;  3G7W A;  4RJZ A;  4IO5 A;  2GFE A;  2QMW A;  2Z8E A;  4F31 B;  3Q28 A;  1IIW A;  1M5E A;  2XXU A;  3DEL B;  2P1S A;  3C36 A;  4G68 B;  3T66 A;  1UTB B;  4R73 A;  2Q2C A;  4HCW A;  1NNP A;  5L9O A;  1VR5 A;  4YKK A;  3S9N C;  2OCU A;  4JSO A;  1DTZ A;  1H43 A;  3JYR A;  3OO6 A;  4OFL A;  4BDL A;  2I4C A;  4ZEB A;  5L9M A;  3R6U A;  3RN8 A;  4MFI A;  4U21 A;  3AXF A;  1DPE A;  5DTB A;  3B7D A;  5ITP A;  4IO2 A;  4OEU A;  4BDR A;  3VLV A;  1VFE A;  3IOV A;  1H3D A;  1Z7M E;  2OBG A;  1B40 A;  1XT8 A;  1TWY A;  2I0B A;  1MY3 A;  1FQC A;  3CVG A;  5H8N B;  1LBC A;  3FXQ A;  3IJO B;  1SDX A;  3ILT B;  4ZDM A;  2FA7 A;  4U4S A;  5FTH A;  3VV5 A;  3TZA A;  2UVJ A;  4X48 A;  4IO3 A;  1NMU A;  3PD8 A;  2QL3 A;  1DOT A;  1GVC A;  4U1Z A;  2ZNU A;  1PB7 A;  3MUQ A;  1B3F A;  2NOO A;  2V3Q A;  3MBP A;  4LA9 A;  5H8H B;  3SEV A;  1B6H A;  4DXU A;  2HQ0 A;  5I59 A;  4PFU A;  3EPE A;  4EQB A;  2GRV A;  2QJE A;  2H4I A;  3UN6 A;  2XXQ A;  4YKJ A;  3UIF A;  1A7L A;  1MH4 A;  1S50 A;  1SD3 A;  3K00 A;  2UYE A;  3CIJ A;  3LUY A;  1MM6 A;  3FVK A;  1P1Q A;  1A8E A;  3CFX A;  1B0H A;  3K6X A;  4RXL A;  3FD3 A;  4G2Z A;  4WXJ A;  4X9T A;  4DZ1 A;  1VFD A;  4M4G A;  4HCY A;  1N0T A;  2W7Y A;  2ZYN A;  3FGS A;  3E13 X;  4I62 A;  1N3X A;  3H6W A;  4FIM A;  2I0C A;  1T0K A;  3TTM A;  2F36 A;  5KDT A;  3MP1 A;  5AA4 A;  1Y9U A;  3IO6 A;  2I6E A;  1PC3 A;  2LAO A;  3C9H A;  3O6H A;  4AQ4 A;  5I57 B;  1B1X A;  1UIV A;  1A99 A;  1PBP A;  2OWT A;  5AE4 A;  3M3L A;  1Y3Q A;  3MQ9 A;  1POY 1;  3FZV A;  5CRY A;  4ELO A;  4RYA A;  2REJ A;  3V5A A;  1BTJ A;  2ONR A;  4F19 A;  4QSE A;  3TKD A;  3TTN A;  3QIM A;  3G3K A;  2F6P A;  1H44 A;  3DP4 A;  3RPW A;  2G29 A;  4YMA A;  2HAV A;  4ZS9 A;  3M3K A;  2Y7K A;  2O7U A;  3K2D A;  4KHZ E;  4MLV A;  4H8I A;  1JW4 A;  4NMY A;  1M5F A;  3CR9 A;  4LZ5 A;  4UAC A;  3IL1 B;  1A54 A;  3C34 A;  4LQ5 A;  1I69 A;  2G93 A;  2GH9 A;  2H5Y A;  2M8C A;  4H67 A;  1EH3 A;  2B3B A;  3IB1 A;  3SEY A;  2Z8F A;  2DYX A;  3HHF A;  3ODB A;  3OEL A;  2XX8 A;  4NWD A;  4RPN A;  5CMM A;  1FQA A;  3D4G A;  3U92 A;  5JK4 A;  3PUY E;  4PET A;  1B7U A;  5I58 A;  1NH8 A;  1TFD A;  3IOR A;  1BIY A;  1LCT A;  3KN8 A;  3K1M A;  4KPT A;  1QJM A;  3H06 B;  2PYY A;  4QFN A;  2O51 A;  1SYI A;  1MPD A;  5H8N A;  4DXC A;  3S9M C;  1POT A;  4H1X A;  4RK9 A;  1B52 A;  1R9Q A;  3TOD A;  2QS2 A;  1US5 A;  4NF8 B;  3KSJ A;  3O6G A;  4EUO A;  3ILU B;  2DS9 A;  1FW0 A;  1HSL A;  2Y7I A;  2ZMB A;  4HS7 A;  1URG A;  4IY5 A;  4FAT A;  5BWJ A;  4RK2 A;  4LQ2 A;  4XKN A;  2Y7W A;  1XS5 A;  3C32 A;  3OOA A;  4OWD A;  4TQU Q;  4NF8 A;  4F2Q A;  4OET A;  2ESN A;  3SDF A;  1GTK A;  5AA1 A;  3SER A;  4QF9 A;  5H8H A;  2QS3 A;  1TXF A;  1A40 A;  2RC7 A;  3RQT A;  1TT1 A;  4GQO A;  3B6Q A;  4ND9 A;  3MZ9 A;  2OLB A;  5ELV A;  5TPA B;  1MY1 A;  2IEE A;  2RCB A;  4ZZA A;  4F22 A;  1B0L A;  3TQL A;  4AB6 A;  5B7D A;  2GHB A;  3RUM A;  1IUD A;  4U2R A;  1B7Z A;  4F1U A;  4LZ7 A;  1BP5 A;  3PUX E;  5TPA A;  2NWJ A;  4IGT A;  5ICT A;  1D3K A;  3HCQ A;  4GWO A;  1LGB C;  3RTF B;  1ANF A;  1Y1M A;  4MBP A;  2V93 A;  3VDF A;  4F3P A;  4YIC A;  1LST A;  3IOT A;  1EU8 A;  3IB0 A;  3KOT A;  1SW2 A;  3DP8 A;  1P1N A;  1UTH B;  2F78 A;  2AL4 A;  3FJG A;  1RYO A;  1QUJ A;  1LFI A;  3IOW A;  2DP8 A;  4IO6 A;  4G8H A;  3SKP A;  2E1S A;  3FUZ A;  3I3V A;  3K6W A;  4GF8 A;  3MAM A;  4NF6 A;  1B7H A;  2XXY A;  1VE4 A;  1ZJL A;  2PBW A;  3KN7 A;  3PMX A;  4NE4 A;  3RTW B;  4DCX A;  5AA2 D;  1XVY A;  5ICQ A;  2H98 A;  4OEN A;  4NF6 B;  3O66 A;  3GBB A;  1FTO A;  4KYS A;  3LBS A;  3RGY A;  1DSN A;  3OSQ A;  4IB2 A;  2VOZ A;  4KCC A;  4RNS A;  3D4C A;  3W9V A;  4O3B A;  3LR1 A;  4PFW A;  3EHT A;  4QFL A;  2HZK A;  2QS4 A;  3HN0 A;  4ESW A;  2V84 A;  4O3C A;  2D3I A;  5I2K A;  2D5W A;  1ZMG A;  2DXY A;  2HAU A;  4ZE8 A;  3A3U A;  5DYH A;  1NFT A;  1IXC A;  4JWY A;  4QFP A;  1MS7 A;  3KEI A;  1ZBM A;  2F7B A;  3B6W A;  4I9D A;  2VP1 A;  1I6B A;  1FQE A;  1MG1 A;  4JDF A;  3MZ1 A;  4GRK A;  4GXS B;  2HFB A;  2ZYM A;  1SW1 A;  3MW0 A;  4K3F A;  5DEX B;  3A3C A;  3IB2 A;  4YB7 A;  4AB5 A;  2PVU A;  2PT2 A;  4ZEC A;  3RY3 A;  5AA2 B;  4YAH X;  4BDQ A;  2DQV A;  1B5H A;  1NNT A;  1H45 A;  2DE3 A;  3C35 A;  4IO4 A;  5DEX A;  4C1U A;  3EHS A;  4H5F A;  3FVO A;  4RA1 A;  3RT6 B;  3TDJ A;  2Y7R A;  1HSJ A;  3GBA A;  2A5S A;  1MQH A;  4QFK A;  4C1T A;  3K1P A;  5AA4 B;  1F9B A;  5I57 A;  3IO4 A;  3Q25 A;  3U1O A;  3KSX A;  1OMP A;  1Y4C A;  3FIR A;  4P0G A;  3KOS A;  3IK6 B;  2PMS A;  2REG A;  1P99 A;  4ONY A;  5KDT B;  3N6T A;  4KI0 E;  1P1W A;  3FVG A;  3OO8 A;  3TCH A;  4ZEK A;  1OLC A;  1R1N A;  3VLW A;  3PUZ E;  2XD3 A;  4YKP A;  1ELJ A;  4THI A;  3H6V A;  4LP2 B;  1JET A;  2FYI A;  1OQG A;  1MXY A;  3TAJ A;  4TOZ A;  4GOT A;  4GL0 A;  4OYV A;  5A5X A;  4LVQ A;  1B32 A;  1MY0 A;  1RYX A;  4E0X A;  4ELR A;  3THI A;  3O2A A;  5DVJ A;  3KFM A;  1Q1K A;  3WAF A;  1Y4T A;  1N84 A;  3QK6 A;  4EXL A;  1LLS A;  2V25 A;  1XC1 A;  1P1U A;  1URS A;  1I6A A;  1MM7 A;  2Q89 A;  1B9J A;  2RC8 A;  3RNN A;  2XXR A;  3PD9 A;  5HPQ A;  3Q26 A;  3CSB A;  4FED A;  2ONS A;  5KZT A;  1ZIU A;  2Q88 A;  4ZEF A;  4OXV A;  3U8Q A;  3VVE A;  4G4P A;  4DCY A;  3K0V A;  4ECF A;  1RKM A;  2I4B A;  1US4 A;  2ALU A;  3H6T A;  3OMB A;  4R2B A;  1N04 A;  4OES A;  3RLF E;  5I56 A;  1MXX A;  4OFJ A;  3T9V A;  3PMV A;  4C0R A;  1MXZ A;  3SEW A;  1XVX A;  5I56 B;  5IAI A;  3MPK A;  4OZ9 A;  3FJM A;  2RC9 A;  1B4Z A;  2AYS A;  4Q8R A;  1EZ9 A;  1GR2 A;  3CRB A;  5I2K B;  2DE2 A;  1A55 A;  2QSX A;  3VVF A;  4ESX A;  2H99 A;  2F7A A;  1IEJ A;  1OVB A;  2DWJ A;  2F5X A;  2QRY A;  4H65 A;  4XKQ A;  4EF1 A;  2XHD A;  1B3H A;  2Y84 A;  2F34 A;  3O6I A;  2RIN A;  4NTL A;  4U22 A;  4XKP A;  5M2V A;  1B3G A;  3QYT A;  1AOV A;  2DE4 A;  4Q0C A;  2HZL A;  2Q9T A;  2XXV A;  4KYE A;  3M8U A;  5ITO A;  3QUJ A;  4IGR A;  4OFO A;  5F7V A;  3HV1 A;  4HTG A;  2DVZ A;  1HSE A;  2O1M A;  2O6A A;  1B58 A;  5EHS A;  3SES A;  1MQJ A;  3U72 A;  1JNF A;  1DPP A;  1OVT A;  3K6U A;  3KG2 A;  3EQ1 A;  1MQD A;  4EQ7 A;  4F3S A;  1LFH A;  1D9Y A;  3TEP A;  3MVW A;  1MDP 1;  2XD2 A;  3W15 C;  4BDN A;  1GV8 A;  2F35 A;  2XXP A;  2GHA A;  4N07 A;  4QSC A;  3S4U A;  3PU5 A;  1QKA A;  1MPB A;  3LSX A;  4XIG Q;  3N5L A;  3LSW A;  3UGW A;  3O29 A;  1Y1Z A;  1YAE A;  3OEN A;  3PUW E;  3ONM A;  4I8C A;  1SBP A;  4R6H A;  5B70 A;  1XHY A;  2V3U A;  1Y3N A;  4R2F A;  3ZSF A;  3K4U A;  3BFT A;  3CI8 A;  4FAJ A;  2OWS A;  1II5 A;  2ZYO A;  1ZTY A;  2I3W A;  3E9X A;  3IOU A;  4FJP A;  4M1V A;  5ISU A;  5K2X A;  1NNF A;  4DE8 A;  4JWO A;  3T22 A;  3TCF A;  3TTK A;  1R6Z A;  4HW8 A;  5KCJ A;  2DOJ A;  2YJP A;  5FHN A;  2BJJ X;  1MH3 A;  1FTL A;  1EZO A;  2NVU B;  3PGF A;  1LCF A;  3I5O A;  1FQB A;  1USY E;  1M5B A;  1ZKB A;  2UVG A;  3G3H A;  1WDN A;  3B6T A;  1WOD A;  3G3G A;  3JZJ A;  4GFR A;  4PE5 B;  3T9U A;  3TPA A;  3UA8 A;  3V89 B;  4PFT A;  3E3K A;  2DWA A;  2AIX A;  2ZNT A;  2Z8D A;  3MPL A;  4XXU A;  2X26 A;  3H6U A;  4EF2 A;  3PUV E;  1VSO A;  5CC2 A;  3USD A;  4YMB A;  1OLA A;  1PB9 A;  4G8N A;  1M5C A;  2FNC A;  2PT1 A;  1S7Y A;  3OO7 A;  4H5G A;  3KGC A;  2UXA A;  3MVZ A;  3V8X B;  1YCJ A;  3FAS A;  4GL8 A;  3T93 B;  2D21 A;  2ANJ A;  2X7P A;  1S9T A;  3FJ7 A;  1O7T A;  1ZU0 A;  3SEU A;  1LAG E;  4MH5 A;  1MPC A;  3R26 A;  3S9E A;  5EHM A;  4OHN A;  3TMG A;  3HST A;  1N7X A;  4DLD A;  5HM4 B;  4OEV A;  1MQG A;  4G68 C;  1BKA A;  1FCK A;  1IXI A;  2XXI A;  3FXR A;  5FHO A;  4GD5 A;  1Y3P A;  3Q29 A;  2PX1 A;  3K1N A;  1B1H A;  4F1Y A;  3L6H A;  4BDO A;  1FTM A;  2Z22 A;  4KYD A;  5H8S A;  3GZG A;  3SEX A;  4GXA A;  4KCD A;  3W9W A;  4WKM A;  3G3F A;  5DVF A;  3CFL A;  4NF4 A;  3DM0 A;  2VD2 A;  4EDP A;  3MP6 A;  2QPQ A;  3MWB A;  4XKR A;  3DP6 A;  2VD3 A;  2O69 A;  1Y20 A;  2XXH A;  4ZEI A;  1WVJ A;  2Q2A A;  3UK4 A;  4YB6 A;  1N7W A;  4H6D A;  1BLF A;  4BLA A; 
#chains in the Genus database with same CATH topology
 1D9V A;  4PFR A;  3GXA A;  4G61 A;  3K6V A;  1DMB A;  3HO7 A;  1LB9 A;  4EXK A;  1KZ8 A;  2I48 A;  3TTR A;  1EZP A;  4ZZE A;  3VVE A;  1KWH A;  1LB8 A;  2QVU A;  3S2V A;  3P7I A;  1A8F A;  4KR5 A;  1FTJ A;  4FBP A;  2DWH A;  5JTY A;  5CMK A;  1NKX A;  3TCG A;  1FPB A;  1SVX B;  4R6K A;  4F29 A;  3FBP A;  3VXB A;  3MC2 A;  4YKI A;  1LBZ A;  4PTK A;  1O64 A;  3ECR A;  3QUF A;  3I6V A;  5FHM A;  1B3E A;  1FBC A;  2CEX A;  2P2A A;  2O68 A;  1IIT A;  1NI9 A;  2NUV A;  3T0J A;  1UTB A;  4ZE9 A;  5H8Q B;  3OSR A;  1RDY A;  1LAF E;  3MZB A;  1QVS A;  4N91 A;  1MRP A;  4MLQ A;  1B2H A;  4U1O A;  2HEU A;  3IX1 A;  4F18 A;  3G3I A;  4NWC A;  1D4N A;  4POW A;  2R9J A;  1FTK A;  1B4H A;  2XXT