1F9HA

Crystal structure of the ternary complex of e. coli hppk(r92a) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.50 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPATLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
publication title Dynamic Roles of Arginine Residues 82 and 92 of Escherichia coli 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase: Crystallographic Studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1f9hA00
4M5KA 3MCMA 3QBCA 5ETVA 4M5JA 1EQ0A 3IP0A 3HSGA 5ETQA 3HT0A 4M5NA 3UDEA 1HKAA 4CYUA 1KBRA 4CRJA 1EQMA 4M5GA 5ETLA 4AD6A 1RU2A 1RU1A 5ETMA 3KUGA 4PZVA 1TMJA 2CG8A 3UD5A 1IM6A 5ETSA 2QX0A 3ILIA 3HCXA 3UDVA 5ETOA 1EX8A 4CWBA 5ETTA 3KUHA 5ETKA 1HQ2A 3HSZA 3MCNA 5ETPA 3HSJA 3ILLA 4M5MA 1F9HA 4M5LA 5ETNA 5ETRA 1DY3A 1RB0A 1G4CA 3ILJA 2BMBA 3HD1A 2F63A 1RTZA 2F65A 1TMMA 4F7VA 3ILOA 1Q0NA 3HSDA 4M5IA 3MCOA 1RAOA 1CBKA 3KUEA 4CYUB 4M5HA 3HD2A
chains in the Genus database with same CATH superfamily
2Z56B 4N76A 3PEHA 2P9EA 4LFAF 4DV0F 3ULHA 2NLWA 4NASA 1YJNS 1IBLF 4K4YA 1RYSA 4K0KJ 3DOMA 3BS9A 3WX4A 2QV6A 2B43A 2HSEB 2QFIA 2LQBA 3R5BA 4JI7J 3QLHA 1BHNA 2W24A 2M3DA 3HFZB 4B17A 1IKYA 3SV4A 1D9DA 1H38A 4NLSA 1WDDA 4ZKAA 1YBUA 2RAQA 4DL6A 1S59A 4J9KA 3LO3A 2L48A 3Q22A 4ANCA 2HS3A 3TR5A 9ATCB 1U09A 1MROA 1RTIB 1S6OA 2OMOA 4K4UA 2WVFA 3F73A 2AJFE 2C2KB 4J5OA 3W9HA 1NJXA 1SJ3P 1S9EA 5D0EA 2HFZA 3L7PA 3BBFA 3Q8PB 1U49A 2CIMA 3ZZUA 2EFNA 3GR0A 1J5EF 3TZXA 4P7TA 2LDYA 2ZKUA 3MECA 3TP2A 1SJ4P 4EWTA 4Q45A 2Q1LA 3DM2B 1GXLA 4P74A 3HHKA 5HMZA 4CLFA 4F0HA 5B09A 2IIHA 3K5OA 4YB5A 3SBMA 4OFZA 1P1LA 3B6BA 1Y5LB 3FEYB 4FDFA 5SUHA 4DV6F 3MAAB 4PPZA 1N5TA 3R2DJ 2CZ4A 5EWFA 3BSAA 3G9CA 1TMJA 4KHMA 1IBKF 1B7YB 4EZ9A 3GG0A 1HI8A 4NRUA 2G2OA 4K4TA 5ETRA 4LSNB 2GX8A 3VZIA 2YWHA 1R0BG 2AGPA 2I1RA 4DF8A 4TN2A 3IFEA 1MN7A 2IJNA 5HP1B 1L3TA 4L76A 1WC6A 2AT1B 2MYFA 3PW7A 4RLEA 1LOUA 3ICLA 3G6XA 1M0SA 4J9OA 1SC6A 3RU0A 4I7FA 4GVBA 2Y1LB 5BJRA 1O0PA 3CSKA 4BCAA 1P6TA 4RW7A 4H4MA 4L75A 3Q8SB 2AHOB 2UUTA 3RW6A 2UP1A 3MUTP 2DH9A 2LCWA 2CPIA 5FJ4A 5G4DA 3MMBB 1GAOA 4ZVOB 1UA1A 1HYSA 3E01B 4X4TA 3U1MA 1JLFA 3BZQA 3PRVA 2BVZA 2ROEA 2HQCA 2HFUA 4F3MA 4IO9Q 6FD1A 2MZJA 1OS5A 2CPJA 4CTAA 4LF6J 2EC0A 5LSLA 2ZVIA 4I1TA 5J1EB 4ZPBA 5EHHA 3HM9A 4D3HA 2MKHA 5C2CA 5AT1B 3VGUA 5LJ3Y 3A3NB 2XYPB 1M1GA 2CVIA 3G8SA 1VQNS 2XCPA 3LGMA 3DRRA 3MAHA 3IM9A 4AL7A 4U8YA 2VFSA 4USJC 2CPEA 4EUVA 2XY7A 4JI6F 3CWJA 2VG5B 4MAKA 1EETA 4USTA 2AYMA 2RSQA 1S99A 2V8DA 5KFPA 2C2MB 1SH3A 4Y3CA 4ZPAA 1VQ5S 1YQHA 4KGKA 1RSCA 4G3IA 1JLEB 1IJFB 1S1XA 3FRYA 1XNRF 2ZH3A 2I9SA 4QOTA 4QW9A 2WZ1A 3UO0A 3D1QA 4TU7A 2E1MC 1WI8A 1RT3B 1D1UA 3E2EA 1N5SA 5I3QA 1S57A 3NMRA 1FRKA 4RUHA 4EBDA 1S97A 2MKIA 1EQMA 3LF0A 4WP3A 4PR6A 1OY9A 1R3NA 2OTLS 2O1PA 4ZA1A 4OZJA 4O3RA 3GPAA 1NJZA 1T94A 2HQDA 3K89A 3CJRA 5GADI 3CT9A 3KG4A 3HHLC 1AYEA 4XDCA 4HHJA 5KT4A 1FX4A 1R27B 1N33J 2Q3PA 5LXYA 4JI3F 4IQXA 5KFRA 3UCGA 2HQ3A 2ZKTA 4HTJA 5M2UA 1HHQA 3HFVA 1D09B 3VWSA 3VAHA 1V5VA 4PCQA 3QT5A 4IYQA 4IH6A 4O4GA 1U4BA 4DSEA 2WOMB 2QFJA 4FS2A 2ROPA 1TQLA 2E5IA 4XK8C 2FYXA 1P1TA 1RA7A 1TV6A 4TKTA 2KKHA 5KFIA 1TU0B 1FF2A 4Z37A 4I56A 1DQAA 2R7VA 5DRKA 1LWEB 4K4WA 4P7VA 4TU9A 1FE4A 2BDPA 1SKWA 3RBZA 5JUMA 5A6WA 2HKEA 4ZLLA 4KIAA 4OHZA 2OD4A 1RWKB 2OIHA 3F0NA 4K4SA 4O0IA 2V9WA 3CE8A 5A8KB 3M9NB 1H2VZ 2EBGA 2BJ8A 1KDNA 1XR6A 3TARA 4X64J 2YWWA 3NL0A 2B4OA 4KSEB 3N6NA 3KDNA 1E6YA 1IQZA 4IRDA 4DR1F 1JIHA 2KXHA 4Y65A 1KP6A 3IM8A 3LOUA 1U47A 2F5GA 2WVDA 4NLTA 1IKWA 1NLKL 2W4PA 5T7LB 4NZ6A 2MZTA 4OI4A 4LF8F 2HZVA 2AJ4A 4TY9A 2VF3A 1FKOA 4B9LA 1FEHA 3VAIA 1SC1B 3UD3P 3RZAA 2OSRA 3CCUS 2FDNA 2UU9F 2FY1A 4C6AA 1KOHA 1L3VA 2NYIA 3KLGA 5LL6d 1TZ0A 5ITHA 3BJYA 2RUGA 3PACA 2G9OA 1VISA 2G4BA 2QEXS 1FWPA 1S0VA 3NLCA 3MAQA 4B3TJ 1RKJA 4ED2A 4FYWB 5D0RA 2MZRA 2O01C 1AB8A 2YNIB 1EKSA 2KYZA 3C46A 1F5BA 2CJ9A 1OYDA 2IDEA 1IWAA 2YBVA 4DV3F 1UVIA 3HZEA 3TUJC 3AODA 4ZPWR 3LP0A 1RAJA 2HBRB 2CFXA 3ZTSA 3HT0A 3PEJA 2KZZA 3J7ZT 2WVCA 4CT9A 4WU2A 3BQ0A 3M1VB 3BH7B 4GKKF 5HMYA 3SDEA 5DDRC 3ZZOA 3SYZA 3PM9A 3OTDA 2RDIA 3PNIA 3FC9A 5IC6B 2R8JA 3CIMA 1RTZA 4DUYF 3CB4A 2V9KA 4LF4J 2PO4A 4FKYA 2Y1JA 1JXLA 2G1DA 3O1LA 4AD6A 2HHPA 5F9NA 2OO4A 3DLKA 3OR2B 4EMDA 4C0BA 3MEDA 2CDQA 4EK2A 4C8YA 3WIUA 3W2WA 4ETXA 1VBYA 3DKDA 5HJXA 5HVFA 3UDEA 3H20A 1X0PA 3NP5A 3KUGA 3MHYA 4MKAA 5KG0A 2FD2A 4YY3J 4DPWA 2F8EX 2FJBB 2H4YB 1JWWA 1Y00A 2FC9A 2A10A 2MEWA 1HNVB 3M7VA 3DHWC 2MSSA 3D28A 2X1GA 2AJ0A 2QLBB 3UWTA 6FDRA 3Q8YA 3MM8A 1GK8A 2VIHA 1OMSA 4PKDB 2H4WB 4DFJA 2UVVA 2VQFJ 3BBBA 1S1TA 1RT1A 2DO4A 2XWYA 5IT9U 1PSDA 5CA5A 3LP1B 3ZTOA 1G6BA 1QAYA 2ZDPA 3C6UA 1RT6B 1FT8A 3MD3A 2ACYA 2CKWA 5F8NA 4HHUA 1D8YA 3W3SA 5IM0B 3PG9A 1VFJA 2M7SA 4LFCJ 2KG1A 3ZFVA 1TKXB 2KHDA 2DRAA 5ETTA 4F3QA 1T9XA 2IJFA 5D4PA 2N3LA 1MWZA 3BQ1A 4KGVB 2XY5A 3MR2A 1U26A 3A4TA 1N5YB 4ZVFA 2R7SA 2QLJB 3H2VE 1OJ4A 3KK3A 2EW9A 2XNRA 1P9YA 5KG1A 3W65A 4FNHA 3HPOA 1RADB 2XC9A 4NI2B 3VAKA 4QYRA 2YKNA 4GC7A 1QAJA 1HBNA 4J9MA 5B08A 4L3KA 1RXOB 2PFFB 5K14B 4DZ6A 1TELA 1TFWA 4JI4J 3FBBA 5IZHA 1LV5A 3PFEA 4XPCA 2E1PA 4CO4A 4C2MA 3PJ9A 3G96A 4X66F 3R3TA 5DQGA 1VQMS 2E5JA 4AUKA 1URNA 3OUYB 3P3DA 4NE9C 1QTNB 4FVMA 4C11A 2XTJP 2JH3A 4F4WA 1M5OC 4HDGA 1HNXJ 1CSJA 4RL1A 2HRYA 3BREA 2BOPA 2IAJB 3Q86A 2VG7B 3IAS9 1SC4B 2W2OP 4KV8B 3GWCA 3PHTA 1GT8A 1FTCA 4CLSA 3G4SS 3DNCA 4RNNA 1ZM4A 1Y3KA 1Q0NA 4DCOB 1CJUA 5F8IA 4JBCA 5HBMA 4BWMA 1NJIT 2FC8A 3HVTA 3I0SB 5F3TA 2B5JA 2RF2A 3PW0A 1N36F 2JRSA 3CIZA 1H72C 1U1OA 4OHVA 4FNIA 2GGPA 2XS7A 4DPUA 1PIEA 1TVRA 4ZJLA 3KFWX 5J2PA 2PI4A 2EFQA 1KQFB 3QNWB 1R6VA 4USKA 3CD0A 4QU7A 1FDAA 1SJ1A 5C24A 3TAMB 3R97A 4DOZA 2LKZA 2ZFHA 4M5DB 2F4VF 2AMCB 4ZPTR 3CC2S 3PX0A 1UL3A 1B99A 2H1YA 5KFSA 1PKUA 4O3SA 4I2PA 4LUBA 4PWDA 5CYQB 4ECYA 3V4MA 2XMKA 1IBMF 4U7UK 4OYPA 3DDNA 1I94F 1R7IA 4IH7A 4P10A 3W2VA 4LF9F 3K8VA 2ATCB 4JI2J 5THWA 1YTYA 4WFAQ 3MPDA 3JB9k 2DNRA 1NPKA 3HHLD 3M2VA 3OSPA 1SXLA 4N5SA 3R5DA 2MKYA 8RUCA 1M5SA 3TEGA 4JI1F 2KN4A 4X4OA 3ISZA 2FVPA 4N8NA 2OP5A 2AW0A 1URRA 4E0DA 3VF0B 2H5IB 4K2JA 2HW3A 4JV0A 4NX9A 4OX6A 3PJXA 4DUZF 3PRBA 3ZNJ1 2K1RA 3UD4P 4MIAA 1UWBB 5I3PA 4DFKA 4MFBB 3GQCA 4UQTA 1W2BR 4CYUB 1SUQA 4EFAC 3QAUA 1M90T 2CNNB 5RUBA 3R1LA 4UUWA 5L1KA 2IC3B 1WHVA 3V81B 2RH3A 1JXVA 2W2NP 5CZVA 3MR3A 1SV5B 2MLZA 1Q86T 4UZBA 4NPOA 4NMLA 3ET6A 2RRAA 2GMLA 3SCJE 2DH8A 2UXCF 3NCQA 2J6TA 5KFJA 5ETLA 4NLDA 3W61A 1G7CB 1WI6A 4DX5A 2MZSA 4PQAA 1OQ3A 3A3OB 1BXNA 4DSLA 2AGQA 2ZHOA 4M5JA 2WAQD 2LU2A 4C3KA 2C3MA 2IHR1 1BC6A 3DRSA 1KOOA 5AXMA 4C9DA 2E5LJ 4HI1A 2KJVA 4ILLA 3HJVA 4LVOP 3JAMU 4DR3F 1X8DA 1UEVA 1TUVA 3I4HX 4I64A 1Y4ZB 1HKAA 3Q8QB 1M1HA 4YS2A 3H4BA 2B9YA 4C8LA 3BSOA 2H5JB 1ZM9A 1R8PA 1U2RA 4NCGB 3AHPA 3LQVA 1WOPA 4URSA 4L6V3 2LP4A 5K8MA 4LF7F 1DTQA 1YHQS 2PMHA 3TQEA 3ZZZA 2BJEA 3JYTA 1WEXA 1MLAA 2HQFA 4IO1A 2XMAA 4A47A 4MKYA 3SXLA 1EJ7L 2PI5A 3MF5A 2N4DA 2JFDA 4KRWA 3MOJB 3VTIA 1R0AA 5KT3A 1RHRB 3WBZA 3V6JA 4YR0A 5LMNF 2YWEA 4CH0S 4KBIA 3CDAA 2MHEA 3UDLA 4WPAA 3NWRA 3GJTB 1YWXA 1S1WB 2YX1A 2NR0A 2QSFA 1JLGB 1X5PA 2PMZD 1R8BA 2LQ9A 5D0HA 5KOWA 1HHTP 3FCHA 4YDDB 3MMCA 4AL6A 5CAAA 1TFYA 5HATA 1XNQJ 2RJZA 4WE1A 2UUBJ 5KT7A 3HP6A 4M1KA 4BS2A 3IN5A 4CDIA 4U6PA 5DO2A 1TL3B 1OSCA 1GMWA 3SQGA 3KUEA 4YOEA 3KJFB 3IR6B 2Q66A 4MYUA 2DGOA 3S8SA 3SEOA 5CYMA 5ETOA 3QYYA 3LH2S 4ZDNA 1WC0A 2F8MA 3BEGB 4UY8T 4WK3A 1RU2A 2GQCA 2IYIA 1V3ZA 5KFAA 1EARA 1MROB 1Y5IB 3CDBA 1NJWA 2NSCA 5I4MA 4DR5F 2J8SA 4LRDA 4WFXA 1WDTA 1K0VA 1S9EB 4O4RA 4U96A 2XSJA 4HH1A 4TVAB 2OEMA 4B02A 2FLPA 4CLKA 4TXSA 4ZVQB 3TNVA 8AT1B 1YRXA 2AU0A 2RKIA 4B3SJ 3RBDA 3DLEA 2NCKL 3ILOA 4RX6A 2PA8D 2PMWA 1U1NA 3MECB 3H4DA 2P2CB 1PC4A 4KFBB 2DKOB 3GIRA 4RUAA 2B0GA 4OYOA 1T95A 2YKQA 4B3MJ 3IRXA 3DYAA 1KS2A 3UNYA 3HD2A 3HMJG 3I0RA 3HI9A 2R2UA 5KTQA 3FUYA 2QMXA 4NZ7A 2B4VA 3A3PB 4O44A 2J7KA 4CQ1A 2OLWA 3MD1A 5F8MA 4FF2A 1RLDA 1CJKB 1EP4A 3SCKE 1S77D 2QLFB 1BQMA 2ZJQQ 3CUNA 3L7OA 2ZZNA 2CJAA 5HVGA 2DJWA 1VYAA 4P2SA 4I4BA 2XM3A 3PW4A 4FZVA 2L08A 2BRLA 4GO5X 1TL1A 4GVBB 1LNQA 3GTYX 5F3ZA 2VB6A 4DG1A 4F04B 4DQIA 3NBPB 2MQ8A 4H4OA 2QG9B 2XLJA 3DCAA 1WTBA 4K7QA 2ZH8A 2HIQA 1SL2A 1JLBA 1Z4UA 3CJ8A 4DV5J 2N3OA 2LFVA 3CJSA 4HH0A 9RUBA 2QZ8A 1JLFB 2HQIA 3RUBL 2R8IA 2GJFA 2QL7B 4ZLPA 1HD1A 2C1EB 4IFVA 2E5GA 4LQ9A 3CDUA 4Z7CA 4NXNF 3ISNC 1XMOF 1JQGA 2VA2A 1HNWF 1FNXH 1ICEB 4QCLA 3S6EA 3VGSA 4CO3A 2E7VA 4NLGA 4KGZB 5GVQA 2DGTA 2HVZA 3OHAA 2QYGA 5KFLA 4GKJF 4F4AA 5ETKA 3NNCA 5LSOA 2KZMA 5J2MA 3IO1A 3H59A 5LOQA 2HFSA 2DNHA 3W9IA 3OXGA 2F9DA 4BC9A 1SVDA 3NEKA 1UWAA 1Q5VA 1KD1T 5B0EA 1F9HA 2YPZA 5KFDA 3MEGA 1S1XB 1QVFR 1YJVA 2XMVA 5SZTA 3OFFA 4WP8A 1RTIA 3AFGA 5EN1A 3TRGA 1S4EA 1U0HB 2FHJD 2HHHJ 1GNKA 4OQJA 5L38A 2QN6B 4UW2A 1E6VB 4NA2A 3TAPA 4B9VA 4CLWA 2ZH9A 2IVFB 1JJCB 5KFTA 1JLQB 2FLOA 3KG0A 2FY8A 3EZUA 4PXBA 2BANB 4XTTA 1U1MA 5MAOA 2HFVA 5KOXA 2CQ0A 1S6QA 3DM2A 3T6JA 1H98A 4AXJA 2FQQB 2KVQE 3CEDA 1FXLA 1VI7A 1HNZJ 2V94A 2Y8YA 4ED6A 2DIUA 2R7TA 1SJRA 5K5MA 3MAAA 4NYPA 4GRSA 2ALYB 3HSGA 5AJ3F 1T02A 4O4GB 5H9FK 1NXIA 3TVZA 5KFXA 3UCZP 5H1SV 4LSNA 2FLLA 1T7PA 4PQUB 1OQ6A 5GADU 2R8KA 1TV6B 4YHHJ 5HP1A 3EXYA 4HEA9 4OI2A 2XO7A 3M8QB 3KXDA 3MPVA 3O2IA 5E3PA 4Q5VA 2FHKA 5DG9A 3DI6A 4OV1A 3FQLA 2W8LA 2O3DA 4RR5A 5LT5A 3AH6A 3ZTRA 2W9CB 4RW9B 2IVMA 2DGQA 3N6LA 4FF4A 3MM5A 3NS7B 5CCLA 3FBFA 3KMQA 2XG8A 3QIPB 1RZMA 1ZBTA 2ZH1A 3MMBA 1RHKB 1S0OA 1B4SA 3CCWA 2HHTA 3KK2B 2ASYA 4LFAJ 4DV0J 3FJ2A 1V9OA 1IBLJ 1C1BA 1J5OA 3KK1A 1WUUA 1WORA 2AZ3A 3LGHA 3C19A 1DLOB 3N6MA 5J1EA 1E6YB 4C8NA 5DDQC 1OIAA 3DC2A 1JNRB 1S1UB 1RT5A 3BR8A 2ZH6A 2Z2YB 2AKWB 5DG7A 1MG7A 1RBLA 3C14B 1F2HA 2EVZA 3EM1A 4FYVB 1WG1A 4ZCMA 1MN9A 2LLZA 1U1QA 1FKOB 2MZQA 3EX7B 2D69A 3NG8A 1ZAWA 4ZVGA 2QO3A 5A76A 2ZD1A 4BDPA 4XPEA 1VCTA 3UR0A 3AOBA 3WDOA 4FF3A 3OTOF 5MLCV 4DZDA 4S0MA 4QIWD 1RT3A 3JXOA 4U67Q 2ADBA 1L3UA 3I5CA 2DR8A 1NU4A 3DDIA 1VQKS 2KL8A 2FJEB 3MM9A 4RNMA 5IS2A 4WK1A 3CDWA 3H5YA 2KT2A 1FJEB 2HK3A 2Y1RI 2JX2A 3FSXA 4LJMA 3IGVA 1YBAA 3D6MB 2MZ1A 5L39A 4DV6J 2ROGA 3JS9A 2C2DA 2BJ1A 2Q79A 3HFKA 5D4LA 4Y2CA 3I87A 1FERA 5KFZA 5E0OA 2NXCA 4E2FB 2G1HA 3KLEA 1IBKJ 3N0VA 4H4KA 3KKFA 3R7NB 3KDOA 2P6SA 3LTOA 4ZLNA 1TUWA 2ZE2B 1QAIA 