1F9QA

Crystal structure of platelet factor 4
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
64
structure length
64
Chain Sequence
b'DLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-Type Reveals the Epitopes for the Heparin-Induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 8
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9qA00
2XIWA 1NR2A 1ESRA 2FHTA 5CMDA 1HRJA 1IL8A 1KNAA 1TVXA 2X6LA 1VMCA 3I91A 4ZAIA 2B2TA 1AZQA 1HA6A 1F9PA 1WTXA 2HCCA 3FPUB 1IKMA 1GUWA 1JICA 1NCVA 1ZXTA 1MI2A 4IUPA 4XDXA 5D65A 1PLFA 1QE6A 2L12A 4HSVA 3DM1A 2VXWA 2JYOA 2R3ZA 3I90A 5JJZA 2KEDA 1RHPA 3FDTA 1RTNA 1O7YA 2FFKB 2J7ZA 2RSOA 4IUQA 4RA8A 4ZK9B 1WTRA 1WD0A 1BBXC 2HDMA 1E0BA 1PFNA 1VMPA 2RA4A 1NR4A 1DOMA 3MTSA 4XT3B 1WTOA 1F9SA 2K05A 3DEPA 2B2WA 3MWYW 1HFNA 5CORA 1B3AA 1RODA 2FJ2A 1B53A 3DEOA 5T1IA 2B2UC 4CJ1B 1ICWA 2B2VA 3KBXA 1LV9A 2BDNA 2HUGA 2MP1A 4IUTA 5E4WC 2EE1A 2K04A 3UI2A 1ILPA 3QO2A 1C8CA 1J8IA 1G2TA 5D14A 2RSNA 4O42A 3GV3A 1QG7A 2B2TC 1F9QA 4RAUC 5CBAE 4HEDA 5E4XA 4X3UA 1U4MA 4ZLTF 5AFWA 5COYA 1CA6A 2M2LA 1EQTA 3IFDA 2Q8RE 1CA5A 1SDFA 1U4PA 4IUVA 5EPJA 1DZ1A 4ZKCB 5DNFA 1DOKA 4MHEA 2K03A 3TN2A 4R8IA 2L11A 2KVMA 1HHVA 4U68A 1X3QA 1MSHA 4CJ2C 3ONAB 1MGSA 1BO0A 1HUNA 1HUMA 2N88A 1S4ZA 1KNEA 1MSGA 2B2WC 3KUPA 3P7JA 1DONA 2RVLA 3I3CA 2L4NA 1PFBA 2X69A 3H91A 2MGSA 2K01A 2Q8TA 2NZ1D 1X32A 3LWEA 1AP0A 2L9HA 3I8ZA 4HCSA 4QUFA 5EJWA 4HAEA 4LMQD 4X3SA 2JP1A 4IUUA 1CM9A 1HFGA 1QNKA 2B2YA 1B2TA 3IL8A 1WTWA 4IURA 5EQ0A 3R93A 5EPKA 1PDQA 1ILQA 1F9RA 2MJ8A 2MPMA 1JE4A 2HDLA 4DN4M 5EKIA 1EL0A 1SSOA 3HP3A 2X6GA 2L1BA 4R9WA 1NAPA 1RTOA 4XT1B 1G6ZA 2H1EA 1BNZA 4X3KA 1BF4A 4ZKBB 4NW2A 2EOTA 1WD1A 2DY7A 1J9OA 2KECA 3D6WA 1U4RA 3TZDA 1B4OA 2B2VC 4OIKA 1G91A 3G7LA 2K1BA 4CJ0B 4MN3A 2KOLA 5T1GA 1G2SA 1M8AA 2FMMA 2D9UA 2KUMA 1U4LA 1PFMA 1XX8A 2KEEA 2NWGA 1O7ZA 2B2YC 5EPLA 1IKLA 1O80A 2HCIA 2DY8A 3Q6SA 4OIJA 1WTPA 1ML0D 2N55A 2EPBA 4QUCA 4RWSC 4X3TA 1F2LA 3GV6A 3SVMA 2K28A 2SDFA 1WTVA 1EIHA 1RJTA 5CBEE 3N52A 1WVLA 4UAIA 1B50A 2NYZD 3F2UA 1AZPA 1WTQA 1XYIA 1Q3LA 1EIGA 2FINB 2B2UA 1A15A 2CVRA 1EOTA 1DOLA 1SAPA 2IL8A 1X3PA
chains in the Genus database with same CATH superfamily
5EKKA 4S3SA 4EGVA 2N78A 3D3RA 3TQYA 2LXKA 3S1RH 4UPAA 3EN2A 4XYQA 2QILA 4DF7A 5ELCA 3EVQA 1TY0A 3I90A 3H3VI 2HQEA 4KKTA 1FGBD 4A3DG 2F0VA 4HMJA 1XWEA 1GUSA 2E2DC 1L0YB 5IWAQ 2XWBB 2D0OA 5T1IA 3HOXB 5IP7G 3MXNA 1CI3M 4A3JG 2ID0A 4EQNA 2AUJD 2Z8LA 2B2TC 2CWPA 3M4YA 3A55A 3I70A 4NDXA 5CBAE 4X3UA 2M00A 1CA6A 5IYCG 3LX0A 4QF4A 1V9PA 2ZT9C 3CPWA 3S1MH 3RN5A 4DV3L 2MHVA 1Q86C 4LF9L 1HHVA 1BCPF 1HR0Q 3KBGA 4UHVA 1KABA 2JQOA 2QA4A 1GJXA 1MGSA 2CFMA 2KHSA 1I6HB 3WOEA 3KUPA 1VQPA 3EIVA 4DUZQ 2F4IA 3OPOA 3RLNA 1X32A 3P1HA 4PG3A 2EY1A 4APVA 1I94Q 4GNXC 3ULJA 2BH2A 1C7YA 3I4NB 4A3FB 2PI2E 3RZOB 1JR0D 1WTWA 1VF7A 1PTOB 4B3SQ 4KJOA 2L5TA 2OXPA 2EYLA 4DV7L 4JOIA 5HY6A 1PH7A 5DLQE 4KK7A 3RZDH 3HOUH 4X65Q 1SNDA 5M5YB 3E0JA 2X6GA 1K8MA 2Z4IA 2B8FA 2NTTA 4OHJA 4JC0A 4XT1B 5FJ8G 3BZKA 1PTOD 4KY7A 4X3KA 1BF4A 1J9OA 2UXBL 4H44C 5I6WA 1MKHA 3NENA 1WTHA 1JORA 4LFCQ 1RKNA 1PMRA 3PO3H 4EQ5A 3T16A 2JA6B 1AZPA 3FP9A 2PMZE 1WTVA 2HIVA 1WVLA 3K59A 1IHZA 3PUYA 4DR7Q 1K3RA 5IWAL 4ZCKA 2FINB 1MHWC 4BBRH 1X3PA 1S5DD 1ESRA 1XMQQ 4LNQA 1K83B 3SR1A 1UE1A 3MC0B 4J1MA 1VQ8A 2HCCA 1JICA 1TS2A 1EWIA 4XDXA 1S5CD 1PLFA 1QE6A 2RQXA 3M7GA 4JV5Q 1D8LA 2E75C 4LK1C 4A3BB 2RSOA 2NTSA 3HOYH 4KTAA 3T4AC 4AQYQ 1U0LA 4GLAC 2Z4HA 2XGTA 1HR0L 1GKHA 2B2WA 2L55A 1QJOA 1RODA 2F3VA 4YCWA 1IZ6A 4HJ8A 5J22A 4DUZL 4Y52H 3KLRA 4LF5Q 1QILA 3H0GB 3ERSX 4RAUC 2V4DA 1VQFA 2UXCL 2CH4A 1EQTA 1CA5A 1QNUA 3CQZB 5C0XH 1SYCA 4B3SL 4L8JA 3J7A5 4X65L 5M5WB 3B6YA 1XTDA 3CW2C 1Y1WG 3LNNA 3KYHC 3MHBA 3C1EA 1FVIA 2NZ1D 2XN9C 4A93H 1I50B 2A6ED 1VQAA 1STHA 3V05A 2Z6KA 1XTCD 1CM9A 2IW3A 5CYUA 3GTOH 1BXTA 1EWHA 2WV6D 1LYLA 3EFXD 3FKIH 4YHHQ 3IL8A 3SGIA 3NP8A 1F2YA 3JC66 4WJ3M 3BZDB 4QY7A 5JPNC 2SNSA 2NN6H 5JEAJ 1CKMA 3T51B 3HKSA 4DR7L 4C3IH 4LF7Q 4P73A 2JA7B 4L6TB 2E5LL 3TRZA 2R93H 4G57A 1U4RA 2ICIA 1XMQL 2QW7A 4OIKA 1NSNS 3J81i 2AKWB 1KHIA 1M8AA 2KUMA 4IFDJ 5IYDH 1GUGA 2KBNA 1B7YB 3LWUA 1QVGA 4JV5L 3TS0A 3KDFA 3VYRA 5C5LA 1EQRA 1GHJA 3VYUA 4UAIA 4FYDA 4AQYL 4QGUA 3PO2B 4DR5Q 4GKKL 1Q3LA 2F0GA 1SXTA 1TWHH 3KK7A 1KXLA 1NR2A 2OQKA 2H5XA 2YV5A 5C3WA 4ZAIA 1WCMG 4LF5L 1I4QA 4JI0L 1E24A 3SK8A 3GTQH 1FNVA 4A3DB 2B39A 1CQVA 4IN3A 4POFA 3ZYYX 2DJFC 5A2QE 5IGGA 5FO9B 5I9OA 4XYOA 4GZYC 1HCZA 5KGUA 1ENCA 3MTSA 3HGBA 3OIPA 5FLMH 1VQ5A 3R2IA 2PQAA 3KLSA 4R4IA 1D2BA 4HCEA 2K4KA 5C6AA 3I4LA 1TS5A 3FRPB 2WAQB 3IFTA 4O42A 1KRTA 4KD4A 2JK8A 3CCVA 4HJ5A 1L1OC 5IGCA 4JBKA 5M3FG 4QIWE 5CV5A 2YU9B 5EKLA 5JAVA 3K7UC 3FHWA 3TN2A 1M1KC 1A8VA 1F77A 2UXDQ 2O5JC 1AE3A 4B08A 1VQKA 3I73A 4LF7L 1J5EL 5LL6S 2L4NA 4A93G 4BBSB 1T5XD 4FVMA 1X3EA 4I65A 4NKLA 4FXKC 4DK6C 4DPGA 4N8X1 4N8FA 3FKIG 5D3IB 5LMNW 4GOPA 3HOXH 1X3GA 2KCCA 1ILQA 2A68C 2NN6G 3NBHA 4GNXB 1SSOA 2VZAA 4CHTB 1SNMA 4PZ7A 4IPHA 5DM63 5KIXA 3F2DA 1Q81C 4KKSA 1X3FA 1NJIC 1X65A 1M4VA 2NVYB 4CJ0B 2BH8A 1EEFD 4A3IB 3NWSA 2BOSA 4K8IA 1TY2A 1IKLA 4OIJA 1K9MC 3GO5A 4KHZA 4HR7B 3J81c 4L5QA 5ELEA 1OXTA 3RR5A 1P8LA 1VQ7A 3PSIA 1KLGD 1X56A 4A3FH 3RZOH 3VR3A 3UDGA 1E1OA 1PTOH 2LSSA 4ZUIA 1FR3A 4I7ZC 3MXGA 5FOBB 3S2HB 4YIJA 1F9PA 4ME5A 4RKLA 1NCVA 4BA1I 3P20A 4NB3A 4RGNA 4FNFA 4C1NI 3J7ZC 1I4XA 2ZTDA 1N33L 5JOBA 3PUZA 5CC4A 2JYOA 3PIO3 1H9SA 1HTLD 1RTNA 3PGZA 1HXYD 4KN7C 1PV4A 4TKOB 5FLMG 4H02A 1HZ9A 2KCNA 3NUCA 2UXDL 3QR8A 4N9PA 3TP8A 2JA6H 2B2VA 1TXYA 1B3QA 2UUCQ 4IFDI 4DAPA 2RSNA 3K6OA 3URYA 3GTLB 3J7AF 1IW7C 3CCLA 2XTIA 3ND8A 5E4XA 1U4MA 2K50A 2WB1G 1LM0A 2IPKD 5DM73 1K83H 3U9SA 1PH9A 4LF6L 1SMXA 4JPBW 3M4OB 2L11A 3D31A 2WB1E 3ONAB 1WOCA 4HN7A 1S4ZA 4X64Q 4UDUC 1DONA 1Y14B 4OO1I 2RVLA 1AE2A 2X69A 2R92B 5EBCA 2K75A 2HD3A 3U4VA 2SOBA 4JI1Q 2VW9A 1PYSB 1KTKA 4X3SA 4JI7Q 3EJIA 1TWFH 1V1OA 3NE5B 2OQ0A 2G9DA 3E5SA 4Y7NB 3A56A 2O5IC 3CD6A 1SNCA 1EY7A 2UUBQ 3R93A 4RCNA 1PDQA 5EPKA 4C1NK 4KHPQ 2K33A 5M3MH 1IBLL 1CQFA 3OMGA 4LFBQ 1EQQA 1N34Q 3UE0A 2VQEQ 3CQZH 5IGBA 1JMCA 2KECA 5IE8A 4A3KB 2IJ0A 5M5WH 4DV5Q 1LT3D 2M9VA 3VA7A 3TSSA 3BU2A 1HZAA 1LTRD 2K32A 5C44B 3Q6SA 4P2CB 4KV6A 2K28A 1K0RA 4JOIC 3I4NG 4A3FG 3OWFA 1GUTA 3N52A 1I5FA 4L5RC 4FF1A 3BJUA 4YWKA 2AQ1B 5K36H 1MJCA 3TS2A 1KRSA 1GUNA 2KQ3A 1D5XC 2ZM6Q 3S1NH 3K5NA 2D0PA 1KD1C 2RCFA 2JA7H 1TT2A 1Z7TA 5J3BA 3CCRA 2UU9Q 1TR5A 4DK1A 1PYBA 3H3VC 4G7ZC 4QIWB 1WTOA 2OTLA 3EA6A 2NVTH 1YITA 1YJNA 2JA6G 2EYOA 3F2BA 1D1KA 4A3MG 4POGA 4H13C 4EVOA 4DK3C 3GTJB 1N36Q 3RMHA 1PH5A 1MJEA 2DGYA 1VDZA 1EY4A 3WDNA 2K7VA 3CXCA 3A74A 5M5XB 1U4PA 5EPJA 4ZKCB 1FJGL 2XRQD 4C3HG 3TZUA 4JYAL 3ITPA 4RH6A 1L1OB 2E8GA 4F8MA 4IPDA 4A3DH 4LFBL 4A3BG 4G7OC 1KNEA 3P7JA 2B2WC 1H9JA 4RHSA 1N34L 5HGQA 3FEWX 2VQEL 1GD7A 4FXDA 2N3SA 3LWEA 5KEEA 3I8ZA 4HCSA 4OL7A 4LMQD 1QB5D 2F0FA 4UP7A 1DGSA 1QNKA 1QWYA 1N32L 3AU7A 3D6CA 2A8VA 1IBMQ 3CPFA 3H0GG 4O2DA 5IYCH 2KA7A 3BDLA 5NUCA 1Q1BA 1JWMD 2SNMA 1Y1VB 5ELFA 5GAEC 2YU9H 4NW2A 3A5ZB 4DV6L 2OT2A 1G91A 3OSOA 4A3LG 4CKEA 2RDHA 2ZM6L 2D9UA 4X66Q 1SFOB 2KEEA 1I4PA 2A68D 4DV2Q 1QCBD 5C4JH 1KAAA 3P75A 4QUCA 3UE1A 2CCZA 5ELOA 3NQIA 1SE4A 2UU9L 4DV3Q 5GROA 4HTHA 4RGMA 1ONLA 5JJLA 4AYBG 1WFQA 2VQFQ 2LY7A 1DOLA 3EQLC 2PW7A 5FJ8H 5BN3A 3KOJA 1VF5C 1IL8A 3J81L 3TP7A 3PMFA 1HA6A 1B44D 4AYBE 5IGEA 1WTXA 1K28A 2JA7G 2K5NA 1ZXTA 2WFWA 5D65A 1SYDA 3TP5A 5K5PA 3BDCA 1KAWA 4DV7Q 1SE3A 1PRTF 1VMPA 2NVYH 1DOMA 4A3IH 3S2DB 1FYCA 1F9SA 2K05A 1XPUA 3I7FA 2B63G 3DWAA 4C3JB 1PH4A 5CR3A 3W1GA 1GVPA 1TIID 3GTPH 2WB1B 4HIOA 3UI2A 1J8IA 3PO2G 1OXUA 1BDOA 3VR4A 4AH6A 4K5WA 3L2PA 5C3EB 2E2JH 4NXMQ 1DZ1A 3KF8A 2AUKA 1IBML 3S2HH 1IYVA 2G5DA 4X62Q 3AMUA 1MSHA 4CJ2C 1HUNA 2JJQA 3NWTA 3Q24A 1VQ9A 1MSGA 2F0DA 2H4OA 3L3OC 1BBUA 3K7AB 1IW7D 5EJWA 2RHQB 5E1FA 1CZWA 2F03A 3HRZC 2B2YA 2F0TA 2F0NA 2EZVA 4X66L 1OXVA 1V8QA 2WAQG 4DV2L 2F4VQ 3U58A 3MXNB 3GTLH 3GQBA 4HSPA 5EKIA 3V96A 2AHOB 1EY5A 3X3NA 5I2YA 1EL0A 5G3LD 3PIP3 5FO8B 3H6MA 3ER0A 2WAQE 2H1EA 3O13A 1Y1WH 2VQFL 4FF3A 4KY5A 4WFN3 2E76C 4OGQC 4B3ML 1I4HA 3M4OH 2BA1A 3CCEA 2QDBA 3EBEA 4BY7B 4M1UB 3HOWB 1A63A 3GTGH 4YY3L 1CKNA 4L5TA 2UXCQ 1XX8A 1YBYA 4WJWA 4BBSG 4C2MB 4GOPC 5KRUA 1HRJA 3FVQA 2DY8A 2R92H 1HNXQ 2NZOA 4KD3A 5CV9A 2NB0A 3U50C 1JC7A 1UEBA 4QQBX 3X3MA 4J6HA 4Y7NH 5IOCA 1JJCB 2B2UA 2TMPA 3K81C 5H1SE 5JJZA 1O7YA 2AQ2B 2OTJA 1XJVA 3A7AB 1XNRL 1VMCA 4K0KL 2BCOA 1Z47A 3S17B 1G51A 1SJHD 4HIDA 1WI5A 1MI2A 