A;  2O84 X;  2RF1 A;  4F39 A;  5LOM A;  3E79 A;  4JSD A;  1YPN A;  5EYF A;  1MY4 A;  4PF8 A;  3PPP A;  5TP9 B;  2VGQ A;  3L6G A;  1JVX A;  1H76 A;  1TFA A;  4FEB A;  1B3L A;  3DLN A;  2ZYK A;  4TLL B;  2P0S A;  3EF7 A;  5K2Y A;  4U23 A;  2XX7 A;  1DCU A;  1NUZ A;  2H25 A;  5F1Q A;  3OD7 A;  4IY6 A;  1LFG A;  2B3F A;  3CG1 A;  3GLB A;  1EYK A;  4LON B;  4GBW A;  5TU0 A;  4R6Y A;  3MVX A;  2QMX A;  4GWY A;  2ONK E;  5IGA A;  5I59 B;  1JW5 A;  4NF5 B;  4NG7 A;  5CMB A;  1MXW A;  3C31 A;  1NUX A;  1Q35 A;  1JQF A;  3IJX B;  4KD5 A;  4RPO A;  2HCA A;  3G7W A;  1M5E A;  1FPG A;  3T66 A;  4G68 B;  4R73 A;  1NV2 A;  1VR5 A;  3S9N C;  4OFL A;  4ZEB A;  3RN8 A;  2ZZW A;  3AXF A;  5DTB A;  5ITP A;  4IO2 A;  1Z7M E;  2OBG A;  5H8N B;  1LBC A;  4AS4 A;  3FXQ A;  1SDX A;  2FA7 A;  3TZA A;  1SPI A;  1NMU A;  3PD8 A;  5EYG A;  1GVC A;  2ZNU A;  4LA9 A;  3MBP A;  1B6H A;  2GRV A;  5DW8 A;  1MH4 A;  3FVK A;  1P1Q A;  4UAB A;  3CFX A;  3K6X A;  4WXJ A;  3FD3 A;  2XWO A;  1VFD A;  2W7Y A;  2ZYN A;  2PFY A;  4P3L A;  3H6W A;  4FIM A;  2F3D A;  2I0C A;  1INP A;  5AA4 A;  3IO6 A;  5I57 B;  2OWT A;  5AE4 A;  3FZV A;  4RYA A;  1BTJ A;  2ONR A;  4QSE A;  2F6P A;  4OVS A;  2Y7K A;  1JW4 A;  4LZ5 A;  4UAC A;  4LQ5 A;  1I69 A;  2M8C A;  3IB1 A;  1FQA A;  3PUY E;  4PET A;  1LCT A;  3TDJ A;  3K1M A;  4QFN A;  4DXC A;  1SYI A;  1MPD A;  1XI6 A;  4H1X A;  1R9Q A;  4IY5 A;  1FW0 A;  4RK2 A;  4XKN A;  2Y7W A;  4OET A;  1GTK A;  2QS3 A;  1TXF A;  3B6Q A;  3MZ9 A;  1DBZ A;  2RCB A;  4HE1 A;  4LZ7 A;  1BP5 A;  5TPA A;  5ICT A;  1D3K A;  3HCQ A;  1ANF A;  2V93 A;  4F3P A;  3IOT A;  3IB0 A;  4NF0 A;  4G8H A;  4HXV A;  1NV3 A;  1B7H A;  1VE4 A;  1XVY A;  1DSN A;  3OSQ A;  2VOZ A;  4RNS A;  4O3B A;  4ESW A;  2FVZ A;  3EHT A;  4QXD A;  1ZMG A;  2DXY A;  4ZE8 A;  5DYH A;  1ZBM A;  3B6W A;  1MG1 A;  5DEX B;  4YB7 A;  4ZEC A;  4NGU A;  5AA2 B;  4BDQ A;  1H45 A;  3C35 A;  1NV1 A;  2Y7R A;  1HSJ A;  3GBA A;  4C1T A;  1MQH A;  1F9B A;  2GQ1 A;  3KSX A;  5I7I A;  1OMP A;  1Y4C A;  2PMS A;  3N6T A;  3TCH A;  1OLC A;  4THI A;  2FYI A;  1OQG A;  1MXY A;  4LVQ A;  1RYX A;  4ELR A;  4X04 A;  3THI A;  3KFM A;  3QK6 A;  1URS A;  4MX6 A;  3U8Q A;  4OXV A;  4G4P A;  1NV7 A;  3K0V A;  2ALU A;  3T9V A;  3SEW A;  5I56 B;  4OAN A;  5F24 A;  1RDX A;  1EZ9 A;  2QSX A;  3VVF A;  4ESX A;  1YXI A;  2F5X A;  2QRY A;  4EF1 A;  3ZSF A;  4NTL A;  5M2V A;  3M8U A;  2HXR A;  4IGR A;  2QVV A;  4OFO A;  3HV1 A;  1B58 A;  5EHS A;  3U72 A;  1JNF A;  4EQ7 A;  3TEP A;  4BDN A;  1MDP 1;  2XXP A;  3IFA A;  3S4U A;  3PU5 A;  4QBA A;  5EQA A;  3OEN A;  4PGN A;  1Y3N A;  2MKZ A;  2OWS A;  2WEF A;  4FJP A;  1NNF A;  3T22 A;  3TTK A;  2YJP A;  3PGF A;  4F1V A;  4OZ9 A;  1WDN A;  3B6T A;  1IMB A;  3T9U A;  2X26 A;  4KXP A;  1PB9 A;  2PT1 A;  2UXA A;  1IMD A;  2ANJ A;  2X7P A;  1S9T A;  3FJ7 A;  1MPC A;  5EHM A;  4OEV A;  2XXI A;  1IXI A;  4GD5 A;  1Y3P A;  1B1H A;  4BDO A;  1AWB A;  3KC0 A;  3SEX A;  4GXA A;  3G3F A;  3CFL A;  1Y20 A;  2XXH A;  2Q2A A;  1AL3 A;  1UTH A;  3LC8 A;  1N76 A;  3ZKL A;  4JB7 A;  1JW1 A;  1FPD A;  1NNK A;  2YLN A;  4KQP A;  4PAK A;  2CZK A;  1AIV A;  1MXU A;  3UP9 A;  4PP0 A;  1IZ1 A;  4QHQ A;  4HE0 A;  5L9S A;  3FAT A;  3T9X B;  4PBH A;  1L5T A;  4OMB A;  3M3F A;  2ZNS A;  4Q30 B;  4O3A A;  4QSD A;  3A09 A;  4LZ8 A;  3A29 A;  4RY1 A;  1USY H;  3KZG A;  2THI A;  1QKB A;  1RDZ A;  2CEY A;  1SW4 A;  2FBP A;  3D1R A;  3N6U A;  3F11 A;  3ZS6 A;  3BIH A;  2F7C A;  5A5X B;  2Y7P A;  3FVN A;  4ELP A;  1JVY A;  1BK4 A;  4PF6 A;  1FQD A;  3S9L C;  2WYK A;  2HPG A;  5EQ9 A;  4UA8 A;  4XTC Q;  2I3V A;  3BKI B;  5H8F B;  4PFI A;  4F2O A;  2YPN A;  3KN3 A;  4POX A;  3C4M A;  1NH7 A;  1B5I A;  4U4X A;  1EYI A;  4YU0 A;  4NF4 B;  2O7I A;  4MHF A;  4F3G A;  1LAX A;  1QUI A;  1UQW A;  4N13 A;  5DT6 A;  3H03 A;  5J1D A;  1CE2 A;  3HPI A;  4Z0I A;  1DTG A;  4LAT A;  2I58 A;  2VHA A;  2VPN A;  2DXR A;  1FBF A;  1PEB A;  4IO7 A;  4FEC A;  1IXH A;  5JEI A;  4R9G A;  3U93 A;  4PBQ A;  5CI5 A;  2BJI A;  1SW5 A;  3T1B A;  5CMC A;  2H9B A;  3OEK A;  3T96 B;  3UOR A;  4GLI A;  3K02 A;  3MJN A;  3PPO A;  4BDM A;  1OQH A;  3PMW A;  3NOH A;  3BBR A;  1OIB A;  3C33 A;  3VFJ A;  1JEU A;  1YZ0 A;  4X8R A;  4R74 A;  3RT8 A;  4IO5 A;  2GFE A;  1IIW A;  1UTB B;  2Q2C A;  1NNP A;  1FJ6 A;  4JSO A;  4OVQ A;  3OO6 A;  4BDL