1F9QA

Crystal structure of platelet factor 4
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
64
structure length
64
Chain Sequence
DLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-Type Reveals the Epitopes for the Heparin-Induced Thrombocytopenia Antibodies
rcsb
molecule keywords PLATELET FACTOR 4
source organism Homo sapiens
molecule tags Blood clotting
total genus 8
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9qA00
2K28A 1G2TA 2KVMA 5EPLA 1U4MA 2HDLA 2L4NA 4MHEA 1BF4A 1WVLA 1ILPA 3D6WA 2FMMA 1CM9A 2L12A 2KOLA 1AP0A 3UI2A 1EOTA 2FHTA 3ONAB 4XT3B 1SSOA 1EIGA 1MSGA 1VMCA 2K03A 3QO2A 4OIKA 4X3TA 1IL8A 1RJTA 3IL8A 2MPMA 4CJ2C 1HRJA 1VMPA 1JICA 2K1BA 5AFWA 2KEDA 2CVRA 1X32A 1NR4A 1E0BA 2K05A 2B2UC 1NCVA 1RODA 1SDFA 2FJ2A 1RTOA 4X3SA 4R8IA 1WD0A 1MGSA 1XX8A 1PFBA 1B50A 2B2UA 3FDTA 4HSVA 3I8ZA 5CMDA 2RA4A 1CA6A 2NZ1D 1WTQA 2BDNA 1O80A 1F9PA 4MN3A 2Q8TA 1CA5A 1SAPA 2J7ZA 1ESRA 1U4RA 2MJ8A 1PFMA 1U4PA 1PLFA 1DOLA 4CJ1B 2FFKB 5CBEE 2EOTA 5T1IA 1DONA 5CORA 1WTWA 5E4XA 2RSNA 4RAUC 4RWSC 4HEDA 3SVMA 1BBXC 2MP1A 4UAIA 2X6LA 1F9RA 4IUVA 4IURA 1HHVA 4ZKCB 1MSHA 1GUWA 3FPUB 1X3QA 4DN4M 1PDQA 3TZDA 5COYA 1WTVA 4ZKBB 1WTPA 5EPKA 4ZLTF 4X3UA 1BO0A 2H1EA 1O7YA 5CBAE 1PFNA 4O42A 5JJZA 1XYIA 1QE6A 3DM1A 3IFDA 1C8CA 3KUPA 4LMQD 2R3ZA 3I90A 3KBXA 2D9UA 2KECA 3F2UA 1IKMA 1RHPA 3I91A 1WD1A 1J8IA 2NYZD 1WTOA 1IKLA 2VXWA 3N52A 3MWYW 5EJWA 1DOMA 1J9OA 5D65A 2MGSA 3GV3A 2XIWA 1RTNA 5D14A 2X6GA 2IL8A 2KUMA 4QUFA 1F9QA 4IUUA 1HFNA 1HUMA 1HA6A 1MI2A 2X69A 1G2SA 1JE4A 1B3AA 1ML0D 1B4OA 3GV6A 2EPBA 1B2TA 1ZXTA 1KNAA 2KEEA 2DY7A 2L1BA 4IUPA 2B2WC 2B2YA 1X3PA 1EQTA 1HUNA 3P7JA 2B2WA 4RA8A 1B53A 1A15A 2HDMA 2K01A 3H91A 4NW2A 4U68A 4XT1B 2N55A 5EQ0A 4ZAIA 4ZK9B 1M8AA 2DY8A 4IUQA 4R9WA 1LV9A 2JP1A 1WTXA 1AZQA 2HCCA 2N88A 5E4WC 1NR2A 5T1GA 1EL0A 1ICWA 1Q3LA 2B2TC 1DOKA 1HFGA 