3E6ZX 3VR6A 1K73C 4KJNA 3EROA 2KHIA 1BR9A 1D5ZC 2RDFA 1D6EC 1NTGA 3TEHB 3CMEA 4RGOS 3QB3A 1WD0A 3M3YB 2EDGA 2VUMB 4NXML 2GVAA 4A3MB 2A6HD 3DM3A 4A3IG 4DUYL 4X62L 4KHVA 4DR3Q 3DWPA 5BR8Q 4CBVA 5C44H 3A54A 2E5LQ 1E2ZA 2HUGA 2KENA 2NVQB 3HOZB 1YZ6A 1Y8PB 1A62A 4A76A 1HPCA 2RKSA 3GV3A 1SYEA 2QDLA 4EQOA 4LAAA 1WCMH 2RBMA 4C3HB 3GTKH 4A3GB 2CW0C 3J81E 1SDFA 2C9OA 1HR0W 3S1QH 5JEAH 2NUCA 2DNCA 4AIMA 2F4VL 2ENBA 1PTOF 4R8IA 1LTLA 1R9TH 4GKKQ 3BVGA 4LF8Q 1QZGA 2K52A 3UDIA 2LS01 5ISRA 3NBIA 1EFID 1CSQA 3BDOA 1B9MA 4IFDH 1C9OA 4JI0Q 2R7FA 3I4OA 3CCQA 1HFGA 2QEXA 4K5VA 2A73B 3GTJH 1TS3A 1D7QA 2GN5A 1WJJA 3PIOA 5M3FH 5CV6A 3PUWA 4JBJA 1CTMA 1HNXL 5GAGC 1ICFB 3M4QA 1YEZA 2F0MA 3I72A 5C4XG 1EYAA 2DY7A 1A3UA 1SYGA 1ET6A 3HS0C 2XNAC 3KJOA 1BUVT 1I4GA 1PFMA 3G4SA 2R92G 1EOVA 3CRKC 4IOAA 1FNWA 2CHBD 3MEHA 4R8NA 2HCIA 2JXMB 4AYBB 2AWNA 2K5VA 1F2LA 2DJGC 1M90C 1SJED 1YNXA 3G6EA 2LMCB 4DR3L 1V43A 1NMFA 1NUCA 2F3IA 3M7NA 4X6AH 5BR8L 1J5EQ 4HMIA 4JBWA 4MTKA 4DKAC 5EBDA 4IJHA 4V0BA 1VQCA 2Z6BA 4DR2Q 5KYLA 3Q22A 3FPUB 2HT1A 1JOKA 1Y1VH 4TQUS 5I9PA 4LUOA 3QOJA 1G6PA 4A3KG 4GS3A 1OXSC 2FFKB 2B63B 5J1ZA 1V1QA 3M85A 1NR4A 1Q8IA 5C44G 2FMCA 1YJ9A 5CORA 4LF8L 2JA5B 1B53A 2ZXPA 5CV7A 1QZHA 1EY6A 2R7ZB 4FF2A 3KDFB 4JBMA 1DM0B 4Q5VA 1ZEQX 3VR2A 3RLOA 3C46A 1B1ZA 1TWAB 2KJXA 4OEMB 4CGYB 1E22A 2PZTA 5COYA 1DCZA 2D62A 5JEAG 3IFDA 4L5SA 2Q8RE 2YTVA 1IBKQ 5L37A 1FGUA 1XMOQ 3UDXA 1VQBA 2A19A 1Q90A 4DV1L 4OELB 2EXDA 4JCVE 4G4KA 4IFDG 4IPCA 1HNWQ 2OF1A 1N33Q 2E2HB 4GKJL 2GVBA 2PQAB 4OWXB 4R4CA 4B9XA 2JA8B 1Q82C 2EVBA 2EY2A 2NZHA 2B8GA 3OMCA 3DWQA 1NAPA 1B70B 2J4XA 4OO1G 4RCOA 3OHXC 5C3EH 1A2TA 2PI2A 1B4OA 5HURA 1STGA 3G7LA 2EIFA 1TKWB 4DR2L 3PUXA 4MNOA 3VDYA 4NP5A 2IHEA 4PMBA 1LUZA 4HIMA 4L63B 1LT4D 4LF6Q 2V1CC 3GV6A 2D5DA 3K0XA 5IYBG 2MNAA 1X55A 4IALA 4O1NA 1I3QB 3K57A 2ZXOA 2WINB 4XIGS 1GXDC 5EAYA 2Q2IA 4GOPB 2UUAQ 1EY9A 1SAPA 2ASBA 3NBHB 1AZQA 3HOVB 1NNXA 4JG2A 2ZJPA 1KLUD 1Y1VG 3AEVA 4DR4Q 1STBA 1I6HH 3DLLA 4DV0L 3K80C 3QIAA 4YCVA 2IX1A 2C35B 1LT5D 1H9MA 1IBKL 3BS1A 1TS4A 1H9RA 2ZTCA 4BY7H 3MEFA 1SNPA 1SYFA 3TBIB 1IBLQ 3HOWH 1SN8A 2Q2TA 3I2ZA 4ZRZA 1XMOL 3I4NH 3PQIA 3VA5A 2E74C 1BKBA 4C2MH 3KF6A 3CCMA 2PNRC 3KBXA 2BDNA 4LW1A 5KNBA 1C8CA 4EQPA 5M5YH 2WKDA 5DEHA 2I5LX 1F9QA 3MA2B 4FO2A 1HNWL 1CKOA 4OWWB 2PNHA 1V1PA 3DUZA 4ZQ3A 4IUVA 2OWOA 3CMAA 1HJPA 2EXZA 1EYDA 3M4PA 2JA9A 1ET9A 1HUMA 1YNJC 4DNTB 1GM5A 2MGSA 3I55A 5ELBA 3OW2A 1BCPC 4A3MH 2VUMH 2L9HA 1VQOA 1A0IA 3OTOQ 4C3JG 4DAVA 3PF4A 4IO9A 2CW0D 2EJMA 1SE8A 5J39A 3NSWA 3SK5A 4KLKA 4DAYA 3J80L 2NVQH 2XVSA 4DV4L 3H3VH 1RF2D 4JI2Q 3F2CA 2HDLA 1CHPD 5C4XB 3CU7A 1SE2A 5C3EG 1NMGA 3OOCA 4C3HH 4DK0A 1QVFA 4A3GH 4FXGC 1BQQT 3U9OA 4PZ6A 2UUAL 1AEXA 4A3BH 5C5MA 5AJ3L 1PH2A 4K6DA 1CZGA 1AN8A 5T1GA 4FP5D 1XXGA 4DR4L 1YHAA 2B2YC 2BE5C 1S5ED 1LACA 3GD7A 5C0XI 1PHJA 1VQEA 1FJGQ 2EYFA 3J7AV 1ENFA 4JYAQ 3H0GH 1U5KA 1KL9A 1O78A 1KDAA 4MIUA 2EQSA 2P5ZX 2RDGA 1JJ2A 3A5UA 3W2DA 4DR1L 3FPPA 1HQRD 2XRSD 1GUWA 1PH8A 2AQ3B 5CV8A 5F2DA 3W5OA 1N32Q 2QEJC 1S40A 4A3LH 4DGZA 2R3ZA 2KEDA 4BY7G 4QMGA 3HOWG 2NN6I 3S16B 1I50H 5BN5A 4A4IA 4XT3B 1IYUA 3PIPA 4IQZA 2A6HC 1L2FA 4A3CG 1Z6HA 4J8QA 5C3XA 3PO3B 3NELA 2B2UC 2Z1CA 2A5HA 1CHQD 4DV6Q 2K04A 3G6JB 4DR6L 4QJFA 3LGJA 2Y0SE 1Q8KA 3OTOL 2ES2A 4HEDA 3KJPA 5IT9c 1Y8OB 1FD7D 3T1HL 4BBRB 1BBWA 4JI8Q 1HH2P 2KVMA 2SEBD 4PQXA 4JI2L 2KCTA 5IIFA 5FLXc 1STNA 2L0CA 2XWJB 4RG1A 2N88A 2N49A 1A2UA 4JVZA 1EZ6A 2VUMG 3CCUA 1JCKB 2I46A 3FMCA 1FNUA 2LKVA 1LT6D 2K5DA 3W1BA 2B63H 2K01A 3L7ZC 3G71A 2F0OA 4XQJA 1T5EA 2JP1A 3PO2H 4IOCA 1HNZQ 1XPOA 2JA5H 3MVVA 2AWOA 3HOZG 4IURA 1QUQB 2R7ZH 1K3BC 3KLWA 2F0JA 2PPBC 1LTID 2I07B 3K8AA 1VQDA 4A3GG 1TWAH 4B3RQ 3RUZA 1VQMA 4BA2I 3H94A 2F0SA 1PZKD 2ZXRA 3HG9A 1Q1EA 1BOSA 2K1BA 1L1OA 1BVSA 5JPMC 1S5BD 2EPBA 5I2XA 1UAPA 4LWCA 2HQLA 3ZJYC 4BWGB 1WTQA 2E2HH 4GLXA 4BY1B 3J80E 2CVRA 2PO4A 3ULLA 4OWTB 1TVXA 2OCEA 3TREA 3I4MG 2VL6A 4DFAA 1IKMA 3T13A 1K8OA 3D4RA 2WP8J 4C3IB 2IT1A 2L12A 2Z6KC 3AFQA 3AQQA 2K5QA 4GN3B 3NTKA 2R93B 2J7ZA 4BBSH 3G48A 3W3AA 4JI8L 1PFNA 4XXEA 3MWYW 3RNUA 1A3TA 1ICWA 2K5WA 3NXWA 1DD2A 1ZYRC 4WORA 3SK6A 1LV9A 2F0LA 1EYCA 2MP1A 4IUTA 4B3MQ 2EE1A 3DHQA 1G2TA 3AB9A 4PNYA 1O7IA 1I3QH 1VCIA 1EYGA 4YY3Q 4ZLTF 1F2MA 5ELDA 1HNZL 1LTAD 1CK1A 1TWHB 5C4HA 3TDQA 1RD9D 1SMYC 4EX5A 1KDBA 5DNFA 2EJGC 3CC2A 1G8ZD 1X3QA 2CWAA 1EZ8A 2F1MA 3GTQB 4F7XA 1SBBB 1BO0A 4MTNA 3CRLC 4B3RL 1G291 1SLJA 3AFPA 4TVAB 3I3CA 2F0WA 2R6GA 5GQOA 2VB3X 1XNRQ 4K0KQ 4LUZA 2ZTEA 1TQOA 4NMZA 2G9HD 4G7HC 2JA5G 2RHSB 5I6YA 1DYQA 4F88A 2R7ZG 3UDFA 4OXPA 1LLRD 1BCPB 1RCVD 4QB4A 3J80i 1X6OA 1JE4A 4DUYQ 1YNJD 1RL2A 4CKBA 1WYDA 2EYMA 1BCPD 1SEBD 4ME3A 4IPGA 4O0AA 3SHLA 1WD1A 4DA2A 2CQAA 3KF8B 2F0EA 1GO3E 3JAMi 3GTMB 3S24A 1QVCA 3NTIA 3PUVA 4RGTA 5GAHC 4TSSA 1FL0A 1H95A 4K5XA 2ZJRA 3VR5A 3J81j 1RJTA 1EIHA 2YYZA 1TWGB 3F2UA 3MZ5A 1EIGA 3GDEA 2JA8G 1YNNC 3TZDA 2K6AA 2R61A 4LFAQ 5C4XH 2BE5D 2F52A 2VY3A 1VQNA 3RD4A 1VQJA 4NXNL 2EYHA 5IY0A 3KFUA 2Y0SB 2TSSA 4RA8A 1YHQA 3DMUA 3AYHB 1J6QA 1PZJD 3E9IA 4RHRA 3QWNA 3KLSX 5GADC 3L9AX 1CKNB 2DN8A 3S15B 4H0LC 1PFSA 4B3TL 3OWEB 3S14B 1XPRA 2AMCB 2CQOA 3T1YQ 4HJAA 2A74C 5LHY1 5G3LF 3HOVG 1CSPA 4J15A 1HZCA 4A3KH 1PH3A 1STEA 2K03A 4ULLA 2F0UA 1XNQQ 3H15A 1NE3A 5IT9L 1F2ZA 2UXBQ 4DU9A 4GN5A 4R4QA 5A2QL 3WOFA 3S16H 1AP0A 3CCSA 4XTCS 4DXFA 3VYSA 1C0AA 4A3EB 5FLXL 1IYJB 4CDCC 4HJ7A 1SR3A 4ID6A 4ILWA 4JW0A 1C48A 3QG1A 4RMFA 4RKBA 4CDEC 3A8IE 2A1AA 4UP9A 1EQVA 2YTXA 3OIQA 3J80c 1TWCB 2B2VC 1EU4A 2PZWA 3CC7A 4LFAL 4XQNA 2CKZB 4K14A 2I0QA 5IP9H 1JQYD 2N55A 2E2IB 4RWSC 3R3OA 3JAMc 4H7BA 1VS0A 4ZYSA 3SK4A 1PH6A 1Q12A 4E6IA 4U673 5LL6X 2K5HA 1TWFB 4DXGA 2Q2HA 3DXJC 3I4MB 1SNOA 4DV1Q 3STBC 5M5XH 2JEAI 1S3OA 1KNAA 4OO1H 4IJLA 4KI0A 1EIFA 2X6LA 5M3MB 1UE7A 1I94L 3HEJA 4KN4C 1OO9B 4GKJQ 2WKCA 5CGKA 3T1YL 4IUQA 2Z0SA 1WTRA 3HKZB 1XNQL 5IYBH 1EWCA 2IX0A 1PA6A 2WIIB 3R2TA 3QO2A 5C4ZA 4YWLA 5KNDA 4LFCL 3K5MA 4BY1H 1LTBD 2F0QA 1UE5A 2MO1A 2M2LA 3BZCA 3HOUG 4FF4A 3HZXA 1MD2D 3K0YA 4IUNA 2ZJQA 3ULPA 1HTPA 4JI3Q 1DOKA 1SROA 2A69C 3S1NB 4CKCA 1ZYRD 1SFOH 2MQHA 3H91A 5ELNA 4HAEA 4K2KA 4LJZC 3PO3G 2NVTB 2MUYA 2LFNA 1SMYD 4DV0Q 2N8NA 4KY6A 5LMNQ 3C3LA 1E2WA 1UEAB 2ALYB 1EEID 2IWHA 3E0EA 4BBRG 5C0XJ 1C4QA 4BXXH 1DXMA 1K0SA 2F0HA 2WACA 3Q0AA 1Z9FA 1A6XA 1YHBA 2NVXB 5JVG3 3SXHA 3F8TA 3IAYA 5IT9E 5IP9G 5IODA 3S2DH 1ASYA 3K58A 1ZKOA 4C3JH 3CAMA 3CHBD 3HOYG 1YIJA 1Q7YC 5FKAC 1ML0D 4OX9Q 4JI6Q 2EYPA 3BYYB 4PMWA 3NPPA 5CBEE 5FLXE 3BVMA 4IZ8A 3T53B 4A3JB 3BG3A 1EUJA 1EOTA 3SE0A 2KCMA 4ABNA 5CMDA 1EY0A 2B2TA 3SDZA 5KYIA 1PH1A 1NY4A 4FDBA 5JJIA 5C0XG 3ERQA 3TP6A 4YHHL 2VXWA 4CDDC 1RIPA 1JOQA 4DV4Q 1L0XB 3K7AH 1D1IA 4JI3L 4B9WA 3GTMH 5A35A 1YNND 3A8JE 3DEPA 1E3PA 2NBFA 5C4JB 1PRTC 1I6VC 2JSOA 2GA4B 5AJ3Q 4LUVA 5D14A 4BY1G 1TWGH 1UE6A 3K5OA 3J7YW 4GNXA 1QOHA 4R4TA 1O7LA 2PYKA 2IHFA 1CT1D 4JK1C 1K8GA 2OEOA 1Y69U 2F0KA 3Q8DA 1LTSD 5LMNL 1W6KA 2B29A 1VQ4A 2F0IA 5FK9C 1I4RA 4C3IG 4C56C 4U68A 4K8JA 1A3VA 4DR5L 1S72A 2PMZB 4NPSA 2R93G 1CUKA 1YVCA 4Q0FA 3I56A 2F3WA 4RFBA 4A3CH 1T9HA 3RN2A 1AH9A 1VQGA 2O2LD 1HA5A 1LTGD 4QUFA 2JEBI 4DR1Q 1VQLA 1Q46A 5LMUQ 3R8BA 5IYDG 3PV0A 2PW5A 3MAQA 1LABA 4IUUA 5IGFA 4I7AA 3A8KE 1TU2B 4YCUA 3S15H 3KF6B 4K2LA 5E3FA 3GTPB 5EQ0A 3NHHA 3S14H 4OX9L 1F9RA 4JI6L 1P16A 1E2VA 3A7LA 4BXXG 2QCPX 2EY6A 3HP3A 3CC4A 3S1RB 3S17H 4PV1C 2L1BA 4R9WA 3PF5A 5IGDA 1G6ZA 2I5MX 5JJKA 1V1PB 1KIXA 1JB7A 2C5CA 1JWSD 2E2JB 1HQMC 1H9SB 3U4ZA 3M3YH 4DR6Q 1EFWA 4YWMA 4MN3A 2BDOA 2KOLA 1STYA 3NTHA 1G2SA 2FMMA 3OW7A 1W3SA 3ICEA 3T1HQ 2NWGA 4WRDA 1O80A 2RF4A 1SNQA 1E7ZA 1SRUA 3CKIB 3SVMA 1JJGA 3HOZH 4WJ4A 5TSSA 1KQSA 4R1JA 3MXUA 4A3EH 2MFIA 4QL5A 3M9BA 1PXUA 1A15A 4DAYB 1AW7A 2XIWA 3BYTB 3H09A 2FHTA 4DNRB 2CH4W 3I91A 2RCNA 3S1MB 3JAML 5I4DA 1KC8C 1PYWD 1EIYB 3BVZA 4IUPA 3F1ZA 4HSVA 3DM1A 1Y1WB 5HGTA 1GUOA 4LF4Q 1R4PB 3FDTA 3MFYA 1TWCH 2O4XA 2HDMA 1E0BA 2RA4A 3D4WA 1LTTD 3C1FA 1DJRD 3GTGB 2XSCA 3STBD 1N9WA 1K8AC 3IKJA 3T56B 1HFNA 2DUDA 1II3A 2FJ2A 1W6JA 2QGQA 1ESFA 2E2IH 4Z9CB 2D2CC 5E4WC 3CP0A 3RZDB 3HOUB 5FO7B 1UUPA 1QG7A 1GHKA 3HOXG 3NEMA 4KKUA 5LMUL 1X54A 3I4MH 3NK9A 2I5HA 5AFWA 1NBWA 2QF7A 1MIUA 2EY5A 1PZID 5EGTA 3SEBA 4MHEA 1N8RC 1Y8NB 3N6RA 4GLVB 4HIKA 2Y0SG 3QJYA 1PFBA 3D0FA 2VB2X 4N9TA 1PTOC 3E3XA 2Q8TA 3MXPA 1YJWA 4DNIA 3NQTA 3IRBA 2ATWA 3Q23A 1VQHA 2JE6I 1W2BA 3CF5A 1B2TA 2FXQA 2Q2UA 3RLFA 2PQEA 2A69D 3L0OA 2MPMA 2HHHQ 4DN4M 1WCMB 4OONA 1L0WA 3GTKB 1BNZA 2Q8IB 3S9WA 3S1QB 4GN4B 1OTCA 2UUCL 4R4OA 1EY8A 3HOYB 1VQIA 3TMEA 2VS1A 1R9TB 4JI4Q 2IX3A 3D8GA 1CFMA 2MO0A 5JVH3 4F87A 1SYBA 5D3DA 1PVOA 1JWUD 4LF4L 4UY8C 2SDFA 4A3EG 1IL2A 1STAA 1IXRA 3D4DA 3CCJA 1R4QB 2NYZD 3PCOB 3WWVA 1U9RA 1S5FD 2JN4A 4MZ9A 4X64L 1JB3A 1QUQA 1JT8A 2IL8A 3QOLA 5M3FB 4PZ8A 4JI1L 2IY5B 1EU3A 1YI2A 2HIXA 4JI7L 3VYTA 1JE5A 2PCFB 2NVXH 2YTYA 1RHPA 2UUBL 4P75A 1JOOA 1UWVA 4UP8A 4ZK9B 1BBXC 4KHPL 2EJFC 4A93B 4K6LA 3C2PA 1B3AA 1B8AA 4JI5Q 3GTOB 3DEOA 3FKIB 4CJ1B 3A0JA 5BN4A 2Z9HA 3MFGA 2JA8H 5DAUA 1ILPA 1X9NA 1E1TA 5IP7H 2B3GA 4A3JH 4DV5L 4P71A 4QCLA 1D5MC 3GP7A 2A6EC 1AFPA 1PRTB 5M3MG 2VNUD 3JAME 3K5LA 2F0PA 3OYYA 1H9KA 2KHJA 2HHHL 4P74A 1PRTD 4ALPA 5E7NA 1MBYA 2K14A 3HKZG 2R7DA 1B9NA 2EYJA 5CV4A 4A75A 4M8AA 2L15A 1UNSA 2DNEA 4NXNQ 4JI4L 3HFZB 4XQQA 1OXXK 1HZBA 3HKZE 1ASZA 4LF9Q 3E9HA 2MJ8A 4CDFC 5M9OA 2J0TD 3HOVH 2ICEC 5K36G 1ENAA 1RDPD 1RTOA 2PZUA 2LXJA 1GOZA 4ZKBB 4HJ9A 1KDCA 2EOTA 4B3TQ 3D6WA 1N36L 4DAMA 3V2TA 1VQ6A 4PMCA 4BS9A 1U4LA 2BA0A 1LO5D 4V190 1O7ZA 5KNCA 5EPLA 1WTPA 4X3TA 2QKIC 4TRDA 4P72A 4ZUJA 1B50A 1XYIA 3ND9A 4KMUC 4ODGA 4JI5L