A;  3MYU A;  4U21 A;  4MJO A;  4OVR A;  1VFE A;  3IOV A;  1H3D A;  2I0B A;  1FQC A;  4DI3 D;  4NX1 A;  3VV5 A;  5IZ3 A;  2UVJ A;  4X48 A;  4IO3 A;  1DOT A;  2NOO A;  3SEV A;  4PFU A;  4EQB A;  3UN6 A;  2WBB A;  4YKJ A;  3K00 A;  3CIJ A;  1B0H A;  4X9T A;  4GX6 A;  3E13 X;  1T0K A;  1PC3 A;  3C9H A;  1B1X A;  1PBP A;  3M3L A;  1FBG A;  4ELO A;  4H6D A;  4F19 A;  1H44 A;  2G29 A;  1QGX A;  2HAV A;  2O7U A;  4H8I A;  3IL1 B;  1A54 A;  1EH3 A;  2Z8F A;  3OEL A;  3HHF A;  2XX8 A;  5I3S A;  5CMM A;  5JK4 A;  1B7U A;  5I58 A;  1TFD A;  4XFE A;  3IOR A;  3S9M C;  2PYY A;  3TOD A;  3EKI A;  4O8M A;  3KSJ A;  4EUO A;  2DS9 A;  1HSL A;  2ZMB A;  1URG A;  4LQ2 A;  5ET5 A;  4NF8 A;  3SDF A;  4H46 A;  1VDW A;  3SER A;  1A40 A;  2RC7 A;  4GQO A;  4ND9 A;  1MY1 A;  2IEE A;  4ZZA A;  5B7D A;  2VPO A;  2GHB A;  3PUX E;  3RTF B;  1EU8 A;  1RYO A;  1QUJ A;  4IO6 A;  3FUZ A;  3I3V A;  4AB6 A;  3RTW B;  1ZJL A;  2PBW A;  5AA2 D;  1LBX A;  5ICQ A;  4OEN A;  4NF6 B;  1FTO A;  4IB2 A;  4MCO A;  4PAI A;  3LR1 A;  3HN0 A;  2D3I A;  2F7B A;  1FQE A;  4JDF A;  1SW1 A;  3MW0 A;  1LBV A;  3RPL B;  3RY3 A;  2DE3 A;  4H5F A;  3RT6 B;  1G0H A;  5AA4 B;  4N4U A;  4QFK A;  5KDT A;  5I57 A;  3K1P A;  4N81 A;  3IO4 A;  4JVC A;  4MAG A;  2REG A;  1P99 A;  1P1W A;  3OO8 A;  4ZEK A;  3PUZ E;  2XD3 A;  1G0I A;  3H6V A;  4LP2 B;  4GOT A;  4GL0 A;  1B32 A;  4E0X A;  1KA0 A;  2XWI A;  3O2A A;  1Q1K A;  1Y4T A;  4EXL A;  1NV6 A;  1I6A A;  3RNN A;  5KZT A;  2XXR A;  3PD9 A;  2V4C A;  3CSB A;  2ONS A;  4ZEF A;  2PCR A;  2I4B A;  1US4 A;  3H6T A;  4R2B A;  4PGP A;  4OES A;  3RLF E;  1FBE A;  5EQ7 A;  1MXZ A;  5IAI A;  3FJM A;  4Q8R A;  2AYS A;  2DE2 A;  2F7A A;  1IEJ A;  1OVB A;  4XKQ A;  4GWS A;  1B3H A;  2Y84 A;  3O6I A;  1B3G A;  2DE4 A;  3QUJ A;  5F7V A;  3HFU A;  2VT5 A;  2DVZ A;  1HSE A;  4HTG A;  3SES A;  1LFH A;  1D9Y A;  3W15 C;  1QKA A;  4XIG Q;  3LSW A;  1Y1Z A;  1YAE A;  3BFT A;  4FAJ A;  1ZTY A;  3E9X A;  5ISU A;  4MNI A;  4GBV A;  1FTL A;  1LCF A;  3I5O A;  3PPQ A;  1M5B A;  4GFR A;  2UVG A;  3TPA A;  2AIX A;  2ZNT A;  4EF2 A;  5IZ1 A;  4G8N A;  4H5G A;  3MVZ A;  1YCJ A;  4GL8 A;  3T93 B;  2D21 A;  1ZU0 A;  1LAG E;  2CZH A;  4OHN A;  3HST A;  1N7X A;  4GWU A;  5HM4 B;  1MQG A;  1BKA A;  3FXR A;  2Q74 A;  4KCD A;  4WKM A;  4I40 A;  2VD2 A;  3MWB A;  2VD3 A;  4ZEI A;  3UK4 A;  4YB6 A;  4XXU A;  1N7W A;  4BLA A;  2XWK A;  4ISU A;  5FTI A;  1N3W A;  4OQO A;  1B51 A;  3TQW A;  2B65 A;  1LBY A;  1PDA A;  1B46 A;  4JBZ A;  2WYP A;  2UVH A;  4LUB A;  2X7Q A;  1PB8 A;  5JTY B;  2RKM A;  1J1N A;  1P1O A;  3HHG A;  4ELQ A;  1MDQ A;  5I2N B;  4I1D A;  3PTY A;  5I5P A;  2UVI A;  3WAE A;  4KFQ A;  5HBC A;  5L8D A;  2DDK A;  2XXX A;  3KBZ A;  2B4M A;  2F3B A;  4H0W A;  3O9P A;  3N94 A;  1MXV A;  1AH5 A;  3JV9 A;  3BFU A;  4TLM B;  4Q5T A;  1QUK A;  3LSL A;  2Q8J A;  5AA3 A;  1B5J A;  3O28 A;  2OK2 A;  4P1E A;  4WED A;  4Z7E A;  1FPI A;  1B05 A;  4QFO A;  4PFY A;  2QVR A;  3IAZ A;  4G8M A;  5TP9 A;  1FSA A;  4E0W A;  4YB5 A;  3FV2 A;  2ABH A;  1AMF A;  2WKY A;  1O63 A;  1GGG A;  4F3B A;  2PFZ A;  3QSL A;  3EHU A;  4P11 A;  4DI4 B;  4O7M A;  4O94 A;  4R72 A;  2F97 A;  3CSG A;  4QRZ A;  4EQ9 A;  2ZXT A;  4OTE A;  3H4Z A;  4JXI A;  1ATG A;  4PCD A;  1ZLQ A;  1K9Y A;  4FOR A;  5ESY A;  4N8G A;  4DIG A;  1FBD A;  2UYF A;  3G3J A;  4L17 A;  4G77 A;  3MVY A;  5KCJ B;  2XXW A;  2F6G A;  3PV0 E;  3QAX A;  1MQI A;  3Q27 A;  2R71 A;  4P0I A;  3E4R A;  5AA2 A;  3OEM A;  5BUU A;  3N26 A;  1IMC A;  4NF5 A;  1SQY A;  1FBH A;  1I6Q A;  3OO9 A;  2A5T A;  1IME A;  1JEV A;  4RJZ A;  2Z8E A;  4F31 B;  4N17 A;  3BIG A;  4HCW A;  5L9O A;  2OCU A;  1H43 A;  3JYR A;  1K9Z A;  4NN3 A;  1LEV A;  2Y5L A;  1IMF A;  1MY3 A;  4I3E A;  4PFB A;  3ILT B;  4ZDM A;  4JVD A;  2QL3 A;  2V3Q A;  2QJE A;  2XXQ A;  1A7L A;  1SD3 A;  1S50 A;  1D9Q A;  4RXL A;  1MM6 A;  3ROJ A;  1A8E A;  4DZ1 A;  4M4G A;  5EQ8 A;  3FGS A;  1N3X A;  3TTM A;  2F36 A;  3MP1 A;  1Y9U A;  3O6H A;  2LAO A;  3LV0 A;  1UIV A;  1Y3Q A;  1POY 1;  1NUW A;  3TKD A;  3DP4 A;  5ET6 A;  3RPW A;  5LDZ A;  4YMA A;  3K2D A;  4KHZ E;  4MLV A;  3C34 A;  4HE2 A;  2GH9 A;  2H5Y A;  3ODB A;  2P3N A;  3U92 A;  3KN8 A;  3TCF A;  2O51 A;  1POT A;  4RK9 A;  3O6G A;  4FAT A;  2Y7I A;  4HS7 A;  4OWD A;  3C32 A;  4TQU Q;  2ESN A;  5H8H A;  3RQT A;  4H45 A;  1TT1 