2WOMA 1VLYA 3NGSA 3PIPQ 3VGTA 2IPOB 2VODA 2LA4A 3DOKB 4DU8A 1VR6A 3EGVA 4DCJB 4CM2A 4ZMMA 1LWEA 2KFYA 4WU3A 4UF4A 1FD8A 2OJ3A 2AJQA 1VMBA 3W2WB 2MJUA 2VKZG 3EGNA 2F63A 1F1BB 3P5BP 3U27A 2BBEA 2HLTA 4N56A 2R7UA 3PYGA 3UD5A 1X4DA 1FO1A 1C0UB 3GYXB 3E8OA 5A8KA 2VC0A 3BPSP 1S5ZA 2P6TA 1KFSA 2DGSA 3OQ2A 2W7PA 1OO0B 2DNLA 3J80Y 4Q2MA 5T14A 5GAEI 3PJWA 3MM8B 1W2IA 4I0WA 3V6DA 3QMQA 5KFBA 4X65F 2V4QA 4ES2A 4ID5B 5I3UA 4ZP9A 5T7LA 3IG1B 2BZ2A 2F3JA 4JI6J 2CJBA 2QRRA 5KT2A 2DNQA 1FRMA 2APOA 3CXCR 2R7RA 2X1BA 2EC2A 1NK9A 1D0EA 3QSIA 1PJ5A 3BB5A 1XNRJ 1EZZB 3IBWA 1R8CA 2LEAA 2ZHAA 1JK9B 4L3NA 3DMJB 3OFEA 1RWNB 2XHWA 7FDRA 4DQSA 2KDOA 3CCSS 3KOAA 1H2UX 3HSDA 4OJ3A 2HIYA 3FEXB 1YGYA 3BR9A 1T3NA 2YNGA 5KFGA 2AYBA 2H5EA 4YN3B 3H40A 3AOCA 1J27A 1KEKA 4KHPF 2V2ZA 3GFHA 5GMEA 1PO6A 1HBNB 3QFWA 2WBRA 2XWXA 3BGRA 2AEMA 4V19X 4HTIA 5CZXA 2PSZA 1NB2A 1UZHA 1DTTB 2CXEA 3BSNA 2EK1A 4P9SA 5HMWA 4J37A 3U7JA 5L9XA 3OLAA 4JI3J 3OBIA 1F0XA 3GFZA 1L3SA 2K8GA 2MMYA 2IDLA 3UR3C 3DLGA 4DN0A 2XB2D 5KG3A 2M4MA 3EMTA 3H7HB 4X62F 1RAFB 2WSFC 1I51B 3ETMA 4PABA 4KH0B 2KJWA 1YJUA 4EO6A 3M1VA 3RG6A 3W8GA 2BKNA 3MUVP 3RRGA 4JI7F 4F0MA 2UXDF 5GAGI 1S1VA 4P2MA 1WACA 3KNAA 5B7WA 4L73A 4OYAA 3MMJA 2K7KA 3NWGA 3JSMB 1LWCB 3MR6A 4EYHB 2BXJA 2D3O1 4IR9A 3CJ4A 2ZUAA 3KNGA 2OPRA 4RW4A 1IN0A 3I55S 5KG4A 4A8MP 3L3CA 1YZ6A 1CJUB 4OHXA 5LJ5Y 2F8HA 4P71A 2B5JB 1MWYA 2XZWA 3G8QA 2ZJRQ 3ZZTA 3TUPA 2D7SA 2D1CA 4BLGA 1RWMB 2HBZB 2GGPB 4CLZA 1DARA 1TVRB 1S10A 5HVHA 1M5KC 1OY8A 5F8HA 4NLUA 1VBXA 1RHUB 3UN5A 1D9FA 2YX7A 4H54A 3EPGA 4J91A 3R1HA 1HNVA 2FZKB 4DR1J 1IUJA 2RUSA 4A8XA 2DO0A 3R7BB 1Z2ZA 1NHVA 3VAJA 4KY3A 1T9WA 4NEYA 4OZNA 2PE8A 2V2QA 2GJ2A 1RYRA 2Z58B 2AEFA 1LK5A 1WG5A 4KYZA 3ENQA 4LF8J 1WF2A 2KH9A 1RCOB 2KFZA 4KGXB 4DPXA 3LP1A 4DPTA 3TA0A 1SJQA 4OYBA 1T8EA 4I2PB 2U2FA 2LMIA 2V0NA 1ZTWA 2UU9J 2KG0A 1VQYA 1NH7A 4RW8B 5IM0A 2J7UA 3QO9B 2RRBA 2GVZB 1JMTA 1H2TZ 2VPYB 2ATLA 1TKXA 3L95X 1XMBA 4M5LA 1NHKL 1RI7A 4DL3A 2LVWA 4A8KA 2CPXA 3US5A 2BE9B 5E33A 1CG2A 3GCWP 4EI2A 2KTQA 1RT2A 3TVKA 4NI2A 2E9RX 3RRHA 2K1RB 4O23A 2QA2A 1FWLA 3ZO7A 4DV3J 4B3RF 2JNJA 3B4DA 4Y2IA 3H42A 1SUQB 5K14A 2ZBCA 4K8RA 3DDKA 3D6HB 1DHMA 3ZTQA 5KG2A 5DG8A 1FKPB 1O51A 4F3OA 3CMQA 1YLXA 4MJKA 5HJYA 2CQGA 1WEZA 4NL5A 4KAIA 5KFYA 1X31C 4GKKJ 2C28A 4WXWA 4OJGA 3BDPA 4TNOA 1Q16B 4NLXA 1X5SA 2IBKA 1LK7A 2CPZA 3P45B 4IFYB 2CWXA 4MKBA 2NS1B 1A7GE 4DUYJ 1D8ZA 1B7FA 2IAJA 1TK8A 2LYVA 1ELOA 2VG7A 1FKAF 1YITS 3DRSB 2XGPA 3DLHA 3CTRA 2WHOA 3DU5A 1HNIA 2YH0A 2HQGA 1T9VA 4W92B 2R4FA 4DR4F 2FJVA 5K20B 2Y3YA 4M5HA 3P96A 5BYSA 5E5NA 1TL4A 4B9MA 2VPWB 3I0SA 1R6YA 4DPYA 1ZM3A 1DRZA 2RNEA 2DPJA 1GEHA 4E98A 4XDDA 2WVEA 3ETOA 1OPIA 2VDIA 1GTEA 1HWIA 3PIOQ 4O3PA 2LEBA 3PYEA 3VAMA 2UUCF 2LQ8A 3HVAA 2ZWPA 2ERRA 1YJTA 3CMES 1TKZB 2CZ9A 3TI0A 3TAMA 4ICLA 4OX9F 1QVGR 5F8GA 2IBOA 2KRBA 4M5DA 2Y9HA 3RB6A 1X9MA 2WBMA 3M2UB 2WB4A 1UFKA 2DCUB 3T1HF 2HBQB 5CYQA 1YI2S 3MMCB 3FSIA 4ECQA 2V8PA 2IFXA 4PAAA 2VASA 1OWXA 3C15B 1JX4A 2K06A 4ED0A 1I1GA 2N7CA 3D67A 5KFHA 3NKYA 4B9SA 1N48A 2UVUA 4NA3A 1EX8A 1IXKA 5ETNA 5JVGQ 1FI4A 1RB0A 1N4LA 3Q83A 1WKJA 2Y0SD 1Q7LB 1T0TV 3X3UA 4ELVA 5IFMA 2ZOGA 2M0GB 2NYHA 3W63A 2JFKA 4G1PA 3NY0A 2VPXB 1UWBA 2R8GA 4CYUA 2CNOB 2YTCA 2J6UA 5E2QA 5M2RA 4X66J 4DSIA 4ELTA 1HWKA 1ZTTA 2IC3A 1SJFA 1EHWA 2SXLA 1CVJA 2HHQA 1SV5A 4R0JA 1SL1A 1KTVA 1N56A 4OYMA 2VKRA 5B0CA 2RKIB 3UNGC 1VRQC 1S4FA 1EB0A 5M2PA 2BUNA 2J9EA 5IV4A 3SFUA 1T11A 4F25A 3R2CJ 1VQLS 2ZUGA 4UTGA 5AXKA 3PX6A 1QE1B 3IRXB 3I0RB 4TU8A 3OTEA 1KHVA 5B0FA 3VR1A 3NGDA 1XWLA 2FJAB 4J9RA 2QL9B 1N36J 4K4XA 2O67A 4C98A 3IS9A 1U0SA 4RBUA 4NCGA 3OL8A 3GIIA 4NCBA 5KFVA 1S79A 4PG4A 3W5XA 3QZ7A 2HURA 2OPQB 1MWQA 1IM4A 2IA0A 3P5TL 5E7OB 3FZ2A 3O5TB 4DJBA 3U02A 3IA0A 4BWJA 1FFSB 3P4UB 2FVRA 1JKHB 2C2RA 3KLHA 3ENWA 3H5UA 4IRCA 5IT4A 2F40A 1X0FA 4UOGA 2MPUA 2DYAA 2MQLA 3N01A 2F4VJ 5E3RA 4DG1B 2MJNA 2FTRA 2RILA 5K8OA 1Q79A 4C8ZA 5I42B 2BACA 3QBCA 3QJPA 1T03B 4QWEA 5G0RB 1IBMJ 2Z0GA 1UCNA 3LGNA 3UPFA 2EG1A 2YQ3A 1I94J 1UETA 4ZS6A 4LF9J 2MQNA 1N6QB 2KVIA 2VA3A 1S0MA 2YNFA 4IFVB 4FKXA 1MSWD 1HR0F 4JI1J 1LWFA 3MR5A 2CPHA 2JSXA 3Q8RB 1V3SA 1R8AA 3OFGA 1X4BA 3SMZA 1TL3A 2FJXA 2VFVA 3EICA 4DUZJ 2BM1A 5IT9Y 4XIUA 4V19J 3G71S 3K2YA 2C2EA 5J2MB 3EJMA 4KO0B 5H9EK 5L1LA 3NNAA 2NZ4A 3L7UA 3J7AN 3MEGB 2BM0A 1NCLA 1UJ6A 1SI9A 2KM8B 1YSJA 3V5RA 4U7UD 3GP9A 2UXCJ 4DL5A 2HRTA 1RWPB 4K4VA 1WF1A 4LF5F 2E44A 5F8LA 4ED4A 4O0NA 2RU9A 3R8YA 1SKSA 2B4UA 4A8SA 4LVNP 3BBCA 3LPYA 1NM2A 2MSTA 4NMXA 3HCXA 1RJJA 1QAXA 3K17A 4AT1B 3W60A 1S6QB 4DR3J 2CPYA 4KFBA 4BHQA 1QM9A 4YB7A 2VJUA 1H6KX 4X84A 3PKYA 4NOHA 5KFUA 4RUBA 2FHJA 5A8WB 4LF7J 4QBUA 2ZC3A 2N82B 4B9NA 3PCOB 2VFTA 1CJKA 1P27B 4Z2XA 4YP3A 1X5OA 1U8SA 1R89A 4DXLA 3D9BA 4U8VA 2V2KA 2PT0A 1NKCA 1HA1A 1RHQB 1X4FA 4A8WA 1U1KA 4GVLA 2B56A 2ZC4A 1RBAA 3RB0A 5LMNJ 2HS0A 2GW8A 4PWWA 3WC2A 3IAM9 3MZIA 3CVKA 3DI6B 4OZ2A 4ECVA 1Y11A 3OR1A 4GMKA 3PYDA 4F0KA 3NBPA 4UZCA 3MM5B 3MUMP 4ZVUB 1MMLA 4IG0A 3EE3A 1DZ5A 2J6SA 3PO5A 4QPXA 1QSYA 4HHHA 4ZITA 3MPUB 3Q8VA 1FRIA 5KFEA 3OV7A 3OHBA 5LMUF 1FE0A 1C1BB 1N34F 1HQEB 2F7VA 2E29A 1J5OB 3KK1B 4YEAA 2QT7A 1AROP 2LECA 5HK4A 3MM6B 1BWEA 3WHIA 2Z2ZA 5HQLA 1Q8KA 2HYIB 3HF5A 3MOZA 1WF0A 1RT5B 2V68A 1IR0A 5IWAF 3RB4A 2IMOA 3BKTA 3DLJA 2BE7D 3TUIC 2FGOA 5HLFA 3U1NA 5E3AA 5K9FA 3CPWR 1JB0C 2ZD1B 4ZIWA 3RR7A 1XJWB 4HLBA 4DR5J 3T6BA 4LR9A 1KLMA 3HDSA 3GFXA 1NNDA 5D15A 2XGQA 2JEJA 1BQNA 2VU5A 2AJ1A 1U0HA 2XZTB 5JXSA 4DX6A 2DR7A 2HWTA 2NSBA 3TANA 5IV3A 3DRPB 1TAUA 1E6VA 1ZA1B 3CW2C 3MM9B 4A8YA 1JLQA 2CQHA 4CCHA 2VONA 4IG3A 1UTAA 2NXNA 2UUAF 1PBUA 4RUCA 1CC7A 2V69A 7AT1B 1NUEA 3H98A 2BANA 1CJVB 4W98A 4X4NA 4TQSA 1VRUB 1HBMB 4ZVTB 1AA1B 1NEEA 2IM1A 4LRFA 2CQDA 2PGCA 2DNNA 4C97A 1HWLA 1S48A 4C0HA 5E41A 4QU6A 2R7XA 5B0DA 4JV5F 1UPPA 5KFWA 2DXDA 2ZOMA 5HSPA 3KLEB 2I2YA 5B0GA 4CH1A 1R31A 3THVA 2QIFA 3BQ2A 2C3PA 5F8JA 2GMHA 2C3UA 2RMLA 3S7RA 2MY8A 1YJ9S 5KG7A 1UA0A 4ZP6A 4PQUA 4DV1F 3ZNUA 2PIIA 1UEKA 1WKKA 1YJRA 1QSSA 2XHCA 2M5YA 3C66A 2QA4G 5AE2A 3M8QA 1Q78A 3A8IA 1QY7A 4USIA 3SFGA 4WCEQ 3B8HA 5HROB 4FBTA 2WONA 2K7JA 2W9CA 3UDVA 4RW9A 2Q6BA 4JYAF 4B9TA 2LU1A 2K2PA 3QIPA 1L3KA 2V4JB 3ONQA 1TP7A 3WX8A 3KK2A 3V4IB 2OPPB 4NXNJ 3MFHA 5DETA 3CO0P 2GAGC 3SSSA 2V5HG 1XMOJ 1HNWJ 1DLOA 3D3CJ 2VFUA 2E1AA 2XI2A 3VZHA 5C5JA 3DLLQ 2HHSA 3V6DB 1C2PA 3FBEA 4HL9A 1PBAA 4GKJJ 4YDXA 4QWCA 2O5DA 4DFPA 3D3BJ 2WTFA 5I3UB 4FF1A 3EUNA 1VQSA 1O5JA 1S1UA 1A0OB 2JJ4D 4HACA 3C14A 2W9BB 2OFHX 2YKMB 4ZVHA 3ENVA 1A9NB 3R27A 3DGPA 5F41A 1NK8A 5GAEU 2VDHA 5EDWA 4OJ1A 1KBRA 2J9DA 4CO1A 3JSYA 2HHVA 4KKOA 2XYHB 3MURP 1H3DA 3SZ2A 2ZBPA 1LW0A 1TTHB 3RBXA 3M9MB 1WJ9A 5KFCA 1TKDA 1CJTA 2YWFA 3T5LA 2DNPA 3EGWB 2WW8A 2YNGB 1YIJS 4WZQA 1KQKA 3GSDA 3HXMA 1U2CA 4ECZA 3QPIA 4L74A 4FS1A 1N54B 2CQIA 4DFMA 2D3UA 4ED5A 3I96A 1X5TA 1H74A 3BGRB 2AEJA 3DFEA 1C0TB 3JSBA 1DQ8A 1N5QA 5T41A 3N28A 2UVWA 4WF9Q 3EPIA 3GFYA 5L9NA 3DLGB 3R6GB 3PHEA 1RHJB 3A8KA 2G0CA 3W62A 3BH6B 5L8RC 4X4QA 5AJ3J 1HWUA 4A46A 2DGVA 3GZ7A 2VFRA 4TQRA 2XMMA 2PFDA 4EEYA 2L9NA 4UOFA 3NOCA 1HMVA 2V2VA 2ZE2A 1TKTA 4WYLA 1K1SA 1S1VB 3N5FA 1VIOA 3IRWP 4BBYA 3HX9A 4W4MA 3DOKA 2W2MP 4CNZA 2B6AA 2OPRB 2W7OA 1DQ9A 4RW4B 4TYBA 2Z57B 3NAIA 1JLCA 4HKQA 3G87A 1K0TA 4O3NA 5DLFA 1WHYA 3R5GA 3GJSB 2VZ9A 3T3FA 2QC3A 4TLRA 1VQOS 2YNHB 5GAGU 4ECSA 4F4KA 4JI8F 4PWUA 3GU0A 1D9AA 1C0UA 3CNQP 3PO4A 1ZS6A 1KVJA 3KLFA 2C22A 3IXQA 3NCPA 2RS2A 1XR7A 4KHRA 4DL7A 2QYCA 3FVYA 3MGJA 4JI5F 2KU7A 4Q8FA 5HO4A 1SKUB 5EX3A 2ZNZA 2B51A 4ALZA 2BJ9A 2XSFA 4DV7F 5FDLB 2MDAA 4ID5A 4QQBA 3IG1A 2HPUA 4ILRA 1WHWA 2OSQA 4MK9A 2YH1A 1TAQA 3F56A 3PXGa 3LW5C 4C3MA 1VHIA 3OTOJ 4WXOA 1BLUA 1WC1A 2GO8A 4J9UE 3M2RA 5FLXY 4QZVB 1EIYB 1PILA 3DMJA 4HVZA 2J9CA 2VBXA 4P2XA 5D3GB 1EQ0A 2JC1A 2OPSB 2NZCA 3GMGA 1MNEA 1SQGA 3GV8B 2UXBF 1QJHA 5LSRA 1RT2B 3CJ5A 2DT9A 3B4MA 1S76D 1O8BA 4CNYA 1UVMA 2OEJA 5JMNA 4MTPA 1KN6A 1RKIA 5CQGA 1Q5YA 2DISA 1K8AT 3KLIB 2HFOA 4DV5F 3BKUA 3HHLB 1FDDA 1J2VA 4DX8H 1HWJA 1TK5A 1PYSB 1DTTA 2ASJA 1JNZB 5ETQA 2MKCA 1RU1A 3CD5A 4EBEA 5EX0A 2Q6CA 4M94A 1IBCB 3SCLE 3M8SA 2HZCA 3NNHA 3HHEA 4LREA 4LR8A 3UI3A 1YJ7A 2KT3A 2KO1A 1VC6A 3OL9A 2P9CA 5B0BA 2ZBIA 2LDIA 1CS4B 3PDNA 4YUDA 2V8HA 5D6GA 2G13A 4DI6A 1RA6A 2XBPA 3HT3A 1XTZA 2ZOFA 1FA0A 2AQ4A 4K2XA 1NSAA 5C2GA 3V2UC 3MM7B 2Y1IA 3VHQA 3I32A 3MPWA 5HN0A 1NDCA 1HNIB 3BM7A 3C6TB 3JSMA 1LWCA 3M8WA 4ED7A 1Q53A 3LUYA 2KI2A 2ACMA 4I67A 3M4XA 5H9FJ 4CP5A 3SCIE 2D9OA 3FFIA 4AQYF 3RBEA 3K8WA 1TK0A 4DR7F 2EXUA 3IGNA 4LBIA 3ZC4A 2F65A 1GFWB 1NK7A 4ZJOA 3G6ES 3HHDA 4DX7A 2A1BA 2CJXB 2XULA 3PYFA 4X4VA 1Z2LA 2R42A 1ZYQA 3I6PA 2X1FA 4NYZA 1S6UA 4IOCQ 3OVAA 3G8TA 3MWBA 1WOSA 3OJUA 4PUOA 4X65J 1RACB 5DQHA 4DR2F 2BA9A 3FMBA 1XMQF 3LAKA 2CQ2A 4CLTA 3C2PA 1XQIA 1L5UA 4ICLB 3OTCA 1RAHB 2NXEA 4URGA 3ILLA 3HHNB 2VH7A 3R9LA 1Q82T 3CCVS 3OL7A 2DNKA 4DSJA 4H4KC 4OLPA 2YX4A 1HBUB 3CDEA 2DK2A 2QMWA 3FEZA 4RW8A 1I3OB 2BX6A 3IC1A 2I5JA 2C42A 1KVKA 3QO9A 3NS6A 4QPTA 1B0TA 2QA4S 2GVZA 1CQNA 5KFMA 4UOHA 2U1AA 2G0IA 1GMUA 3M8PB 3U1LA 3J80U 4D3GA 5A0YB 3Q0AA 4OI3A 4ES3A 3GG1A 4DR6F 2DHXA 5K8PA 4ZVRB 4Q2LA 1DBDA 4YFUA 5FIIA 2KYXA 4KHPJ 3HJFA 2P5VA 1GMWD 1XN9A 5D78A 4HR2A 3T1YF 3BGFA 2CQ3A 3HULA 3KJQB 3PR5B 2E1CA 3J7A1 1Q81T 1HL6A 1RT4B 1ZETA 2RQCA 4NXMF 3D5MA 3W5YA 3RJMB 2JVOA 1VQPS 4UOCA 4V1Ak 3I5AA 5J1NA 1CEZA 1FKPA 3JQKA 4XO0A 4X62J 4WFZA 2H51B 3TWZA 1M1KT 1LW2A 2QA1A 4OI0A 3IMQJ 4FYXB 4RJVA 3QRRA 4WJBA 4AE5A 2BJ7A 2H65B 1F5AA 2KXNB 2UXDJ 3BV8A 5KFNA 3LANA 4J9NA 3MCSA 4IFYA 3N9UC 1Q8IA 3POTA 3TZWA 2MQOA 1I6JA 4LSLB 1FRHA 3TAQA 7FD1A 3SIPB 3TJ9A 2AZ1A 1PJ7A 3CCJS 1RTDB 4R25A 4RPFA 2E1RA 5E3CA 2B9XA 1OSDA 3EYZA 1F3VA 2NPFA 3GONA 3IS9B 3QT7A 1N88A 2DVIA 3K5PA 1KLNA 3A1YG 2HRUA 4ECTA 5KFOA 2BE2B 1LQ9A 2HEKA 1CULB 2RS8A 3B54A 2GHVC 3KLHB 3SV3A 4C4WA 5KAKA 1FNMA 1HQUA 1NK5A 2Z30B 5GAHI 5L46A 1CBKA 1X4HA 3M30B 2WB1D 2BOAA 3IP0A 2JEFA 4B9UA 1TKZA 2H9ZA 5BYRA 2R2RA 4IOBA 4JB8B 3TX0A 1QTMA 2H3EB 4NLRA 1GTHA 2V67A 4F4ZA 4I6WA 3M2UA 1VJWA 3K57A 2ZM6F 2PA3A 2BR0A 1NB7A 1UMJA 2YNFB 1SPBP 3GB0A 2GAHC 2DIVA 3QRQA 3C15A 1Q1KA 1LWFB 3UE2A 2MXYA 1EAYC 1AT1B 2HGMA 2AX0A 2M2BA 1VS3A 3HKWA 1FESA 4EGLA 3E3XA 1NO8A 