1F2LA 2EE1A 2FINB 1S4ZA 3G7LA 1F9SA 2B2TA 2RVLA 1G6ZA 1QG7A 1TVXA 2HUGA 2Q8RE 2M2LA 3MTSA 4X3KA 1ILQA 2RSOA 2HCIA 2SDFA 3HP3A 4XDXA 1BNZA 4HAEA 1G91A 1QNKA 3DEOA 2L9HA 1KNEA 3DEPA 1DZ1A 1U4LA 2B2YC 2NWGA 4IUTA 4HCSA 2K04A 5DNFA 5EKIA 4QUCA 2B2VC 4OIJA 1O7ZA 2L11A 3Q6SA 3R93A 3TN2A 4CJ0B 1WTRA 1AZPA 1NAPA 5EPJA 2B2VA 3I3CA 1EIHA 3LWEA 2JYOA
chains in the Genus database with same CATH superfamily
1STNA 2BA1A 4I7ZC 4MHEA 1BF4A 4CKCA 1X56A 4A3MG 3H09A 1AP0A 2L12A 3EQLC 2I5MX 1I3QB 2CW0C 2GN5A 2IHEA 2IX1A 3JAMc 1VMPA 4KK7A 3W5OA 1HR0L 2UXBL 3BVMA 3J7AV 3R2TA 3NXWA 3HKZG 1JMCA 1TWCB 4B3RL 1PTOD 1EIFA 4GKKQ 1I3QH 4CBVA 4K2KA 2OT2A 3W1GA 4LJZC 1WTQA 1KL9A 5CYUA 4GKJQ 1O80A 2HHHL 5DM73 4JPBW 1TWCH 4A3BB 2EVBA 3S24A 3GD7A 4GN3B 3JAME 3T1YL 4TSSA 3EA6A 1CHPD 1YJ9A 5G3LD 4JOIA 1NE3A 1I4GA 3KF8A 4IURA 5I6YA 4A3BH 1HHVA 4JW0A 4DN4M 3BZDB 3J81L 2H1EA 5FO9B 4YY3L 5JJZA 3WOFA 5BN3A 4WRDA 4A3DH 1SROA 4QF4A 3SR1A 4DR3Q 2MUYA 1JOKA 2R3ZA 1KXLA 3F2UA 3HFZB 3PGZA 3F2CA 3N52A 5KNBA 3MWYW 1QB5D 4TKOB 3TP6A 4AYBE 4X62Q 4NKLA 1CK1A 4OO1G 2IL8A 4HTHA 2Q2HA 2UXCQ 4HIDA 1F9QA 2A8VA 1LO5D 4C3JG 3E9HA 5K36G 3HOYG 4QB4A 2A6EC 4KD3A 5C3XA 3ZYYX 1NBWA 4QMGA 1HTLD 4I7AA 4JI5Q 4YCVA 5JOBA 4CKBA 2R93G 2JXMB 2I07B 4ZAIA 2XRQD 4L5RC 4OXPA 2JA5B 5T1GA 3K0YA 1HNXQ 1PRTC 4A3KB 1AW7A 1JOOA 1MD2D 1YNJC 4A3IB 2B2TA 4DNRB 2WKCA 4PNYA 4X3KA 2JA5H 2QCPX 2SDFA 1A2TA 3QB3A 2R7ZB 1QUQA 4A3KH 3H15A 1DZ1A 3PIOA 4O1NA 4A3IH 5EKIA 3VR4A 2EYHA 1DJRD 1TKWB 5M3FB 2VUMB 1OXUA 4K6DA 2B2VA 2R7ZH 1E1TA 3MZ5A 3LWEA 2ES2A 1XMQL 5M3FH 2VUMH 3VA5A 3A74A 3A7AB 1EOTA 3BG3A 3ONAB 2I0QA 3S15B 1MSGA 2AQ1B 3SEBA 1EY0A 1PRTF 4B9XA 1SYCA 3NUCA 1NMGA 4R4IA 1STGA 4DV0Q 1U0LA 3S15H 1IXRA 1MGSA 4A3MB 4EGVA 3GTQB 3QIAA 3RZOB 4DR5Q 3ND9A 3QJYA 1QVGA 4IFDG 4DR7L 3I2ZA 4BY7G 1LT3D 3CCQA 4A3MH 4C2MB 1YITA 3HKZB 1XPRA 4LW1A 4F87A 3RZOH 