A;  3QMF A;  2OLB A;  5ELV A;  5TPA B;  3TQL A;  1LBW A;  1B7Z A;  4F1U A;  2NWJ A;  4IGT A;  4GWO A;  3SZP A;  1LST A;  1SW2 A;  1P1N A;  1UTH B;  4GWW A;  3IOW A;  4GF8 A;  3MAM A;  3KN7 A;  2XXY A;  4DCX A;  3ISP A;  3PMX A;  4NE4 A;  2H98 A;  3O66 A;  3GBB A;  4KYS A;  3LBS A;  3FXB A;  3D4C A;  3W9V A;  4PFW A;  4QFL A;  4GWX A;  4O3C A;  3A3U A;  1NFT A;  1IXC A;  4JWY A;  4QFP A;  1MS7 A;  3KEI A;  4I9D A;  1I6B A;  4K3F A;  4P47 A;  3A3C A;  4AB5 A;  2PT2 A;  4YAH X;  5DEX A;  3V5A A;  3FVO A;  4PDH A;  3Q25 A;  3FIR A;  4P0G A;  4ONY A;  3FVG A;  1R1N A;  1JET A;  5ET7 A;  4TOZ A;  5A5X A;  1MY0 A;  5IZZ A;  1N84 A;  1NV5 A;  1XC1 A;  1FPL A;  1MM7 A;  2Q89 A;  1EYJ A;  3Q26 A;  4FED A;  1ZIU A;  4XF5 A;  2Q88 A;  4ECF A;  1N04 A;  5I56 A;  4OFJ A;  4OVP A;  4C0R A;  1XVX A;  2RC9 A;  2JJK A;  1B4Z A;  1GR2 A;  3CRB A;  5I2K B;  2H99 A;  2DWJ A;  2XHD A;  4U22 A;  2RIN A;  3QYT A;  4Q0C A;  2HZL A;  2Q9T A;  5ITO A;  4N8Y A;  2O1M A;  1MQJ A;  3K6U A;  1DPP A;  1OVT A;  3KG2 A;  5EYH A;  3EQ1 A;  1MQD A;  2XD2 A;  1GV8 A;  4QSC A;  3LSX A;  4MMP A;  3O29 A;  4R6H A;  3PUW E;  3ONM A;  1SBP A;  2V3U A;  4R2F A;  2I3W A;  3IOU A;  4M1V A;  5K2X A;  4DE8 A;  1R6Z A;  5FHN A;  1FQB A;  1USY E;  3G3H A;  3TAJ A;  3V89 B;  4PFT A;  3E3K A;  2DWA A;  4O7I A;  3MPL A;  1VSO A;  3USD A;  4YMB A;  1OLA A;  1M5C A;  1S7Y A;  3OO7 A;  3FAS A;  1O7T A;  4N15 A;  3SEU A;  4MH5 A;  3R26 A;  3S9E A;  2ZZX A;  4DLD A;  4G68 C;  1FPE A;  1FCK A;  5FHO A;  2PX1 A;  2WX9 A;  4KYD A;  3GZG A;  3W9W A;  5DVF A;  3DM0 A;  3MP6 A;  2QPQ A;  1WVJ A;  1BLF A;  3CHG A;  3TTL A;  3ZKK A;  4PDD A;  3KJ7 A;  2OJT A;  4GIZ A;  4I3Y A;  5J16 A;  1UIU A;  2V3T A;  4N6P A;  3FXU A;  4R9F A;  4JWX A;  4OVJ A;  1YYZ A;  4P56 A;  4X1B A;  3KJT A;  2FHY A;  1IQ7 A;  3IFC A;  3KC1 A;  4PAF A;  2R6G E;  3TUS A;  1YTV A;  1FPF A;  1Z7N E;  2DWI A;  2NXO A;  3CG3 A;  1URD A;  3H7M A;  2R8T A;  2RCA A;  5DVI A;  4PQJ A;  2O1L A;  4MF3 A;  2KLF A;  3QXM A;  3R7X A;  5I84 A;  4DXB A;  4AS5 A;  4G68 A;  2DVC A;  4N6D A;  2F8D A;  2QS1 A;  3TYH A;  4YZZ A;  1LBB A;  4GX3 A;  1M5D A;  4X1D A;  3PPN A;  5FBP A;  5I58 B;  4MNP A;  3KBR A;  2DSF A;  2OZZ A;  2E0S A;  4JVI A;  4OER A;  2Z23 A;  1NUY A;  3EN3 A;  3U94 A;  4WEP A;  3K01 A;  3V83 A;  3IR1 A;  5H8F A;  2A5T B;  3FV1 A;  1NL5 A;  3O97 A;  4XEQ A;  2CZL A;  3PPR A;  3TEL A;  3H3G A;  1QW0 A;  1LAH E;  3T9H B;  1FQF A;  5LTC A;  4OVT A;  1QUL A;  4H8J A;  4R75 A;  3SET A;  2XX9 A;  2AL5 A;  5CM6 A;  5IKB A;  1DK4 A;  4ZED A;  1SI1 A;  1SI0 A;  1PBQ A;  1SYH A;  5H8Q A;  4FE8 A;  1XOC A;  1CB6 A;  3LSF B;  2CMO A;  3TFL A;  3MP8 A;  2IA4 A;  5CBS A;  2I49 A;  1IXG A;  2KR0 A;  4GWZ A;  5CBR A;  1Q9D A;  5A5L A;  4OA4 A;  2HXW A;  3VVD A;  1MY2 A;  5I2N A;  1R9L A;  4GVO A;  4NED A;  3VXC A;  3OXN A;  3CFZ A;  3VLU A;  4LN5 A;  2QMW A;  3Q28 A;  2XXU A;  3DEL B;  2P1S A;  3LUZ A;  3C36 A;  1DTZ A;  2I4C A;  5L9M A;  3R6U A;  4MFI A;  1DPE A;  3B7D A;  4OEU A;  4BDR A;  3E78 A;  1B40 A;  1XT8 A;  1TWY A;  3CVG A;  3IJO B;  4MEV A;  4U4S A;  5FTH A;  4NQ8 A;  1CNQ A;  4U1Z A;  1PB7 A;  3MUQ A;  1B3F A;  5H8H B;  2L5V A;  4DXU A;  2HQ0 A;  5I59 A;  3B50 A;  3EPE A;  2H4I A;  3GYY A;  3UIF A;  4NAP A;  2UYE A;  3LUY A;  4G2Z A;  1NV4 A;  4HCY A;  1N0T A;  4I62 A;  2XA5 A;  2KQZ A;  2I6E A;  4AQ4 A;  4N6K A;  1A99 A;  3MQ9 A;  1FPK A;  5CRY A;  2REJ A;  3TTN A;  3QIM A;  3G3K A;  4MNC A;  3B8B A;  4ZS9 A;  3M3K A;  4NMY A;  1M5F A;  3CR9 A;  2OWZ A;  2G93 A;  4H67 A;  2FIX A;  2B3B A;  3SEY A;  2DYX A;  4RPN A;  4NWD A;  1JP4 A;  3D4G A;  1NH8 A;  1BIY A;  4KPT A;  1QJM A;  3H06 B;  5H8N A;  1FPJ A;  1IMA A;  1B52 A;  2QS2 A;  1US5 A;  4NF8 B;  3ILU B;  5BWJ A;  4P1L A;  1XS5 A;  3OOA A;  4F2Q A;  5AA1 A;  4QF9 A;  4F22 A;  1B0L A;  4GX4 A;  3RUM A;  1IUD A;  4U2R A;  2ZZV A;  1FBP A;  1LGB C;  1Y1M A;  4MBP A;  3VDF A;  1FRP A;  4YIC A;  3KOT A;  3DP8 A;  2F78 A;  2XWV A;  2AL4 A;  3FJG A;  1LFI A;  2DP8 A;  3SKP A;  2E1S A;  4DDD A;  3K6W A;  4NF6 A;  2B4L A;  3RGY A;  4KCC A;  1FTA A;  2HZK A;  2QS4 A;  2V84 A;  5I2K A;  2D5W A;  2HAU A;  2VP1 A;  3MZ1 A;  4GRK A;  4GXS B;  2HFB A;  2ZYM A;  2HHM A;  3IB2 A;  2PVU A;  2Q8M A;  2DQV A;  1B5H A;  1NNT A;  4IO4 A;  4C1U A;  3EHS A;  4RA1 A;  1KA1 A;  2A5S A;  3RPL