chains in the Genus database with same CATH topology
5EKKA 4S3SA 4EGVA 3D3RA 4XYQA 2QILA 4DF7A 5ELCA 3EVQA 1TY0A 3I90A 2HQEA 4KKTA 1FGBD 2F0VA 4HMJA 1XWEA 1GUSA 2E2DC 1L0YB 2XWBB 5T1IA 3HOXB 3MXNA 1CI3M 2ID0A 4EQNA 2AUJD 2Z8LA 2B2TC 3M4YA 3A55A 3I70A 4NDXA 5CBAE 4X3UA 2M00A 1CA6A 3LX0A 4QF4A 2ZT9C 2MHVA 1HHVA 1BCPF 3KBGA 1KABA 1GJXA 1MGSA 2KHSA 1I6HB 3WOEA 3KUPA 2F4IA 3OPOA 1X32A 3P1HA 2EY1A 3I4NB 4A3FB 3RZOB 1JR0D 1WTWA 1VF7A 1PTOB 4KJOA 2L5TA 2OXPA 2EYLA 4KK7A 1SNDA 5M5YB 3E0JA 2X6GA 1K8MA 2Z4IA 2B8FA 2NTTA 4OHJA 4XT1B 1PTOD 4KY7A 4X3KA 1BF4A 1J9OA 4H44C 5I6WA 1JORA 1RKNA 1PMRA 3T16A 2JA6B 1AZPA 1WTVA 1WVLA 3K59A 1IHZA 3PUYA 2FINB 1X3PA 1S5DD 1ESRA 1K83B 3SR1A 3MC0B 4J1MA 2HCCA 1JICA 1TS2A 4XDXA 1S5CD 1PLFA 1QE6A 2RQXA 3M7GA 2E75C 4LK1C 4A3BB 2RSOA 2NTSA 4KTAA 3T4AC 2Z4HA 2B2WA 2L55A 1QJOA 1RODA 2F3VA 5J22A 3KLRA 1QILA 3H0GB 4RAUC 2V4DA 1EQTA 1CA5A 1QNUA 3CQZB 5C0XH 1SYCA 4L8JA 5M5WB 3LNNA 3MHBA 3C1EA 2NZ1D 2XN9C 1I50B 2A6ED 1STHA 3V05A 1XTCD 1CM9A 2IW3A 5CYUA 1BXTA 1EWHA 2WV6D 3EFXD 3IL8A 3NP8A 1F2YA 3BZDB 5JPNC 2SNSA 2NN6H 5JEAJ 3T51B 2JA7B 4L6TB 4G57A 1U4RA 2ICIA 4OIKA 1NSNS 1M8AA 2KUMA 4IFDJ 1GUGA 3LWUA 3VYRA 5C5LA 1GHJA 3VYUA 4UAIA 4FYDA 3PO2B 1Q3LA 2F0GA 1SXTA 3KK7A 1NR2A 5C3WA 4ZAIA 1I4QA 3SK8A 1FNVA 4A3DB 2B39A 1CQVA 4IN3A 3ZYYX 5A2QE 5IGGA 5FO9B 5I9OA 4XYOA 4GZYC 1HCZA 5KGUA 1ENCA 3MTSA 3HGBA 3OIPA 3R2IA 3KLSA 1D2BA 4HCEA 5C6AA 3I4LA 1TS5A 3FRPB 2WAQB 3IFTA 4O42A 4KD4A 5IGCA 5CV5A 2YU9B 5EKLA 5JAVA 3TN2A 1F77A 2O5JC 4B08A 3I73A 5LL6S 2L4NA 4BBSB 1T5XD 4FVMA 4I65A 4NKLA 4FXKC 5D3IB 2KCCA 1ILQA 2A68C 2NN6G 3NBHA 1SSOA 4CHTB 1SNMA 5DM63 5KIXA 4KKSA 1M4VA 2NVYB 4CJ0B 1EEFD 4A3IB 3NWSA 2BOSA 4K8IA 1TY2A 1IKLA 4OIJA 3GO5A 4KHZA 4HR7B 5ELEA 1OXTA 1KLGD 3VR3A 1PTOH 4ZUIA 1FR3A 4I7ZC 3MXGA 5FOBB 3S2HB 4YIJA 1F9PA 4ME5A 4RKLA 1NCVA 4BA1I 3P20A 4RGNA 4C1NI 4FNFA 1I4XA 5JOBA 3PUZA 5CC4A 2JYOA 3PIO3 1H9SA 1HTLD 1RTNA 1HXYD 4KN7C 4TKOB 2KCNA 3NUCA 4N9PA 3TP8A 2B2VA 4IFDI 4DAPA 2RSNA 3K6OA 3URYA 3GTLB 3J7AF 1IW7C 3ND8A 5E4XA 1U4MA 2IPKD 5DM73 3U9SA 3M4OB 2L11A 3D31A 3ONAB 4HN7A 1S4ZA 4UDUC 1DONA 4OO1I 2RVLA 2X69A 2R92B 5EBCA 2SOBA 1KTKA 4X3SA 3EJIA 1V1OA 3NE5B 2G9DA 3E5SA 4Y7NB 3A56A 2O5IC 1SNCA 1EY7A 3R93A 4RCNA 1PDQA 5EPKA 4C1NK 2K33A 1CQFA 3OMGA 5IGBA 2KECA 4A3KB 2IJ0A 1LT3D 2M9VA 3VA7A 3TSSA 1LTRD 2K32A 5C44B 3Q6SA 4P2CB 4KV6A 2K28A 3OWFA 1GUTA 3N52A 4FF1A 2AQ1B 5K36H 1GUNA 2KQ3A 1D5XC 3K5NA 1TT2A 1Z7TA 1TR5A 4DK1A 3H3VC 4G7ZC 4QIWB 1WTOA 3EA6A 2EYOA 1D1KA 4H13C 4EVOA 3GTJB 3RMHA 1VDZA 1EY4A 3WDNA 2K7VA 5M5XB 1U4PA 5EPJA 4ZKCB 2XRQD 4C3HG 3TZUA 3ITPA 4RH6A 4F8MA 4G7OC 1KNEA 3P7JA 2B2WC 1H9JA 4RHSA 3FEWX 4FXDA 3LWEA 5KEEA 3I8ZA 4HCSA 4OL7A 4LMQD 1QB5D 2F0FA 1QNKA 1QWYA 3AU7A 3D6CA 2KA7A 3BDLA 5NUCA 1Q1BA 1JWMD 2SNMA 1Y1VB 5ELFA 4NW2A 2OT2A 1G91A 3OSOA 4CKEA 2RDHA 2D9UA 1SFOB 2KEEA 1I4PA 2A68D 1QCBD 1KAAA 3P75A 4QUCA 3NQIA 1SE4A 4HTHA 4RGMA 1ONLA 2LY7A 1DOLA 3EQLC 2PW7A 5BN3A 1VF5C 1IL8A 3J81L 3TP7A 3PMFA 1HA6A 1B44D 5IGEA 1WTXA 1ZXTA 5D65A 1SYDA 3TP5A 5K5PA 3BDCA 1SE3A 1PRTF 1VMPA 1DOMA 3S2DB 1FYCA 1F9SA 2K05A 3DWAA 4C3JB 5CR3A 1TIID 2WB1B 3UI2A 1J8IA 1OXUA 1BDOA 3VR4A 4K5WA 5C3EB 1DZ1A 3KF8A 2AUKA 1IYVA 3AMUA 1MSHA 4CJ2C 1HUNA 3NWTA 3Q24A 1MSGA 2F0DA 2H4OA 3L3OC 3K7AB 1IW7D 5EJWA 5E1FA 1CZWA 2F03A 3HRZC 2B2YA 2F0TA 2F0NA 2EZVA 1OXVA 1V8QA 3GQBA 4HSPA 5EKIA 3V96A 1EL0A 3X3NA 5I2YA 1EY5A 5G3LD 3PIP3 5FO8B 3H6MA 2H1EA 3O13A 4FF3A 4KY5A 4WFN3 2E76C 4OGQC 1I4HA 2BA1A 2QDBA 4BY7B 4M1UB 3HOWB 1XX8A 4WJWA 4C2MB 5KRUA 1HRJA 3FVQA 2DY8A 4KD3A 5CV9A 2NB0A 1JC7A 3X3MA 4J6HA 5IOCA 2B2UA 2TMPA 5JJZA 1O7YA 2AQ2B 3A7AB 1VMCA 2BCOA 1Z47A 3S17B 1SJHD 1MI2A 3E6ZX 3VR6A 4KJNA 3EROA 1BR9A 1D5ZC 2RDFA 1D6EC 4RGOS 3QB3A 1WD0A 3M3YB 2EDGA 2VUMB 4A3MB 2A6HD 4KHVA 3DWPA 4CBVA 3A54A 1E2ZA 2HUGA 2NVQB 3HOZB 1Y8PB 1HPCA 2RKSA 3GV3A 1SYEA 4EQOA 4LAAA 2RBMA 4C3HB 4A3GB 2CW0C 3J81E 1SDFA 2C9OA 5JEAH 2NUCA 2DNCA 2ENBA 1PTOF 4R8IA 3BVGA 2LS01 5ISRA 3NBIA 1EFID 3BDOA 1B9MA 4IFDH 1HFGA 4K5VA 2A73B 1TS3A 5CV6A 3PUWA 1CTMA 2F0MA 3I72A 1EYAA 2DY7A 1A3UA 1SYGA 1ET6A 3HS0C 2XNAC 1BUVT 1I4GA 1PFMA 3CRKC 1FNWA 2CHBD 3MEHA 4R8NA 2HCIA 2JXMB 4AYBB 2AWNA 1F2LA 1SJED 2LMCB 1V43A 3M7NA 1NUCA 4HMIA 4JBWA 5EBDA 4V0BA 5KYLA 3Q22A 3FPUB 1JOKA 4TQUS 5I9PA 3QOJA 1OXSC 2FFKB 2B63B 5J1ZA 3M85A 1NR4A 1Q8IA 2FMCA 5CORA 2JA5B 1B53A 2ZXPA 5CV7A 1EY6A 2R7ZB 4FF2A 1DM0B 4Q5VA 1ZEQX 3VR2A 3C46A 1B1ZA 1TWAB 2KJXA 4CGYB 2PZTA 5COYA 1DCZA 2D62A 5JEAG 3IFDA 2Q8RE 1Q90A 4G4KA 4IFDG 2OF1A 2E2HB 4B9XA 2JA8B 2EVBA 2EY2A 2B8GA 3OMCA 3DWQA 1NAPA 2J4XA 4OO1G 4RCOA 3OHXC 1A2TA 1B4OA 5HURA 1STGA 3G7LA 1TKWB 3PUXA 4NP5A 4PMBA 4L63B 1LT4D 3GV6A 2D5DA 4O1NA 4IALA 1I3QB 3K57A 2ZXOA 2WINB 4XIGS 1GXDC 1EY9A 1SAPA 1AZQA 3HOVB 1KLUD 1STBA 3QIAA 2IX1A 1LT5D 1H9MA 3BS1A 1TS4A 1H9RA 1SNPA 1SYFA 3TBIB 4ZRZA 3VA5A 2E74C 2PNRC 3KBXA 2BDNA 5KNBA 1C8CA 4EQPA 2WKDA 5DEHA 1F9QA 3MA2B 4FO2A 1V1PA 3DUZA 4ZQ3A 4IUVA 2EXZA 1EYDA 1ET9A 1HUMA 1YNJC 4DNTB 2MGSA 5ELBA 1BCPC 2L9HA 4C3JG 4DAVA 2CW0D 2EJMA 5J39A 3NSWA 3SK5A 4DAYA 3J80L 2XVSA 1RF2D 2HDLA 1CHPD 5C4XB 3CU7A 1SE2A 3OOCA 4DK0A 4FXGC 1BQQT 3U9OA 1AEXA 5C5MA 4K6DA 1CZGA 1AN8A 5T1GA 4FP5D 1XXGA 5C0XI 2B2YC 2BE5C 1S5ED 1LACA 3GD7A 2EYFA 3J7AV 1ENFA 1O78A 1KDAA 4MIUA 2RDGA 3W2DA 3FPPA 1HQRD 2XRSD 1GUWA 2AQ3B 5CV8A 5F2DA 2QEJC 4DGZA 2R3ZA 2KEDA 4QMGA 2NN6I 3S16B 5BN5A 4XT3B 1IYUA 4IQZA 2A6HC 1Z6HA 4J8QA 5C3XA 3PO3B 2B2UC 2Z1CA 2A5HA 1CHQD 2K04A 3G6JB 4HEDA 1Y8OB 1FD7D 4BBRB 2KVMA 2SEBD 4PQXA 5IIFA 1STNA 2L0CA 2XWJB 2N88A 1A2UA 1EZ6A 1JCKB 2I46A 3FMCA 1FNUA 2LKVA 1LT6D 2K5DA 2K01A 3L7ZC 2F0OA 4XQJA 1T5EA 2JP1A 3MVVA 2AWOA 4IURA 2PPBC 2F0JA 1LTID 2I07B 3RUZA 4BA2I 3H94A 2F0SA 1PZKD 2ZXRA 3HG9A 1Q1EA 1BOSA 2K1BA 5JPMC 1S5BD 2EPBA 5I2XA 1UAPA 4BWGB 1WTQA 4BY1B 3J80E 2CVRA 2PO4A 1TVXA 4DFAA 1K8OA 1IKMA 3T13A 3D4RA 2WP8J 4C3IB 2IT1A 2L12A 2K5QA 3NTKA 2R93B 2J7ZA 3W3AA 1PFNA 4XXEA 3MWYW 1A3TA 1ICWA 2K5WA 3NXWA 1DD2A 4WORA 1ZYRC 3SK6A 1LV9A 2F0LA 1EYCA 2MP1A 4IUTA 2EE1A 3DHQA 1G2TA 3AB9A 4PNYA 1VCIA 4ZLTF 1F2MA 5ELDA 1LTAD 1CK1A 1TWHB 5C4HA 3TDQA 1RD9D 1SMYC 1KDBA 5DNFA 2EJGC 1G8ZD 1X3QA 1EZ8A 2F1MA 3GTQB 4F7XA 1SBBB 1BO0A 3CRLC 1G291 3I3CA 2F0WA 2R6GA 2VB3X 1TQOA 4NMZA 2G9HD 4G7HC 5I6YA 1DYQA 4F88A 1LLRD 1BCPB 1RCVD 4QB4A 1JE4A 1YNJD 4CKBA 2EYMA 1BCPD 1SEBD 3SHLA 1WD1A 4DA2A 2CQAA 2F0EA 3GTMB 3NTIA 3PUVA 4RGTA 4TSSA 4K5XA 3VR5A 1EIHA 1RJTA 2YYZA 1TWGB 3F2UA 3MZ5A 1EIGA 1YNNC 3TZDA 2K6AA 2R61A 2BE5D 3RD4A 2EYHA 2Y0SB 2TSSA 4RA8A 3DMUA 1PZJD 4RHRA 3QWNA 3KLSX 3L9AX 2DN8A 3S15B 4H0LC 3OWEB 3S14B 2A74C 5LHY1 5G3LF 1STEA 2K03A 4ULLA 2F0UA 5IT9L 1F2ZA 4DU9A 5A2QL 3WOFA 1AP0A 4XTCS 4DXFA 3VYSA 4A3EB 5FLXL 4ID6A 4ILWA 1C48A 3QG1A 4RKBA 3A8IE 1EQVA 3OIQA 1TWCB 2B2VC 1EU4A 2PZWA 4XQNA 4K14A 1JQYD 2N55A 2E2IB 4RWSC 3R3OA 4H7BA 4ZYSA 3SK4A 1Q12A 4E6IA 4U673 5LL6X 1TWFB 4DXGA 3DXJC 3I4MB 1SNOA 2JEAI 1KNAA 4OO1H 4KI0A 2X6LA 5M3MB 3HEJA 4KN4C 1OO9B 2WKCA 5CGKA 4IUQA 1WTRA 3HKZB 1EWCA 2IX0A 2WIIB 3R2TA 3QO2A 5C4ZA 5KNDA 3K5MA 1LTBD 2F0QA 2M2LA 4FF4A 3HZXA 1MD2D 3K0YA 4IUNA 1HTPA 1DOKA 2A69C 3S1NB 4CKCA 1ZYRD 3H91A 4HAEA 4K2KA 4LJZC 2NVTB 2MUYA 2LFNA 1SMYD 4KY6A 3C3LA 1E2WA 1UEAB 1EEID 2IWHA 5C0XJ 1C4QA 1DXMA 2F0HA 2WACA 3Q0AA 1A6XA 2NVXB 5JVG3 3SXHA 3IAYA 5IT9E 5IODA 