3NOGA 2JVRA 5CD4A 1AZSB 3K0JA 2P9GA 3J81j 3C16B 1BE4A 3JSRA 2DHGA 2P8IA 2VQEF 2PEBA 4A8QA 4B3RJ 1AW0A 2WSEC 4ZCIA 2CZVC 2GMJA 2DR9A 4QIGA 1KKHA 1YDLA 2GO9A 2WVBA 4R5PA 2BKOA 3KTQA 1WOOA 1C1CB 1UVJA 3UVJB 2IM0A 1RGVA 4L72B 2IA6A 3VQTA 4Y0FA 3EWGA 2HS4A 5GMDA 3GILA 3FCVA 4DN9A 1FD2A 1X60A 1S6PB 2HGNA 4LF2A 2OI2A 3CJQA 3D4JA 3QT6A 3HLUA 2HMIA 4PXCA 3AD7C 1T9UA 2AYEA 2PDAA 4LIWA 3SQOP 1U1PA 3CD7A 3MCMA 4ED1A 4TYAA 3AT1B 2DHHA 1UZDA 2BRKA 2X3GA 4DR4J 4RNFA 1QUPA 1QE1A 3IWNC 4DSFA 3M8RA 2YKOA 4CO5A 3BSCA 1HW8A 1EKRA 1KTQA 2R2TA 4CZCA 1XC9A 4Q0BB 2OAUA 1FJ7A 3OD2A 2OH2A 3BN4A 5C7PA 1RAOA 3FK4A 4YR3A 2Y0BB 1XK8A 4DV2J 2OPQA 2VJVA 2C3YA 2NXUA 2UUCJ 3DGVA 1JKHA 2VL1A 1VK8A 5JJBA 3FSYA 2KXFA 2Y8WA 4CLPA 1JLAB 2DR6A 4OX9J 2OFGX 3OR1B 3CMAS 5J1PA 2NXJA 3KG1A 4M5IA 3D66A 4FYDA 3T1HJ 4IG0B 4UQGA 3M8YA 2CJKA 5I42A 2RQKA 2CVEA 1VJQA 4FBUA 1T03A 5G0RA 3W1YC 1UJ4A 3H2UB 3PR4A 1N6QA 3RRKA 2W1BA 1IKXA 3G2XA 1UW9A 4YR2A 1IM6A 5DJBA 3CCLS 5DDOC 2QGFB 2VOOA 2DXFA 3LPEA 3NGKA 3KMSA 1KQGB 2DNZA 4C3LA 4RBTA 1KSPA 4ELUA 3FKBA 1S7IA 2ILZA 1KC8T 5HLFB 4KO0A 2RIJA 2DNOA 1RISA 4CLYA 1PAUB 2J0WA 5DQIA 1U24A 3MDFA 4QWBA 2XZDB 2FIUA 1QUVA 1U6FA 4M5MA 1N5VA 3DXSX 4RW6A 1KLMB 2VG6A 2HNDB 2RE1A 4CO0A 2HNZA 1FK9A 1BQNB 5CYJA 3J7YI 2RHQB 1KR4A 3J81Y 2OEKA 1SH2A 4FPRA 3GJRB 3S01A 5BR8F 1SL0A 3CJ0A 2X1AA 2EPIA 4QYZK 1YBTA 4GO7X 5A2QU 3W64A 4J7CA 4LIRA 3D1OA 2J7WA 4C0OC 3D54A 4LFBF 4IG3B 1S0NA 3T19A 2XLIA 2OTJS 4P2FA 2DGXA 2DNGA 4JI0F 5C25B 4OYXA 2V34A 2QSWA 3JTOA 3RYLA 1ZM2A 4N41A 4USWA 3NGTA 5E3QA 4Y2KA 1GX6A 4OV6A 4DV4F 1PYOB 2PC6A 2CJQA 2GCFA 3IWXA 2M88A 3BN7A 2VBZA 4RU9A 2HHXA 1N32F 2VV5A 5A8WA 1NRKA 4A48A 1GX5A 4NLYA 1AXQA 3D0GE 1WC3A 4OHYA 1RAEB 2RB7A 1U45A 3D2WA 1LKZA 3RR8A 2QLWA 3G86A 1FRXA 2O66A 1Q7YT 3MR7A 5C42B 5LXRA 3PTWA 2HGLA 1UKUA 2OKQA 2DB1A 2B9EA 2LXIA 1NKBA 4F26A 3QFHA 2XQCA 3PW2A 4OYZA 3QRPA 4ZHRA 2WONB 2HVIA 2F4FA 3M6WA 3BO4A 2L9DA 1YRTA 3ADAC 2XS2A 1VRTA 1ZH5A 1VLOA 4ZPVR 3TJAA 4NLWA 2AP6A 3JQMA 5HI7A 3HVWA 4ES1A 3GV7B 4NCAA 3G82A 3D6TB 1PYTA 3EVMA 2V63A 3NS5A 4ZN3A 1ZA2B 3CJ3A 4ZK7M 3A12A 1MU2B 1HR0J 4M5GA 4WIIA 2ZEJA 5L1JA 1HQEA 3G6VA 1UFLA 2MQMA 1X4EA 3LA0A 1H73A 1NK4A 4OLOA 1VK3A 4DL2A 1HFEL 3PVXA 4OIXA 4OI1A 1UVNA 5IT0A 3MM6A 4ETZA 3D1HA 1K1QA 4K50A 2OGUA 1UFWA 5ETSA 1JJ4A 1YZ7A 2IVYA 2EWHA 1CC8A 4HACB 1HPZB 1DAXA 2EEYA 4C8MA 1V6HA 2ZBQA 1S49A 5GMKa 1Y3JA 2WSCC 4Q44A 1IKVB 2CADA 2K3IA 1W25A 3AXMA 1FJGF 3TW0A 4JV2A 3DGPB 2G2ZA 2HG4A 3BF4A 1MMDA 1LXNA 3LWLA 3KHRA 4ED8A 2ZWOA 4KKOB 1T3OA 5A8RB 3HO1A 1F9FA 1LW0B 3V6HA 2DEJA 2DY9A 3EVOA 4LF5J 1W26A 1CJTB 4WFNQ 2DRBA 1J5EJ 1BQXA 3PW5A 1QLNA 1WSRA 1KONA 3DRPA 3I9ZA 1R43A 4TLQA 1M5HA 3DOLA 2CQBA 3RAMA 3MI7X 2YVSA 3JTPA 1DY3A 1H7XA 4DSKA 4P72A 4J9VA 3J7Z5 3R5CA 3UQSA 1CJVA 1FDBA 1U6BA 4CIOA 4X4UA 2FPHX 3D0IE 1IR1A 1BD6A 1VRUA 1JJHA 5HMXA 1HBMA 4MT1A 4KPCA 4NLPA 2W4CA 2CWKA 2B8PA 5J2QB 1UPMB 3ZZ0A 4HDHA 2M8HA 4EZ6A 2YPYA 3ITHB 1S9GB 4URQU 2MB0B 1U2FA 1VQ4S 3UW1A 3FZBA 1HMVB 3I5BA 1TKTB 2EKYA 4DEZA 2VBWA 5DZ6A 4DS4A 4U9RA 1WC5A 3OJSA 2XY6A 2EBEA 1YG0A 2B6AB 4FXWA 3ZZYA 1JLCB 5HROA 3CJ2A 1BY9A 3O44A 2DHSA 2AX1A 2HK2A 4DL4A 3CCMS 4I2QB 5LMUJ 3H8YA 3GIKA 4J9QA 2V4JA 1N34J 4LQ3A 1I5OB 3CJKB 3TUZC 3K5NA 1B0PA 1Z1ZA 2DGUA 3V4IA 2OPPA 2FHMA 3KLFB 2I6WA 2OELA 4IDKB 1FX2A 4BC7A 1S9FA 1REVB 1N0VC 4WYWA 3RW7A 3GYGA 2ASDA 2A6MA 1RTJB 1GH8A 4G1IA 3ILIA 4ZVEA 1RK8A 5IWAJ 1F60B 2ZH5A 2DCLA 2W25A 2J0QD 2HNYB 3D0HE 3L4BC 3AQPA 2R2SA 1K9MT 2HLUA 3TZYA 4WIQA 1F3FA 5HQ8A 1HBOA 1H7WA 1FRJA 1VGYA 2W9BA 2JDJA 3KHGA 3P8BB 2YKMA 3TO8A 2N7YA 1S72S 3IBCB 4ITSA 4LSZB 3WZ0A 2J8AA 2D74B 4ZIVA 3VVTA 3QWPA 3M2RB 5IC4B 5H9EJ 3PRDA 4FP9A 2BKPA 2E5HA 4NWBA 1KVIA 2GFFA 5LM7E 4ECXA 1O6XA 4HYKA 3OFHA 3TX8A 4P75A 1DJ0A 1W7WA 2VD3A 2JWNA 1IWGA 5KFQA 2UUAJ 5KT5A 1D3WA 1RWXB 1X9WA 1F2GA 1ZAXA 1SCJB 1GXTA 1RP5A 1C4AA 2LEPA 1LFPA 3AB2B 3AD8C 3E51A 1C0TA 1VOMA 2GJIA 1CQMA 4U7CA 4F7VA 3T5HA 4JV5J 4IRKA 4ZLJA 2C3OA 2AJ2A 1V5IB 1ITPA 2A3JA 3OLBA 1NH8A 2AV5A 1RAGB 5D4NA 1LWXA 5B0AA 2HAFA 2A2DA 1PC5A 1S12A 4K0KF 2XMUA 1R0CB 1RLCL 1U25A 4OZ3A 4DV1J 3OPKA 2BQRA 2YWGA 4ATNA 2E66A 5IQQA 1RWOB 3LP2B 4PYAA 4Y28C 3FCWA 4I6AA 3ISND 3FFIB 2BABA 2D41A 4I68A 2DNYA 4ECUA 1C4CA 1Y9OA 3GR1A 2VUGA 4X4SA 4JYAJ 5DGBA 4KB7A 1FEEA 2IM2A 3O3LA 2J0XA 4PRFA 1VQ6S 3X1LB 2V4RA 2BV3A 1X4CA 4LRAA 4DUTA 2YNHA 1DURA 5KFKA 3CCQS 3DU6A 4NA1A 4CWBA 3MMAA 3Q24A 3QIDA 2GS8A 1VQ8S 3A8JA 2RT3A 4R0EA 4PUOB 4FVCA 2MGZA 4PPDA 1FXRA 1PG5B 2CG4A 2JOQA 3M32A 1FFGB 4J9LA 5FD1A 4ZVSB 4RO0A 1X4GA 4K4ZA 3MXHP 3M6XA 2MLXA 4JUZA 4C8KA 4UUXA 5FDLA 3AY0A 2B4PA 4DLEA 1T05B 5DS7A 3MPYA 2M70A 2LA6A 5J2NB 3AXKA 4DHVA 1U1RA 2AGOA 2ZNYA 1SB6A 3KJNB 1Y0HA 4MIWA 4K5RA 1U1LA 3BKFA 3Q2SC 2I5JB 4I69A 3A13A 5D0GA 5AE1A 1N8RT 2F9JA 1YVFA 4USVA 1WHXA 4KJIA 2W2PP 4ERDA 1RTHA 3NRBA 3FBCA 2HHUA 2HVEA 1SIWB 3UCUP 4WZMA 3VV2B 4WP9A 1NDLA 3THPA 5D3GA 3NMAA 4TY8B 2OPSA 4ID8A 4CLUA 2FVCA 4QR1A 2GVDB 3DRYA 4N47A 4RBVA 3BGLA 3R6LB 2Z2LA 5KG5A 2GC8A 2B7CB 4C7QA 1RBOB 4F36A 4R8UA 3AOAA 2M52A 3KLIA 2G2YA 3AJDA 5CD4H 4IH5A 1G1XA 3HHLA 4QR2A 4W90B 1G3OA 1ZPVA 4O3OA 3CCZA 4OZ0A 1BGXT 1LW2B 3AQOA 3ZTPA 4LF6F 3DOMB 2NUUG 2I0XA 2IY5B 1UJ5A 2RRNA 2W9AA 3GJQB 3W66A 3QLHB 5ETVA 2ASLA 5EUHA 1CS4A 2A2CA 3VALA 4IR1A 2AWZA 3GLJA 4OI6A 3POTB 3BPDA 3MM7A 1IKYB 4K5SA 5IQ6A 4M5KA 4CH7A 4X4PA 3VGVA 1KQSR 4MYTA 4P52A 4WWSA 1FTRA 2NUHA 1QD1A 1RT7A 3EDQB 1HI1A 3C6TA 1WELA 4F2RA 3P6YC 2GIRA 4U95A 1B0VA 2RD5C 4ZVPB 4ECRA 3HD1A 2DBBA 4J90A 3RGIA 3OT9A 1OYEA 1NK0A 2CUYA 1U02A 2NPIA 3O8WA 3FRZA 5CH7B 5F9LA 2B8QA 4JI8J 1TL7A 2DEIA 4B3OA 2RHSB 1X4AA 2HVDA 2MKJA 1RE1B 5F0UA 2J5AA 3OTBA 3TOQA 4N8OA 3HKZD 2NREA 3GSIA 3T5JA 1IJEB 2CQPA 1PCAA 2IMWP 4JI5J 4MMOA 3A8EA 1HQUB 2GNKA 1KNZA 4MK8A 1GQEA 4PYDA 4DV7J 1KWMA 4DQQA 5DZ7A 3NAHA 4M8LA 3KYLA 3I9V9 1LEOA 1CPZA 3MEEA 2JEGA 3I82A 1N33F 3DLBA 4KQZA 4AL5A 3TA1A 1YRUA 3FNNA 4WKYA 1FWKA 2DHAA 4Y2AA 3KWMA 2J76E 1HBUA 3K5MA 5ETPA 5GAHU 3KJVA 4G1QA 1AFIA 2DRDA 2FJWA 3M8PA 1NSQA 5F0WA 4I6YA 1JJ2R 5A0YA 2H54B 4PZVA 2CRLA 3EZOA 1K47A 4I7FB 3SSRA 3RB3A 4UT4A 2UXBJ 1RHMB 2UV8G 1Q8BA 2OD6A 4Z7YA 1MW7A 4RW7B 4UY85 3CULA 4H4MB 5AXLA 2XI3A 1SQFA 4PXEA 4YQWA 4ANDA 1SH0A 4PG7A 1HYSB 3BGUA 1WG4A 2MQQA 1RT4A 1V3RA 4DL0C 4R5PB 2WRMA 3BGOP 1VC0A 4QW8A 5BXIA 4E8UA 3K58A 4CTAB 3AJ1A 3TA2A 4KT0C 3NGRA 4ZPDA 5FLXU 2ZDOA 4Y6IA 1HI0P 4X64F 3O6QA 3VAGA 2HMIB 3D7SB 3QJLA 4OL8A 3DRRB 3AAWB 5HQMA 4P73A 2R3VA 1ULRA 2XYGB 1T9YA 1NDKA 2FVSA 2VC1A 3L09A 1UEUA 4LSLA 1EETB 3W8PA 4AQYJ 4PG8A 4F8RA 3D68A 4DR7J 2EFGA 2D3ZA 2BW2A 2MY7A 3H0PA 1RTDA 1QDUB 4IOAQ 2NQPA 2HBYB 2GZOA 4QIEA 1FVQA 3V6KA 3HSZA 4MK7A 3OVBA 1G4CA 2CNLB 3CGIA 5DGAA 3K7RA 2Z4PA 5U47A 2BE2A 2KB2A 2VHGA 2ZH2A 1CULA 4B3TF 3QJJA 1BMQB 3N5BA 5CCMA 4DR2J 2CQ1A 3H25A 4DCPB 3TJ8A 4ZP8A 3Q23A 1XMQJ 3R5AA 4NRTA 3PX4A 5HANA 4ZP7A 2W2QP 3PZPA 3CF5Q 4F2SA 4LBHA 3M30A 3H5SA 2X3DA 5ETMA 2QJ3A 3IWLA 3WIVA 2EFOA 1FNOA 2R7QA 4ZCKA 4RWWA 2QE5A 1SC3B 3M05A 1WTFA 3UDCA 1ZZNA 2YQ1A 4OZ5A 4RZRA 2V8VA 3ZZPA 3DHXA 2ZJPQ 5DLGA 1Q4RA 2FGCA 3CD6S 1IKXB 3SI8A 4CT8A 2XO6A 4DR6J 1WC4A 2GIFA 4CO2A 2HFNA 1RAIB 4WBFA 2RU3A 4OX8A 4ENOA 4QWDA 2IM3A 2RVJA 3Q2TC 2B3TB 3T1YJ 4LF4F 4DDFA 2ALZA 2FUG9 4Y34A 1AZSA 2CQ4A 2YQ0A 3C16A 2M8DB 4F50A 1YJWS 2HWIA 4NXMJ 4ANEA 2EK6A 4USUA 1HARA 4JP8A 2FHOB 1FVSA 2GIQA 3E01A 2ZH4A 3CCTA 3MEKA 4QWAA 4KPYA 4PXDA 3QGHA 1C1CA 4RW6B 2VG6B 3UVJA 2W4DA 4F4XA 4YY3F 2HNZB 4OMFG 4NEZA 1X9SA 1FK9B 2WK4A 2WCXA 1FFWB 4ZOSA 1S6PA 4P6QA 1NPRA 2JLGA 3KUHA 3C3LA 2R9LA 4F67A 1IKWB 2BJ3A 4DPOA 2ILYA 4JOUA 2IJRA 3DXBA 3VCDA 3MTKA 3N79A 2JEIA 1RWVB 2YKPA 2PD1A 2VQFF 4HT7A 3JTNA 4ER8A 1REGX 1HLWA 1M5VC 2QLXA 2VG5A 3BO3A 4Y00A 3HZGA 3J7YU 2D3OR 2R7OA 2JLEA 1JLEA 4X4RA 3KLGB 4LFCF 4ILMA 2PN6A 3R7SB 2DH7A 4Q0BA 3FQKA 4CRJA 2F1FA 3DRXA 1WWHA 2QX0A 1HD0A 3TYTA 2BJDA 1GXUA 4LT6A 2AIRB 4HT5A 2GA7A 1ZPWX 2W8KA 3N4WA 5BYQA 1U8WA 1AUSL 2A6OA 3LWMA 3CCRS 3DN9A 1JLAA 3ZZRA 4IKAA 1VQ7S 4ZHRB 1KFDA 2I8EA 3T41A 3LP0B 3GE9A 2KHCA 4JI4F 3G6YA 4MIBA 1VRTB 3EZ5A 1WNEA 2ZM6J 4WTYA 1P8GA 1ZAVA 2HHWA 4YMEA 3QGIA 1F6TA 3G82B 1OY6A 3SDEB 2DNMA 2YY3A 5CXTA 4G65A 4LBPA 1NK6A 4ZCLA 2A18A 4F4YA 2VICA 3OSNA 2N4CA 3QQCD 1HNXF 4N77A 3T5KA 1RWWB 2B7BB 2RQMA 3HK2A 3T1AA 1SBRA 5HL7Q 5JVHQ 3RAQA 2FZGB 4J9SA 1DFDA 3ENAA 3DLKB 2VQEJ 1VDHA 3MEDB 1YX2A 1JXEA 3H90A 3CC7S 1MMNA 2LXFA 2IRXA 2CJYB 3EXCX 1RCXB 2V50A 2CPDA 4EBCA 4FXVA 4KGMA 4RKUC 1FRLA 1FJCA 4LRBA 4K59A 4OZ1A 4OX7A 3IR5B 2HNDA 4N7TA 3QT8A 1YKWA 1IQTA 4IQMA 2GQQA 4QJVA 1NMEB 4WFBQ 2GHPA 2GQ2A 4B08A 3I31A 1S1TB 1RT1B 3TVYA 1G2EA 1TUGB 1NBEB 4LR7A 3DOLB 2MHNA 2WW4A 2EFPA 2IRYA 2UVRA 1Y10A 3B78A 3C6UB 5C25A 1QSLA 4A8FA 1FHTA 1RWUA 3NXZA 2B9WA 1UP1A 2IRUA 1F5CA 4JI2F 1KRPA 3EDRB 5A6PA 3AD9C 1NSKL 3QATA 4AXIA 1ACMB 2MTLA 3MTJA 2HAIA 2RQ4A 3WQPA 4USMA 3KK3B 2ZHBA 3RAXA 2OHDA 1PGZA 1UVLA 3B82A 3SSQA 5C42A 3GIMA 2YKNB 2YNIA 1FXDA 2AYGA 2CA9A 4RU2A 2ZZTA 2MLYA 1LXJA 3M9OB 4QR0A 3JAMY 5DDPC 4Q8EA 2W01A 1B70B 3OL6A 2X7IA 1NPPA 4QIVA 2KRRA 1U6ZA 4LMZA 3VAFA 1HIYA 4C8OA 1XBWA 4C11B 2ZZMA 1VHFA 1UAWA 4FYYB 2G0JA 2DGWA 1MU2A 1TL5A 4NYOA 2E9TA 3THTA 4PEOA 4WKRA 4NZ0A 4M95A 2GHWA 1SQEA 1WKLA 2C2OB 1RQ0A 3QZ8A 4QIFA 2CG8A 1OPZA 2YWKA 4G6VB 2CYYA 3LAMA 2BW7A 1GMVA 2R7WA 2E5LF 1VBZA 2AD9A 3OR2A 5HBMB 1WSVA 3HVTB 1HPZA 2EKNA 1XEZA 4MKVA 2RF2B 1HBOB 1VBKA 1IKVA 1BUXA 1NKEA 4CM0A 1WD6A 3HVRA 2XNQA 1AUDA 5J2PB 2UZAA 4RNOA 5EGYA 1FDNA 1R8HA 4OJHA 1P9QC 3K59A 1ROFA 3AJ2A 5A8RA 4JV1A 2FZCB 5BR8J 2CAJA 3BDEA 1ZZFA 4DMZA 3KLVA 4DQPA 3KHLA 2OMLA 2M9KA 2JC0A 3QSYB 5C24B 2HVHA 2LQJA 2POKA 4A4JA 1AFJA 5ADZA 4M5NA 5KFFA 4LFBJ 3AA9A 4JI0J 2CQCA 3M6UA 3F41A 1CLFA 1A6LA 3FDSA 4PWDB 3FGVA 1WEYA 1NAQA 2X51A 3IBFB 4DV4J 4A8OA 1RT6A 1NJYA 4MH8A 2J9DE 3CJTA 3W2VB 3UN3A 2JL9A 4OZLA 4X2BA 4OYWA 1N32J 2RDDA 3P49B 2KT5A 1XNQF 3M2VB 2HWHA 2L3MA 5K8NA 2L41A 3I4PA 5KT6A 3FMWA 5D77A 5J2QA 3J81U 1Q95G 2XMWA 2UUBF 4NLQA 2DY1A 1N5YA 2CDRB 3HSJA 3ITHA 1S9GA 2V8GA 4ECWA 5D8HB 3PFOA 2DR5A 3T9NA 2EFVA 1IR2A 2BQ3A 1K44A 4AYBD 4PG6A 1UW4A 4EYIB 4EU0A 4USHA 2ADCA 3GYNA 3TQ1A 4YB1P 5EWGA 2ZITA 3CO9A 4Y2MA 2ZBRA 3ZXWA 2EI5A 3OVSA 2FJDB 2K3KA 5AE3A 2KM8C 3ET6B 2VBYA 3MFIA 2W7AA 2RDJA 2COLA 