2EXDA 1SNPA 3SK6A 3WOEA 1XXGA 1EUJA 4UP9A 4V190 4C2MH 2WP8J 3Q23A 1PH1A 1WTVA 2HIVA 2AUKA 1FYCA 4RGNA 5CBAE 4Q5VA 1SYFA 1QE6A 1SEBD 1N8RC 3PIP3 1JJ2A 2UXDQ 3PUWA 1GXDC 5F2DA 1WTOA 2DJFC 2F0WA 3NTKA 4K0KQ 3K57A 1VQ4A 3DWAA 2E76C 3BDLA 2EYFA 1QJOA 1I94L 4XQNA 1YHQA 4FF3A 2OTLA 3ERQA 5I9OA 1NNXA 1EQTA 3SK4A 1C48A 3U9SA 2PO4A 2KJXA 4RA8A 4DXFA 4B3TQ 4U68A 2JE6I 1HA5A 5DAUA 1X54A 1WTXA 1X3GA 5KNCA 4JI2L 1NR2A 3PO3G 3GTKB 1EEFD 2D62A 1GM5A 1UE6A 2B2TC 2F0IA 3K80C 5C3EG 1RIPA 4H44C 2XRSD 3HOYH 2YU9B 1QG7A 3WDNA 3MTSA 4U673 3GTKH 5IGGA 3HP3A 1G91A 3BDOA 1FJGQ 3M4QA 1M90C 4A93G 1L0WA 2NWGA 3M9BA 1KC8C 1LYLA 3FPPA 3PUXA 5DNFA 2R93H 2B2VC 3J7AF 5EKLA 2F0MA 2QDBA 2UUCQ 4TRDA 3ULLA 5K5PA 1CM9A 2DNCA 3CCMA 4KHVA 1R4QB 4KN4C 1K3RA 4JBMA 4DV6L 1HQMC 2V1CC 2K1BA 4JI3L 1SMXA 2AQ2B 3MAQA 1PVOA 1ZKOA 4XQQA 1HZCA 1B1ZA 4IOCA 3NTIA 5FLMG 4K5VA 3EN2A 3S1QB 4PZ6A 2NZ1D 1J6QA 4L5SA 2NN6I 4Z9CB 1HR0W 4KD4A 1A8VA 1PYSB 5DLQE 1VQNA 2IX3A 2K5HA 3JAML 1NSNS 2WAQE 5D3IB 3S1QH 2H5XA 1D6EC 1X3FA 1HPCA 1WI5A 4RHRA 3NWTA 3D4WA 3K7AB 1STYA 4BY7B 1TR5A 4BXXG 1X3QA 3MXGA 5FO8B 2BOSA 2E74C 1E7ZA 2ZTEA 4DKAC 5C0XJ 1TS5A 3K7AH 4IFDH 4BY7H 4A3JG 1G8ZD 1SJED 3QOJA 1VCIA 1PH2A 2ALYB 2XVSA 2K5WA 4KKTA 3ULPA 1XTCD 2SEBD 1AE2A 4IJHA 4K8JA 4M1UB 1PFSA 3DXJC 3J80c 2BH2A 4WJ4A 3HOWB 2L5TA 2E5LL 1WTHA 1KRSA 4LF9L 3VR3A 1B7YB 1BCPD 2F0JA 4FF4A 3HOWH 1FD7D 4IPDA 2ZTCA 3J80E 1SMYD 2HIXA 1YBYA 4DV1Q 2K32A 4OWXB 3T1HL 1KQSA 2N78A 3NBIA 2VQFL 2F1MA 3CCRA 2D5DA 4POFA 4O2DA 2ZT9C 1TS3A 3DEOA 4UP7A 2L9HA 1A3UA 2F0TA 4C1NK 5BN4A 2K04A 1PZJD 3R93A 4HIMA 5EPJA 4MZ9A 4P73A 1E2WA 4X6AH 1G2TA 4PV1C 1SFOB 2KVMA 4DV4Q 1V1QA 2NUCA 3MXPA 1V1OA 3N6RA 4A93B 3W1BA 4EVOA 3M3YB 3URYA 2C9OA 1FGUA 3K58A 1CFMA 1SFOH 1BVSA 3OPOA 1ET9A 2A6HD 3DLLA 1EFWA 1X32A 4A93H 4R8IA 3M3YH 3NP8A 4HN7A 4X3SA 1KDAA 4GKKL 1HCZA 4PMBA 3I4LA 4A4IA 5C0XG 