3K58A 1ZKOA 3CHBD 5FKAC 1ML0D 2EYPA 3BYYB 4PMWA 3NPPA 5CBEE 5FLXE 3BVMA 4IZ8A 3T53B 4A3JB 3BG3A 1EOTA 3SE0A 4ABNA 5CMDA 1EY0A 2B2TA 3SDZA 5KYIA 5C0XG 3ERQA 3TP6A 2VXWA 1JOQA 1L0XB 1D1IA 4B9WA 5A35A 1YNND 3A8JE 3DEPA 2NBFA 5C4JB 1PRTC 1I6VC 2JSOA 2GA4B 5D14A 3J7YW 3K5OA 1QOHA 1O7LA 2PYKA 1CT1D 4JK1C 2OEOA 1Y69U 2F0KA 1LTSD 1W6KA 2F0IA 5FK9C 1I4RA 4C3IG 4C56C 4U68A 4K8JA 1A3VA 2PMZB 4Q0FA 2F3WA 4RFBA 2O2LD 1HA5A 4QUFA 1LTGD 2JEBI 3R8BA 3PV0A 2PW5A 3MAQA 1LABA 4IUUA 5IGFA 3A8KE 1TU2B 4K2LA 5E3FA 3GTPB 5EQ0A 3NHHA 1F9RA 1E2VA 3A7LA 2QCPX 2EY6A 3HP3A 3S1RB 4PV1C 2L1BA 4R9WA 5IGDA 1G6ZA 1V1PB 2C5CA 1JWSD 2E2JB 1HQMC 1H9SB 4MN3A 2BDOA 2KOLA 1STYA 3NTHA 1G2SA 2FMMA 3OW7A 2NWGA 4WRDA 1O80A 1SNQA 3CKIB 3SVMA 5TSSA 3MXUA 1PXUA 1A15A 1AW7A 2XIWA 3BYTB 3H09A 2FHTA 4DNRB 3I91A 3S1MB 3JAML 5I4DA 1PYWD 3BVZA 4IUPA 4HSVA 3DM1A 1Y1WB 5HGTA 1GUOA 1R4PB 3FDTA 3MFYA 2O4XA 2HDMA 1E0BA 2RA4A 3D4WA 1LTTD 3C1FA 1DJRD 3GTGB 2XSCA 3IKJA 3T56B 1HFNA 2FJ2A 1II3A 1W6JA 1ESFA 4Z9CB 2D2CC 5E4WC 3RZDB 3HOUB 5FO7B 1UUPA 1QG7A 1GHKA 4KKUA 3NK9A 5AFWA 2QF7A 2EY5A 1PZID 5EGTA 3SEBA 4MHEA 1Y8NB 3N6RA 3QJYA 1PFBA 4N9TA 2VB2X 1PTOC 2Q8TA 3MXPA 3NQTA 3Q23A 2JE6I 1B2TA 3RLFA 2PQEA 2A69D 2MPMA 4DN4M 1WCMB 3GTKB 1BNZA 2Q8IB 3S9WA 3S1QB 1EY8A 3HOYB 3TMEA 1R9TB 2IX3A 3D8GA 1CFMA 5JVH3 4F87A 1SYBA 5D3DA 1JWUD 2SDFA 1STAA 3D4DA 1R4QB 2NYZD 1U9RA 1S5FD 1JB3A 2IL8A 3QOLA 5M3FB 1EU3A 3VYTA 2PCFB 1RHPA 4ZK9B 1JOOA 1BBXC 2EJFC 4A93B 4K6LA 3C2PA 1B3AA 3GTOB 3DEOA 3FKIB 4CJ1B 5BN4A 3MFGA 5DAUA 1ILPA 4QCLA 1D5MC 2A6EC 3GP7A 1AFPA 1PRTB 2VNUD 3JAME 3K5LA 2F0PA 1H9KA 1PRTD 1MBYA 1B9NA 2EYJA 5CV4A 4M8AA 1UNSA 2DNEA 4XQQA 1OXXK 2MJ8A 5M9OA 2J0TD 2ICEC 5K36G 1ENAA 1RDPD 1RTOA 2PZUA 1GOZA 4ZKBB 1KDCA 2EOTA 3D6WA 3V2TA 4PMCA 4BS9A 1U4LA 2BA0A 1LO5D 4V190 1O7ZA 5KNCA 5EPLA 1WTPA 4X3TA 2QKIC 4TRDA 4ZUJA 1B50A 1XYIA 3ND9A 4KMUC 4ODGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XIW A;  1NR2 A;  1ESR A;  2FHT A;  5CMD A;  1HRJ A;  1IL8 A;  1KNA A;  1TVX A;  2X6L A;  1VMC A;  3I91 A;  4ZAI A;  2B2T A;  1AZQ A;  1HA6 A;  1F9P A;  1WTX A;  2HCC A;  3FPU B;  1IKM A;  1GUW A;  1JIC A;  1NCV A;  1ZXT A;  1MI2 A;  4IUP A;  4XDX A;  5D65 A;  1PLF A;  1QE6 A;  2L12 A;  4HSV A;  3DM1 A;  2VXW A;  2JYO A;  2R3Z A;  3I90 A;  5JJZ A;  2KED A;  1RHP A;  3FDT A;  1RTN A;  1O7Y A;  2FFK B;  2J7Z A;  2RSO A;  4IUQ A;  4RA8 A;  4ZK9 B;  1WTR A;  1WD0 A;  1BBX C;  2HDM A;  1E0B A;  1PFN A;  1VMP A;  2RA4 A;  1NR4 A;  1DOM A;  3MTS A;  4XT3 B;  1WTO A;  1F9S A;  2K05 A;  3DEP A;  2B2W A;  3MWY W;  1HFN A;  5COR A;  1B3A A;  1ROD A;  2FJ2 A;  1B53 A;  3DEO A;  5T1I A;  2B2U C;  4CJ1 B;  1ICW A;  2B2V A;  3KBX A;  1LV9 A;  2BDN A;  2HUG A;  2MP1 A;  4IUT A;  5E4W C;  2EE1 A;  2K04 A;  3UI2 A;  1ILP A;  3QO2 A;  1C8C A;  1J8I A;  1G2T A;  5D14 A;  2RSN A;  4O42 A;  3GV3 A;  1QG7 A;  2B2T C;  1F9Q A;  4RAU C;  5CBA E;  4HED A;  5E4X A;  4X3U A;  1U4M A;  4ZLT F;  5AFW A;  5COY A;  1CA6 A;  2M2L A;  1EQT A;  3IFD A;  2Q8R E;  1CA5 A;  1SDF A;  1U4P A;  4IUV A;  5EPJ A;  1DZ1 A;  4ZKC B;  5DNF A;  1DOK A;  4MHE A;  2K03 A;  3TN2 A;  4R8I A;  2L11 A;  2KVM A;  1HHV A;  4U68 A;  1X3Q A;  1MSH A;  4CJ2 C;  3ONA B;  1MGS A;  1BO0 A;  1HUN A;  1HUM A;  2N88 A;  1S4Z A;  1KNE A;  1MSG A;  2B2W C;  3KUP A;  3P7J A;  1DON A;  2RVL A;  3I3C A;  2L4N A;  1PFB A;  2X69 A;  3H91 A;  2MGS A;  2K01 A;  2Q8T A;  2NZ1 D;  1X32 A;  3LWE A;  1AP0 A;  2L9H A;  3I8Z A;  4HCS A;  4QUF A;  5EJW A;  4HAE A;  4LMQ D;  4X3S A;  2JP1 A;  4IUU A;  1CM9 A;  1HFG A;  1QNK A;  2B2Y A;  1B2T A;  3IL8 A;  1WTW A;  4IUR A;  5EQ0 A;  3R93 A;  5EPK A;  1PDQ A;  1ILQ A;  1F9R A;  2MJ8 A;  2MPM A;  1JE4 A;  2HDL A;  4DN4 M;  5EKI A;  1EL0 A;  1SSO A;  3HP3 A;  2X6G A;  2L1B A;  4R9W A;  1NAP A;  1RTO A;  4XT1 B;  1G6Z A;  2H1E A;  1BNZ A;  4X3K A;  1BF4 A;  4ZKB B;  4NW2 A;  2EOT A;  1WD1 A;  2DY7 A;  1J9O A;  2KEC A;  3D6W A;  1U4R A;  3TZD A;  1B4O A;  2B2V C;  4OIK A;  1G91 A;  3G7L A;  2K1B A;  4CJ0 B;  4MN3 A;  2KOL A;  5T1G A;  1G2S A;  1M8A A;  2FMM A;  2D9U A;  2KUM A;  1U4L A;  1PFM A;  1XX8 A;  2KEE A;  2NWG A;  1O7Z A;  2B2Y C;  5EPL A;  1IKL A;  1O80 A;  2HCI A;  2DY8 A;  3Q6S A;  4OIJ A;  1WTP A;  1ML0 D;  2N55 A;  2EPB A;  4QUC A;  4RWS C;  4X3T A;  1F2L A;  3GV6 A;  3SVM A;  2K28 A;  2SDF A;  1WTV A;  1EIH A;  1RJT A;  5CBE E;  3N52 A;  1WVL A;  4UAI A;  1B50 A;  2NYZ D;  3F2U A;  1AZP A;  1WTQ A;  1XYI A;  1Q3L A;  1EIG A;  2FIN B;  2B2U A;  1A15 A;  2CVR A;  1EOT A;  1DOL A;  1SAP A;  2IL8 A;  1X3P A; 
#chains in the Genus database with same CATH topology
 5EKK A;  4S3S A;  4EGV A;  2N78 A;  3D3R A;  3TQY A;  2LXK A;  3S1R H;  4UPA A;  3EN2 A;  4XYQ A;  2QIL A;  4DF7 A;  5ELC A;  3EVQ A;  1TY0 A;  3I90 A;  3H3V I;  2HQE A;  4KKT A;  1FGB D;  4A3D G;  2F0V A;  4HMJ A;  1XWE A;  1GUS A;  2E2D C;  1L0Y B;  5IWA Q;  2XWB B;  2D0O A;  5T1I A;  3HOX B;  5IP7 G;  3MXN A;  1CI3 M;  4A3J G;  2ID0 A;  4EQN A;  2AUJ D;  2Z8L A;  2B2T C;  2CWP A;  3M4Y A;  3A55 A;  3I70 A;  4NDX A;  5CBA E;  4X3U A;  2M00 A;  1CA6 A;  5IYC G;  3LX0 A;  4QF4 A;  1V9P A;  2ZT9 C;  3CPW A;  3S1M H;  3RN5 A;  4DV3 L;  2MHV A;  1Q86 C;  4LF9 L;  1HHV A;  1BCP F;  1HR0 Q;  3KBG A;  4UHV A;  1KAB A;  2JQO A;  2QA4 A;  1GJX A;  1MGS A;  2CFM A;  2KHS A;  1I6H B;  3WOE A;  3KUP A;  1VQP A;  3EIV A;  4DUZ Q;  2F4I A;  3OPO A;  3RLN A;  1X32 A;  3P1H A;  4PG3 A;  2EY1 A;  4APV A;  1I94 Q;  4GNX C;  3ULJ A;  2BH2 A;  1C7Y A;  3I4N B;  4A3F B;  2PI2 E;  3RZO B;  1JR0 D;  1WTW A;  1VF7 A;  1PTO B;  4B3S Q;  4KJO A;  2L5T A;  2OXP A;  2EYL A;  4DV7 L;  4JOI A;  5HY6 A;  1PH7 A;  5DLQ E;  4KK7 A;  3RZD H;  3HOU H;  4X65 Q;  1SND A;  5M5Y B;  3E0J A;  2X6G A;  1K8M A;  2Z4I A;  2B8F A;  2NTT A;  4OHJ A;  4JC0 A;  4XT1 B;  5FJ8 G;  3BZK A;  1PTO D;  4KY7 A;  4X3K A;  1BF4 A;  1J9O A;  2UXB L;  4H44 C;  5I6W A;  1MKH A;  3NEN A;  1WTH A;  1JOR A;  4LFC Q;  1RKN A;  1PMR A;  3PO3 H;  4EQ5 A;  3T16 A;  2JA6 B;  1AZP A;  3FP9 A;  2PMZ E;  1WTV A;  2HIV A;  1WVL A;  3K59 A;  1IHZ A;  3PUY A;  4DR7 Q;  1K3R A;  5IWA L;  4ZCK A;  2FIN B;  1MHW C;  4BBR H;  1X3P A;  1S5D D;  1ESR A;  1XMQ Q;  4LNQ A;  1K83 B;  3SR1 A;  1UE1 A;  3MC0 B;  4J1M A;  1VQ8 A;  2HCC A;  1JIC A;  1TS2 A;  1EWI A;  4XDX A;  1S5C D;  1PLF A;  1QE6 A;  2RQX A;  3M7G A;  4JV5 Q;  1D8L A;  2E75 C;  4LK1 C;  4A3B B;  2RSO A;  2NTS A;  3HOY H;  4KTA A;  3T4A C;  4AQY Q;  1U0L A;  4GLA C;  2Z4H A;  2XGT A;  1HR0 L;  1GKH A;  2B2W A;  2L55 A;  1QJO A;  1ROD A;  2F3V A;  4YCW A;  1IZ6 A;  4HJ8 A;  5J22 A;  4DUZ L;  4Y52 H;  3KLR A;  4LF5 Q;  1QIL A;  3H0G B;  3ERS X;  4RAU C;  2V4D A;  1VQF A;  2UXC L;  2CH4 A;  1EQT A;  1CA5 A;  1QNU A;  3CQZ B;  5C0X H;  1SYC A;  4B3S L;  4L8J A;  3J7A 5;  4X65 L;  5M5W B;  3B6Y A;  1XTD A;  3CW2 C;  1Y1W G;  3LNN A;  3KYH C;  3MHB A;  3C1E A;  1FVI A;  2NZ1 D;  2XN9 C;  4A93 H;  1I50 B;  2A6E D;  1VQA A;  1STH A;  3V05 A;  2Z6K A;  1XTC D;  1CM9 A;  2IW3 A;  5CYU A;  3GTO H;  1BXT A;  1EWH A;  2WV6 D;  1LYL A;  3EFX D;  3FKI H;  4YHH Q;  3IL8 A;  3SGI A;  3NP8 A;  1F2Y A;  3JC6 6;  4WJ3 M;  3BZD B;  4QY7 A;  5JPN C;  2SNS A;  2NN6 H;  5JEA J;  1CKM A;  3T51 B;  3HKS A;  4DR7 L;  4C3I H;  4LF7 Q;  4P73 A;  2JA7 B;  4L6T B;  2E5L L;  3TRZ A;  2R93 H;  4G57 A;  1U4R A;  2ICI A;  1XMQ L;  2QW7 A;  4OIK A;  1NSN S;  3J81 i;  2AKW B;  1KHI A;  1M8A A;  2KUM A;  4IFD J;  5IYD H;  1GUG A;  2KBN A;  1B7Y B;  3LWU A;  1QVG A;  4JV5 L;  3TS0 A;  3KDF A;  3VYR A;  5C5L A;  1EQR A;  1GHJ A;  3VYU A;  4UAI A;  4FYD A;  4AQY L;  4QGU A;  3PO2 B;  4DR5 Q;  4GKK L;  1Q3L A;  2F0G A;  1SXT A;  1TWH H;  3KK7 A;  1KXL A;  1NR2 A;  2OQK A;  2H5X A;  2YV5 A;  5C3W A;  4ZAI A;  1WCM G;  4LF5 L;  1I4Q A;  4JI0 L;  1E24 A;  3SK8 A;  3GTQ H;  1FNV A;  4A3D B;  2B39 A;  1CQV A;  4IN3 A;  4POF A;  3ZYY X;  2DJF C;  5A2Q E;  5IGG A;  5FO9 B;  5I9O A;  4XYO A;  4GZY C;  1HCZ A;  5KGU A;  1ENC A;  3MTS A;  3HGB A;  3OIP A;  5FLM H;  1VQ5 A;  3R2I A;  2PQA A;  3KLS A;  4R4I A;  1D2B A;  4HCE A;  2K4K A;  5C6A A;  3I4L A;  1TS5 A;  3FRP B;  2WAQ B;  3IFT A;  4O42 A;  1KRT A;  4KD4 A;  2JK8 A;  3CCV A;  4HJ5 A;  1L1O C;  5IGC A;  4JBK A;  5M3F G;  4QIW E;  5CV5 A;  2YU9 B;  5EKL A;  5JAV A;  3K7U C;  3FHW A;  3TN2 A;  1M1K C;  1A8V A;  1F77 A;  2UXD Q;  