4I2QA 3OUYA 4AFFA 1NHUA 2VPZB 4OYIA 3K5LA 3VVUA 3MMAB 3BYRA 3CJKA 4XAKA 3CC4S 2YXLA 5DM7Q 3GCXP 4B3SF 3CCES 2FLNA 1N52B 2MGZB 4IDKA 4LRCA 1REVA 2I38A 2XMJA 4KV8A 3M32B 3PKMA 1RTJA 5L1IA 4Q43A 2LXUA 2DD8S 1U7LA 2EG2A 1B3TA 4B3MF 8ATCB 2OUGA 4KR0B 5AXNA 1SIZA 4WTOB 2C2NA 4PG5A 3M6VA 2HNYA 1X7VA 4M63A 1XR5A 2XMTA 3QAEA 1FJGJ 2H48B 3TEHB 4FPIA 1B64A 1DTQB 3ILJA 2E9ZA 2YKAA 2BMBA 3VQSA 2E7XA 2Z2MA 3JYTB 3W7BA 2DPIA 4FN5A 3I56S 1APSA 2QTWA 3F44A 2FB0A 4FXDA 3GV5B 1TR0A 3OXFA 5DM6Q 2ABYA 4HI2A 4DV2F 1RAAB 4GC6A 1RTHB 2Z8QA 4DU7A 1HW9A 2DTJA 2VOPA 1R0AB 2BYCA 2XS5A 3UFCX 1RDRA 3UN2A 3L9ZA 5IXUA 3Q89A 1UVKA 4IUFA 4ZJQA 3T9ZA 1H0HB 4KC5A 2Q43A 2L9WA 5EWEA 3OW2R 2GV1A 4R8UB 4RWXA 4QYZJ 1HQ2A 3MCNA 2JLFA 6AT1B 3C8YA 4J9PA 4WE1B 4DF4A 4DQRA 1SKRA 2J0SD 4CLLA 2QMUB 4NLVA 4KE5A 2D9PA 3NGUA 4F02A 1NZ8A 3IR7B 3SQGB 1N0UA 3EVWA 2FVQA 4YB6A 5A2QY 2DITA 3BO2A 5CYMB 5HAOA 2CNKB 1VC5A 2XEXA 2UUWA 2A0FB 1VIXA 3PV8A 1S7HA 1RT7B 3NCRA 1RABB 4MFBA 1M5PC 2CPFA 3LALA 1ZOTA 3LP2A 1U48A 1NDPA 1F9EB 4KH1B 4DLGA 3GIJA 2XLKA 3V81A 4KTQA 2C2ZB 2XSJB 3S1TA 2JHEA 1NZAA 1TL7B 3D6FB 3EGZA 4B3OB 4DS5A 1FCAA 4Q7AA 3BYPA 2HZAA 3M8ZA 1VQ9S 3W9JA 2HHHF 2MKKA 3DLEB 1T9TA 5KG6A 2V6AA 1Y7PA 1TMMA 2BEFA 4DBQA 2R8HA 3PY8A 1Q8LA 3AA8A 2XCAA 3QWUA 2MKSA 1K73T 3DYAB 2LQ5A 1KHWA 1YK9A 4DWIA 4O44B 3QGPA 3MEEB 2E7WA 3Q8UA 1HNZF 2MQPA 2JZ5A 2UV8A 4ZPCA 4WFYA 1T05A 3TZZA 1EP4B 5J2NA 3H2LA 3MCOA 2DXEA 1RUSA 1XERA 1IVZA 4C48A 5IOLA 1BQMB 3ELHA 1BWVA 4RNHA 2ZVSA 3KJVB 4G1QB 3R5JB 5D4OA 1PAEX 2PEHA 3KHHA 2QL5B 4ED3A 1HHSA 3QGGA 3OXLA 1Y5NB 1TL1B 4LF1A 3AB4B 4YHHF 5CHCB 4TY8A 4NLOA 4EO8A 4H4OB 3W5ZA 1XIQA 4ZN1A 2GVDA 2ZH7A 2AF6A 2IYGA 4OHWA 1JLBB 3H5XA 4O3QA 1S1WA 2BQUA 1JLGA 4CI0B 2KFNA 1NSPA 5CABA 3JQJA 3WC0A 3RTVA 1PJ6A 1LFWA
chains in the Genus database with same CATH topology
4M5KA 3MCMA 3QBCA 5ETVA 4M5JA 1EQ0A 3IP0A 3HSGA 5ETQA 3HT0A 4M5NA 3UDEA 1HKAA 4CYUA 1KBRA 4CRJA 1EQMA 4M5GA 5ETLA 4AD6A 1RU2A 1RU1A 5ETMA 3KUGA 4PZVA 1TMJA 2CG8A 3UD5A 1IM6A 5ETSA 2QX0A 3ILIA 3HCXA 3UDVA 5ETOA 1EX8A 4CWBA 5ETTA 3KUHA 5ETKA 1HQ2A 3HSZA 3MCNA 5ETPA 3HSJA 3ILLA 4M5MA 1F9HA 4M5LA 5ETNA 5ETRA 1DY3A 1RB0A 1G4CA 3ILJA 2BMBA 3HD1A 2F63A 1RTZA 2F65A 1TMMA 4F7VA 3ILOA 1Q0NA 3HSDA 4M5IA 3MCOA 1RAOA 1CBKA 3KUEA 4CYUB 4M5HA 3HD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M5K A;  3MCM A;  3QBC A;  5ETV A;  4M5J A;  1EQ0 A;  3IP0 A;  3HSG A;  5ETQ A;  3HT0 A;  4M5N A;  3UDE A;  1HKA A;  4CYU A;  1KBR A;  4CRJ A;  1EQM A;  4M5G A;  5ETL A;  4AD6 A;  1RU2 A;  1RU1 A;  5ETM A;  3KUG A;  4PZV A;  1TMJ A;  2CG8 A;  3UD5 A;  1IM6 A;  5ETS A;  2QX0 A;  3ILI A;  3HCX A;  3UDV A;  5ETO A;  1EX8 A;  4CWB A;  5ETT A;  3KUH A;  5ETK A;  1HQ2 A;  3HSZ A;  3MCN A;  5ETP A;  3HSJ A;  3ILL A;  4M5M A;  1F9H A;  4M5L A;  5ETN A;  5ETR A;  1DY3 A;  1RB0 A;  1G4C A;  3ILJ A;  2BMB A;  3HD1 A;  2F63 A;  1RTZ A;  2F65 A;  1TMM A;  4F7V A;  3ILO A;  1Q0N A;  3HSD A;  4M5I A;  3MCO A;  1RAO A;  1CBK A;  3KUE A;  4CYU B;  4M5H A;  3HD2 A; 
#chains in the Genus database with same CATH topology
 2Z56 B;  4N76 A;  3PEH A;  2P9E A;  4LFA F;  4DV0 F;  3ULH A;  2NLW A;  4NAS A;  1YJN S;  1IBL F;  4K4Y A;  1RYS A;  4K0K J;  3DOM A;  3BS9 A;  3WX4 A;  2QV6 A;  2B43 A;  2HSE B;  2QFI A;  2LQB A;  3R5B A;  4JI7 J;  3QLH A;  1BHN A;  2W24 A;  2M3D A;  3HFZ B;  4B17 A;  1IKY A;  3SV4 A;  1D9D A;  1H38 A;  4NLS A;  1WDD A;  4ZKA A;  1YBU A;  2RAQ A;  4DL6 A;  1S59 A;  4J9K A;  3LO3 A;  2L48 A;  3Q22 A;  4ANC A;  2HS3 A;  3TR5 A;  9ATC B;  1U09 A;  1MRO A;  1RTI B;  1S6O A;  2OMO A;  4K4U A;  2WVF A;  3F73 A;  2AJF E;  2C2K B;  4J5O A;  3W9H A;  1NJX A;  1SJ3 P;  1S9E A;  5D0E A;  2HFZ A;  3L7P A;  3BBF A;  3Q8P B;  1U49 A;  2CIM A;  3ZZU A;  2EFN A;  3GR0 A;  1J5E F;  3TZX A;  4P7T A;  2LDY A;  2ZKU A;  3MEC A;  3TP2 A;  1SJ4 P;  4EWT A;  4Q45 A;  2Q1L A;  3DM2 B;  1GXL A;  4P74 A;  3HHK A;  5HMZ A;  4CLF A;  4F0H A;  5B09 A;  2IIH A;  3K5O A;  4YB5 A;  3SBM A;  4OFZ A;  1P1L A;  3B6B A;  1Y5L B;  3FEY B;  4FDF A;  5SUH A;  4DV6 F;  3MAA B;  4PPZ A;  1N5T A;  3R2D J;  2CZ4 A;  5EWF A;  3BSA A;  3G9C A;  1TMJ A;  4KHM A;  1IBK F;  1B7Y B;  4EZ9 A;  3GG0 A;  1HI8 A;  4NRU A;  2G2O A;  4K4T A;  5ETR A;  4LSN B;  2GX8 A;  3VZI A;  2YWH A;  1R0B G;  2AGP A;  2I1R A;  4DF8 A;  4TN2 A;  3IFE A;  1MN7 A;  2IJN A;  5HP1 B;  1L3T A;  4L76 A;  1WC6 A;  2AT1 B;  2MYF A;  3PW7 A;  4RLE A;  1LOU A;  3ICL A;  3G6X A;  1M0S A;  4J9O A;  1SC6 A;  3RU0 A;  4I7F A;  4GVB A;  2Y1L B;  5BJR A;  1O0P A;  3CSK A;  4BCA A;  1P6T A;  4RW7 A;  4H4M A;  4L75 A;  3Q8S B;  2AHO B;  2UUT A;  3RW6 A;  2UP1 A;  3MUT P;  2DH9 A;  2LCW A;  2CPI A;  5FJ4 A;  5G4D A;  3MMB B;  1GAO A;  4ZVO B;  1UA1 A;  1HYS A;  3E01 B;  4X4T A;  3U1M A;  1JLF A;  3BZQ A;  3PRV A;  2BVZ A;  2ROE A;  2HQC A;  2HFU A;  4F3M A;  4IO9 Q;  6FD1 A;  2MZJ A;  1OS5 A;  2CPJ A;  4CTA A;  4LF6 J;  2EC0 A;  5LSL A;  2ZVI A;  4I1T A;  5J1E B;  4ZPB A;  5EHH A;  3HM9 A;  4D3H A;  2MKH A;  5C2C A;  5AT1 B;  3VGU A;  5LJ3 Y;  3A3N B;  2XYP B;  1M1G A;  2CVI A;  3G8S A;  1VQN S;  2XCP A;  3LGM A;  3DRR A;  3MAH A;  3IM9 A;  4AL7 A;  4U8Y A;  2VFS A;  4USJ C;  2CPE A;  4EUV A;  2XY7 A;  4JI6 F;  3CWJ A;  2VG5 B;  4MAK A;  1EET A;  4UST A;  2AYM A;  2RSQ A;  1S99 A;  2V8D A;  5KFP A;  2C2M B;  1SH3 A;  4Y3C A;  4ZPA A;  1VQ5 S;  1YQH A;  4KGK A;  1RSC A;  4G3I A;  1JLE B;  1IJF B;  1S1X A;  3FRY A;  1XNR F;  2ZH3 A;  2I9S A;  4QOT A;  4QW9 A;  2WZ1 A;  3UO0 A;  3D1Q A;  4TU7 A;  2E1M C;  1WI8 A;  1RT3 B;  1D1U A;  3E2E A;  1N5S A;  5I3Q A;  1S57 A;  3NMR A;  1FRK A;  4RUH A;  4EBD A;  1S97 A;  2MKI A;  1EQM A;  3LF0 A;  4WP3 A;  4PR6 A;  1OY9 A;  1R3N A;  2OTL S;  2O1P A;  4ZA1 A;  4OZJ A;  4O3R A;  3GPA A;  1NJZ A;  1T94 A;  2HQD A;  3K89 A;  3CJR A;  5GAD I;  3CT9 A;  3KG4 A;  3HHL C;  1AYE A;  4XDC A;  4HHJ A;  5KT4 A;  1FX4 A;  1R27 B;  1N33 J;  2Q3P A;  5LXY A;  4JI3 F;  4IQX A;  5KFR A;  3UCG A;  2HQ3 A;  2ZKT A;  4HTJ A;  5M2U A;  1HHQ A;  3HFV A;  1D09 B;  3VWS A;  3VAH A;  1V5V A;  4PCQ A;  3QT5 A;  4IYQ A;  4IH6 A;  4O4G A;  1U4B A;  4DSE A;  2WOM B;  2QFJ A;  4FS2 A;  2ROP A;  1TQL A;  2E5I A;  4XK8 C;  2FYX A;  1P1T A;  1RA7 A;  1TV6 A;  4TKT A;  2KKH A;  5KFI A;  1TU0 B;  1FF2 A;  4Z37 A;  4I56 A;  1DQA A;  2R7V A;  5DRK A;  1LWE B;  4K4W A;  4P7V A;  4TU9 A;  1FE4 A;  2BDP A;  1SKW A;  3RBZ A;  5JUM A;  5A6W A;  2HKE A;  4ZLL A;  4KIA A;  4OHZ A;  2OD4 A;  1RWK B;  2OIH A;  3F0N A;  4K4S A;  4O0I A;  2V9W A;  3CE8 A;  5A8K B;  3M9N B;  1H2V Z;  2EBG A;  2BJ8 A;  1KDN A;  1XR6 A;  3TAR A;  4X64 J;  2YWW A;  3NL0 A;  2B4O A;  4KSE B;  3N6N A;  3KDN A;  1E6Y A;  1IQZ A;  4IRD A;  4DR1 F;  1JIH A;  2KXH A;  4Y65 A;  1KP6 A;  3IM8 A;  3LOU A;  1U47 A;  2F5G A;  2WVD A;  4NLT A;  1IKW A;  1NLK L;  2W4P A;  5T7L B;  4NZ6 A;  2MZT A;  4OI4 A;  4LF8 F;  2HZV A;  2AJ4 A;  4TY9 A;  2VF3 A;  1FKO A;  4B9L A;  1FEH A;  3VAI A;  1SC1 B;  3UD3 P;  3RZA A;  2OSR A;  3CCU S;  2FDN A;  2UU9 F;  2FY1 A;  4C6A A;  1KOH A;  1L3V A;  2NYI A;  3KLG A;  5LL6 d;  1TZ0 A;  5ITH A;  3BJY A;  2RUG A;  3PAC A;  2G9O A;  1VIS A;  2G4B A;  2QEX S;  1FWP A;  1S0V A;  3NLC A;  3MAQ A;  4B3T J;  1RKJ A;  4ED2 A;  4FYW B;  5D0R A;  2MZR A;  2O01 C;  1AB8 A;  2YNI B;  1EKS A;  2KYZ A;  3C46 A;  1F5B A;  2CJ9 A;  1OYD A;  2IDE A;  1IWA A;  2YBV A;  4DV3 F;  1UVI A;  3HZE A;  3TUJ C;  3AOD A;  4ZPW R;  3LP0 A;  1RAJ A;  2HBR B;  2CFX A;  3ZTS A;  3HT0 A;  3PEJ A;  2KZZ A;  3J7Z T;  2WVC A;  4CT9 A;  4WU2 A;  3BQ0 A;  3M1V B;  3BH7 B;  4GKK F;  5HMY A;  3SDE A;  5DDR C;  3ZZO A;  3SYZ A;  3PM9 A;  3OTD A;  2RDI A;  3PNI A;  3FC9 A;  5IC6 B;  2R8J A;  3CIM A;  1RTZ A;  4DUY F;  3CB4 A;  2V9K A;  4LF4 J;  2PO4 A;  4FKY A;  2Y1J A;  1JXL A;  2G1D A;  3O1L A;  4AD6 A;  2HHP A;  5F9N A;  2OO4 A;  3DLK A;  3OR2 B;  4EMD A;  4C0B A;  3MED A;  2CDQ A;  4EK2 A;  4C8Y A;  3WIU A;  3W2W A;  4ETX A;  1VBY A;  3DKD A;  5HJX A;  5HVF A;  3UDE A;  3H20 A;  1X0P A;  3NP5 A;  3KUG A;  3MHY A;  4MKA A;  5KG0 A;  2FD2 A;  4YY3 J;  4DPW A;  2F8E X;  2FJB B;  2H4Y B;  1JWW A;  1Y00 A;  2FC9 A;  2A10 A;  2MEW A;  1HNV B;  3M7V A;  3DHW C;  2MSS A;  3D28 A;  2X1G A;  2AJ0 A;  2QLB B;  3UWT A;  6FDR A;  3Q8Y A;  3MM8 A;  1GK8 A;  2VIH A;  1OMS A;  4PKD B;  2H4W B;  4DFJ A;  2UVV A;  2VQF J;  3BBB A;  1S1T A;  1RT1 A;  2DO4 A;  2XWY A;  5IT9 U;  1PSD A;  5CA5 A;  3LP1 B;  3ZTO A;  1G6B A;  1QAY A;  2ZDP A;  3C6U A;  1RT6 B;  1FT8 A;  3MD3 A;  2ACY A;  2CKW A;  5F8N A;  4HHU A;  1D8Y A;  3W3S A;  5IM0 B;  3PG9 A;  1VFJ A;  2M7S A;  4LFC J;  2KG1 A;  3ZFV A;  1TKX B;  2KHD A;  2DRA A;  5ETT A;  4F3Q A;  1T9X A;  2IJF A;  5D4P A;  2N3L A;  1MWZ A;  3BQ1 A;  4KGV B;  2XY5 A;  3MR2 A;  1U26 A;  3A4T A;  1N5Y B;  4ZVF A;  2R7S A;  2QLJ B;  3H2V E;  1OJ4 A;  3KK3 A;  2EW9 A;  2XNR A;  1P9Y A;  5KG1 A;  3W65 A;  4FNH A;  3HPO A;  1RAD B;  2XC9 A;  4NI2 B;  3VAK A;  4QYR A;  2YKN A;  4GC7 A;  1QAJ A;  1HBN A;  4J9M A;  5B08 A;  4L3K A;  1RXO B;  2PFF B;  5K14 B;  4DZ6 A;  1TEL A;  1TFW A;  4JI4 J;  3FBB A;  5IZH A;  1LV5 A;  3PFE A;  4XPC A;  2E1P A;  4CO4 A;  4C2M A;  3PJ9 A;  3G96 A;  4X66 F;  3R3T A;  5DQG A;  1VQM S;  2E5J A;  4AUK A;  1URN A;  3OUY B;  3P3D A;  4NE9 C;  1QTN B;  4FVM A;  4C11 A;  2XTJ P;  2JH3 A;  4F4W A;  1M5O C;  4HDG A;  1HNX J;  1CSJ A;  4RL1 A;  2HRY A;  3BRE A;  2BOP A;  2IAJ B;  3Q86 A;  2VG7 B;  3IAS 9;  1SC4 B;  2W2O P;  4KV8 B;  3GWC A;  3PHT A;  1GT8 A;  1FTC A;  4CLS A;  3G4S S;  3DNC A;  4RNN A;  1ZM4 A;  1Y3K A;  1Q0N A;  4DCO B;  1CJU A;  5F8I A;  4JBC A;  5HBM A;  4BWM A;  1NJI T;  2FC8 A;  3HVT A;  3I0S B;  5F3T A;  2B5J A;  2RF2 A;  3PW0 A;  1N36 F;  2JRS A;  3CIZ A;  1H72 C;  1U1O A;  4OHV A;  4FNI A;  2GGP A;  2XS7 A;  4DPU A;  1PIE A;  1TVR A;  4ZJL A;  3KFW X;  5J2P A;  2PI4 A;  2EFQ A;  1KQF B;  3QNW B;  1R6V A;  4USK A;  3CD0 A;  4QU7 A;  1FDA A;  1SJ1 A;  5C24 A;  3TAM B;  3R97 A;  4DOZ A;  2LKZ A;  2ZFH A;  4M5D B;  2F4V F;  2AMC B;  4ZPT R;  3CC2 S;  3PX0 