A;  2XXK A;  4P8B A;  3KOS A;  3IK6 B;  5KDT B;  2P3V A;  4KI0 E;  3VLW A;  4YKP A;  1ELJ A;  5ET8 A;  4OYV A;  4PC9 A;  5DVJ A;  3WAF A;  1LLS A;  2V25 A;  1P1U A;  1B9J A;  2RC8 A;  5HPQ A;  4DCY A;  1RKM A;  3OMB A;  3RYD A;  1MXX A;  3PMV A;  4P9K A;  3MPK A;  4IR8 A;  2CZI A;  5IZ3 B;  1A55 A;  4H65 A;  4XKP A;  2F34 A;  1FJ9 A;  1AOV A;  2OX3 A;  4KYE A;  2XXV A;  4PE3 A;  4NHB A;  5T3J A;  3U1O A;  2O6A A;  4F3S A;  3MVW A;  2F35 A;  2GHA A;  4N07 A;  1MPB A;  3N5L A;  2WBD A;  3UGW A;  4I8C A;  3U65 A;  5B70 A;  1XHY A;  3K4U A;  3CI8 A;  2QFL A;  1II5 A;  2ZYO A;  1NV0 A;  3MST A;  4JWO A;  4HW8 A;  5KCJ A;  2DOJ A;  1EZO A;  2BJJ X;  1MH3 A;  2NVU B;  1ZKB A;  4PE5 B;  1WOD A;  3G3G A;  3JZJ A;  3UA8 A;  2Z8D A;  3H6U A;  3PUV E;  5CC2 A;  3VE1 B;  3VLV A;  2FNC A;  3V8X B;  3KGC A;  3TMG A;  4F1Y A;  3Q29 A;  3K1N A;  3L6H A;  5IM2 A;  1FTM A;  2Z22 A;  5H8S A;  2FIE A;  4NF4 A;  4EDP A;  2Y5K A;  4XKR A;  3DP6 A;  2O69 A;  4MIJ A;  4YKK A; 
#chains in the Genus database with same CATH homology
 1D9V A;  3TTL A;  1AL3 A;  3ZKK A;  3GXA A;  3KJ7 A;  3K6V A;  1DMB A;  3HO7 A;  1UTH A;  1LB9 A;  4ISU A;  5FTI A;  2OJT A;  1N3W A;  3LC8 A;  4GIZ A;  4EXK A;  4DDD A;  1UIU A;  2I48 A;  1N76 A;  3ZKL A;  4JB7 A;  4OQO A;  2V3T A;  4N6P A;  3TTR A;  1EZP A;  1JW1 A;  3FXU A;  4R9F A;  4ZZE A;  1B51 A;  4JWX A;  1KWH A;  4OVJ A;  1LB8 A;  2B65 A;  4KQP A;  1NNK A;  1PDA A;  2YLN A;  4X1B A;  3S2V A;  1B46 A;  3KJT A;  3P7I A;  1IQ7 A;  4JBZ A;  1A8F A;  4KR5 A;  1FTJ A;  2UVH A;  2DWH A;  4LUB A;  2X7Q A;  1AIV A;  2R6G E;  1MXU A;  5JTY A;  1YTV A;  1PB8 A;  3TUS A;  3UP9 A;  5CMK A;  1NKX A;  3TCG A;  1Z7N E;  2DWI A;  4PP0 A;  1IZ1 A;  2NXO A;  1SVX B;  4QHQ A;  5JTY B;  5L9S A;  3FAT A;  3CG3 A;  2RKM A;  1J1N A;  1P1O A;  3HHG A;  4ELQ A;  1MDQ A;  3T9X B;  1URD A;  3H7M A;  4R6K A;  4F29 A;  5I2N B;  1L5T A;  4I1D A;  3VXB A;  3MC2 A;  4YKI A;  3TQW A;  4OMB A;  3M3F A;  2UVI A;  2ZNS A;  4Q30 B;  1O64 A;  4O3A A;  2RCA A;  4QSD A;  5DVI A;  4PQJ A;  3A09 A;  3WAE A;  3ECR A;  3QUF A;  4KFQ A;  3I6V A;  4LZ8 A;  2O1L A;  4MF3 A;  5FHM A;  5HBC A;  4RY1 A;  5L8D A;  2KLF A;  1B3E A;  2XXX A;  1USY H;  3KZG A;  2THI A;  3QXM A;  1QKB A;  2P2A A;  3R7X A;  2O68 A;  1IIT A;  5I84 A;  2NUV A;  4H0W A;  3N6U A;  1SW4 A;  3O9P A;  4DXB A;  4G68 A;  2DVC A;  1UTB A;  3N94 A;  4ZE9 A;  2F8D A;  2QS1 A;  1MXV A;  3F11 A;  3TYH A;  1AH5 A;  3JV9 A;  3BFU A;  4YZZ A;  5H8Q B;  3OSR A;  1LBB A;  4Q5T A;  4TLM B;  3ZS6 A;  2F7C A;  1M5D A;  5A5X B;  1QUK A;  2Y7P A;  1LAF E;  4X1D A;  3VE1 B;  3MZB A;  3FVN A;  3LSL A;  1QVS A;  4ELP A;  2Q8J A;  3PPN A;  1MRP A;  4MLQ A;  5AA3 A;  5I58 B;  1B2H A;  1B5J A;  1JVY A;  2OK2 A;  3KBR A;  3O28 A;  2DSF A;  4U1O A;  2OZZ A;  4WED A;  2HEU A;  3IX1 A;  4Z7E A;  1FQD A;  3S9L C;  1B05 A;  2E0S A;  4F18 A;  3G3I A;  4UA8 A;  4XTC Q;  2I3V A;  4OER A;  4PFY A;  2Z23 A;  3BKI B;  3EN3 A;  4QFO A;  4NWC A;  5H8F B;  3U94 A;  4F1V A;  1D4N A;  4POW A;  2R9J A;  4WEP A;  3K01 A;  4F2O A;  1FTK A;  3V83 A;  1B4H A;  2XXT A;  2YPN A;  2O84 X;  2RF1 A;  4F39 A;  3IR1 A;  5H8F A;  5LOM A;  3KN3 A;  3IAZ A;  4POX A;  4G8M A;  4JSD A;  1YPN A;  2A5T B;  3C4M A;  5EYF A;  3FV1 A;  5TP9 A;  1NL5 A;  1MY4 A;  1NH7 A;  3O97 A;  4E0W A;  2CZL A;  3PPP A;  4YB5 A;  3FV2 A;  2ABH A;  1AMF A;  1B5I A;  1O63 A;  2WKY A;  1GGG A;  3PPQ A;  4U4X A;  5TP9 B;  2VGQ A;  3L6G A;  4F3B A;  1JVX A;  3QSL A;  4NF4 B;  4YU0 A;  1H76 A;  1TFA A;  2O7I A;  3EHU A;  4P11 A;  3PPR A;  4FEB A;  1B3L A;  3TEL A;  4F3G A;  1LAX A;  1QUI A;  1UQW A;  3DLN A;  3H3G A;  4N13 A;  5DT6 A;  1QW0 A;  2ZYK A;  1LAH E;  3H03 A;  4TLL B;  2P0S A;  3T9H B;  1FQF A;  4R72 A;  1QUL A;  2F97 A;  3CSG A;  4H8J A;  4QRZ A;  5J1D A;  1CE2 A;  4EQ9 A;  4R75 A;  3HPI A;  2ZXT A;  4OTE A;  3H4Z A;  4JXI A;  3SET A;  1ATG A;  1DTG A;  2XX9 A;  2AL5 A;  3EF7 A;  4LAT A;  4Z0I A;  5K2Y A;  2I58 A;  5CM6 A;  5IKB A;  4U23 A;  1ZLQ A;  2VHA A;  2XX7 A;  4ZED A;  2H25 A;  4FOR A;  1SI1 A;  5F1Q A;  2DXR A;  3OD7 A;  1SI0 A;  1PBQ A;  1PEB A;  4IY6 A;  1SYH A;  4DIG A;  1LFG A;  2B3F A;  3CG1 A;  2UYF A;  1IXH A;  4FEC A;  4IO7 A;  5H8Q A;  3GLB A;  5JEI A;  4R9G A;  4FE8 A;  1XOC A;  3U93 A;  1CB6 A;  3LSF B;  3G3J A;  4L17 A;  4LON B;  2CMO A;  5CI5 