2O5J C;  1AE3 A;  4B08 A;  1VQK A;  3I73 A;  4LF7 L;  1J5E L;  5LL6 S;  2L4N A;  4A93 G;  4BBS B;  1T5X D;  4FVM A;  1X3E A;  4I65 A;  4NKL A;  4FXK C;  4DK6 C;  4DPG A;  4N8X 1;  4N8F A;  3FKI G;  5D3I B;  5LMN W;  4GOP A;  3HOX H;  1X3G A;  2KCC A;  1ILQ A;  2A68 C;  2NN6 G;  3NBH A;  4GNX B;  1SSO A;  2VZA A;  4CHT B;  1SNM A;  4PZ7 A;  4IPH A;  5DM6 3;  5KIX A;  3F2D A;  1Q81 C;  4KKS A;  1X3F A;  1NJI C;  1X65 A;  1M4V A;  2NVY B;  4CJ0 B;  2BH8 A;  1EEF D;  4A3I B;  3NWS A;  2BOS A;  4K8I A;  1TY2 A;  1IKL A;  4OIJ A;  1K9M C;  3GO5 A;  4KHZ A;  4HR7 B;  3J81 c;  4L5Q A;  5ELE A;  1OXT A;  3RR5 A;  1P8L A;  1VQ7 A;  3PSI A;  1KLG D;  1X56 A;  4A3F H;  3RZO H;  3VR3 A;  3UDG A;  1E1O A;  1PTO H;  2LSS A;  4ZUI A;  1FR3 A;  4I7Z C;  3MXG A;  5FOB B;  3S2H B;  4YIJ A;  1F9P A;  4ME5 A;  4RKL A;  1NCV A;  4BA1 I;  3P20 A;  4NB3 A;  4RGN A;  4FNF A;  4C1N I;  3J7Z C;  1I4X A;  2ZTD A;  1N33 L;  5JOB A;  3PUZ A;  5CC4 A;  2JYO A;  3PIO 3;  1H9S A;  1HTL D;  1RTN A;  3PGZ A;  1HXY D;  4KN7 C;  1PV4 A;  4TKO B;  5FLM G;  4H02 A;  1HZ9 A;  2KCN A;  3NUC A;  2UXD L;  3QR8 A;  4N9P A;  3TP8 A;  2JA6 H;  2B2V A;  1TXY A;  1B3Q A;  2UUC Q;  4IFD I;  4DAP A;  2RSN A;  3K6O A;  3URY A;  3GTL B;  3J7A F;  1IW7 C;  3CCL A;  2XTI A;  3ND8 A;  5E4X A;  1U4M A;  2K50 A;  2WB1 G;  1LM0 A;  2IPK D;  5DM7 3;  1K83 H;  3U9S A;  1PH9 A;  4LF6 L;  1SMX A;  4JPB W;  3M4O B;  2L11 A;  3D31 A;  2WB1 E;  3ONA B;  1WOC A;  4HN7 A;  1S4Z A;  4X64 Q;  4UDU C;  1DON A;  1Y14 B;  4OO1 I;  2RVL A;  1AE2 A;  2X69 A;  2R92 B;  5EBC A;  2K75 A;  2HD3 A;  3U4V A;  2SOB A;  4JI1 Q;  2VW9 A;  1PYS B;  1KTK A;  4X3S A;  4JI7 Q;  3EJI A;  1TWF H;  1V1O A;  3NE5 B;  2OQ0 A;  2G9D A;  3E5S A;  4Y7N B;  3A56 A;  2O5I C;  3CD6 A;  1SNC A;  1EY7 A;  2UUB Q;  3R93 A;  4RCN A;  1PDQ A;  5EPK A;  4C1N K;  4KHP Q;  2K33 A;  5M3M H;  1IBL L;  1CQF A;  3OMG A;  4LFB Q;  1EQQ A;  1N34 Q;  3UE0 A;  2VQE Q;  3CQZ H;  5IGB A;  1JMC A;  2KEC A;  5IE8 A;  4A3K B;  2IJ0 A;  5M5W H;  4DV5 Q;  1LT3 D;  2M9V A;  3VA7 A;  3TSS A;  3BU2 A;  1HZA A;  1LTR D;  2K32 A;  5C44 B;  3Q6S A;  4P2C B;  4KV6 A;  2K28 A;  1K0R A;  4JOI C;  3I4N G;  4A3F G;  3OWF A;  1GUT A;  3N52 A;  1I5F A;  4L5R C;  4FF1 A;  3BJU A;  4YWK A;  2AQ1 B;  5K36 H;  1MJC A;  3TS2 A;  1KRS A;  1GUN A;  2KQ3 A;  1D5X C;  2ZM6 Q;  3S1N H;  3K5N A;  2D0P A;  1KD1 C;  2RCF A;  2JA7 H;  1TT2 A;  1Z7T A;  5J3B A;  3CCR A;  2UU9 Q;  1TR5 A;  4DK1 A;  1PYB A;  3H3V C;  4G7Z C;  4QIW B;  1WTO A;  2OTL A;  3EA6 A;  2NVT H;  1YIT A;  1YJN A;  2JA6 G;  2EYO A;  3F2B A;  1D1K A;  4A3M G;  4POG A;  4H13 C;  4EVO A;  4DK3 C;  3GTJ B;  1N36 Q;  3RMH A;  1PH5 A;  1MJE A;  2DGY A;  1VDZ A;  1EY4 A;  3WDN A;  2K7V A;  3CXC A;  3A74 A;  5M5X B;  1U4P A;  5EPJ A;  4ZKC B;  1FJG L;  2XRQ D;  4C3H G;  3TZU A;  4JYA L;  3ITP A;  4RH6 A;  1L1O B;  2E8G A;  4F8M A;  4IPD A;  4A3D H;  4LFB L;  4A3B G;  4G7O C;  1KNE A;  3P7J A;  2B2W C;  1H9J A;  4RHS A;  1N34 L;  5HGQ A;  3FEW X;  2VQE L;  1GD7 A;  4FXD A;  2N3S A;  3LWE A;  5KEE A;  3I8Z A;  4HCS A;  4OL7 A;  4LMQ D;  1QB5 D;  2F0F A;  4UP7 A;  1DGS A;  1QNK A;  1QWY A;  1N32 L;  3AU7 A;  3D6C A;  2A8V A;  1IBM Q;  3CPF A;  3H0G G;  4O2D A;  5IYC H;  2KA7 A;  3BDL A;  5NUC A;  1Q1B A;  1JWM D;  2SNM A;  1Y1V B;  5ELF A;  5GAE C;  2YU9 H;  4NW2 A;  3A5Z B;  4DV6 L;  2OT2 A;  1G91 A;  3OSO A;  4A3L G;  4CKE A;  2RDH A;  2ZM6 L;  2D9U A;  4X66 Q;  1SFO B;  2KEE A;  1I4P A;  2A68 D;  4DV2 Q;  1QCB D;  5C4J H;  1KAA A;  3P75 A;  4QUC A;  3UE1 A;  2CCZ A;  5ELO A;  3NQI A;  1SE4 A;  2UU9 L;  4DV3 Q;  5GRO A;  4HTH A;  4RGM A;  1ONL A;  5JJL A;  4AYB G;  1WFQ A;  2VQF Q;  2LY7 A;  1DOL A;  3EQL C;  2PW7 A;  5FJ8 H;  5BN3 A;  3KOJ A;  1VF5 C;  1IL8 A;  3J81 L;  3TP7 A;  3PMF A;  1HA6 A;  1B44 D;  4AYB E;  5IGE A;  1WTX A;  1K28 A;  2JA7 G;  2K5N A;  1ZXT A;  2WFW A;  5D65 A;  1SYD A;  3TP5 A;  5K5P A;  3BDC A;  1KAW A;  4DV7 Q;  1SE3 A;  1PRT F;  1VMP A;  2NVY H;  1DOM A;  4A3I H;  3S2D B;  1FYC A;  1F9S A;  2K05 A;  1XPU A;  3I7F A;  2B63 G;  3DWA A;  4C3J B;  1PH4 A;  5CR3 A;  3W1G A;  1GVP A;  1TII D;  3GTP H;  2WB1 B;  4HIO A;  3UI2 A;  1J8I A;  3PO2 G;  1OXU A;  1BDO A;  3VR4 A;  4AH6 A;  4K5W A;  3L2P A;  5C3E B;  2E2J H;  4NXM Q;  1DZ1 A;  3KF8 A;  2AUK A;  1IBM L;  3S2H H;  1IYV A;  2G5D A;  4X62 Q;  3AMU A;  1MSH A;  4CJ2 C;  1HUN A;  2JJQ A;  3NWT A;  3Q24 A;  1VQ9 A;  1MSG A;  2F0D A;  2H4O A;  3L3O C;  1BBU A;  3K7A B;  1IW7 D;  5EJW A;  2RHQ B;  5E1F A;  1CZW A;  2F03 A;  3HRZ C;  2B2Y A;  2F0T A;  2F0N A;  2EZV A;  4X66 L;  1OXV A;  1V8Q A;  2WAQ G;  4DV2 L;  2F4V Q;  3U58 A;  3MXN B;  3GTL H;  3GQB A;  4HSP A;  5EKI A;  3V96 A;  2AHO B;  1EY5 A;  3X3N A;  5I2Y A;  1EL0 A;  5G3L D;  3PIP 3;  5FO8 B;  3H6M A;  3ER0 A;  2WAQ E;  2H1E A;  3O13 A;  1Y1W H;  2VQF L;  4FF3 A;  4KY5 A;  4WFN 3;  2E76 C;  4OGQ C;  4B3M L;  1I4H A;  3M4O H;  2BA1 A;  3CCE A;  2QDB A;  3EBE A;  4BY7 B;  4M1U B;  3HOW B;  1A63 A;  3GTG H;  4YY3 L;  1CKN A;  4L5T A;  2UXC Q;  1XX8 A;  1YBY A;  4WJW A;  4BBS G;  4C2M B;  4GOP C;  5KRU A;  1HRJ A;  3FVQ A;  2DY8 A;  2R92 H;  1HNX Q;  2NZO A;  4KD3 A;  5CV9 A;  2NB0 A;  3U50 C;  1JC7 A;  1UEB A;  4QQB X;  3X3M A;  4J6H A;  4Y7N H;  5IOC A;  1JJC B;  2B2U A;  2TMP A;  3K81 C;  5H1S E;  5JJZ A;  1O7Y A;  2AQ2 B;  2OTJ A;  1XJV A;  3A7A B;  1XNR L;  1VMC A;  4K0K L;  2BCO A;  1Z47 A;  3S17 B;  1G51 A;  1SJH D;  4HID A;  1WI5 A;  1MI2 A;  3E6Z X;  3VR6 A;  1K73 C;  4KJN A;  3ERO A;  2KHI A;  1BR9 A;  1D5Z C;  2RDF A;  1D6E C;  1NTG A;  3TEH B;  3CME A;  4RGO S;  3QB3 A;  1WD0 A;  3M3Y B;  2EDG A;  2VUM B;  4NXM L;  2GVA A;  4A3M B;  2A6H D;  3DM3 A;  4A3I G;  4DUY L;  4X62 L;  4KHV A;  4DR3 Q;  3DWP A;  5BR8 Q;  4CBV A;  5C44 H;  3A54 A;  2E5L Q;  1E2Z A;  2HUG A;  2KEN A;  2NVQ B;  3HOZ B;  1YZ6 A;  1Y8P B;  1A62 A;  4A76 A;  1HPC A;  2RKS A;  3GV3 A;  1SYE A;  2QDL A;  4EQO A;  4LAA A;  1WCM H;  2RBM A;  4C3H B;  3GTK H;  4A3G B;  2CW0 C;  3J81 E;  1SDF A;  2C9O A;  1HR0 W;  3S1Q H;  5JEA H;  2NUC A;  2DNC A;  4AIM A;  2F4V L;  2ENB A;  1PTO F;  4R8I A;  1LTL A;  1R9T H;  4GKK Q;  3BVG A;  4LF8 Q;  1QZG A;  2K52 A;  3UDI A;  2LS0 1;  5ISR A;  3NBI A;  1EFI D;  1CSQ A;  3BDO A;  1B9M A;  4IFD H;  1C9O A;  4JI0 Q;  2R7F A;  3I4O A;  3CCQ A;  1HFG A;  2QEX A;  4K5V A;  2A73 B;  3GTJ H;  1TS3 A;  1D7Q A;  2GN5 A;  1WJJ A;  3PIO A;  5M3F H;  5CV6 A;  3PUW A;  4JBJ A;  1CTM A;  1HNX L;  5GAG C;  1ICF B;  3M4Q A;  1YEZ A;  2F0M A;  3I72 A;  5C4X G;  1EYA A;  2DY7 A;  1A3U A;  1SYG A;  1ET6 A;  3HS0 C;  2XNA C;  3KJO A;  1BUV T;  1I4G A;  1PFM A;  3G4S A;  2R92 G;  1EOV A;  3CRK C;  4IOA A;  1FNW A;  2CHB D;  3MEH A;  4R8N A;  2HCI A;  2JXM B;  4AYB B;  2AWN A;  2K5V A;  1F2L A;  2DJG C;  1M90 C;  1SJE D;  1YNX A;  3G6E A;  2LMC B;  4DR3 L;  1V43 A;  1NMF A;  1NUC A;  2F3I A;  3M7N A;  4X6A H;  5BR8 L;  1J5E Q;  4HMI A;  4JBW A;  4MTK A;  4DKA C;  5EBD A;  4IJH A;  4V0B A;  1VQC A;  2Z6B A;  4DR2 Q;  5KYL A;  3Q22 A;  3FPU B;  2HT1 A;  1JOK A;  1Y1V H;  4TQU S;  5I9P A;  4LUO A;  3QOJ A;  1G6P A;  4A3K G;  4GS3 A;  1OXS C;  2FFK B;  2B63 B;  5J1Z A;  1V1Q A;  3M85 A;  1NR4 A;  1Q8I A;  5C44 G;  2FMC A;  1YJ9 A;  5COR A;  4LF8 L;  2JA5 B;  1B53 A;  2ZXP A;  5CV7 A;  1QZH A;  1EY6 A;  2R7Z B;  4FF2 A;  3KDF B;  4JBM A;  1DM0 B;  4Q5V A;  1ZEQ X;  3VR2 A;  3RLO A;  3C46 A;  1B1Z A;  1TWA B;  2KJX A;  4OEM B;  4CGY B;  1E22 A;  2PZT A;  5COY A;  1DCZ A;  2D62 A;  5JEA G;  3IFD A;  4L5S A;  2Q8R E;  2YTV A;  1IBK Q;  5L37 A;  1FGU A;  1XMO Q;  3UDX A;  1VQB A;  2A19 A;  1Q90 A;  4DV1 L;  4OEL B;  2EXD A;  4JCV E;  4G4K A;  4IFD G;  4IPC A;  1HNW Q;  2OF1 A;  1N33 Q;  2E2H B;  4GKJ L;  2GVB A;  2PQA B;  4OWX B;  4R4C A;  4B9X A;  2JA8 B;  1Q82 C;  2EVB A;  2EY2 A;  2NZH A;  2B8G A;  3OMC A;  3DWQ A;  1NAP A;  1B70 B;  2J4X A;  4OO1 G;  4RCO A;  3OHX C;  5C3E H;  1A2T A;  2PI2 A;  1B4O A;  5HUR A;  1STG A;  3G7L A;  2EIF A;  1TKW B;  4DR2 L;  3PUX A;  4MNO A;  3VDY A;  4NP5 A;  2IHE A;  4PMB A;  1LUZ A;  4HIM A;  4L63 B;  1LT4 D;  4LF6 Q;  2V1C C;  3GV6 A;  2D5D A;  3K0X A;  5IYB G;  2MNA A;  1X55 A;  4IAL A;  4O1N A;  1I3Q B;  3K57 A;  2ZXO A;  2WIN B;  4XIG S;  1GXD C;  5EAY A;  2Q2I A;  4GOP B;  2UUA Q;  1EY9 A;  