A;  1UL3 A;  1B99 A;  2H1Y A;  5KFS A;  1PKU A;  4O3S A;  4I2P A;  4LUB A;  4PWD A;  5CYQ B;  4ECY A;  3V4M A;  2XMK A;  1IBM F;  4U7U K;  4OYP A;  3DDN A;  1I94 F;  1R7I A;  4IH7 A;  4P10 A;  3W2V A;  4LF9 F;  3K8V A;  2ATC B;  4JI2 J;  5THW A;  1YTY A;  4WFA Q;  3MPD A;  3JB9 k;  2DNR A;  1NPK A;  3HHL D;  3M2V A;  3OSP A;  1SXL A;  4N5S A;  3R5D A;  2MKY A;  8RUC A;  1M5S A;  3TEG A;  4JI1 F;  2KN4 A;  4X4O A;  3ISZ A;  2FVP A;  4N8N A;  2OP5 A;  2AW0 A;  1URR A;  4E0D A;  3VF0 B;  2H5I B;  4K2J A;  2HW3 A;  4JV0 A;  4NX9 A;  4OX6 A;  3PJX A;  4DUZ F;  3PRB A;  3ZNJ 1;  2K1R A;  3UD4 P;  4MIA A;  1UWB B;  5I3P A;  4DFK A;  4MFB B;  3GQC A;  4UQT A;  1W2B R;  4CYU B;  1SUQ A;  4EFA C;  3QAU A;  1M90 T;  2CNN B;  5RUB A;  3R1L A;  4UUW A;  5L1K A;  2IC3 B;  1WHV A;  3V81 B;  2RH3 A;  1JXV A;  2W2N P;  5CZV A;  3MR3 A;  1SV5 B;  2MLZ A;  1Q86 T;  4UZB A;  4NPO A;  4NML A;  3ET6 A;  2RRA A;  2GML A;  3SCJ E;  2DH8 A;  2UXC F;  3NCQ A;  2J6T A;  5KFJ A;  5ETL A;  4NLD A;  3W61 A;  1G7C B;  1WI6 A;  4DX5 A;  2MZS A;  4PQA A;  1OQ3 A;  3A3O B;  1BXN A;  4DSL A;  2AGQ A;  2ZHO A;  4M5J A;  2WAQ D;  2LU2 A;  4C3K A;  2C3M A;  2IHR 1;  1BC6 A;  3DRS A;  1KOO A;  5AXM A;  4C9D A;  2E5L J;  4HI1 A;  2KJV A;  4ILL A;  3HJV A;  4LVO P;  3JAM U;  4DR3 F;  1X8D A;  1UEV A;  1TUV A;  3I4H X;  4I64 A;  1Y4Z B;  1HKA A;  3Q8Q B;  1M1H A;  4YS2 A;  3H4B A;  2B9Y A;  4C8L A;  3BSO A;  2H5J B;  1ZM9 A;  1R8P A;  1U2R A;  4NCG B;  3AHP A;  3LQV A;  1WOP A;  4URS A;  4L6V 3;  2LP4 A;  5K8M A;  4LF7 F;  1DTQ A;  1YHQ S;  2PMH A;  3TQE A;  3ZZZ A;  2BJE A;  3JYT A;  1WEX A;  1MLA A;  2HQF A;  4IO1 A;  2XMA A;  4A47 A;  4MKY A;  3SXL A;  1EJ7 L;  2PI5 A;  3MF5 A;  2N4D A;  2JFD A;  4KRW A;  3MOJ B;  3VTI A;  1R0A A;  5KT3 A;  1RHR B;  3WBZ A;  3V6J A;  4YR0 A;  5LMN F;  2YWE A;  4CH0 S;  4KBI A;  3CDA A;  2MHE A;  3UDL A;  4WPA A;  3NWR A;  3GJT B;  1YWX A;  1S1W B;  2YX1 A;  2NR0 A;  2QSF A;  1JLG B;  1X5P A;  2PMZ D;  1R8B A;  2LQ9 A;  5D0H A;  5KOW A;  1HHT P;  3FCH A;  4YDD B;  3MMC A;  4AL6 A;  5CAA A;  1TFY A;  5HAT A;  1XNQ J;  2RJZ A;  4WE1 A;  2UUB J;  5KT7 A;  3HP6 A;  4M1K A;  4BS2 A;  3IN5 A;  4CDI A;  4U6P A;  5DO2 A;  1TL3 B;  1OSC A;  1GMW A;  3SQG A;  3KUE A;  4YOE A;  3KJF B;  3IR6 B;  2Q66 A;  4MYU A;  2DGO A;  3S8S A;  3SEO A;  5CYM A;  5ETO A;  3QYY A;  3LH2 S;  4ZDN A;  1WC0 A;  2F8M A;  3BEG B;  4UY8 T;  4WK3 A;  1RU2 A;  2GQC A;  2IYI A;  1V3Z A;  5KFA A;  1EAR A;  1MRO B;  1Y5I B;  3CDB A;  1NJW A;  2NSC A;  5I4M A;  4DR5 F;  2J8S A;  4LRD A;  4WFX A;  1WDT A;  1K0V A;  1S9E B;  4O4R A;  4U96 A;  2XSJ A;  4HH1 A;  4TVA B;  2OEM A;  4B02 A;  2FLP A;  4CLK A;  4TXS A;  4ZVQ B;  3TNV A;  8AT1 B;  1YRX A;  2AU0 A;  2RKI A;  4B3S J;  3RBD A;  3DLE A;  2NCK L;  3ILO A;  4RX6 A;  2PA8 D;  2PMW A;  1U1N A;  3MEC B;  3H4D A;  2P2C B;  1PC4 A;  4KFB B;  2DKO B;  3GIR A;  4RUA A;  2B0G A;  4OYO A;  1T95 A;  2YKQ A;  4B3M J;  3IRX A;  3DYA A;  1KS2 A;  3UNY A;  3HD2 A;  3HMJ G;  3I0R A;  3HI9 A;  2R2U A;  5KTQ A;  3FUY A;  2QMX A;  4NZ7 A;  2B4V A;  3A3P B;  4O44 A;  2J7K A;  4CQ1 A;  2OLW A;  3MD1 A;  5F8M A;  4FF2 A;  1RLD A;  1CJK B;  1EP4 A;  3SCK E;  1S77 D;  2QLF B;  1BQM A;  2ZJQ Q;  3CUN A;  3L7O A;  2ZZN A;  2CJA A;  5HVG A;  2DJW A;  1VYA A;  4P2S A;  4I4B A;  2XM3 A;  3PW4 A;  4FZV A;  2L08 A;  2BRL A;  4GO5 X;  1TL1 A;  4GVB B;  1LNQ A;  3GTY X;  5F3Z A;  2VB6 A;  4DG1 A;  4F04 B;  4DQI A;  3NBP B;  2MQ8 A;  4H4O A;  2QG9 B;  2XLJ A;  3DCA A;  1WTB A;  4K7Q A;  2ZH8 A;  2HIQ A;  1SL2 A;  1JLB A;  1Z4U A;  3CJ8 A;  4DV5 J;  2N3O A;  2LFV A;  3CJS A;  4HH0 A;  9RUB A;  2QZ8 A;  1JLF B;  2HQI A;  3RUB L;  2R8I A;  2GJF A;  2QL7 B;  4ZLP A;  1HD1 A;  2C1E B;  4IFV A;  2E5G A;  4LQ9 A;  3CDU A;  4Z7C A;  4NXN F;  3ISN C;  1XMO F;  1JQG A;  2VA2 A;  1HNW F;  1FNX H;  1ICE B;  4QCL A;  3S6E A;  3VGS A;  4CO3 A;  2E7V A;  4NLG A;  4KGZ B;  5GVQ A;  2DGT A;  2HVZ A;  3OHA A;  2QYG A;  5KFL A;  4GKJ F;  4F4A A;  5ETK A;  3NNC A;  5LSO A;  2KZM A;  5J2M A;  3IO1 A;  3H59 A;  5LOQ A;  2HFS A;  2DNH A;  3W9I A;  3OXG A;  2F9D A;  4BC9 A;  1SVD A;  3NEK A;  1UWA A;  1Q5V A;  1KD1 T;  5B0E A;  1F9H A;  2YPZ A;  5KFD A;  3MEG A;  1S1X B;  1QVF R;  1YJV A;  2XMV A;  5SZT A;  3OFF A;  4WP8 A;  1RTI A;  3AFG A;  5EN1 A;  3TRG A;  1S4E A;  1U0H B;  2FHJ D;  2HHH J;  1GNK A;  4OQJ A;  5L38 A;  2QN6 B;  4UW2 A;  1E6V B;  4NA2 A;  3TAP A;  4B9V A;  4CLW A;  2ZH9 A;  2IVF B;  1JJC B;  5KFT A;  1JLQ B;  2FLO A;  3KG0 A;  2FY8 A;  3EZU A;  4PXB A;  2BAN B;  4XTT A;  1U1M A;  5MAO A;  2HFV A;  5KOX A;  2CQ0 A;  1S6Q A;  3DM2 A;  3T6J A;  1H98 A;  4AXJ A;  2FQQ B;  2KVQ E;  3CED A;  1FXL A;  1VI7 A;  1HNZ J;  2V94 A;  2Y8Y A;  4ED6 A;  2DIU A;  2R7T A;  1SJR A;  5K5M A;  3MAA A;  4NYP A;  4GRS A;  2ALY B;  3HSG A;  5AJ3 F;  1T02 A;  4O4G B;  5H9F K;  1NXI A;  3TVZ A;  5KFX A;  3UCZ P;  5H1S V;  4LSN A;  2FLL A;  1T7P A;  4PQU B;  1OQ6 A;  5GAD U;  2R8K A;  1TV6 B;  4YHH J;  5HP1 A;  3EXY A;  4HEA 9;  4OI2 A;  2XO7 A;  3M8Q B;  3KXD A;  3MPV A;  3O2I A;  5E3P A;  4Q5V A;  2FHK A;  5DG9 A;  3DI6 A;  4OV1 A;  3FQL A;  2W8L A;  2O3D A;  4RR5 A;  5LT5 A;  3AH6 A;  3ZTR A;  2W9C B;  4RW9 B;  2IVM A;  2DGQ A;  3N6L A;  4FF4 A;  3MM5 A;  3NS7 B;  5CCL A;  3FBF A;  3KMQ A;  2XG8 A;  3QIP B;  1RZM A;  1ZBT A;  2ZH1 A;  3MMB A;  1RHK B;  1S0O A;  1B4S A;  3CCW A;  2HHT A;  3KK2 B;  2ASY A;  4LFA J;  4DV0 J;  3FJ2 A;  1V9O A;  1IBL J;  1C1B A;  1J5O A;  3KK1 A;  1WUU A;  1WOR A;  2AZ3 A;  3LGH A;  3C19 A;  1DLO B;  3N6M A;  5J1E A;  1E6Y B;  4C8N A;  5DDQ C;  1OIA A;  3DC2 A;  1JNR B;  1S1U B;  1RT5 A;  3BR8 A;  2ZH6 A;  2Z2Y B;  2AKW B;  5DG7 A;  1MG7 A;  1RBL A;  3C14 B;  1F2H A;  2EVZ A;  3EM1 A;  4FYV B;  1WG1 A;  4ZCM A;  1MN9 A;  2LLZ A;  1U1Q A;  1FKO B;  2MZQ A;  3EX7 B;  2D69 A;  3NG8 A;  1ZAW A;  4ZVG A;  2QO3 A;  5A76 A;  2ZD1 A;  4BDP A;  4XPE A;  1VCT A;  3UR0 A;  3AOB A;  3WDO A;  4FF3 A;  3OTO F;  5MLC V;  4DZD A;  4S0M A;  4QIW D;  1RT3 A;  3JXO A;  4U67 Q;  2ADB A;  1L3U A;  3I5C A;  2DR8 A;  1NU4 A;  3DDI A;  1VQK S;  2KL8 A;  2FJE B;  3MM9 A;  4RNM A;  5IS2 A;  4WK1 A;  3CDW A;  3H5Y A;  2KT2 A;  1FJE B;  2HK3 A;  2Y1R I;  2JX2 A;  3FSX A;  4LJM A;  3IGV A;  1YBA A;  3D6M B;  2MZ1 A;  5L39 A;  4DV6 J;  2ROG A;  3JS9 A;  2C2D A;  2BJ1 A;  2Q79 A;  3HFK A;  5D4L A;  4Y2C A;  3I87 A;  1FER A;  5KFZ A;  5E0O A;  2NXC A;  4E2F B;  2G1H A;  3KLE A;  1IBK J;  3N0V A;  4H4K A;  3KKF A;  3R7N B;  3KDO A;  2P6S A;  3LTO A;  4ZLN A;  1TUW A;  2ZE2 B;  1QAI A;  2WOM A;  1VLY A;  3NGS A;  3PIP Q;  3VGT A;  2IPO B;  2VOD A;  2LA4 A;  3DOK B;  4DU8 A;  1VR6 A;  3EGV A;  4DCJ B;  4CM2 A;  4ZMM A;  1LWE A;  2KFY A;  4WU3 A;  4UF4 A;  1FD8 A;  2OJ3 A;  2AJQ A;  1VMB A;  3W2W B;  2MJU A;  2VKZ G;  3EGN A;  2F63 A;  1F1B B;  3P5B P;  3U27 A;  2BBE A;  2HLT A;  4N56 A;  2R7U A;  3PYG A;  3UD5 A;  1X4D A;  1FO1 A;  1C0U B;  3GYX B;  3E8O A;  5A8K A;  2VC0 A;  3BPS P;  1S5Z A;  2P6T A;  1KFS A;  2DGS A;  3OQ2 A;  2W7P A;  1OO0 B;  2DNL A;  3J80 Y;  4Q2M A;  5T14 A;  5GAE I;  3PJW A;  3MM8 B;  1W2I A;  4I0W A;  3V6D A;  3QMQ A;  5KFB A;  4X65 F;  2V4Q A;  4ES2 A;  4ID5 B;  5I3U A;  4ZP9 A;  5T7L A;  3IG1 B;  2BZ2 A;  2F3J A;  4JI6 J;  2CJB A;  2QRR A;  5KT2 A;  2DNQ A;  1FRM A;  2APO A;  3CXC R;  2R7R A;  2X1B A;  2EC2 A;  1NK9 A;  1D0E A;  3QSI A;  1PJ5 A;  3BB5 A;  1XNR J;  1EZZ B;  3IBW A;  1R8C A;  2LEA A;  2ZHA A;  1JK9 B;  4L3N A;  3DMJ B;  3OFE A;  1RWN B;  2XHW A;  7FDR A;  4DQS A;  2KDO A;  3CCS S;  3KOA A;  1H2U X;  3HSD A;  4OJ3 A;  2HIY A;  3FEX B;  1YGY A;  3BR9 A;  1T3N A;  2YNG A;  5KFG A;  2AYB A;  2H5E A;  4YN3 B;  3H40 A;  3AOC A;  1J27 A;  1KEK A;  4KHP F;  2V2Z A;  3GFH A;  5GME A;  1PO6 A;  1HBN B;  3QFW A;  2WBR A;  2XWX A;  3BGR A;  2AEM A;  4V19 X;  4HTI A;  5CZX A;  2PSZ A;  1NB2 A;  1UZH A;  1DTT B;  2CXE A;  3BSN A;  2EK1 A;  4P9S A;  5HMW A;  4J37 A;  3U7J A;  5L9X A;  3OLA A;  4JI3 J;  3OBI A;  1F0X A;  3GFZ A;  1L3S A;  2K8G A;  2MMY A;  2IDL A;  3UR3 C;  3DLG A;  4DN0 A;  2XB2 D;  5KG3 A;  2M4M A;  3EMT A;  3H7H B;  4X62 F;  1RAF B;  2WSF C;  1I51 B;  3ETM A;  4PAB A;  4KH0 B;  2KJW A;  1YJU A;  4EO6 A;  3M1V A;  3RG6 A;  3W8G A;  2BKN A;  3MUV P;  3RRG A;  4JI7 F;  4F0M A;  2UXD F;  5GAG I;  1S1V A;  4P2M A;  1WAC A;  3KNA A;  5B7W A;  4L73 A;  4OYA A;  3MMJ A;  2K7K A;  3NWG A;  3JSM B;  1LWC B;  3MR6 A;  4EYH B;  2BXJ A;  2D3O 1;  4IR9 A;  3CJ4 A;  2ZUA A;  3KNG A;  2OPR A;  4RW4 A;  1IN0 A;  3I55 S;  5KG4 A;  4A8M P;  3L3C A;  1YZ6 A;  1CJU B;  4OHX A;  5LJ5 Y;  2F8H A;  4P71 A;  2B5J B;  1MWY A;  2XZW A;  3G8Q A;  2ZJR Q;  3ZZT A;  3TUP A;  2D7S A;  2D1C A;  4BLG A;  1RWM B;  2HBZ B;  2GGP B;  4CLZ A;  1DAR A;  1TVR B;  1S10 A;  5HVH A;  1M5K C;  1OY8 A;  5F8H A;  4NLU A;  1VBX A;  1RHU B;  3UN5 A;  1D9F A;  2YX7 A;  4H54 A;  3EPG A;  4J91 A;  3R1H A;  1HNV A;  2FZK B;  4DR1 J;  1IUJ A;  2RUS A;  4A8X A;  2DO0 A;  3R7B B;  1Z2Z A;  1NHV A;  3VAJ A;  4KY3 A;  1T9W A;  4NEY A;  4OZN A;  2PE8 A;  2V2Q A;  2GJ2 A;  1RYR A;  2Z58 B;  2AEF A;  1LK5 A;  1WG5 A;  4KYZ A;  3ENQ A;  4LF8 J;  1WF2 A;  2KH9 A;  1RCO B;  2KFZ A;  4KGX B;  4DPX A;  3LP1 A;  4DPT A;  3TA0 A;  1SJQ A;  4OYB A;  1T8E A;  4I2P B;  2U2F A;  2LMI A;  2V0N A;  1ZTW A;  2UU9 J;  2KG0 A;  1VQY A;  1NH7 A;  4RW8 B;  5IM0 A;  2J7U A;  3QO9 B;  2RRB A;  2GVZ B;  1JMT A;  1H2T Z;  2VPY B;  2ATL A;  1TKX A;  3L95 X;  1XMB A;  4M5L A;  1NHK L;  1RI7 A;  4DL3 A;  2LVW A;  4A8K A;  2CPX A;  3US5 A;  2BE9 B;  5E33 A;  1CG2 A;  3GCW P;  4EI2 A;  2KTQ A;  1RT2 A;  3TVK A;  4NI2 A;  2E9R X;  3RRH A;  2K1R B;  4O23 A;  2QA2 A;  1FWL A;  3ZO7 A;  4DV3 J;  4B3R F;  2JNJ A;  3B4D A;  4Y2I A;  3H42 A;  1SUQ B;  5K14 A;  2ZBC A;  4K8R A;  3DDK A;  3D6H B;  1DHM A;  3ZTQ A;  5KG2 A;  5DG8 A;  1FKP B;  1O51 A;  4F3O A;  3CMQ A;  1YLX A;  4MJK A;  5HJY A;  2CQG A;  1WEZ A;  4NL5 A;  4KAI A;  5KFY A;  1X31 C;  4GKK J;  2C28 A;  4WXW A;  