2XTIA 2R6GA 4GKJL 3BVGA 5IY0A 5GAEC 2BH8A 3FHWA 3HS0C 2EY1A 5DEHA 2BE5C 4A3FB 4H13C 1I4PA 3KOJA 4DXGA 3NQIA 4RAUC 5KIXA 3M85A 4DV5Q 3D6CA 4C1NI 3HKZE 1VQPA 3H3VH 1MSHA 3ICEA 2EYPA 5LMUQ 3E5SA 4K6LA 4A3FH 3D4RA 1KAWA 1IW7C 5EPKA 5GQOA 5FLMH 2Z0SA 5M3MB 2D2CC 4DR3L 1N9WA 3I90A 4IQZA 1EYGA 1RF2D 1LUZA 1WJJA 1WD1A 4LF4L 1IKLA 1PYBA 2F0VA 4GZYC 5M3MH 5D65A 3GV3A 1K9MC 4X62L 2LKVA 2UXCL 1YIJA 4BXXH 4JC0A 4ZRZA 3I4MB 1TS4A 5I4DA 1HA6A 2CH4A 4Y52H 2Z8LA 4YIJA 1SYGA 2Q2IA 4OGQC 5LL6X 3KF6B 2A68D 2AUJD 2A1AA 1XTDA 1DYQA 4A3JH 3I4MH 4JI5L 3S1MH 1CA6A 5C4XG 1SE3A 3QOLA 5I6WA 2N55A 4AYBB 1IZ6A 1GD7A 1RCVD 2D0OA 4R4QA 1QCBD 2QF7A 2UUAQ 3A56A 1HNXL 3RN2A 1XWEA 3IKJA 3MC0B 2FINB 3T4AC 3OOCA 4OELB 4DUZL 1BQQT 3S17H 1WTRA 3PMFA 1JWSD 2AHOB 4HAEA 4X65Q 1KDCA 5C4HA 5FLXc 4LUZA 4H7BA 2L11A 1VDZA 4P71A 3TS2A 1WYDA 1PZID 4C3IG 2PW5A 3KYHC 1K73C 5IOCA 4QUFA 1E2VA 5A35A 3S2DB 4IUNA 2L0CA 4JBJA 1Q82C 1Q8IA 4KKUA 3D31A 1EIGA 3KK7A 4OIKA 5FLXE 1K0RA 2XWJB 1N33Q 2MO1A 3CXCA 2PZUA 1NCVA 4DV0L 1ESFA 3CC2A 4GNXB 2HD3A 1K0SA 1TQOA 3GDEA 4POGA 2RA4A 1A63A 2XSCA 4RCOA 1CKNA 2F3IA 1F9PA 3EBEA 1ESRA 4MIUA 3AQQA 1U4PA 2EYJA 2DGYA 1V1PB 1LABA 3ITPA 4JBWA 5FOBB 1GOZA 2F0KA 4WORA 2JA7G 4EQ5A 4DF7A 5JAVA 2MNAA 3CMAA 5C0XH 2CH4W 2JEBI 4CDCC 3UE0A 1C8CA 1IHZA 2OTJA 2JA8G 1RHPA 2UXDL 1ZYRD 2ZJRA 4LFAQ 3GP7A 3NEMA 4IJLA 1DOMA 3MXUA 1LTGD 4K0KL 1TU2B 3Q8DA 1RL2A 2XIWA 2KQ3A 2F3VA 2I5LX 4Y7NB 2RKSA 5LL6S 1K3BC 5M5WB 3STBD 1G2SA 1K83H 1B4OA 4JYAQ 1ET6A 4ID6A 1H9SB 1Q46A 3SXHA 3V05A 3CCLA 1TIID 1VQLA 3D4DA 4DAVA 4B3TL 1GHKA 2G9DA 5EQ0A 1TY2A 3C3LA 2Q2UA 1AZQA 1CKMA 1XPOA 2HCCA 1N34Q 2Z6KC 3J80L 3Q0AA 5AJ3Q 1F9SA 5KEEA 2RF4A 4H0LC 2RDGA 3CAMA 3K8AA 1LLRD 3AU7A 1FJGL 4RHSA 2R7FA 3A55A 1MJEA 3U50C 1Q7YC 2R92B 5C4XH 1S3OA 3KJOA 2NB0A 4N8FA 2EDGA 1Y8NB 2BCOA 1K8MA 1UWVA 4F8MA 2HQLA 3DHQA 3VYRA 1Q12A 2IT1A 2UUCL 