1SAP A;  2ASB A;  3NBH B;  1AZQ A;  3HOV B;  1NNX A;  4JG2 A;  2ZJP A;  1KLU D;  1Y1V G;  3AEV A;  4DR4 Q;  1STB A;  1I6H H;  3DLL A;  4DV0 L;  3K80 C;  3QIA A;  4YCV A;  2IX1 A;  2C35 B;  1LT5 D;  1H9M A;  1IBK L;  3BS1 A;  1TS4 A;  1H9R A;  2ZTC A;  4BY7 H;  3MEF A;  1SNP A;  1SYF A;  3TBI B;  1IBL Q;  3HOW H;  1SN8 A;  2Q2T A;  3I2Z A;  4ZRZ A;  1XMO L;  3I4N H;  3PQI A;  3VA5 A;  2E74 C;  1BKB A;  4C2M H;  3KF6 A;  3CCM A;  2PNR C;  3KBX A;  2BDN A;  4LW1 A;  5KNB A;  1C8C A;  4EQP A;  5M5Y H;  2WKD A;  5DEH A;  2I5L X;  1F9Q A;  3MA2 B;  4FO2 A;  1HNW L;  1CKO A;  4OWW B;  2PNH A;  1V1P A;  3DUZ A;  4ZQ3 A;  4IUV A;  2OWO A;  3CMA A;  1HJP A;  2EXZ A;  1EYD A;  3M4P A;  2JA9 A;  1ET9 A;  1HUM A;  1YNJ C;  4DNT B;  1GM5 A;  2MGS A;  3I55 A;  5ELB A;  3OW2 A;  1BCP C;  4A3M H;  2VUM H;  2L9H A;  1VQO A;  1A0I A;  3OTO Q;  4C3J G;  4DAV A;  3PF4 A;  4IO9 A;  2CW0 D;  2EJM A;  1SE8 A;  5J39 A;  3NSW A;  3SK5 A;  4KLK A;  4DAY A;  3J80 L;  2NVQ H;  2XVS A;  4DV4 L;  3H3V H;  1RF2 D;  4JI2 Q;  3F2C A;  2HDL A;  1CHP D;  5C4X B;  3CU7 A;  1SE2 A;  5C3E G;  1NMG A;  3OOC A;  4C3H H;  4DK0 A;  1QVF A;  4A3G H;  4FXG C;  1BQQ T;  3U9O A;  4PZ6 A;  2UUA L;  1AEX A;  4A3B H;  5C5M A;  5AJ3 L;  1PH2 A;  4K6D A;  1CZG A;  1AN8 A;  5T1G A;  4FP5 D;  1XXG A;  4DR4 L;  1YHA A;  2B2Y C;  2BE5 C;  1S5E D;  1LAC A;  3GD7 A;  5C0X I;  1PHJ A;  1VQE A;  1FJG Q;  2EYF A;  3J7A V;  1ENF A;  4JYA Q;  3H0G H;  1U5K A;  1KL9 A;  1O78 A;  1KDA A;  4MIU A;  2EQS A;  2P5Z X;  2RDG A;  1JJ2 A;  3A5U A;  3W2D A;  4DR1 L;  3FPP A;  1HQR D;  2XRS D;  1GUW A;  1PH8 A;  2AQ3 B;  5CV8 A;  5F2D A;  3W5O A;  1N32 Q;  2QEJ C;  1S40 A;  4A3L H;  4DGZ A;  2R3Z A;  2KED A;  4BY7 G;  4QMG A;  3HOW G;  2NN6 I;  3S16 B;  1I50 H;  5BN5 A;  4A4I A;  4XT3 B;  1IYU A;  3PIP A;  4IQZ A;  2A6H C;  1L2F A;  4A3C G;  1Z6H A;  4J8Q A;  5C3X A;  3PO3 B;  3NEL A;  2B2U C;  2Z1C A;  2A5H A;  1CHQ D;  4DV6 Q;  2K04 A;  3G6J B;  4DR6 L;  4QJF A;  3LGJ A;  2Y0S E;  1Q8K A;  3OTO L;  2ES2 A;  4HED A;  3KJP A;  5IT9 c;  1Y8O B;  1FD7 D;  3T1H L;  4BBR B;  1BBW A;  4JI8 Q;  1HH2 P;  2KVM A;  2SEB D;  4PQX A;  4JI2 L;  2KCT A;  5IIF A;  5FLX c;  1STN A;  2L0C A;  2XWJ B;  4RG1 A;  2N88 A;  2N49 A;  1A2U A;  4JVZ A;  1EZ6 A;  2VUM G;  3CCU A;  1JCK B;  2I46 A;  3FMC A;  1FNU A;  2LKV A;  1LT6 D;  2K5D A;  3W1B A;  2B63 H;  2K01 A;  3L7Z C;  3G71 A;  2F0O A;  4XQJ A;  1T5E A;  2JP1 A;  3PO2 H;  4IOC A;  1HNZ Q;  1XPO A;  2JA5 H;  3MVV A;  2AWO A;  3HOZ G;  4IUR A;  1QUQ B;  2R7Z H;  1K3B C;  3KLW A;  2F0J A;  2PPB C;  1LTI D;  2I07 B;  3K8A A;  1VQD A;  4A3G G;  1TWA H;  4B3R Q;  3RUZ A;  1VQM A;  4BA2 I;  3H94 A;  2F0S A;  1PZK D;  2ZXR A;  3HG9 A;  1Q1E A;  1BOS A;  2K1B A;  1L1O A;  1BVS A;  5JPM C;  1S5B D;  2EPB A;  5I2X A;  1UAP A;  4LWC A;  2HQL A;  3ZJY C;  4BWG B;  1WTQ A;  2E2H H;  4GLX A;  4BY1 B;  3J80 E;  2CVR A;  2PO4 A;  3ULL A;  4OWT B;  1TVX A;  2OCE A;  3TRE A;  3I4M G;  2VL6 A;  4DFA A;  1IKM A;  3T13 A;  1K8O A;  3D4R A;  2WP8 J;  4C3I B;  2IT1 A;  2L12 A;  2Z6K C;  3AFQ A;  3AQQ A;  2K5Q A;  4GN3 B;  3NTK A;  2R93 B;  2J7Z A;  4BBS H;  3G48 A;  3W3A A;  4JI8 L;  1PFN A;  4XXE A;  3MWY W;  3RNU A;  1A3T A;  1ICW A;  2K5W A;  3NXW A;  1DD2 A;  1ZYR C;  4WOR A;  3SK6 A;  1LV9 A;  2F0L A;  1EYC A;  2MP1 A;  4IUT A;  4B3M Q;  2EE1 A;  3DHQ A;  1G2T A;  3AB9 A;  4PNY A;  1O7I A;  1I3Q H;  1VCI A;  1EYG A;  4YY3 Q;  4ZLT F;  1F2M A;  5ELD A;  1HNZ L;  1LTA D;  1CK1 A;  1TWH B;  5C4H A;  3TDQ A;  1RD9 D;  1SMY C;  4EX5 A;  1KDB A;  5DNF A;  2EJG C;  3CC2 A;  1G8Z D;  1X3Q A;  2CWA A;  1EZ8 A;  2F1M A;  3GTQ B;  4F7X A;  1SBB B;  1BO0 A;  4MTN A;  3CRL C;  4B3R L;  1G29 1;  1SLJ A;  3AFP A;  4TVA B;  3I3C A;  2F0W A;  2R6G A;  5GQO A;  2VB3 X;  1XNR Q;  4K0K Q;  4LUZ A;  2ZTE A;  1TQO A;  4NMZ A;  2G9H D;  4G7H C;  2JA5 G;  2RHS B;  5I6Y A;  1DYQ A;  4F88 A;  2R7Z G;  3UDF A;  4OXP A;  1LLR D;  1BCP B;  1RCV D;  4QB4 A;  3J80 i;  1X6O A;  1JE4 A;  4DUY Q;  1YNJ D;  1RL2 A;  4CKB A;  1WYD A;  2EYM A;  1BCP D;  1SEB D;  4ME3 A;  4IPG A;  4O0A A;  3SHL A;  1WD1 A;  4DA2 A;  2CQA A;  3KF8 B;  2F0E A;  1GO3 E;  3JAM i;  3GTM B;  3S24 A;  1QVC A;  3NTI A;  3PUV A;  4RGT A;  5GAH C;  4TSS A;  1FL0 A;  1H95 A;  4K5X A;  2ZJR A;  3VR5 A;  3J81 j;  1RJT A;  1EIH A;  2YYZ A;  1TWG B;  3F2U A;  3MZ5 A;  1EIG A;  3GDE A;  2JA8 G;  1YNN C;  3TZD A;  2K6A A;  2R61 A;  4LFA Q;  5C4X H;  2BE5 D;  2F52 A;  2VY3 A;  1VQN A;  3RD4 A;  1VQJ A;  4NXN L;  2EYH A;  5IY0 A;  3KFU A;  2Y0S B;  2TSS A;  4RA8 A;  1YHQ A;  3DMU A;  3AYH B;  1J6Q A;  1PZJ D;  3E9I A;  4RHR A;  3QWN A;  3KLS X;  5GAD C;  3L9A X;  1CKN B;  2DN8 A;  3S15 B;  4H0L C;  1PFS A;  4B3T L;  3OWE B;  3S14 B;  1XPR A;  2AMC B;  2CQO A;  3T1Y Q;  4HJA A;  2A74 C;  5LHY 1;  5G3L F;  3HOV G;  1CSP A;  4J15 A;  1HZC A;  4A3K H;  1PH3 A;  1STE A;  2K03 A;  4ULL A;  2F0U A;  1XNQ Q;  3H15 A;  1NE3 A;  5IT9 L;  1F2Z A;  2UXB Q;  4DU9 A;  4GN5 A;  4R4Q A;  5A2Q L;  3WOF A;  3S16 H;  1AP0 A;  3CCS A;  4XTC S;  4DXF A;  3VYS A;  1C0A A;  4A3E B;  5FLX L;  1IYJ B;  4CDC C;  4HJ7 A;  1SR3 A;  4ID6 A;  4ILW A;  4JW0 A;  1C48 A;  3QG1 A;  4RMF A;  4RKB A;  4CDE C;  3A8I E;  2A1A A;  4UP9 A;  1EQV A;  2YTX A;  3OIQ A;  3J80 c;  1TWC B;  2B2V C;  1EU4 A;  2PZW A;  3CC7 A;  4LFA L;  4XQN A;  2CKZ B;  4K14 A;  2I0Q A;  5IP9 H;  1JQY D;  2N55 A;  2E2I B;  4RWS C;  3R3O A;  3JAM c;  4H7B A;  1VS0 A;  4ZYS A;  3SK4 A;  1PH6 A;  1Q12 A;  4E6I A;  4U67 3;  5LL6 X;  2K5H A;  1TWF B;  4DXG A;  2Q2H A;  3DXJ C;  3I4M B;  1SNO A;  4DV1 Q;  3STB C;  5M5X H;  2JEA I;  1S3O A;  1KNA A;  4OO1 H;  4IJL A;  4KI0 A;  1EIF A;  2X6L A;  5M3M B;  1UE7 A;  1I94 L;  3HEJ A;  4KN4 C;  1OO9 B;  4GKJ Q;  2WKC A;  5CGK A;  3T1Y L;  4IUQ A;  2Z0S A;  1WTR A;  3HKZ B;  1XNQ L;  5IYB H;  1EWC A;  2IX0 A;  1PA6 A;  2WII B;  3R2T A;  3QO2 A;  5C4Z A;  4YWL A;  5KND A;  4LFC L;  3K5M A;  4BY1 H;  1LTB D;  2F0Q A;  1UE5 A;  2MO1 A;  2M2L A;  3BZC A;  3HOU G;  4FF4 A;  3HZX A;  1MD2 D;  3K0Y A;  4IUN A;  2ZJQ A;  3ULP A;  1HTP A;  4JI3 Q;  1DOK A;  1SRO A;  2A69 C;  3S1N B;  4CKC A;  1ZYR D;  1SFO H;  2MQH A;  3H91 A;  5ELN A;  4HAE A;  4K2K A;  4LJZ C;  3PO3 G;  2NVT B;  2MUY A;  2LFN A;  1SMY D;  4DV0 Q;  2N8N A;  4KY6 A;  5LMN Q;  3C3L A;  1E2W A;  1UEA B;  2ALY B;  1EEI D;  2IWH A;  3E0E A;  4BBR G;  5C0X J;  1C4Q A;  4BXX H;  1DXM A;  1K0S A;  2F0H A;  2WAC A;  3Q0A A;  1Z9F A;  1A6X A;  1YHB A;  2NVX B;  5JVG 3;  3SXH A;  3F8T A;  3IAY A;  5IT9 E;  5IP9 G;  5IOD A;  3S2D H;  1ASY A;  3K58 A;  1ZKO A;  4C3J H;  3CAM A;  3CHB D;  3HOY G;  1YIJ A;  1Q7Y C;  5FKA C;  1ML0 D;  4OX9 Q;  4JI6 Q;  2EYP A;  3BYY B;  4PMW A;  3NPP A;  5CBE E;  5FLX E;  3BVM A;  4IZ8 A;  3T53 B;  4A3J B;  3BG3 A;  1EUJ A;  1EOT A;  3SE0 A;  2KCM A;  4ABN A;  5CMD A;  1EY0 A;  2B2T A;  3SDZ A;  5KYI A;  1PH1 A;  1NY4 A;  4FDB A;  5JJI A;  5C0X G;  3ERQ A;  3TP6 A;  4YHH L;  2VXW A;  4CDD C;  1RIP A;  1JOQ A;  4DV4 Q;  1L0X B;  3K7A H;  1D1I A;  4JI3 L;  4B9W A;  3GTM H;  5A35 A;  1YNN D;  3A8J E;  3DEP A;  1E3P A;  2NBF A;  5C4J B;  1PRT C;  1I6V C;  2JSO A;  2GA4 B;  5AJ3 Q;  4LUV A;  5D14 A;  4BY1 G;  1TWG H;  1UE6 A;  3K5O A;  3J7Y W;  4GNX A;  1QOH A;  4R4T A;  1O7L A;  2PYK A;  2IHF A;  1CT1 D;  4JK1 C;  1K8G A;  2OEO A;  1Y69 U;  2F0K A;  3Q8D A;  1LTS D;  5LMN L;  1W6K A;  2B29 A;  1VQ4 A;  2F0I A;  5FK9 C;  1I4R A;  4C3I G;  4C56 C;  4U68 A;  4K8J A;  1A3V A;  4DR5 L;  1S72 A;  2PMZ B;  4NPS A;  2R93 G;  1CUK A;  1YVC A;  4Q0F A;  3I56 A;  2F3W A;  4RFB A;  4A3C H;  1T9H A;  3RN2 A;  1AH9 A;  1VQG A;  2O2L D;  1HA5 A;  1LTG D;  4QUF A;  2JEB I;  4DR1 Q;  1VQL A;  1Q46 A;  5LMU Q;  3R8B A;  5IYD G;  3PV0 A;  2PW5 A;  3MAQ A;  1LAB A;  4IUU A;  5IGF A;  4I7A A;  3A8K E;  1TU2 B;  4YCU A;  3S15 H;  3KF6 B;  4K2L A;  5E3F A;  3GTP B;  5EQ0 A;  3NHH A;  3S14 H;  4OX9 L;  1F9R A;  4JI6 L;  1P16 A;  1E2V A;  3A7L A;  4BXX G;  2QCP X;  2EY6 A;  3HP3 A;  3CC4 A;  3S1R B;  3S17 H;  4PV1 C;  2L1B A;  4R9W A;  3PF5 A;  5IGD A;  1G6Z A;  2I5M X;  5JJK A;  1V1P B;  1KIX A;  1JB7 A;  2C5C A;  1JWS D;  2E2J B;  1HQM C;  1H9S B;  3U4Z A;  3M3Y H;  4DR6 Q;  1EFW A;  4YWM A;  4MN3 A;  2BDO A;  2KOL A;  1STY A;  3NTH A;  1G2S A;  2FMM A;  3OW7 A;  1W3S