4OJG A;  3BDP A;  4TNO A;  1Q16 B;  4NLX A;  1X5S A;  2IBK A;  1LK7 A;  2CPZ A;  3P45 B;  4IFY B;  2CWX A;  4MKB A;  2NS1 B;  1A7G E;  4DUY J;  1D8Z A;  1B7F A;  2IAJ A;  1TK8 A;  2LYV A;  1ELO A;  2VG7 A;  1FKA F;  1YIT S;  3DRS B;  2XGP A;  3DLH A;  3CTR A;  2WHO A;  3DU5 A;  1HNI A;  2YH0 A;  2HQG A;  1T9V A;  4W92 B;  2R4F A;  4DR4 F;  2FJV A;  5K20 B;  2Y3Y A;  4M5H A;  3P96 A;  5BYS A;  5E5N A;  1TL4 A;  4B9M A;  2VPW B;  3I0S A;  1R6Y A;  4DPY A;  1ZM3 A;  1DRZ A;  2RNE A;  2DPJ A;  1GEH A;  4E98 A;  4XDD A;  2WVE A;  3ETO A;  1OPI A;  2VDI A;  1GTE A;  1HWI A;  3PIO Q;  4O3P A;  2LEB A;  3PYE A;  3VAM A;  2UUC F;  2LQ8 A;  3HVA A;  2ZWP A;  2ERR A;  1YJT A;  3CME S;  1TKZ B;  2CZ9 A;  3TI0 A;  3TAM A;  4ICL A;  4OX9 F;  1QVG R;  5F8G A;  2IBO A;  2KRB A;  4M5D A;  2Y9H A;  3RB6 A;  1X9M A;  2WBM A;  3M2U B;  2WB4 A;  1UFK A;  2DCU B;  3T1H F;  2HBQ B;  5CYQ A;  1YI2 S;  3MMC B;  3FSI A;  4ECQ A;  2V8P A;  2IFX A;  4PAA A;  2VAS A;  1OWX A;  3C15 B;  1JX4 A;  2K06 A;  4ED0 A;  1I1G A;  2N7C A;  3D67 A;  5KFH A;  3NKY A;  4B9S A;  1N48 A;  2UVU A;  4NA3 A;  1EX8 A;  1IXK A;  5ETN A;  5JVG Q;  1FI4 A;  1RB0 A;  1N4L A;  3Q83 A;  1WKJ A;  2Y0S D;  1Q7L B;  1T0T V;  3X3U A;  4ELV A;  5IFM A;  2ZOG A;  2M0G B;  2NYH A;  3W63 A;  2JFK A;  4G1P A;  3NY0 A;  2VPX B;  1UWB A;  2R8G A;  4CYU A;  2CNO B;  2YTC A;  2J6U A;  5E2Q A;  5M2R A;  4X66 J;  4DSI A;  4ELT A;  1HWK A;  1ZTT A;  2IC3 A;  1SJF A;  1EHW A;  2SXL A;  1CVJ A;  2HHQ A;  1SV5 A;  4R0J A;  1SL1 A;  1KTV A;  1N56 A;  4OYM A;  2VKR A;  5B0C A;  2RKI B;  3UNG C;  1VRQ C;  1S4F A;  1EB0 A;  5M2P A;  2BUN A;  2J9E A;  5IV4 A;  3SFU A;  1T11 A;  4F25 A;  3R2C J;  1VQL S;  2ZUG A;  4UTG A;  5AXK A;  3PX6 A;  1QE1 B;  3IRX B;  3I0R B;  4TU8 A;  3OTE A;  1KHV A;  5B0F A;  3VR1 A;  3NGD A;  1XWL A;  2FJA B;  4J9R A;  2QL9 B;  1N36 J;  4K4X A;  2O67 A;  4C98 A;  3IS9 A;  1U0S A;  4RBU A;  4NCG A;  3OL8 A;  3GII A;  4NCB A;  5KFV A;  1S79 A;  4PG4 A;  3W5X A;  3QZ7 A;  2HUR A;  2OPQ B;  1MWQ A;  1IM4 A;  2IA0 A;  3P5T L;  5E7O B;  3FZ2 A;  3O5T B;  4DJB A;  3U02 A;  3IA0 A;  4BWJ A;  1FFS B;  3P4U B;  2FVR A;  1JKH B;  2C2R A;  3KLH A;  3ENW A;  3H5U A;  4IRC A;  5IT4 A;  2F40 A;  1X0F A;  4UOG A;  2MPU A;  2DYA A;  2MQL A;  3N01 A;  2F4V J;  5E3R A;  4DG1 B;  2MJN A;  2FTR A;  2RIL A;  5K8O A;  1Q79 A;  4C8Z A;  5I42 B;  2BAC A;  3QBC A;  3QJP A;  1T03 B;  4QWE A;  5G0R B;  1IBM J;  2Z0G A;  1UCN A;  3LGN A;  3UPF A;  2EG1 A;  2YQ3 A;  1I94 J;  1UET A;  4ZS6 A;  4LF9 J;  2MQN A;  1N6Q B;  2KVI A;  2VA3 A;  1S0M A;  2YNF A;  4IFV B;  4FKX A;  1MSW D;  1HR0 F;  4JI1 J;  1LWF A;  3MR5 A;  2CPH A;  2JSX A;  3Q8R B;  1V3S A;  1R8A A;  3OFG A;  1X4B A;  3SMZ A;  1TL3 A;  2FJX A;  2VFV A;  3EIC A;  4DUZ J;  2BM1 A;  5IT9 Y;  4XIU A;  4V19 J;  3G71 S;  3K2Y A;  2C2E A;  5J2M B;  3EJM A;  4KO0 B;  5H9E K;  5L1L A;  3NNA A;  2NZ4 A;  3L7U A;  3J7A N;  3MEG B;  2BM0 A;  1NCL A;  1UJ6 A;  1SI9 A;  2KM8 B;  1YSJ A;  3V5R A;  4U7U D;  3GP9 A;  2UXC J;  4DL5 A;  2HRT A;  1RWP B;  4K4V A;  1WF1 A;  4LF5 F;  2E44 A;  5F8L A;  4ED4 A;  4O0N A;  2RU9 A;  3R8Y A;  1SKS A;  2B4U A;  4A8S A;  4LVN P;  3BBC A;  3LPY A;  1NM2 A;  2MST A;  4NMX A;  3HCX A;  1RJJ A;  1QAX A;  3K17 A;  4AT1 B;  3W60 A;  1S6Q B;  4DR3 J;  2CPY A;  4KFB A;  4BHQ A;  1QM9 A;  4YB7 A;  2VJU A;  1H6K X;  4X84 A;  3PKY A;  4NOH A;  5KFU A;  4RUB A;  2FHJ A;  5A8W B;  4LF7 J;  4QBU A;  2ZC3 A;  2N82 B;  4B9N A;  3PCO B;  2VFT A;  1CJK A;  1P27 B;  4Z2X A;  4YP3 A;  1X5O A;  1U8S A;  1R89 A;  4DXL A;  3D9B A;  4U8V A;  2V2K A;  2PT0 A;  1NKC A;  1HA1 A;  1RHQ B;  1X4F A;  4A8W A;  1U1K A;  4GVL A;  2B56 A;  2ZC4 A;  1RBA A;  3RB0 A;  5LMN J;  2HS0 A;  2GW8 A;  4PWW A;  3WC2 A;  3IAM 9;  3MZI A;  3CVK A;  3DI6 B;  4OZ2 A;  4ECV A;  1Y11 A;  3OR1 A;  4GMK A;  3PYD A;  4F0K A;  3NBP A;  4UZC A;  3MM5 B;  3MUM P;  4ZVU B;  1MML A;  4IG0 A;  3EE3 A;  1DZ5 A;  2J6S A;  3PO5 A;  4QPX A;  1QSY A;  4HHH A;  4ZIT A;  3MPU B;  3Q8V A;  1FRI A;  5KFE A;  3OV7 A;  3OHB A;  5LMU F;  1FE0 A;  1C1B B;  1N34 F;  1HQE B;  2F7V A;  2E29 A;  1J5O B;  3KK1 B;  4YEA A;  2QT7 A;  1ARO P;  2LEC A;  5HK4 A;  3MM6 B;  1BWE A;  3WHI A;  2Z2Z A;  5HQL A;  1Q8K A;  2HYI B;  3HF5 A;  3MOZ A;  1WF0 A;  1RT5 B;  2V68 A;  1IR0 A;  5IWA F;  3RB4 A;  2IMO A;  3BKT A;  3DLJ A;  2BE7 D;  3TUI C;  2FGO A;  5HLF A;  3U1N A;  5E3A A;  5K9F A;  3CPW R;  1JB0 C;  2ZD1 B;  4ZIW A;  3RR7 A;  1XJW B;  4HLB A;  4DR5 J;  3T6B A;  4LR9 A;  1KLM A;  3HDS A;  3GFX A;  1NND A;  5D15 A;  2XGQ A;  2JEJ A;  1BQN A;  2VU5 A;  2AJ1 A;  1U0H A;  2XZT B;  5JXS A;  4DX6 A;  2DR7 A;  2HWT A;  2NSB A;  3TAN A;  5IV3 A;  3DRP B;  1TAU A;  1E6V A;  1ZA1 B;  3CW2 C;  3MM9 B;  4A8Y A;  1JLQ A;  2CQH A;  4CCH A;  2VON A;  4IG3 A;  1UTA A;  2NXN A;  2UUA F;  1PBU A;  4RUC A;  1CC7 A;  2V69 A;  7AT1 B;  1NUE A;  3H98 A;  2BAN A;  1CJV B;  4W98 A;  4X4N A;  4TQS A;  1VRU B;  1HBM B;  4ZVT B;  1AA1 B;  1NEE A;  2IM1 A;  4LRF A;  2CQD A;  2PGC A;  2DNN A;  4C97 A;  1HWL A;  1S48 A;  4C0H A;  5E41 A;  4QU6 A;  2R7X A;  5B0D A;  4JV5 F;  1UPP A;  5KFW A;  2DXD A;  2ZOM A;  5HSP A;  3KLE B;  2I2Y A;  5B0G A;  4CH1 A;  1R31 A;  3THV A;  2QIF A;  3BQ2 A;  2C3P A;  5F8J A;  2GMH A;  2C3U A;  2RML A;  3S7R A;  2MY8 A;  1YJ9 S;  5KG7 A;  1UA0 A;  4ZP6 A;  4PQU A;  4DV1 F;  3ZNU A;  2PII A;  1UEK A;  1WKK A;  1YJR A;  1QSS A;  2XHC A;  2M5Y A;  3C66 A;  2QA4 G;  5AE2 A;  3M8Q A;  1Q78 A;  3A8I A;  1QY7 A;  4USI A;  3SFG A;  4WCE Q;  3B8H A;  5HRO B;  4FBT A;  2WON A;  2K7J A;  2W9C A;  3UDV A;  4RW9 A;  2Q6B A;  4JYA F;  4B9T A;  2LU1 A;  2K2P A;  3QIP A;  1L3K A;  2V4J B;  3ONQ A;  1TP7 A;  3WX8 A;  3KK2 A;  3V4I B;  2OPP B;  4NXN J;  3MFH A;  5DET A;  3CO0 P;  2GAG C;  3SSS A;  2V5H G;  1XMO J;  1HNW J;  1DLO A;  3D3C J;  2VFU A;  2E1A A;  2XI2 A;  3VZH A;  5C5J A;  3DLL Q;  2HHS A;  3V6D B;  1C2P A;  3FBE A;  4HL9 A;  1PBA A;  4GKJ J;  4YDX A;  4QWC A;  2O5D A;  4DFP A;  3D3B J;  2WTF A;  5I3U B;  4FF1 A;  3EUN A;  1VQS A;  1O5J A;  1S1U A;  1A0O B;  2JJ4 D;  4HAC A;  3C14 A;  2W9B B;  2OFH X;  2YKM B;  4ZVH A;  3ENV A;  1A9N B;  3R27 A;  3DGP A;  5F41 A;  1NK8 A;  5GAE U;  2VDH A;  5EDW A;  4OJ1 A;  1KBR A;  2J9D A;  4CO1 A;  3JSY A;  2HHV A;  4KKO A;  2XYH B;  3MUR P;  1H3D A;  3SZ2 A;  2ZBP A;  1LW0 A;  1TTH B;  3RBX A;  3M9M B;  1WJ9 A;  5KFC A;  1TKD A;  1CJT A;  2YWF A;  3T5L A;  2DNP A;  3EGW B;  2WW8 A;  2YNG B;  1YIJ S;  4WZQ A;  1KQK A;  3GSD A;  3HXM A;  1U2C A;  4ECZ A;  3QPI A;  4L74 A;  4FS1 A;  1N54 B;  2CQI A;  4DFM A;  2D3U A;  4ED5 A;  3I96 A;  1X5T A;  1H74 A;  3BGR B;  2AEJ A;  3DFE A;  1C0T B;  3JSB A;  1DQ8 A;  1N5Q A;  5T41 A;  3N28 A;  2UVW A;  4WF9 Q;  3EPI A;  3GFY A;  5L9N A;  3DLG B;  3R6G B;  3PHE A;  1RHJ B;  3A8K A;  2G0C A;  3W62 A;  3BH6 B;  5L8R C;  4X4Q A;  5AJ3 J;  1HWU A;  4A46 A;  2DGV A;  3GZ7 A;  2VFR A;  4TQR A;  2XMM A;  2PFD A;  4EEY A;  2L9N A;  4UOF A;  3NOC A;  1HMV A;  2V2V A;  2ZE2 A;  1TKT A;  4WYL A;  1K1S A;  1S1V B;  3N5F A;  1VIO A;  3IRW P;  4BBY A;  3HX9 A;  4W4M A;  3DOK A;  2W2M P;  4CNZ A;  2B6A A;  2OPR B;  2W7O A;  1DQ9 A;  4RW4 B;  4TYB A;  2Z57 B;  3NAI A;  1JLC A;  4HKQ A;  3G87 A;  1K0T A;  4O3N A;  5DLF A;  1WHY A;  3R5G A;  3GJS B;  2VZ9 A;  3T3F A;  2QC3 A;  4TLR A;  1VQO S;  2YNH B;  5GAG U;  4ECS A;  4F4K A;  4JI8 F;  4PWU A;  3GU0 A;  1D9A A;  1C0U A;  3CNQ P;  3PO4 A;  1ZS6 A;  1KVJ A;  3KLF A;  2C22 A;  3IXQ A;  3NCP A;  2RS2 A;  1XR7 A;  4KHR A;  4DL7 A;  2QYC A;  3FVY A;  3MGJ A;  4JI5 F;  2KU7 A;  4Q8F A;  5HO4 A;  1SKU B;  5EX3 A;  2ZNZ A;  2B51 A;  4ALZ A;  2BJ9 A;  2XSF A;  4DV7 F;  5FDL B;  2MDA A;  4ID5 A;  4QQB A;  3IG1 A;  2HPU A;  4ILR A;  1WHW A;  2OSQ A;  4MK9 A;  2YH1 A;  1TAQ A;  3F56 A;  3PXG a;  3LW5 C;  4C3M A;  1VHI A;  3OTO J;  4WXO A;  1BLU A;  1WC1 A;  2GO8 A;  4J9U E;  3M2R A;  5FLX Y;  4QZV B;  1EIY B;  1PIL A;  3DMJ A;  4HVZ A;  2J9C A;  2VBX A;  4P2X A;  5D3G B;  1EQ0 A;  2JC1 A;  2OPS B;  2NZC A;  3GMG A;  1MNE A;  1SQG A;  3GV8 B;  2UXB F;  1QJH A;  5LSR A;  1RT2 B;  3CJ5 A;  2DT9 A;  3B4M A;  1S76 D;  1O8B A;  4CNY A;  1UVM A;  2OEJ A;  5JMN A;  4MTP A;  1KN6 A;  1RKI A;  5CQG A;  1Q5Y A;  2DIS A;  1K8A T;  3KLI B;  2HFO A;  4DV5 F;  3BKU A;  3HHL B;  1FDD A;  1J2V A;  4DX8 H;  1HWJ A;  1TK5 A;  1PYS B;  1DTT A;  2ASJ A;  1JNZ B;  5ETQ A;  2MKC A;  1RU1 A;  3CD5 A;  4EBE A;  5EX0 A;  2Q6C A;  4M94 A;  1IBC B;  3SCL E;  3M8S A;  2HZC A;  3NNH A;  3HHE A;  4LRE A;  4LR8 A;  3UI3 A;  1YJ7 A;  2KT3 A;  2KO1 A;  1VC6 A;  3OL9 A;  2P9C A;  5B0B A;  2ZBI A;  2LDI A;  1CS4 B;  3PDN A;  4YUD A;  2V8H A;  5D6G A;  2G13 A;  4DI6 A;  1RA6 A;  2XBP A;  3HT3 A;  1XTZ A;  2ZOF A;  1FA0 A;  2AQ4 A;  4K2X A;  1NSA A;  5C2G A;  3V2U C;  3MM7 B;  2Y1I A;  3VHQ A;  3I32 A;  3MPW A;  5HN0 A;  1NDC A;  1HNI B;  3BM7 A;  3C6T B;  3JSM A;  1LWC A;  3M8W A;  4ED7 A;  1Q53 A;  3LUY A;  2KI2 A;  2ACM A;  4I67 A;  3M4X A;  5H9F J;  4CP5 A;  3SCI E;  2D9O A;  3FFI A;  4AQY F;  3RBE A;  3K8W A;  1TK0 A;  4DR7 F;  2EXU A;  3IGN A;  4LBI A;  3ZC4 A;  2F65 A;  1GFW B;  1NK7 A;  4ZJO A;  3G6E S;  3HHD A;  4DX7 A;  2A1B A;  2CJX B;  2XUL A;  3PYF A;  4X4V A;  1Z2L A;  2R42 A;  1ZYQ A;  3I6P A;  2X1F A;  4NYZ A;  1S6U A;  4IOC Q;  3OVA A;  3G8T A;  3MWB A;  1WOS A;  3OJU A;  4PUO A;  4X65 J;  1RAC B;  5DQH A;  4DR2 F;  2BA9 A;  3FMB A;  1XMQ F;  3LAK A;  2CQ2 A;  4CLT A;  3C2P A;  1XQI A;  1L5U A;  4ICL B;  3OTC A;  1RAH B;  2NXE A;  4URG A;  3ILL A;  3HHN B;  2VH7 A;  3R9L A;  1Q82 T;  3CCV S;  3OL7 A;  2DNK A;  4DSJ A;  4H4K C;  4OLP A;  2YX4 A;  1HBU B;  3CDE A;  2DK2 A;  2QMW A;  3FEZ A;  4RW8 A;  1I3O B;  2BX6 A;  3IC1 A;  2I5J A;  2C42 A;  1KVK A;  3QO9 A;  3NS6 A;  4QPT A;  1B0T A;  2QA4 S;  2GVZ A;  1CQN A;  5KFM A;  4UOH A;  2U1A A;  2G0I A;  1GMU A;  3M8P B;  3U1L A;  3J80 U;  4D3G A;  5A0Y B;  3Q0A A;  4OI3 A;  4ES3 A;  3GG1 A;  4DR6 F;  2DHX A;  5K8P A;  4ZVR B;  4Q2L