A;  3MP8 A;  2IA4 A;  4G77 A;  3TFL A;  5CBS A;  2I49 A;  1IXG A;  1SW5 A;  5TU0 A;  3MVY A;  5CMC A;  5KCJ B;  2H9B A;  4R6Y A;  3MVX A;  2QMX A;  3OEK A;  3T96 B;  2ONK E;  2XXW A;  2F6G A;  3PV0 E;  3QAX A;  1MQI A;  3UOR A;  3Q27 A;  5CBR A;  5I59 B;  2R71 A;  1JW5 A;  4NF5 B;  4GLI A;  2HXW A;  4P0I A;  3E4R A;  5AA2 A;  5CMB A;  1MXW A;  3K02 A;  3MJN A;  1MY2 A;  3OEM A;  3PPO A;  3VVD A;  3C31 A;  5BUU A;  3N26 A;  5I2N A;  4NF5 A;  4BDM A;  1SQY A;  1OQH A;  1R9L A;  3PMW A;  3BBR A;  4GVO A;  1OIB A;  1Q35 A;  1JQF A;  3C33 A;  4NED A;  1I6Q A;  3IJX B;  3OO9 A;  4KD5 A;  2A5T A;  4RPO A;  1JEU A;  3VFJ A;  3VXC A;  3OXN A;  2HCA A;  4R74 A;  3CFZ A;  3RT8 A;  3VLU A;  1JEV A;  3G7W A;  4RJZ A;  4IO5 A;  2GFE A;  2QMW A;  2Z8E A;  4F31 B;  3Q28 A;  1IIW A;  1M5E A;  2XXU A;  3DEL B;  2P1S A;  3C36 A;  4G68 B;  3T66 A;  1UTB B;  4R73 A;  2Q2C A;  4HCW A;  1NNP A;  5L9O A;  1VR5 A;  4YKK A;  3S9N C;  2OCU A;  4JSO A;  1DTZ A;  1H43 A;  3JYR A;  3OO6 A;  4OFL A;  4BDL A;  2I4C A;  4ZEB A;  5L9M A;  3R6U A;  3RN8 A;  4MFI A;  4U21 A;  3AXF A;  1DPE A;  5DTB A;  3B7D A;  5ITP A;  4IO2 A;  4OEU A;  4BDR A;  3VLV A;  1VFE A;  3IOV A;  1H3D A;  1Z7M E;  2OBG A;  1B40 A;  1XT8 A;  1TWY A;  2I0B A;  1MY3 A;  1FQC A;  3CVG A;  5H8N B;  1LBC A;  3FXQ A;  3IJO B;  1SDX A;  3ILT B;  4ZDM A;  2FA7 A;  4U4S A;  5FTH A;  3VV5 A;  3TZA A;  2UVJ A;  4X48 A;  4IO3 A;  1NMU A;  3PD8 A;  2QL3 A;  1DOT A;  1GVC A;  4U1Z A;  2ZNU A;  1PB7 A;  3MUQ A;  1B3F A;  2NOO A;  2V3Q A;  3MBP A;  4LA9 A;  5H8H B;  3SEV A;  1B6H A;  4DXU A;  2HQ0 A;  5I59 A;  4PFU A;  3EPE A;  4EQB A;  2GRV A;  2QJE A;  2H4I A;  3UN6 A;  2XXQ A;  4YKJ A;  3UIF A;  1A7L A;  1MH4 A;  1S50 A;  1SD3 A;  3K00 A;  2UYE A;  3CIJ A;  3LUY A;  1MM6 A;  3FVK A;  1P1Q A;  1A8E A;  3CFX A;  1B0H A;  3K6X A;  4RXL A;  3FD3 A;  4G2Z A;  4WXJ A;  4X9T A;  4DZ1 A;  1VFD A;  4M4G A;  4HCY A;  1N0T A;  2W7Y A;  2ZYN A;  3FGS A;  3E13 X;  4I62 A;  1N3X A;  3H6W A;  4FIM A;  2I0C A;  1T0K A;  3TTM A;  2F36 A;  5KDT A;  3MP1 A;  5AA4 A;  1Y9U A;  3IO6 A;  2I6E A;  1PC3 A;  2LAO A;  3C9H A;  3O6H A;  4AQ4 A;  5I57 B;  1B1X A;  1UIV A;  1A99 A;  1PBP A;  2OWT A;  5AE4 A;  3M3L A;  1Y3Q A;  3MQ9 A;  1POY 1;  3FZV A;  5CRY A;  4ELO A;  4RYA A;  2REJ A;  3V5A A;  1BTJ A;  2ONR A;  4F19 A;  4QSE A;  3TKD A;  3TTN A;  3QIM A;  3G3K A;  2F6P A;  1H44 A;  3DP4 A;  3RPW A;  2G29 A;  4YMA A;  2HAV A;  4ZS9 A;  3M3K A;  2Y7K A;  2O7U A;  3K2D A;  4KHZ E;  4MLV A;  4H8I A;  1JW4 A;  4NMY A;  1M5F A;  3CR9 A;  4LZ5 A;  4UAC A;  3IL1 B;  1A54 A;  3C34 A;  4LQ5 A;  1I69 A;  2G93 A;  2GH9 A;  2H5Y A;  2M8C A;  4H67 A;  1EH3 A;  2B3B A;  3IB1 A;  3SEY A;  2Z8F A;  2DYX A;  3HHF A;  3ODB A;  3OEL A;  2XX8 A;  4NWD A;  4RPN A;  5CMM A;  1FQA A;  3D4G A;  3U92 A;  5JK4 A;  3PUY E;  4PET A;  1B7U A;  5I58 A;  1NH8 A;  1TFD A;  3IOR A;  1BIY A;  1LCT A;  3KN8 A;  3K1M A;  4KPT A;  1QJM A;  3H06 B;  2PYY A;  4QFN A;  2O51 A;  1SYI A;  1MPD A;  5H8N A;  4DXC A;  3S9M C;  1POT A;  4H1X A;  4RK9 A;  1B52 A;  1R9Q A;  3TOD A;  2QS2 A;  1US5 A;  4NF8 B;  3KSJ A;  3O6G A;  4EUO A;  3ILU B;  2DS9 A;  1FW0 A;  1HSL A;  2Y7I A;  2ZMB A;  4HS7 A;  1URG A;  4IY5 A;  4FAT A;  5BWJ A;  4RK2 A;  4LQ2 A;  4XKN A;  2Y7W A;  1XS5 A;  3C32 A;  3OOA A;  4OWD A;  4TQU Q;  4NF8 A;  4F2Q A;  4OET A;  2ESN A;  3SDF A;  1GTK A;  5AA1 A;  3SER A;  4QF9 A;  5H8H A;  2QS3 A;  1TXF A;  1A40 A;  2RC7 A;  3RQT A;  1TT1 A;  4GQO A;  3B6Q A;  4ND9 A;  3MZ9 A;  2OLB A;  5ELV A;  5TPA B;  1MY1 A;  2IEE A;  2RCB A;  4ZZA A;  4F22 A;  1B0L A;  3TQL A;  4AB6 A;  5B7D A;  2GHB A;  3RUM A;  1IUD A;  4U2R A;  1B7Z A;  4F1U A;  4LZ7 A;  1BP5 A;  3PUX E;  5TPA A;  2NWJ A;  4IGT A;  5ICT A;  1D3K A;  3HCQ A;  4GWO A;  1LGB C;  3RTF B;  1ANF A;  1Y1M A;  4MBP A;  2V93 A;  3VDF A;  4F3P A;  4YIC A;  1LST A;  3IOT A;  1EU8 A;  3IB0 A;  3KOT A;  1SW2 A;  3DP8 A;  1P1N A;  1UTH B;  2F78 A;  2AL4 A;  3FJG A;  1RYO A;  1QUJ A;  1LFI A;  3IOW A;  2DP8 A;  4IO6 A;  4G8H A;  3SKP A;  2E1S A;  3FUZ A;  3I3V A;  3K6W A;  4GF8 A;  3MAM A;  4NF6 A;  1B7H A;  2XXY A;  1VE4 A;  1ZJL A;  2PBW A;  3KN7 A;  3PMX A;  4NE4 A;  3RTW B;  4DCX A;  5AA2 D;  1XVY A;  5ICQ A;  2H98 A;  4OEN A;  4NF6 B;  3O66 A;  3GBB A;  1FTO A;  4KYS A;  3LBS A;  3RGY A;  1DSN A;  3OSQ A;  4IB2 