A;  3ICE A;  3T1H Q;  2NWG A;  4WRD A;  1O80 A;  2RF4 A;  1SNQ A;  1E7Z A;  1SRU A;  3CKI B;  3SVM A;  1JJG A;  3HOZ H;  4WJ4 A;  5TSS A;  1KQS A;  4R1J A;  3MXU A;  4A3E H;  2MFI A;  4QL5 A;  3M9B A;  1PXU A;  1A15 A;  4DAY B;  1AW7 A;  2XIW A;  3BYT B;  3H09 A;  2FHT A;  4DNR B;  2CH4 W;  3I91 A;  2RCN A;  3S1M B;  3JAM L;  5I4D A;  1KC8 C;  1PYW D;  1EIY B;  3BVZ A;  4IUP A;  3F1Z A;  4HSV A;  3DM1 A;  1Y1W B;  5HGT A;  1GUO A;  4LF4 Q;  1R4P B;  3FDT A;  3MFY A;  1TWC H;  2O4X A;  2HDM A;  1E0B A;  2RA4 A;  3D4W A;  1LTT D;  3C1F A;  1DJR D;  3GTG B;  2XSC A;  3STB D;  1N9W A;  1K8A C;  3IKJ A;  3T56 B;  1HFN A;  2DUD A;  1II3 A;  2FJ2 A;  1W6J A;  2QGQ A;  1ESF A;  2E2I H;  4Z9C B;  2D2C C;  5E4W C;  3CP0 A;  3RZD B;  3HOU B;  5FO7 B;  1UUP A;  1QG7 A;  1GHK A;  3HOX G;  3NEM A;  4KKU A;  5LMU L;  1X54 A;  3I4M H;  3NK9 A;  2I5H A;  5AFW A;  1NBW A;  2QF7 A;  1MIU A;  2EY5 A;  1PZI D;  5EGT A;  3SEB A;  4MHE A;  1N8R C;  1Y8N B;  3N6R A;  4GLV B;  4HIK A;  2Y0S G;  3QJY A;  1PFB A;  3D0F A;  2VB2 X;  4N9T A;  1PTO C;  3E3X A;  2Q8T A;  3MXP A;  1YJW A;  4DNI A;  3NQT A;  3IRB A;  2ATW A;  3Q23 A;  1VQH A;  2JE6 I;  1W2B A;  3CF5 A;  1B2T A;  2FXQ A;  2Q2U A;  3RLF A;  2PQE A;  2A69 D;  3L0O A;  2MPM A;  2HHH Q;  4DN4 M;  1WCM B;  4OON A;  1L0W A;  3GTK B;  1BNZ A;  2Q8I B;  3S9W A;  3S1Q B;  4GN4 B;  1OTC A;  2UUC L;  4R4O A;  1EY8 A;  3HOY B;  1VQI A;  3TME A;  2VS1 A;  1R9T B;  4JI4 Q;  2IX3 A;  3D8G A;  1CFM A;  2MO0 A;  5JVH 3;  4F87 A;  1SYB A;  5D3D A;  1PVO A;  1JWU D;  4LF4 L;  4UY8 C;  2SDF A;  4A3E G;  1IL2 A;  1STA A;  1IXR A;  3D4D A;  3CCJ A;  1R4Q B;  2NYZ D;  3PCO B;  3WWV A;  1U9R A;  1S5F D;  2JN4 A;  4MZ9 A;  4X64 L;  1JB3 A;  1QUQ A;  1JT8 A;  2IL8 A;  3QOL A;  5M3F B;  4PZ8 A;  4JI1 L;  2IY5 B;  1EU3 A;  1YI2 A;  2HIX A;  4JI7 L;  3VYT A;  1JE5 A;  2PCF B;  2NVX H;  2YTY A;  1RHP A;  2UUB L;  4P75 A;  1JOO A;  1UWV A;  4UP8 A;  4ZK9 B;  1BBX C;  4KHP L;  2EJF C;  4A93 B;  4K6L A;  3C2P A;  1B3A A;  1B8A A;  4JI5 Q;  3GTO B;  3DEO A;  3FKI B;  4CJ1 B;  3A0J A;  5BN4 A;  2Z9H A;  3MFG A;  2JA8 H;  5DAU A;  1ILP A;  1X9N A;  1E1T A;  5IP7 H;  2B3G A;  4A3J H;  4DV5 L;  4P71 A;  4QCL A;  1D5M C;  3GP7 A;  2A6E C;  1AFP A;  1PRT B;  5M3M G;  2VNU D;  3JAM E;  3K5L A;  2F0P A;  3OYY A;  1H9K A;  2KHJ A;  2HHH L;  4P74 A;  1PRT D;  4ALP A;  5E7N A;  1MBY A;  2K14 A;  3HKZ G;  2R7D A;  1B9N A;  2EYJ A;  5CV4 A;  4A75 A;  4M8A A;  2L15 A;  1UNS A;  2DNE A;  4NXN Q;  4JI4 L;  3HFZ B;  4XQQ A;  1OXX K;  1HZB A;  3HKZ E;  1ASZ A;  4LF9 Q;  3E9H A;  2MJ8 A;  4CDF C;  5M9O A;  2J0T D;  3HOV H;  2ICE C;  5K36 G;  1ENA A;  1RDP D;  1RTO A;  2PZU A;  2LXJ A;  1GOZ A;  4ZKB B;  4HJ9 A;  1KDC A;  2EOT A;  4B3T Q;  3D6W A;  1N36 L;  4DAM A;  3V2T A;  1VQ6 A;  4PMC A;  4BS9 A;  1U4L A;  2BA0 A;  1LO5 D;  4V19 0;  1O7Z A;  5KNC A;  5EPL A;  1WTP A;  4X3T A;  2QKI C;  4TRD A;  4P72 A;  4ZUJ A;  1B50 A;  1XYI A;  3ND9 A;  4KMU C;  4ODG A;  4JI5 L; 
#chains in the Genus database with same CATH homology
 5EKK A;  4S3S A;  4EGV A;  3D3R A;  4XYQ A;  2QIL A;  4DF7 A;  5ELC A;  3EVQ A;  1TY0 A;  3I90 A;  2HQE A;  4KKT A;  1FGB D;  2F0V A;  4HMJ A;  1XWE A;  1GUS A;  2E2D C;  1L0Y B;  2XWB B;  5T1I A;  3HOX B;  3MXN A;  1CI3 M;  2ID0 A;  4EQN A;  2AUJ D;  2Z8L A;  2B2T C;  3M4Y A;  3A55 A;  3I70 A;  4NDX A;  5CBA E;  4X3U A;  2M00 A;  1CA6 A;  3LX0 A;  4QF4 A;  2ZT9 C;  2MHV A;  1HHV A;  1BCP F;  3KBG A;  1KAB A;  1GJX A;  1MGS A;  2KHS A;  1I6H B;  3WOE A;  3KUP A;  2F4I A;  3OPO A;  1X32 A;  3P1H A;  2EY1 A;  3I4N B;  4A3F B;  3RZO B;  1JR0 D;  1WTW A;  1VF7 A;  1PTO B;  4KJO A;  2L5T A;  2OXP A;  2EYL A;  4KK7 A;  1SND A;  5M5Y B;  3E0J A;  2X6G A;  1K8M A;  2Z4I A;  2B8F A;  2NTT A;  4OHJ A;  4XT1 B;  1PTO D;  4KY7 A;  4X3K A;  1BF4 A;  1J9O A;  4H44 C;  5I6W A;  1JOR A;  1RKN A;  1PMR A;  3T16 A;  2JA6 B;  1AZP A;  1WTV A;  1WVL A;  3K59 A;  1IHZ A;  3PUY A;  2FIN B;  1X3P A;  1S5D D;  1ESR A;  1K83 B;  3SR1 A;  3MC0 B;  4J1M A;  2HCC A;  1JIC A;  1TS2 A;  4XDX A;  1S5C D;  1PLF A;  1QE6 A;  2RQX A;  3M7G A;  2E75 C;  4LK1 C;  4A3B B;  2RSO A;  2NTS A;  4KTA A;  3T4A C;  2Z4H A;  2B2W A;  2L55 A;  1QJO A;  1ROD A;  2F3V A;  5J22 A;  3KLR A;  1QIL A;  3H0G B;  4RAU C;  2V4D A;  1EQT A;  1CA5 A;  1QNU A;  3CQZ B;  5C0X H;  1SYC A;  4L8J A;  5M5W B;  3LNN A;  3MHB A;  3C1E A;  2NZ1 D;  2XN9 C;  1I50 B;  2A6E D;  1STH A;  3V05 A;  1XTC D;  1CM9 A;  2IW3 A;  5CYU A;  1BXT A;  1EWH A;  2WV6 D;  3EFX D;  3IL8 A;  3NP8 A;  1F2Y A;  3BZD B;  5JPN C;  2SNS A;  2NN6 H;  5JEA J;  3T51 B;  2JA7 B;  4L6T B;  4G57 A;  1U4R A;  2ICI A;  4OIK A;  1NSN S;  1M8A A;  2KUM A;  4IFD J;  1GUG A;  3LWU A;  3VYR A;  5C5L A;  1GHJ A;  3VYU A;  4UAI A;  4FYD A;  3PO2 B;  1Q3L A;  2F0G A;  1SXT A;  3KK7 A;  1NR2 A;  5C3W A;  4ZAI A;  1I4Q A;  3SK8 A;  1FNV A;  4A3D B;  2B39 A;  1CQV A;  4IN3 A;  3ZYY X;  5A2Q E;  5IGG A;  5FO9 B;  5I9O A;  4XYO A;  4GZY C;  1HCZ A;  5KGU A;  1ENC A;  3MTS A;  3HGB A;  3OIP A;  3R2I A;  3KLS A;  1D2B A;  4HCE A;  5C6A A;  3I4L A;  1TS5 A;  3FRP B;  2WAQ B;  3IFT A;  4O42 A;  4KD4 A;  5IGC A;  5CV5 A;  2YU9 B;  5EKL A;  5JAV A;  3TN2 A;  1F77 A;  2O5J C;  4B08 A;  3I73 A;  5LL6 S;  2L4N A;  4BBS B;  1T5X D;  4FVM A;  4I65 A;  4NKL A;  4FXK C;  5D3I B;  2KCC A;  1ILQ A;  2A68 C;  2NN6 G;  3NBH A;  1SSO A;  4CHT B;  1SNM A;  5DM6 3;  5KIX A;  4KKS A;  1M4V A;  2NVY B;  4CJ0 B;  1EEF D;  4A3I B;  3NWS A;  2BOS A;  4K8I A;  1TY2 A;  1IKL A;  4OIJ A;  3GO5 A;  4KHZ A;  4HR7 B;  5ELE A;  1OXT A;  1KLG D;  3VR3 A;  1PTO H;  4ZUI A;  1FR3 A;  4I7Z C;  3MXG A;  5FOB B;  3S2H B;  4YIJ A;  1F9P A;  4ME5 A;  4RKL A;  1NCV A;  4BA1 I;  3P20 A;  4RGN A;  4C1N I;  4FNF A;  1I4X A;  5JOB A;  3PUZ A;  5CC4 A;  2JYO A;  3PIO 3;  1H9S A;  1HTL D;  1RTN A;  1HXY D;  4KN7 C;  4TKO B;  2KCN A;  3NUC A;  4N9P A;  3TP8 A;  2B2V A;  4IFD I;  4DAP A;  2RSN A;  3K6O A;  3URY A;  3GTL B;  3J7A F;  1IW7 C;  3ND8 A;  5E4X A;  1U4M A;  2IPK D;  5DM7 3;  3U9S A;  3M4O B;  2L11 A;  3D31 A;  3ONA B;  4HN7 A;  1S4Z A;  4UDU C;  1DON A;  4OO1 I;  2RVL A;  2X69 A;  2R92 B;  5EBC A;  2SOB A;  1KTK A;  4X3S A;  3EJI A;  1V1O A;  3NE5 B;  2G9D A;  3E5S A;  4Y7N B;  3A56 A;  2O5I C;  1SNC A;  1EY7 A;  3R93 A;  4RCN A;  1PDQ A;  5EPK A;  4C1N K;  2K33 A;  1CQF A;  3OMG A;  5IGB A;  2KEC A;  4A3K B;  2IJ0 A;  1LT3 D;  2M9V A;  3VA7 A;  3TSS A;  1LTR D;  2K32 A;  5C44 B;  3Q6S A;  4P2C B;  4KV6 A;  2K28 A;  3OWF A;  1GUT A;  3N52 A;  4FF1 A;  2AQ1 B;  5K36 H;  1GUN A;  2KQ3 A;  1D5X C;  3K5N A;  1TT2 A;  1Z7T A;  1TR5 A;  4DK1 A;  3H3V C;  4G7Z C;  4QIW B;  1WTO A;  3EA6 A;  2EYO A;  1D1K A;  4H13 C;  4EVO A;  3GTJ B;  3RMH A;  1VDZ A;  1EY4 A;  3WDN A;  2K7V A;  5M5X B;  1U4P A;  5EPJ A;  4ZKC B;  2XRQ D;  4C3H G;  3TZU A;  3ITP A;  4RH6 A;  4F8M A;  4G7O C;  1KNE A;  3P7J A;  2B2W C;  1H9J A;  4RHS A;  3FEW X;  4FXD A;  3LWE A;  5KEE A;  3I8Z A;  4HCS A;  4OL7 A;  4LMQ D;  1QB5 D;  2F0F A;  1QNK A;  1QWY A;  3AU7 A;  3D6C A;  2KA7 A;  3BDL A;  5NUC A;  1Q1B A;  1JWM D;  2SNM A;  1Y1V B;  5ELF A;  4NW2 A;  2OT2 A;  1G91 A;  3OSO A;  4CKE A;  2RDH A;  2D9U A;  1SFO B;  2KEE A;  1I4P A;  2A68 D;  1QCB D;  1KAA A;  3P75 A;  4QUC A;  3NQI A;  1SE4 A;  4HTH A;  4RGM A;  1ONL A;  2LY7 A;  1DOL A;  3EQL C;  2PW7 A;  5BN3 A;  1VF5 C;  1IL8 A;  3J81 L;  3TP7 A;  3PMF A;  1HA6 A;  1B44 D;  5IGE A;  1WTX A;  1ZXT A;  5D65 A;  1SYD A;  3TP5 A;  5K5P A;  3BDC A;  1SE3 A;  1PRT F;  1VMP A;  1DOM A;  3S2D B;  1FYC A;  1F9S A;  2K05 A;  3DWA A;  4C3J B;  5CR3 A;  1TII D;  2WB1 B;  3UI2 A;  1J8I A;  1OXU A;  1BDO A;  3VR4 A;  4K5W A;  5C3E B;  1DZ1 A;  3KF8 A;  2AUK A;  1IYV A;  3AMU A;  1MSH A;  4CJ2 C;  1HUN A;  3NWT A;  3Q24 A;  1MSG A;  2F0D A;  2H4O A;  3L3O C;  3K7A B;  1IW7 D;  5EJW A;  5E1F A;  1CZW A;  2F03 A;  3HRZ C;  2B2Y A;  2F0T A;  2F0N A;  2EZV A;  1OXV A;  1V8Q A;  3GQB A;  4HSP A;  5EKI A;  3V96 A;  1EL0 A;  3X3N A;  5I2Y A;  1EY5 A;  5G3L D;  3PIP 3;  5FO8 B;  3H6M A;  2H1E A;  3O13 A;  4FF3 A;  4KY5 A;  4WFN 3;  2E76 C;  4OGQ C;  1I4H A;  2BA1 A;  2QDB A;  4BY7 B;  4M1U B;  3HOW B;  1XX8 A;  4WJW A;  4C2M B;  5KRU A;  1HRJ A;  3FVQ A;  2DY8 A;  4KD3 A;  5CV9 A;  2NB0 A;  1JC7 A;  3X3M A;  4J6H