A;  1DBD A;  4YFU A;  5FII A;  2KYX A;  4KHP J;  3HJF A;  2P5V A;  1GMW D;  1XN9 A;  5D78 A;  4HR2 A;  3T1Y F;  3BGF A;  2CQ3 A;  3HUL A;  3KJQ B;  3PR5 B;  2E1C A;  3J7A 1;  1Q81 T;  1HL6 A;  1RT4 B;  1ZET A;  2RQC A;  4NXM F;  3D5M A;  3W5Y A;  3RJM B;  2JVO A;  1VQP S;  4UOC A;  4V1A k;  3I5A A;  5J1N A;  1CEZ A;  1FKP A;  3JQK A;  4XO0 A;  4X62 J;  4WFZ A;  2H51 B;  3TWZ A;  1M1K T;  1LW2 A;  2QA1 A;  4OI0 A;  3IMQ J;  4FYX B;  4RJV A;  3QRR A;  4WJB A;  4AE5 A;  2BJ7 A;  2H65 B;  1F5A A;  2KXN B;  2UXD J;  3BV8 A;  5KFN A;  3LAN A;  4J9N A;  3MCS A;  4IFY A;  3N9U C;  1Q8I A;  3POT A;  3TZW A;  2MQO A;  1I6J A;  4LSL B;  1FRH A;  3TAQ A;  7FD1 A;  3SIP B;  3TJ9 A;  2AZ1 A;  1PJ7 A;  3CCJ S;  1RTD B;  4R25 A;  4RPF A;  2E1R A;  5E3C A;  2B9X A;  1OSD A;  3EYZ A;  1F3V A;  2NPF A;  3GON A;  3IS9 B;  3QT7 A;  1N88 A;  2DVI A;  3K5P A;  1KLN A;  3A1Y G;  2HRU A;  4ECT A;  5KFO A;  2BE2 B;  1LQ9 A;  2HEK A;  1CUL B;  2RS8 A;  3B54 A;  2GHV C;  3KLH B;  3SV3 A;  4C4W A;  5KAK A;  1FNM A;  1HQU A;  1NK5 A;  2Z30 B;  5GAH I;  5L46 A;  1CBK A;  1X4H A;  3M30 B;  2WB1 D;  2BOA A;  3IP0 A;  2JEF A;  4B9U A;  1TKZ A;  2H9Z A;  5BYR A;  2R2R A;  4IOB A;  4JB8 B;  3TX0 A;  1QTM A;  2H3E B;  4NLR A;  1GTH A;  2V67 A;  4F4Z A;  4I6W A;  3M2U A;  1VJW A;  3K57 A;  2ZM6 F;  2PA3 A;  2BR0 A;  1NB7 A;  1UMJ A;  2YNF B;  1SPB P;  3GB0 A;  2GAH C;  2DIV A;  3QRQ A;  3C15 A;  1Q1K A;  1LWF B;  3UE2 A;  2MXY A;  1EAY C;  1AT1 B;  2HGM A;  2AX0 A;  2M2B A;  1VS3 A;  3HKW A;  1FES A;  4EGL A;  3E3X A;  1NO8 A;  3NOG A;  2JVR A;  5CD4 A;  1AZS B;  3K0J A;  2P9G A;  3J81 j;  3C16 B;  1BE4 A;  3JSR A;  2DHG A;  2P8I A;  2VQE F;  2PEB A;  4A8Q A;  4B3R J;  1AW0 A;  2WSE C;  4ZCI A;  2CZV C;  2GMJ A;  2DR9 A;  4QIG A;  1KKH A;  1YDL A;  2GO9 A;  2WVB A;  4R5P A;  2BKO A;  3KTQ A;  1WOO A;  1C1C B;  1UVJ A;  3UVJ B;  2IM0 A;  1RGV A;  4L72 B;  2IA6 A;  3VQT A;  4Y0F A;  3EWG A;  2HS4 A;  5GMD A;  3GIL A;  3FCV A;  4DN9 A;  1FD2 A;  1X60 A;  1S6P B;  2HGN A;  4LF2 A;  2OI2 A;  3CJQ A;  3D4J A;  3QT6 A;  3HLU A;  2HMI A;  4PXC A;  3AD7 C;  1T9U A;  2AYE A;  2PDA A;  4LIW A;  3SQO P;  1U1P A;  3CD7 A;  3MCM A;  4ED1 A;  4TYA A;  3AT1 B;  2DHH A;  1UZD A;  2BRK A;  2X3G A;  4DR4 J;  4RNF A;  1QUP A;  1QE1 A;  3IWN C;  4DSF A;  3M8R A;  2YKO A;  4CO5 A;  3BSC A;  1HW8 A;  1EKR A;  1KTQ A;  2R2T A;  4CZC A;  1XC9 A;  4Q0B B;  2OAU A;  1FJ7 A;  3OD2 A;  2OH2 A;  3BN4 A;  5C7P A;  1RAO A;  3FK4 A;  4YR3 A;  2Y0B B;  1XK8 A;  4DV2 J;  2OPQ A;  2VJV A;  2C3Y A;  2NXU A;  2UUC J;  3DGV A;  1JKH A;  2VL1 A;  1VK8 A;  5JJB A;  3FSY A;  2KXF A;  2Y8W A;  4CLP A;  1JLA B;  2DR6 A;  4OX9 J;  2OFG X;  3OR1 B;  3CMA S;  5J1P A;  2NXJ A;  3KG1 A;  4M5I A;  3D66 A;  4FYD A;  3T1H J;  4IG0 B;  4UQG A;  3M8Y A;  2CJK A;  5I42 A;  2RQK A;  2CVE A;  1VJQ A;  4FBU A;  1T03 A;  5G0R A;  3W1Y C;  1UJ4 A;  3H2U B;  3PR4 A;  1N6Q A;  3RRK A;  2W1B A;  1IKX A;  3G2X A;  1UW9 A;  4YR2 A;  1IM6 A;  5DJB A;  3CCL S;  5DDO C;  2QGF B;  2VOO A;  2DXF A;  3LPE A;  3NGK A;  3KMS A;  1KQG B;  2DNZ A;  4C3L A;  4RBT A;  1KSP A;  4ELU A;  3FKB A;  1S7I A;  2ILZ A;  1KC8 T;  5HLF B;  4KO0 A;  2RIJ A;  2DNO A;  1RIS A;  4CLY A;  1PAU B;  2J0W A;  5DQI A;  1U24 A;  3MDF A;  4QWB A;  2XZD B;  2FIU A;  1QUV A;  1U6F A;  4M5M A;  1N5V A;  3DXS X;  4RW6 A;  1KLM B;  2VG6 A;  2HND B;  2RE1 A;  4CO0 A;  2HNZ A;  1FK9 A;  1BQN B;  5CYJ A;  3J7Y I;  2RHQ B;  1KR4 A;  3J81 Y;  2OEK A;  1SH2 A;  4FPR A;  3GJR B;  3S01 A;  5BR8 F;  1SL0 A;  3CJ0 A;  2X1A A;  2EPI A;  4QYZ K;  1YBT A;  4GO7 X;  5A2Q U;  3W64 A;  4J7C A;  4LIR A;  3D1O A;  2J7W A;  4C0O C;  3D54 A;  4LFB F;  4IG3 B;  1S0N A;  3T19 A;  2XLI A;  2OTJ S;  4P2F A;  2DGX A;  2DNG A;  4JI0 F;  5C25 B;  4OYX A;  2V34 A;  2QSW A;  3JTO A;  3RYL A;  1ZM2 A;  4N41 A;  4USW A;  3NGT A;  5E3Q A;  4Y2K A;  1GX6 A;  4OV6 A;  4DV4 F;  1PYO B;  2PC6 A;  2CJQ A;  2GCF A;  3IWX A;  2M88 A;  3BN7 A;  2VBZ A;  4RU9 A;  2HHX A;  1N32 F;  2VV5 A;  5A8W A;  1NRK A;  4A48 A;  1GX5 A;  4NLY A;  1AXQ A;  3D0G E;  1WC3 A;  4OHY A;  1RAE B;  2RB7 A;  1U45 A;  3D2W A;  1LKZ A;  3RR8 A;  2QLW A;  3G86 A;  1FRX A;  2O66 A;  1Q7Y T;  3MR7 A;  5C42 B;  5LXR A;  3PTW A;  2HGL A;  1UKU A;  2OKQ A;  2DB1 A;  2B9E A;  2LXI A;  1NKB A;  4F26 A;  3QFH A;  2XQC A;  3PW2 A;  4OYZ A;  3QRP A;  4ZHR A;  2WON B;  2HVI A;  2F4F A;  3M6W A;  3BO4 A;  2L9D A;  1YRT A;  3ADA C;  2XS2 A;  1VRT A;  1ZH5 A;  1VLO A;  4ZPV R;  3TJA A;  4NLW A;  2AP6 A;  3JQM A;  5HI7 A;  3HVW A;  4ES1 A;  3GV7 B;  4NCA A;  3G82 A;  3D6T B;  1PYT A;  3EVM A;  2V63 A;  3NS5 A;  4ZN3 A;  1ZA2 B;  3CJ3 A;  4ZK7 M;  3A12 A;  1MU2 B;  1HR0 J;  4M5G A;  4WII A;  2ZEJ A;  5L1J A;  1HQE A;  3G6V A;  1UFL A;  2MQM A;  1X4E A;  3LA0 A;  1H73 A;  1NK4 A;  4OLO A;  1VK3 A;  4DL2 A;  1HFE L;  3PVX A;  4OIX A;  4OI1 A;  1UVN A;  5IT0 A;  3MM6 A;  4ETZ A;  3D1H A;  1K1Q A;  4K50 A;  2OGU A;  1UFW A;  5ETS A;  1JJ4 A;  1YZ7 A;  2IVY A;  2EWH A;  1CC8 A;  4HAC B;  1HPZ B;  1DAX A;  2EEY A;  4C8M A;  1V6H A;  2ZBQ A;  1S49 A;  5GMK a;  1Y3J A;  2WSC C;  4Q44 A;  1IKV B;  2CAD A;  2K3I A;  1W25 A;  3AXM A;  1FJG F;  3TW0 A;  4JV2 A;  3DGP B;  2G2Z A;  2HG4 A;  3BF4 A;  1MMD A;  1LXN A;  3LWL A;  3KHR A;  4ED8 A;  2ZWO A;  4KKO B;  1T3O A;  5A8R B;  3HO1 A;  1F9F A;  1LW0 B;  3V6H A;  2DEJ A;  2DY9 A;  3EVO A;  4LF5 J;  1W26 A;  1CJT B;  4WFN Q;  2DRB A;  1J5E J;  1BQX A;  3PW5 A;  1QLN A;  1WSR A;  1KON A;  3DRP A;  3I9Z A;  1R43 A;  4TLQ A;  1M5H A;  3DOL A;  2CQB A;  3RAM A;  3MI7 X;  2YVS A;  3JTP A;  1DY3 A;  1H7X A;  4DSK A;  4P72 A;  4J9V A;  3J7Z 5;  3R5C A;  3UQS A;  1CJV A;  1FDB A;  1U6B A;  4CIO A;  4X4U A;  2FPH X;  3D0I E;  1IR1 A;  1BD6 A;  1VRU A;  1JJH A;  5HMX A;  1HBM A;  4MT1 A;  4KPC A;  4NLP A;  2W4C A;  2CWK A;  2B8P A;  5J2Q B;  1UPM B;  3ZZ0 A;  4HDH A;  2M8H A;  4EZ6 A;  2YPY A;  3ITH B;  1S9G B;  4URQ U;  2MB0 B;  1U2F A;  1VQ4 S;  3UW1 A;  3FZB A;  1HMV B;  3I5B A;  1TKT B;  2EKY A;  4DEZ A;  2VBW A;  5DZ6 A;  4DS4 A;  4U9R A;  1WC5 A;  3OJS A;  2XY6 A;  2EBE A;  1YG0 A;  2B6A B;  4FXW A;  3ZZY A;  1JLC B;  5HRO A;  3CJ2 A;  1BY9 A;  3O44 A;  2DHS A;  2AX1 A;  2HK2 A;  4DL4 A;  3CCM S;  4I2Q B;  5LMU J;  3H8Y A;  3GIK A;  4J9Q A;  2V4J A;  1N34 J;  4LQ3 A;  1I5O B;  3CJK B;  3TUZ C;  3K5N A;  1B0P A;  1Z1Z A;  2DGU A;  3V4I A;  2OPP A;  2FHM A;  3KLF B;  2I6W A;  2OEL A;  4IDK B;  1FX2 A;  4BC7 A;  1S9F A;  1REV B;  1N0V C;  4WYW A;  3RW7 A;  3GYG A;  2ASD A;  2A6M A;  1RTJ B;  1GH8 A;  4G1I A;  3ILI A;  4ZVE A;  1RK8 A;  5IWA J;  1F60 B;  2ZH5 A;  2DCL A;  2W25 A;  2J0Q D;  2HNY B;  3D0H E;  3L4B C;  3AQP A;  2R2S A;  1K9M T;  2HLU A;  3TZY A;  4WIQ A;  1F3F A;  5HQ8 A;  1HBO A;  1H7W A;  1FRJ A;  1VGY A;  2W9B A;  2JDJ A;  3KHG A;  3P8B B;  2YKM A;  3TO8 A;  2N7Y A;  1S72 S;  3IBC B;  4ITS A;  4LSZ B;  3WZ0 A;  2J8A A;  2D74 B;  4ZIV A;  3VVT A;  3QWP A;  3M2R B;  5IC4 B;  5H9E J;  3PRD A;  4FP9 A;  2BKP A;  2E5H A;  4NWB A;  1KVI A;  2GFF A;  5LM7 E;  4ECX A;  1O6X A;  4HYK A;  3OFH A;  3TX8 A;  4P75 A;  1DJ0 A;  1W7W A;  2VD3 A;  2JWN A;  1IWG A;  5KFQ A;  2UUA J;  5KT5 A;  1D3W A;  1RWX B;  1X9W A;  1F2G A;  1ZAX A;  1SCJ B;  1GXT A;  1RP5 A;  1C4A A;  2LEP A;  1LFP A;  3AB2 B;  3AD8 C;  3E51 A;  1C0T A;  1VOM A;  2GJI A;  1CQM A;  4U7C A;  4F7V A;  3T5H A;  4JV5 J;  4IRK A;  4ZLJ A;  2C3O A;  2AJ2 A;  1V5I B;  1ITP A;  2A3J A;  3OLB A;  1NH8 A;  2AV5 A;  1RAG B;  5D4N A;  1LWX A;  5B0A A;  2HAF A;  2A2D A;  1PC5 A;  1S12 A;  4K0K F;  2XMU A;  1R0C B;  1RLC L;  1U25 A;  4OZ3 A;  4DV1 J;  3OPK A;  2BQR A;  2YWG A;  4ATN A;  2E66 A;  5IQQ A;  1RWO B;  3LP2 B;  4PYA A;  4Y28 C;  3FCW A;  4I6A A;  3ISN D;  3FFI B;  2BAB A;  2D41 A;  4I68 A;  2DNY A;  4ECU A;  1C4C A;  1Y9O A;  3GR1 A;  2VUG A;  4X4S A;  4JYA J;  5DGB A;  4KB7 A;  1FEE A;  2IM2 A;  3O3L A;  2J0X A;  4PRF A;  1VQ6 S;  3X1L B;  2V4R A;  2BV3 A;  1X4C A;  4LRA A;  4DUT A;  2YNH A;  1DUR A;  5KFK A;  3CCQ S;  3DU6 A;  4NA1 A;  4CWB A;  3MMA A;  3Q24 A;  3QID A;  2GS8 A;  1VQ8 S;  3A8J A;  2RT3 A;  4R0E A;  4PUO B;  4FVC A;  2MGZ A;  4PPD A;  1FXR A;  1PG5 B;  2CG4 A;  2JOQ A;  3M32 A;  1FFG B;  4J9L A;  5FD1 A;  4ZVS B;  4RO0 A;  1X4G A;  4K4Z A;  3MXH P;  3M6X A;  2MLX A;  4JUZ A;  4C8K A;  4UUX A;  5FDL A;  3AY0 A;  2B4P A;  4DLE A;  1T05 B;  5DS7 A;  3MPY A;  2M70 A;  2LA6 A;  5J2N B;  3AXK A;  4DHV A;  1U1R A;  2AGO A;  2ZNY A;  1SB6 A;  3KJN B;  1Y0H A;  4MIW A;  4K5R A;  1U1L A;  3BKF A;  3Q2S C;  2I5J B;  4I69 A;  3A13 A;  5D0G A;  5AE1 A;  1N8R T;  2F9J A;  1YVF A;  4USV A;  1WHX A;  4KJI A;  2W2P P;  4ERD A;  1RTH A;  3NRB A;  3FBC A;  2HHU A;  2HVE A;  1SIW B;  3UCU P;  4WZM A;  3VV2 B;  4WP9 A;  1NDL A;  3THP A;  5D3G A;  3NMA A;  4TY8 B;  2OPS A;  4ID8 A;  4CLU A;  2FVC A;  4QR1 A;  2GVD B;  3DRY A;  4N47 A;  4RBV A;  3BGL A;  3R6L B;  2Z2L A;  5KG5 A;  2GC8 A;  2B7C B;  4C7Q A;  1RBO B;  4F36 A;  4R8U A;  3AOA A;  2M52 A;  3KLI A;  2G2Y A;  3AJD A;  5CD4 H;  4IH5 A;  1G1X A;  3HHL A;  4QR2 A;  4W90 B;  1G3O A;  1ZPV A;  4O3O A;  3CCZ A;  4OZ0 A;  1BGX T;  1LW2 B;  3AQO A;  3ZTP A;  4LF6 F;  3DOM B;  2NUU G;  2I0X A;  2IY5 B;  1UJ5 A;  2RRN A;  2W9A A;  3GJQ B;  3W66 A;  3QLH B;  5ETV A;  2ASL A;  5EUH A;  1CS4 A;  2A2C A;  3VAL A;  4IR1 A;  2AWZ A;  3GLJ A;  4OI6 A;  3POT B;  3BPD A;  3MM7 A;  1IKY B;  4K5S A;  5IQ6 A;  4M5K A;  4CH7 A;  4X4P A;  3VGV A;  1KQS R;  4MYT A;  4P52 A;  4WWS A;  1FTR A;  2NUH A;  1QD1 A;  1RT7 A;  3EDQ B;  1HI1 A;  3C6T A;  1WEL A;  4F2R A;  3P6Y C;  2GIR A;  4U95 A;  1B0V A;  2RD5 C;  4ZVP B;  4ECR A;  3HD1 A;  2DBB A;  4J90 A;  3RGI A;  3OT9 A;  1OYE A;  1NK0 A;  2CUY A;  1U02 A;  2NPI A;  3O8W A;  3FRZ A;  5CH7 B;  5F9L A;  2B8Q A;  4JI8 J;  1TL7 A;  2DEI A;  4B3O A;  2RHS B;  1X4A A;  2HVD A;  2MKJ A;  1RE1 B;  5F0U A;  2J5A A;  3OTB A;  3TOQ A;  4N8O A;  3HKZ D;  2NRE A;  3GSI A;  3T5J A;  1IJE B;  2CQP A;  1PCA A;  2IMW P;  4JI5 J;  