2R92H 1Q90A 3M4OB 1BDOA 1SE2A 3SE0A 2CHBD 2MPMA 3RZDB 1P16A 3CKIB 2XWBB 4HCEA 2O5IC 5IP9G 4EQNA 2K05A 2F0LA 1RODA 4QL5A 3M4OH 2EYOA 4DPGA 1PTOC 3DUZA 2DNEA 1PRTB 1YZ6A 2BDNA 4M8AA 4BBSB 5CV8A 3A5ZB 1HH2P 1Q86C 5IT9c 2CWPA 1PLFA 1VQJA 1KD1C 2SNSA 4JI6Q 3W3AA 5E3FA 4BBSH 1STHA 4HEDA 3NWSA 4ME5A 4R1JA 3TBIB 1L1OB 1CZWA 4JI1Q 5EKKA 3U58A 1IYVA 4I65A 5JPMC 2PI2A 3I4OA 2VB2X 4X3UA 4FO2A 1XPUA 3AMUA 3S14B 3HOUG 5IT9E 1BXTA 5IYBG 4OX9L 1DD2A 2EYMA 2FXQA 2WAQB 4QY7A 5GAGC 3I91A 2NTTA 1PTOF 2QILA 1LACA 2JA7B 1J8IA 2IW3A 3S14H 3CC7A 4BBRG 1J5EQ 3A5UA 4XYOA 4PQXA 4JI4Q 2KENA 3RNUA 3C2PA 2JA7H 2SOBA 1MI2A 1X65A 5E1FA 2JA8B 4A3DB 3A54A 2DUDA 4KMUC 1A3VA 5G3LF 4UDUC 1ZXTA 2RQXA 3V96A 3UDFA 3H0GB 1JT8A 4IFDJ 2A69D 1BOSA 2JA8H 4ME3A 3AYHB 1SYBA 2K01A 1N32Q 2IX0A 3TS0A 3TRZA 3A8KE 3PCOB 3H0GH 4GOPB 2AKWB 4R8NA 3J7ZC 5EGTA 3GTJH 1UAPA 4DV1L 2Y0SG 4C3HG 3M7NA 2GVBA 2IPKD 3X3MA 4XDXA 2NN6G 1BNZA 3OW7A 4NXNQ 1QZGA 1KNEA 5C44G 1JORA 4IUTA 4FXGC 3IAYA 1K8GA 3D3RA 1RDPD 3U4ZA 2PQAB 1Y8OB 5C4ZA 2QKIC 4CDEC 4DV4L 1VQCA 1LTBD 1FVIA 1Q81C 1PMRA 1JR0D 5FLXL 4V0BA 2ZXRA 4PG3A 5FK9C 4DR6Q 2K5DA 3EFXD 4B9WA 1WD0A 1C9OA 3MHBA 1HNWQ 1VQMA 4HSVA 1PH6A 2RCNA 2CFMA 2Z9HA 3CQZB 1NY4A 3RLOA 3MFGA 5IYDG 4YHHQ 1OTCA 4B3MQ 2Q8TA 3L2PA 2MJ8A 3MVVA 4KLKA 1PFMA 5EAYA 3CQZH 2RDFA 4KHPQ 4HJAA 2RCFA 1DONA 4TVAB 3GTGB 2RSNA 2ATWA 1D1KA 5ELBA 4DV5L 5IGBA 2WB1G 4CGYB 4ZYSA 4IPGA 5IP9H 1YNND 1S5FD 1VQ8A 1H9KA 4B3SQ 3GTMB 2ZM6Q 3GTGH 1F2MA 2XGTA 3BDCA 1L0XB 3S2HB 1XYIA 1C4QA 3GTMH 2F0FA 4ODGA 1CHQD 4GN5A 3S2HH 2K5VA 2ZXPA 3OTOQ 2F3WA 1H9MA 1SRUA 4JOIC 3HOUB 5FO7B 4L63B 3F8TA 1BBWA 2R7DA 2BDOA 3TEHB 3GV6A 1W6KA 3HOUH 4LAAA 3U9OA 4BBRB 1GO3E 5IYBH 3I55A 1VQHA 4UY8C 3P7JA 3P20A 4BBRH 3E0JA 3G6EA 2UUAL 4HMIA 2NZHA 5E4WC 3SK5A 4A76A 1HQRD 4KN7C 1LTLA 4R4TA 5ELDA 1OXTA 1EU4A 1S5DD 5LMNQ 3CU7A 4X65L 1EYCA 5JJLA 