A;  5IOC A;  2B2U A;  2TMP A;  5JJZ A;  1O7Y A;  2AQ2 B;  3A7A B;  1VMC A;  2BCO A;  1Z47 A;  3S17 B;  1SJH D;  1MI2 A;  3E6Z X;  3VR6 A;  4KJN A;  3ERO A;  1BR9 A;  1D5Z C;  2RDF A;  1D6E C;  4RGO S;  3QB3 A;  1WD0 A;  3M3Y B;  2EDG A;  2VUM B;  4A3M B;  2A6H D;  4KHV A;  3DWP A;  4CBV A;  3A54 A;  1E2Z A;  2HUG A;  2NVQ B;  3HOZ B;  1Y8P B;  1HPC A;  2RKS A;  3GV3 A;  1SYE A;  4EQO A;  4LAA A;  2RBM A;  4C3H B;  4A3G B;  2CW0 C;  3J81 E;  1SDF A;  2C9O A;  5JEA H;  2NUC A;  2DNC A;  2ENB A;  1PTO F;  4R8I A;  3BVG A;  2LS0 1;  5ISR A;  3NBI A;  1EFI D;  3BDO A;  1B9M A;  4IFD H;  1HFG A;  4K5V A;  2A73 B;  1TS3 A;  5CV6 A;  3PUW A;  1CTM A;  2F0M A;  3I72 A;  1EYA A;  2DY7 A;  1A3U A;  1SYG A;  1ET6 A;  3HS0 C;  2XNA C;  1BUV T;  1I4G A;  1PFM A;  3CRK C;  1FNW A;  2CHB D;  3MEH A;  4R8N A;  2HCI A;  2JXM B;  4AYB B;  2AWN A;  1F2L A;  1SJE D;  2LMC B;  1V43 A;  3M7N A;  1NUC A;  4HMI A;  4JBW A;  5EBD A;  4V0B A;  5KYL A;  3Q22 A;  3FPU B;  1JOK A;  4TQU S;  5I9P A;  3QOJ A;  1OXS C;  2FFK B;  2B63 B;  5J1Z A;  3M85 A;  1NR4 A;  1Q8I A;  2FMC A;  5COR A;  2JA5 B;  1B53 A;  2ZXP A;  5CV7 A;  1EY6 A;  2R7Z B;  4FF2 A;  1DM0 B;  4Q5V A;  1ZEQ X;  3VR2 A;  3C46 A;  1B1Z A;  1TWA B;  2KJX A;  4CGY B;  2PZT A;  5COY A;  1DCZ A;  2D62 A;  5JEA G;  3IFD A;  2Q8R E;  1Q90 A;  4G4K A;  4IFD G;  2OF1 A;  2E2H B;  4B9X A;  2JA8 B;  2EVB A;  2EY2 A;  2B8G A;  3OMC A;  3DWQ A;  1NAP A;  2J4X A;  4OO1 G;  4RCO A;  3OHX C;  1A2T A;  1B4O A;  5HUR A;  1STG A;  3G7L A;  1TKW B;  3PUX A;  4NP5 A;  4PMB A;  4L63 B;  1LT4 D;  3GV6 A;  2D5D A;  4O1N A;  4IAL A;  1I3Q B;  3K57 A;  2ZXO A;  2WIN B;  4XIG S;  1GXD C;  1EY9 A;  1SAP A;  1AZQ A;  3HOV B;  1KLU D;  1STB A;  3QIA A;  2IX1 A;  1LT5 D;  1H9M A;  3BS1 A;  1TS4 A;  1H9R A;  1SNP A;  1SYF A;  3TBI B;  4ZRZ A;  3VA5 A;  2E74 C;  2PNR C;  3KBX A;  2BDN A;  5KNB A;  1C8C A;  4EQP A;  2WKD A;  5DEH A;  1F9Q A;  3MA2 B;  4FO2 A;  1V1P A;  3DUZ A;  4ZQ3 A;  4IUV A;  2EXZ A;  1EYD A;  1ET9 A;  1HUM A;  1YNJ C;  4DNT B;  2MGS A;  5ELB A;  1BCP C;  2L9H A;  4C3J G;  4DAV A;  2CW0 D;  2EJM A;  5J39 A;  3NSW A;  3SK5 A;  4DAY A;  3J80 L;  2XVS A;  1RF2 D;  2HDL A;  1CHP D;  5C4X B;  3CU7 A;  1SE2 A;  3OOC A;  4DK0 A;  4FXG C;  1BQQ T;  3U9O A;  1AEX A;  5C5M A;  4K6D A;  1CZG A;  1AN8 A;  5T1G A;  4FP5 D;  1XXG A;  5C0X I;  2B2Y C;  2BE5 C;  1S5E D;  1LAC A;  3GD7 A;  2EYF A;  3J7A V;  1ENF A;  1O78 A;  1KDA A;  4MIU A;  2RDG A;  3W2D A;  3FPP A;  1HQR D;  2XRS D;  1GUW A;  2AQ3 B;  5CV8 A;  5F2D A;  2QEJ C;  4DGZ A;  2R3Z A;  2KED A;  4QMG A;  2NN6 I;  3S16 B;  5BN5 A;  4XT3 B;  1IYU A;  4IQZ A;  2A6H C;  1Z6H A;  4J8Q A;  5C3X A;  3PO3 B;  2B2U C;  2Z1C A;  2A5H A;  1CHQ D;  2K04 A;  3G6J B;  4HED A;  1Y8O B;  1FD7 D;  4BBR B;  2KVM A;  2SEB D;  4PQX A;  5IIF A;  1STN A;  2L0C A;  2XWJ B;  2N88 A;  1A2U A;  1EZ6 A;  1JCK B;  2I46 A;  3FMC A;  1FNU A;  2LKV A;  1LT6 D;  2K5D A;  2K01 A;  3L7Z C;  2F0O A;  4XQJ A;  1T5E A;  2JP1 A;  3MVV A;  2AWO A;  4IUR A;  2PPB C;  2F0J A;  1LTI D;  2I07 B;  3RUZ A;  4BA2 I;  3H94 A;  2F0S A;  1PZK D;  2ZXR A;  3HG9 A;  1Q1E A;  1BOS A;  2K1B A;  5JPM C;  1S5B D;  2EPB A;  5I2X A;  1UAP A;  4BWG B;  1WTQ A;  4BY1 B;  3J80 E;  2CVR A;  2PO4 A;  1TVX A;  4DFA A;  1K8O A;  1IKM A;  3T13 A;  3D4R A;  2WP8 J;  4C3I B;  2IT1 A;  2L12 A;  2K5Q A;  3NTK A;  2R93 B;  2J7Z A;  3W3A A;  1PFN A;  4XXE A;  3MWY W;  1A3T A;  1ICW A;  2K5W A;  3NXW A;  1DD2 A;  4WOR A;  1ZYR C;  3SK6 A;  1LV9 A;  2F0L A;  1EYC A;  2MP1 A;  4IUT A;  2EE1 A;  3DHQ A;  1G2T A;  3AB9 A;  4PNY A;  1VCI A;  4ZLT F;  1F2M A;  5ELD A;  1LTA D;  1CK1 A;  1TWH B;  5C4H A;  3TDQ A;  1RD9 D;  1SMY C;  1KDB A;  5DNF A;  2EJG C;  1G8Z D;  1X3Q A;  1EZ8 A;  2F1M A;  3GTQ B;  4F7X A;  1SBB B;  1BO0 A;  3CRL C;  1G29 1;  3I3C A;  2F0W A;  2R6G A;  2VB3 X;  1TQO A;  4NMZ A;  2G9H D;  4G7H C;  5I6Y A;  1DYQ A;  4F88 A;  1LLR D;  1BCP B;  1RCV D;  4QB4 A;  1JE4 A;  1YNJ D;  4CKB A;  2EYM A;  1BCP D;  1SEB D;  3SHL A;  1WD1 A;  4DA2 A;  2CQA A;  2F0E A;  3GTM B;  3NTI A;  3PUV A;  4RGT A;  4TSS A;  4K5X A;  3VR5 A;  1EIH A;  1RJT A;  2YYZ A;  1TWG B;  3F2U A;  3MZ5 A;  1EIG A;  1YNN C;  3TZD A;  2K6A A;  2R61 A;  2BE5 D;  3RD4 A;  2EYH A;  2Y0S B;  2TSS A;  4RA8 A;  3DMU A;  1PZJ D;  4RHR A;  3QWN A;  3KLS X;  3L9A X;  2DN8 A;  3S15 B;  4H0L C;  3OWE B;  3S14 B;  2A74 C;  5LHY 1;  5G3L F;  1STE A;  2K03 A;  4ULL A;  2F0U A;  5IT9 L;  1F2Z A;  4DU9 A;  5A2Q L;  3WOF A;  1AP0 A;  4XTC S;  4DXF A;  3VYS A;  4A3E B;  5FLX L;  4ID6 A;  4ILW A;  1C48 A;  3QG1 A;  4RKB A;  3A8I E;  1EQV A;  3OIQ A;  1TWC B;  2B2V C;  1EU4 A;  2PZW A;  4XQN A;  4K14 A;  1JQY D;  2N55 A;  2E2I B;  4RWS C;  3R3O A;  4H7B A;  4ZYS A;  3SK4 A;  1Q12 A;  4E6I A;  4U67 3;  5LL6 X;  1TWF B;  4DXG A;  3DXJ C;  3I4M B;  1SNO A;  2JEA I;  1KNA A;  4OO1 H;  4KI0 A;  2X6L A;  5M3M B;  3HEJ A;  4KN4 C;  1OO9 B;  2WKC A;  5CGK A;  4IUQ A;  1WTR A;  3HKZ B;  1EWC A;  2IX0 A;  2WII B;  3R2T A;  3QO2 A;  5C4Z A;  5KND A;  3K5M A;  1LTB D;  2F0Q A;  2M2L A;  4FF4 A;  3HZX A;  1MD2 D;  3K0Y A;  4IUN A;  1HTP A;  1DOK A;  2A69 C;  3S1N B;  4CKC A;  1ZYR D;  3H91 A;  4HAE A;  4K2K A;  4LJZ C;  2NVT B;  2MUY A;  2LFN A;  1SMY D;  4KY6 A;  3C3L A;  1E2W A;  1UEA B;  1EEI D;  2IWH A;  5C0X J;  1C4Q A;  1DXM A;  2F0H A;  2WAC A;  3Q0A A;  1A6X A;  2NVX B;  5JVG 3;  3SXH A;  3IAY A;  5IT9 E;  5IOD A;  3K58 A;  1ZKO A;  3CHB D;  5FKA C;  1ML0 D;  2EYP A;  3BYY B;  4PMW A;  3NPP A;  5CBE E;  5FLX E;  3BVM A;  4IZ8 A;  3T53 B;  4A3J B;  3BG3 A;  1EOT A;  3SE0 A;  4ABN A;  5CMD A;  1EY0 A;  2B2T A;  3SDZ A;  5KYI A;  5C0X G;  3ERQ A;  3TP6 A;  2VXW A;  1JOQ A;  1L0X B;  1D1I A;  4B9W A;  5A35 A;  1YNN D;  3A8J E;  3DEP A;  2NBF A;  5C4J B;  1PRT C;  1I6V C;  2JSO A;  2GA4 B;  5D14 A;  3J7Y W;  3K5O A;  1QOH A;  1O7L A;  2PYK A;  1CT1 D;  4JK1 C;  2OEO A;  1Y69 U;  2F0K A;  1LTS D;  1W6K A;  2F0I A;  5FK9 C;  1I4R A;  4C3I G;  4C56 C;  4U68 A;  4K8J A;  1A3V A;  2PMZ B;  4Q0F A;  2F3W A;  4RFB A;  2O2L D;  1HA5 A;  4QUF A;  1LTG D;  2JEB I;  3R8B A;  3PV0 A;  2PW5 A;  3MAQ A;  1LAB A;  4IUU A;  5IGF A;  3A8K E;  1TU2 B;  4K2L A;  5E3F A;  3GTP B;  5EQ0 A;  3NHH A;  1F9R A;  1E2V A;  3A7L A;  2QCP X;  2EY6 A;  3HP3 A;  3S1R B;  4PV1 C;  2L1B A;  4R9W A;  5IGD A;  1G6Z A;  1V1P B;  2C5C A;  1JWS D;  2E2J B;  1HQM C;  1H9S B;  4MN3 A;  2BDO A;  2KOL A;  1STY A;  3NTH A;  1G2S A;  2FMM A;  3OW7 A;  2NWG A;  4WRD A;  1O80 A;  1SNQ A;  3CKI B;  3SVM A;  5TSS A;  3MXU A;  1PXU A;  1A15 A;  1AW7 A;  2XIW A;  3BYT B;  3H09 A;  2FHT A;  4DNR B;  3I91 A;  3S1M B;  3JAM L;  5I4D A;  1PYW D;  3BVZ A;  4IUP A;  4HSV A;  3DM1 A;  1Y1W B;  5HGT A;  1GUO A;  1R4P B;  3FDT A;  3MFY A;  2O4X A;  2HDM A;  1E0B A;  2RA4 A;  3D4W A;  1LTT D;  3C1F A;  1DJR D;  3GTG B;  2XSC A;  3IKJ A;  3T56 B;  1HFN A;  2FJ2 A;  1II3 A;  1W6J A;  1ESF A;  4Z9C B;  2D2C C;  5E4W C;  3RZD B;  3HOU B;  5FO7 B;  1UUP A;  1QG7 A;  1GHK A;  4KKU A;  3NK9 A;  5AFW A;  2QF7 A;  2EY5 A;  1PZI D;  5EGT A;  3SEB A;  4MHE A;  1Y8N B;  3N6R A;  3QJY A;  1PFB A;  4N9T A;  2VB2 X;  1PTO C;  2Q8T A;  3MXP A;  3NQT A;  3Q23 A;  2JE6 I;  1B2T A;  3RLF A;  2PQE A;  2A69 D;  2MPM A;  4DN4 M;  1WCM B;  3GTK B;  1BNZ A;  2Q8I B;  3S9W A;  3S1Q B;  1EY8 A;  3HOY B;  3TME A;  1R9T B;  2IX3 A;  3D8G A;  1CFM A;  5JVH 3;  4F87 A;  1SYB A;  5D3D A;  1JWU D;  2SDF A;  1STA A;  3D4D A;  1R4Q B;  2NYZ D;  1U9R A;  1S5F D;  1JB3 A;  2IL8 A;  3QOL A;  5M3F B;  1EU3 A;  3VYT A;  2PCF B;  1RHP A;  4ZK9 B;  1JOO A;  1BBX C;  2EJF C;  4A93 B;  4K6L A;  3C2P A;  1B3A A;  3GTO B;  3DEO A;  3FKI B;  4CJ1 B;  5BN4 A;  3MFG A;  5DAU A;  1ILP A;  4QCL A;  1D5M C;  2A6E C;  3GP7 A;  1AFP A;  1PRT B;  2VNU D;  3JAM E;  3K5L A;  2F0P A;  1H9K A;  1PRT D;  1MBY A;  1B9N A;  2EYJ A;  5CV4 A;  4M8A A;  1UNS A;  2DNE A;  4XQQ A;  1OXX K;  2MJ8 A;  5M9O A;  2J0T D;  2ICE C;  5K36 G;  1ENA A;  1RDP D;  1RTO A;  2PZU A;  1GOZ A;  4ZKB B;  1KDC A;  2EOT A;  3D6W A;  3V2T A;  4PMC A;  4BS9 A;  1U4L A;  2BA0 A;  1LO5 D;  4V19 0;  1O7Z A;  5KNC A;  5EPL A;  1WTP A;  4X3T A;  2QKI C;  4TRD A;  4ZUJ A;  1B50 A;  1XYI A;  3ND9 A;  4KMU C;  4ODG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...