4MMO A;  3A8E A;  1HQU B;  2GNK A;  1KNZ A;  4MK8 A;  1GQE A;  4PYD A;  4DV7 J;  1KWM A;  4DQQ A;  5DZ7 A;  3NAH A;  4M8L A;  3KYL A;  3I9V 9;  1LEO A;  1CPZ A;  3MEE A;  2JEG A;  3I82 A;  1N33 F;  3DLB A;  4KQZ A;  4AL5 A;  3TA1 A;  1YRU A;  3FNN A;  4WKY A;  1FWK A;  2DHA A;  4Y2A A;  3KWM A;  2J76 E;  1HBU A;  3K5M A;  5ETP A;  5GAH U;  3KJV A;  4G1Q A;  1AFI A;  2DRD A;  2FJW A;  3M8P A;  1NSQ A;  5F0W A;  4I6Y A;  1JJ2 R;  5A0Y A;  2H54 B;  4PZV A;  2CRL A;  3EZO A;  1K47 A;  4I7F B;  3SSR A;  3RB3 A;  4UT4 A;  2UXB J;  1RHM B;  2UV8 G;  1Q8B A;  2OD6 A;  4Z7Y A;  1MW7 A;  4RW7 B;  4UY8 5;  3CUL A;  4H4M B;  5AXL A;  2XI3 A;  1SQF A;  4PXE A;  4YQW A;  4AND A;  1SH0 A;  4PG7 A;  1HYS B;  3BGU A;  1WG4 A;  2MQQ A;  1RT4 A;  1V3R A;  4DL0 C;  4R5P B;  2WRM A;  3BGO P;  1VC0 A;  4QW8 A;  5BXI A;  4E8U A;  3K58 A;  4CTA B;  3AJ1 A;  3TA2 A;  4KT0 C;  3NGR A;  4ZPD A;  5FLX U;  2ZDO A;  4Y6I A;  1HI0 P;  4X64 F;  3O6Q A;  3VAG A;  2HMI B;  3D7S B;  3QJL A;  4OL8 A;  3DRR B;  3AAW B;  5HQM A;  4P73 A;  2R3V A;  1ULR A;  2XYG B;  1T9Y A;  1NDK A;  2FVS A;  2VC1 A;  3L09 A;  1UEU A;  4LSL A;  1EET B;  3W8P A;  4AQY J;  4PG8 A;  4F8R A;  3D68 A;  4DR7 J;  2EFG A;  2D3Z A;  2BW2 A;  2MY7 A;  3H0P A;  1RTD A;  1QDU B;  4IOA Q;  2NQP A;  2HBY B;  2GZO A;  4QIE A;  1FVQ A;  3V6K A;  3HSZ A;  4MK7 A;  3OVB A;  1G4C A;  2CNL B;  3CGI A;  5DGA A;  3K7R A;  2Z4P A;  5U47 A;  2BE2 A;  2KB2 A;  2VHG A;  2ZH2 A;  1CUL A;  4B3T F;  3QJJ A;  1BMQ B;  3N5B A;  5CCM A;  4DR2 J;  2CQ1 A;  3H25 A;  4DCP B;  3TJ8 A;  4ZP8 A;  3Q23 A;  1XMQ J;  3R5A A;  4NRT A;  3PX4 A;  5HAN A;  4ZP7 A;  2W2Q P;  3PZP A;  3CF5 Q;  4F2S A;  4LBH A;  3M30 A;  3H5S A;  2X3D A;  5ETM A;  2QJ3 A;  3IWL A;  3WIV A;  2EFO A;  1FNO A;  2R7Q A;  4ZCK A;  4RWW A;  2QE5 A;  1SC3 B;  3M05 A;  1WTF A;  3UDC A;  1ZZN A;  2YQ1 A;  4OZ5 A;  4RZR A;  2V8V A;  3ZZP A;  3DHX A;  2ZJP Q;  5DLG A;  1Q4R A;  2FGC A;  3CD6 S;  1IKX B;  3SI8 A;  4CT8 A;  2XO6 A;  4DR6 J;  1WC4 A;  2GIF A;  4CO2 A;  2HFN A;  1RAI B;  4WBF A;  2RU3 A;  4OX8 A;  4ENO A;  4QWD A;  2IM3 A;  2RVJ A;  3Q2T C;  2B3T B;  3T1Y J;  4LF4 F;  4DDF A;  2ALZ A;  2FUG 9;  4Y34 A;  1AZS A;  2CQ4 A;  2YQ0 A;  3C16 A;  2M8D B;  4F50 A;  1YJW S;  2HWI A;  4NXM J;  4ANE A;  2EK6 A;  4USU A;  1HAR A;  4JP8 A;  2FHO B;  1FVS A;  2GIQ A;  3E01 A;  2ZH4 A;  3CCT A;  3MEK A;  4QWA A;  4KPY A;  4PXD A;  3QGH A;  1C1C A;  4RW6 B;  2VG6 B;  3UVJ A;  2W4D A;  4F4X A;  4YY3 F;  2HNZ B;  4OMF G;  4NEZ A;  1X9S A;  1FK9 B;  2WK4 A;  2WCX A;  1FFW B;  4ZOS A;  1S6P A;  4P6Q A;  1NPR A;  2JLG A;  3KUH A;  3C3L A;  2R9L A;  4F67 A;  1IKW B;  2BJ3 A;  4DPO A;  2ILY A;  4JOU A;  2IJR A;  3DXB A;  3VCD A;  3MTK A;  3N79 A;  2JEI A;  1RWV B;  2YKP A;  2PD1 A;  2VQF F;  4HT7 A;  3JTN A;  4ER8 A;  1REG X;  1HLW A;  1M5V C;  2QLX A;  2VG5 A;  3BO3 A;  4Y00 A;  3HZG A;  3J7Y U;  2D3O R;  2R7O A;  2JLE A;  1JLE A;  4X4R A;  3KLG B;  4LFC F;  4ILM A;  2PN6 A;  3R7S B;  2DH7 A;  4Q0B A;  3FQK A;  4CRJ A;  2F1F A;  3DRX A;  1WWH A;  2QX0 A;  1HD0 A;  3TYT A;  2BJD A;  1GXU A;  4LT6 A;  2AIR B;  4HT5 A;  2GA7 A;  1ZPW X;  2W8K A;  3N4W A;  5BYQ A;  1U8W A;  1AUS L;  2A6O A;  3LWM A;  3CCR S;  3DN9 A;  1JLA A;  3ZZR A;  4IKA A;  1VQ7 S;  4ZHR B;  1KFD A;  2I8E A;  3T41 A;  3LP0 B;  3GE9 A;  2KHC A;  4JI4 F;  3G6Y A;  4MIB A;  1VRT B;  3EZ5 A;  1WNE A;  2ZM6 J;  4WTY A;  1P8G A;  1ZAV A;  2HHW A;  4YME A;  3QGI A;  1F6T A;  3G82 B;  1OY6 A;  3SDE B;  2DNM A;  2YY3 A;  5CXT A;  4G65 A;  4LBP A;  1NK6 A;  4ZCL A;  2A18 A;  4F4Y A;  2VIC A;  3OSN A;  2N4C A;  3QQC D;  1HNX F;  4N77 A;  3T5K A;  1RWW B;  2B7B B;  2RQM A;  3HK2 A;  3T1A A;  1SBR A;  5HL7 Q;  5JVH Q;  3RAQ A;  2FZG B;  4J9S A;  1DFD A;  3ENA A;  3DLK B;  2VQE J;  1VDH A;  3MED B;  1YX2 A;  1JXE A;  3H90 A;  3CC7 S;  1MMN A;  2LXF A;  2IRX A;  2CJY B;  3EXC X;  1RCX B;  2V50 A;  2CPD A;  4EBC A;  4FXV A;  4KGM A;  4RKU C;  1FRL A;  1FJC A;  4LRB A;  4K59 A;  4OZ1 A;  4OX7 A;  3IR5 B;  2HND A;  4N7T A;  3QT8 A;  1YKW A;  1IQT A;  4IQM A;  2GQQ A;  4QJV A;  1NME B;  4WFB Q;  2GHP A;  2GQ2 A;  4B08 A;  3I31 A;  1S1T B;  1RT1 B;  3TVY A;  1G2E A;  1TUG B;  1NBE B;  4LR7 A;  3DOL B;  2MHN A;  2WW4 A;  2EFP A;  2IRY A;  2UVR A;  1Y10 A;  3B78 A;  3C6U B;  5C25 A;  1QSL A;  4A8F A;  1FHT A;  1RWU A;  3NXZ A;  2B9W A;  1UP1 A;  2IRU A;  1F5C A;  4JI2 F;  1KRP A;  3EDR B;  5A6P A;  3AD9 C;  1NSK L;  3QAT A;  4AXI A;  1ACM B;  2MTL A;  3MTJ A;  2HAI A;  2RQ4 A;  3WQP A;  4USM A;  3KK3 B;  2ZHB A;  3RAX A;  2OHD A;  1PGZ A;  1UVL A;  3B82 A;  3SSQ A;  5C42 A;  3GIM A;  2YKN B;  2YNI A;  1FXD A;  2AYG A;  2CA9 A;  4RU2 A;  2ZZT A;  2MLY A;  1LXJ A;  3M9O B;  4QR0 A;  3JAM Y;  5DDP C;  4Q8E A;  2W01 A;  1B70 B;  3OL6 A;  2X7I A;  1NPP A;  4QIV A;  2KRR A;  1U6Z A;  4LMZ A;  3VAF A;  1HIY A;  4C8O A;  1XBW A;  4C11 B;  2ZZM A;  1VHF A;  1UAW A;  4FYY B;  2G0J A;  2DGW A;  1MU2 A;  1TL5 A;  4NYO A;  2E9T A;  3THT A;  4PEO A;  4WKR A;  4NZ0 A;  4M95 A;  2GHW A;  1SQE A;  1WKL A;  2C2O B;  1RQ0 A;  3QZ8 A;  4QIF A;  2CG8 A;  1OPZ A;  2YWK A;  4G6V B;  2CYY A;  3LAM A;  2BW7 A;  1GMV A;  2R7W A;  2E5L F;  1VBZ A;  2AD9 A;  3OR2 A;  5HBM B;  1WSV A;  3HVT B;  1HPZ A;  2EKN A;  1XEZ A;  4MKV A;  2RF2 B;  1HBO B;  1VBK A;  1IKV A;  1BUX A;  1NKE A;  4CM0 A;  1WD6 A;  3HVR A;  2XNQ A;  1AUD A;  5J2P B;  2UZA A;  4RNO A;  5EGY A;  1FDN A;  1R8H A;  4OJH A;  1P9Q C;  3K59 A;  1ROF A;  3AJ2 A;  5A8R A;  4JV1 A;  2FZC B;  5BR8 J;  2CAJ A;  3BDE A;  1ZZF A;  4DMZ A;  3KLV A;  4DQP A;  3KHL A;  2OML A;  2M9K A;  2JC0 A;  3QSY B;  5C24 B;  2HVH A;  2LQJ A;  2POK A;  4A4J A;  1AFJ A;  5ADZ A;  4M5N A;  5KFF A;  4LFB J;  3AA9 A;  4JI0 J;  2CQC A;  3M6U A;  3F41 A;  1CLF A;  1A6L A;  3FDS A;  4PWD B;  3FGV A;  1WEY A;  1NAQ A;  2X51 A;  3IBF B;  4DV4 J;  4A8O A;  1RT6 A;  1NJY A;  4MH8 A;  2J9D E;  3CJT A;  3W2V B;  3UN3 A;  2JL9 A;  4OZL A;  4X2B A;  4OYW A;  1N32 J;  2RDD A;  3P49 B;  2KT5 A;  1XNQ F;  3M2V B;  2HWH A;  2L3M A;  5K8N A;  2L41 A;  3I4P A;  5KT6 A;  3FMW A;  5D77 A;  5J2Q A;  3J81 U;  1Q95 G;  2XMW A;  2UUB F;  4NLQ A;  2DY1 A;  1N5Y A;  2CDR B;  3HSJ A;  3ITH A;  1S9G A;  2V8G A;  4ECW A;  5D8H B;  3PFO A;  2DR5 A;  3T9N A;  2EFV A;  1IR2 A;  2BQ3 A;  1K44 A;  4AYB D;  4PG6 A;  1UW4 A;  4EYI B;  4EU0 A;  4USH A;  2ADC A;  3GYN A;  3TQ1 A;  4YB1 P;  5EWG A;  2ZIT A;  3CO9 A;  4Y2M A;  2ZBR A;  3ZXW A;  2EI5 A;  3OVS A;  2FJD B;  2K3K A;  5AE3 A;  2KM8 C;  3ET6 B;  2VBY A;  3MFI A;  2W7A A;  2RDJ A;  2COL A;  4I2Q A;  3OUY A;  4AFF A;  1NHU A;  2VPZ B;  4OYI A;  3K5L A;  3VVU A;  3MMA B;  3BYR A;  3CJK A;  4XAK A;  3CC4 S;  2YXL A;  5DM7 Q;  3GCX P;  4B3S F;  3CCE S;  2FLN A;  1N52 B;  2MGZ B;  4IDK A;  4LRC A;  1REV A;  2I38 A;  2XMJ A;  4KV8 A;  3M32 B;  3PKM A;  1RTJ A;  5L1I A;  4Q43 A;  2LXU A;  2DD8 S;  1U7L A;  2EG2 A;  1B3T A;  4B3M F;  8ATC B;  2OUG A;  4KR0 B;  5AXN A;  1SIZ A;  4WTO B;  2C2N A;  4PG5 A;  3M6V A;  2HNY A;  1X7V A;  4M63 A;  1XR5 A;  2XMT A;  3QAE A;  1FJG J;  2H48 B;  3TEH B;  4FPI A;  1B64 A;  1DTQ B;  3ILJ A;  2E9Z A;  2YKA A;  2BMB A;  3VQS A;  2E7X A;  2Z2M A;  3JYT B;  3W7B A;  2DPI A;  4FN5 A;  3I56 S;  1APS A;  2QTW A;  3F44 A;  2FB0 A;  4FXD A;  3GV5 B;  1TR0 A;  3OXF A;  5DM6 Q;  2ABY A;  4HI2 A;  4DV2 F;  1RAA B;  4GC6 A;  1RTH B;  2Z8Q A;  4DU7 A;  1HW9 A;  2DTJ A;  2VOP A;  1R0A B;  2BYC A;  2XS5 A;  3UFC X;  1RDR A;  3UN2 A;  3L9Z A;  5IXU A;  3Q89 A;  1UVK A;  4IUF A;  4ZJQ A;  3T9Z A;  1H0H B;  4KC5 A;  2Q43 A;  2L9W A;  5EWE A;  3OW2 R;  2GV1 A;  4R8U B;  4RWX A;  4QYZ J;  1HQ2 A;  3MCN A;  2JLF A;  6AT1 B;  3C8Y A;  4J9P A;  4WE1 B;  4DF4 A;  4DQR A;  1SKR A;  2J0S D;  4CLL A;  2QMU B;  4NLV A;  4KE5 A;  2D9P A;  3NGU A;  4F02 A;  1NZ8 A;  3IR7 B;  3SQG B;  1N0U A;  3EVW A;  2FVQ A;  4YB6 A;  5A2Q Y;  2DIT A;  3BO2 A;  5CYM B;  5HAO A;  2CNK B;  1VC5 A;  2XEX A;  2UUW A;  2A0F B;  1VIX A;  3PV8 A;  1S7H A;  1RT7 B;  3NCR A;  1RAB B;  4MFB A;  1M5P C;  2CPF A;  3LAL A;  1ZOT A;  3LP2 A;  1U48 A;  1NDP A;  1F9E B;  4KH1 B;  4DLG A;  3GIJ A;  2XLK A;  3V81 A;  4KTQ A;  2C2Z B;  2XSJ B;  3S1T A;  2JHE A;  1NZA A;  1TL7 B;  3D6F B;  3EGZ A;  4B3O B;  4DS5 A;  1FCA A;  4Q7A A;  3BYP A;  2HZA A;  3M8Z A;  1VQ9 S;  3W9J A;  2HHH F;  2MKK A;  3DLE B;  1T9T A;  5KG6 A;  2V6A A;  1Y7P A;  1TMM A;  2BEF A;  4DBQ A;  2R8H A;  3PY8 A;  1Q8L A;  3AA8 A;  2XCA A;  3QWU A;  2MKS A;  1K73 T;  3DYA B;  2LQ5 A;  1KHW A;  1YK9 A;  4DWI A;  4O44 B;  3QGP A;  3MEE B;  2E7W A;  3Q8U A;  1HNZ F;  2MQP A;  2JZ5 A;  2UV8 A;  4ZPC A;  4WFY A;  1T05 A;  3TZZ A;  1EP4 B;  5J2N A;  3H2L A;  3MCO A;  2DXE A;  1RUS A;  1XER A;  1IVZ A;  4C48 A;  5IOL A;  1BQM B;  3ELH A;  1BWV A;  4RNH A;  2ZVS A;  3KJV B;  4G1Q B;  3R5J B;  5D4O A;  1PAE X;  2PEH A;  3KHH A;  2QL5 B;  4ED3 A;  1HHS A;  3QGG A;  3OXL A;  1Y5N B;  1TL1 B;  4LF1 A;  3AB4 B;  4YHH F;  5CHC B;  4TY8 A;  4NLO A;  4EO8 A;  4H4O B;  3W5Z A;  1XIQ A;  4ZN1 A;  2GVD A;  2ZH7 A;  2AF6 A;  2IYG A;  4OHW A;  1JLB B;  3H5X A;  4O3Q A;  1S1W A;  2BQU A;  1JLG A;  4CI0 B;  2KFN A;  1NSP A;  5CAB A;  3JQJ A;  3WC0 A;  3RTV A;  1PJ6 A;  1LFW A; 
#chains in the Genus database with same CATH homology
 4M5K A;  3MCM A;  3QBC A;  5ETV A;  4M5J A;  1EQ0 A;  3IP0 A;  3HSG A;  5ETQ A;  3HT0 A;  4M5N A;  3UDE A;  1HKA A;  4CYU A;  1KBR A;  4CRJ A;  1EQM A;  4M5G A;  5ETL A;  4AD6 A;  1RU2 A;  1RU1 A;  5ETM A;  3KUG A;  4PZV A;  1TMJ A;  2CG8 A;  3UD5 A;  1IM6 A;  5ETS A;  2QX0 A;  3ILI A;  3HCX A;  3UDV A;  5ETO A;  1EX8 A;  4CWB A;  5ETT A;  3KUH A;  5ETK A;  1HQ2 A;  3HSZ A;  3MCN A;  5ETP A;  3HSJ A;  3ILL A;  4M5M A;  1F9H A;  4M5L A;  5ETN A;  5ETR A;  1DY3 A;  1RB0 A;  1G4C A;  3ILJ A;  2BMB A;  3HD1 A;  2F63 A;  1RTZ A;  2F65 A;  1TMM A;  4F7V A;  3ILO A;  1Q0N A;  3HSD A;  4M5I A;  3MCO A;  1RAO A;  1CBK A;  3KUE A;  4CYU B;  4M5H A;  3HD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...