1VQIA 1LTID 4DR2Q 2Y0SB 4QUCA 5J39A 4C3HB 1AFPA 3KLSA 3SDZA 4C3JB 2OCEA 1Z6HA 3HOYB 2L4NA 1ILPA 1YHBA 5C44B 2LMCB 4C3HH 4OO1H 4MNOA 4WFN3 3UDIA 2K03A 3FRPB 4C3JH 1EWIA 5K36H 1N33L 2R93B 2O5JC 4HSPA 1JICA 5C44H 2QDLA 2CVRA 5C5LA 3VR2A 4AIMA 1QVCA 4JI8Q 2B2UA 2F4IA 5CV9A 1SNQA 2PMZE 1EQVA 3RN5A 3Q24A 4K5WA 4Q0FA 3I4NG 1VQFA 4IO9A 1O7IA 1STAA 1XNQQ 4EX5A 4IOAA 2A73B 4OEMB 2M9VA 4J8QA 5CBEE 1K28A 1BR9A 5CC4A 4RKBA 2AMCB 3HOVG 1GUWA 1IBMQ 1D5ZC 1BO0A 2NTSA 1O7YA 1PFNA 2R61A 3K81C 5IT9L 3KBXA 5J22A 5JVG3 4LFAL 1RD9D 2F0QA 4CDFC 5CGKA 3PF5A 1D5MC 2FMCA 3TMEA 1C0AA 1ML0D 2ZJPA 4JYAL 1U9RA 2DY7A 2LS01 2YV5A 1KDBA 4EQOA 1PHJA 2JA6G 4A3GG 4DV2Q 3OIPA 1HUNA 1BUVT 2ICEC 4MTNA 1A15A 3H91A 4ZK9B 1QOHA 2WKDA 4J6HA 2OQ0A 4IUQA 1IBLQ 1FNVA 1JB3A 1O7LA 4DGZA 1N34L 2PQEA 3K6OA 1BCPC 1B44D 1SMYC 4YCWA 5HURA 5AJ3L 2O2LD 3VYTA 4RGMA 4R4OA 4TQUS 1ILQA 4DAYB 2VQEQ 1E1OA 3I70A 3EIVA 5FJ8G 1KRTA 3UDGA 4OIJA 1EYDA 2HQEA 1T9HA 2HHHQ 1EIHA 5CV4A 3KBGA 4IPCA 4ZQ3A 3WWVA 1T5XD 1JWUD 4PMCA 2ENBA 2PZTA 3D6WA 3P1HA 3UI2A 3KFUA 3BYYB 4RG1A 1NUCA 3NTHA 3IL8A 1CT1D 2IWHA 1BCPF 2GVAA 2B63G 2B2UC 2A6HC 1EOVA 4LUOA 4KHZA 2E2JB 2LXKA 3PO3B 3D8GA 1SN8A 1K8AC 1Q1BA 5C3EB 4KY6A 4A3CG 4AQYQ 5ISRA 3QWNA 4R4CA 2E2JH 3PO3H 1MIUA 2EOTA 4X64Q 3K5LA 5C3EH 4YCUA 1WTWA 4JI6L 2E2HB 3UDXA 1VQ6A 1II3A 2ID0A 2MFIA 1F9RA 4JI1L 3U4VA 1I6VC 3K5OA 1YNXA 3AB9A 3NBHB 3S9WA 2E2HH 2B29A 1VQDA 3T16A 1PH3A 2AQ3B 2AWNA 2KECA 1IKMA 5I9PA 4E6IA 4EQPA 1J5EL 4NXMQ 3L9AX 1TS2A 4PMWA 3CCJA 1F2YA 4JI4L 2M00A 5A2QE 2ASBA 1A62A 2JK8A 1BKBA 1D2BA 2F0SA 4IZ8A 4GLVB 1A3TA 5BN5A 1B2TA 3M4PA 2A68C 4ILWA 4G7HC 4LFCQ 2L1BA 1GUGA 3O13A 1EU3A 2B39A 1G291 3HKSA 2CCZA 2IHFA 5KRUA 2ZXOA 3LX0A 1MKHA 4NW2A 4XT1B 4ABNA 2JSOA 3T13A 4YWLA 3Q22A 1N32L 1Z7TA 2JP1A 4DK3C 2WINB 4DU9A 1YVCA 1DOKA 3LNNA 3NE5B 3PO2G 2H4OA 4A3JB 1LTRD 1TWAB 3S1MB 1S72A 4NXNL 