A;  2VOZ A;  4KCC A;  4RNS A;  3D4C A;  3W9V A;  4O3B A;  3LR1 A;  4PFW A;  3EHT A;  4QFL A;  2HZK A;  2QS4 A;  3HN0 A;  4ESW A;  2V84 A;  4O3C A;  2D3I A;  5I2K A;  2D5W A;  1ZMG A;  2DXY A;  2HAU A;  4ZE8 A;  3A3U A;  5DYH A;  1NFT A;  1IXC A;  4JWY A;  4QFP A;  1MS7 A;  3KEI A;  1ZBM A;  2F7B A;  3B6W A;  4I9D A;  2VP1 A;  1I6B A;  1FQE A;  1MG1 A;  4JDF A;  3MZ1 A;  4GRK A;  4GXS B;  2HFB A;  2ZYM A;  1SW1 A;  3MW0 A;  4K3F A;  5DEX B;  3A3C A;  3IB2 A;  4YB7 A;  4AB5 A;  2PVU A;  2PT2 A;  4ZEC A;  3RY3 A;  5AA2 B;  4YAH X;  4BDQ A;  2DQV A;  1B5H A;  1NNT A;  1H45 A;  2DE3 A;  3C35 A;  4IO4 A;  5DEX A;  4C1U A;  3EHS A;  4H5F A;  3FVO A;  4RA1 A;  3RT6 B;  3TDJ A;  2Y7R A;  1HSJ A;  3GBA A;  2A5S A;  1MQH A;  4QFK A;  4C1T A;  3K1P A;  5AA4 B;  1F9B A;  5I57 A;  3IO4 A;  3Q25 A;  3U1O A;  3KSX A;  1OMP A;  1Y4C A;  3FIR A;  4P0G A;  3KOS A;  3IK6 B;  2PMS A;  2REG A;  1P99 A;  4ONY A;  5KDT B;  3N6T A;  4KI0 E;  1P1W A;  3FVG A;  3OO8 A;  3TCH A;  4ZEK A;  1OLC A;  1R1N A;  3VLW A;  3PUZ E;  2XD3 A;  4YKP A;  1ELJ A;  4THI A;  3H6V A;  4LP2 B;  1JET A;  2FYI A;  1OQG A;  1MXY A;  3TAJ A;  4TOZ A;  4GOT A;  4GL0 A;  4OYV A;  5A5X A;  4LVQ A;  1B32 A;  1MY0 A;  1RYX A;  4E0X A;  4ELR A;  3THI A;  3O2A A;  5DVJ A;  3KFM A;  1Q1K A;  3WAF A;  1Y4T A;  1N84 A;  3QK6 A;  4EXL A;  1LLS A;  2V25 A;  1XC1 A;  1P1U A;  1URS A;  1I6A A;  1MM7 A;  2Q89 A;  1B9J A;  2RC8 A;  3RNN A;  2XXR A;  3PD9 A;  5HPQ A;  3Q26 A;  3CSB A;  4FED A;  2ONS A;  5KZT A;  1ZIU A;  2Q88 A;  4ZEF A;  4OXV A;  3U8Q A;  3VVE A;  4G4P A;  4DCY A;  3K0V A;  4ECF A;  1RKM A;  2I4B A;  1US4 A;  2ALU A;  3H6T A;  3OMB A;  4R2B A;  1N04 A;  4OES A;  3RLF E;  5I56 A;  1MXX A;  4OFJ A;  3T9V A;  3PMV A;  4C0R A;  1MXZ A;  3SEW A;  1XVX A;  5I56 B;  5IAI A;  3MPK A;  4OZ9 A;  3FJM A;  2RC9 A;  1B4Z A;  2AYS A;  4Q8R A;  1EZ9 A;  1GR2 A;  3CRB A;  5I2K B;  2DE2 A;  1A55 A;  2QSX A;  3VVF A;  4ESX A;  2H99 A;  2F7A A;  1IEJ A;  1OVB A;  2DWJ A;  2F5X A;  2QRY A;  4H65 A;  4XKQ A;  4EF1 A;  2XHD A;  1B3H A;  2Y84 A;  2F34 A;  3O6I A;  2RIN A;  4NTL A;  4U22 A;  4XKP A;  5M2V A;  1B3G A;  3QYT A;  1AOV A;  2DE4 A;  4Q0C A;  2HZL A;  2Q9T A;  2XXV A;  4KYE A;  3M8U A;  5ITO A;  3QUJ A;  4IGR A;  4OFO A;  5F7V A;  3HV1 A;  4HTG A;  2DVZ A;  1HSE A;  2O1M A;  2O6A A;  1B58 A;  5EHS A;  3SES A;  1MQJ A;  3U72 A;  1JNF A;  1DPP A;  1OVT A;  3K6U A;  3KG2 A;  3EQ1 A;  1MQD A;  4EQ7 A;  4F3S A;  1LFH A;  1D9Y A;  3TEP A;  3MVW A;  1MDP 1;  2XD2 A;  3W15 C;  4BDN A;  1GV8 A;  2F35 A;  2XXP A;  2GHA A;  4N07 A;  4QSC A;  3S4U A;  3PU5 A;  1QKA A;  1MPB A;  3LSX A;  4XIG Q;  3N5L A;  3LSW A;  3UGW A;  3O29 A;  1Y1Z A;  1YAE A;  3OEN A;  3PUW E;  3ONM A;  4I8C A;  1SBP A;  4R6H A;  5B70 A;  1XHY A;  2V3U A;  1Y3N A;  4R2F A;  3ZSF A;  3K4U A;  3BFT A;  3CI8 A;  4FAJ A;  2OWS A;  1II5 A;  2ZYO A;  1ZTY A;  2I3W A;  3E9X A;  3IOU A;  4FJP A;  4M1V A;  5ISU A;  5K2X A;  1NNF A;  4DE8 A;  4JWO A;  3T22 A;  3TCF A;  3TTK A;  1R6Z A;  4HW8 A;  5KCJ A;  2DOJ A;  2YJP A;  5FHN A;  2BJJ X;  1MH3 A;  1FTL A;  1EZO A;  2NVU B;  3PGF A;  1LCF A;  3I5O A;  1FQB A;  1USY E;  1M5B A;  1ZKB A;  2UVG A;  3G3H A;  1WDN A;  3B6T A;  1WOD A;  3G3G A;  3JZJ A;  4GFR A;  4PE5 B;  3T9U A;  3TPA A;  3UA8 A;  3V89 B;  4PFT A;  3E3K A;  2DWA A;  2AIX A;  2ZNT A;  2Z8D A;  3MPL A;  4XXU A;  2X26 A;  3H6U A;  4EF2 A;  3PUV E;  1VSO A;  5CC2 A;  3USD A;  4YMB A;  1OLA A;  1PB9 A;  4G8N A;  1M5C A;  2FNC A;  2PT1 A;  1S7Y A;  3OO7 A;  4H5G A;  3KGC A;  2UXA A;  3MVZ A;  3V8X B;  1YCJ A;  3FAS A;  4GL8 A;  3T93 B;  2D21 A;  2ANJ A;  2X7P A;  1S9T A;  3FJ7 A;  1O7T A;  1ZU0 A;  3SEU A;  1LAG E;  4MH5 A;  1MPC A;  3R26 A;  3S9E A;  5EHM A;  4OHN A;  3TMG A;  3HST A;  1N7X A;  4DLD A;  5HM4 B;  4OEV A;  1MQG A;  4G68 C;  1BKA A;  1FCK A;  1IXI A;  2XXI A;  3FXR A;  5FHO A;  4GD5 A;  1Y3P A;  3Q29 A;  2PX1 A;  3K1N A;  1B1H A;  4F1Y A;  3L6H A;  4BDO A;  1FTM A;  2Z22 A;  4KYD A;  5H8S A;  3GZG A;  3SEX A;  4GXA A;  4KCD A;  3W9W A;  4WKM A;  3G3F A;  5DVF A;  3CFL A;  4NF4 A;  3DM0 A;  2VD2 A;  4EDP A;  3MP6 A;  2QPQ A;  3MWB A;  4XKR A;  3DP6 A;  2VD3 A;  2O69 A;  1Y20 A;  2XXH A;  4ZEI A;  1WVJ A;  2Q2A A;  3UK4 A;  4YB6 A;  1N7W A;  4H6D A;  1BLF A;  4BLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...