1VS0A 4CHTB 2YYZA 3DEPA 1EWHA 1WFQA 3PSIA 3T51B 3TN2A 1TWAH 4G57A 3TQYA 4DUYQ 1EQRA 3KF6A 2BE5D 4G7OC 2Y0SE 3S17B 4XIGS 1H9RA 2P5ZX 3KLWA 3FKIG 1WVLA 4JV5Q 1VMCA 2EJGC 4X3TA 1VQ5A 1QZHA 4DR6L 1N36Q 3PUVA 1KABA 1UEAB 2FJ2A 1SDFA 1HNWL 1QILA 2RHSB 1EEID 3J81i 2HT1A 4YHHL 2JQOA 3H3VI 4B3ML 1XNRQ 1I5FA 4FF2A 1EY5A 2JJQA 4KHPL 1HZ9A 2F0DA 3TP8A 2X6LA 2B63H 4KJOA 1W3SA 4ZKCB 2SNMA 4B3SL 3OWFA 4B08A 4N9TA 2L55A 5CV5A 5GROA 1LT6D 2ZM6L 1EY4A 4NPSA 2UU9Q 5H1SE 1YJNA 4A3CH 3IFDA 3T53B 1Y1WG 1CTMA 5IGCA 4DR5L 3CW2C 1HZBA 2PCFB 1QWYA 2NYZD 4GNXA 1ZYRC 5EJWA 5LHY1 1DGSA 1UE5A 3OTOL 3RUZA 1D7QA 2WB1E 2EZVA 1ASZA 1LM0A 1C7YA 2KUMA 4K14A 1E22A 2K33A 4HJ7A 1HFNA 1PH9A 3K7UC 4RH6A 2VW9A 3STBC 4NB3A 1V1PA 2F4VQ 3BZKA 3PQIA 3VR6A 1XMOQ 1PTOH 1UUPA 2B2YA 1X3PA 1B53A 3F2DA 1LV9A 2GA4B 4G4KA 2B8FA 3HRZC 1FNWA 1K83B 4K5XA 1CSQA 1EY6A 1KAAA 2E2IB 2RVLA 1CSPA 3MEFA 1TVXA 5IODA 4A3BG 2UUBQ 1B50A 2RSOA 3AFQA 5LMNL 5IGFA 1D1IA 2Q2TA 2NZOA 2E2IH 3DMUA 4DR2L 1L2FA 4WJ3M 1FL0A 2F52A 1PA6A 3PO2B 1F77A 3MXNB 4DR1Q 1JB7A 4F7XA 3EJIA 1H9SA 2HDLA 2PYKA 1KLUD 1DCZA 2F0HA 1W6JA 3I73A 3PO2H 2FHTA 3ERSX 1S5ED 3QO2A 3TSSA 3I72A 4CJ2C 4J1MA 1ENAA 5M5XB 4P2CB 5C4XB 1MBYA 3D0FA 5AFWA 3KJPA 4DNTB 2KHJA 2OF1A 1PFBA 4JI8L 2WV6D 4RKLA 3I8ZA 5M5XH 4H02A 1W2BA 1D5XC 3NPPA 2QW7A 3PIO3 1GUNA 4DAPA 3FKIH 3X3NA 1XNQL 3VYUA 4LNQA 3I7FA 5C0XI 5CORA 2EJFC 2PZWA 5IGDA 1BBXC 1ENCA 3RD4A 4OONA 1PH5A 3OHXC 5BR8Q 4C3IB 1M1KC 1IBML 2PMZB 2K14A 4ZLTF 2VY3A 3C1FA 3HEJA 4NDXA 3KLSX 3A8IE 4O42A 4HIKA 5ELNA 1B8AA 2C35B 3DM1A 3DM3A 4C3IH 2A74C 2KA7A 3CCUA 3R8BA 3ULJA 4GNXC 4NMZA 2YTYA 3OYYA 1NTGA 1Y1VG 4KV6A 2F0EA 1PH7A 5M3FG 2VUMG 5A2QL 3GTLB 5CV7A 4FVMA 2KCTA 1S5CD 2WACA 4ALPA 4IALA 5M5YB 3IFTA 4LF5Q 2LY7A 3GTLH 1KIXA 2Z4HA 3GTPB 4PZ7A 4QJFA 4DV2L 1L1OA 1UE7A 2A69C 1SLJA 5M5YH 1AH9A 2DY8A 1IBLL 2KBNA 2Z1CA 1VQAA 1B9NA 3GTPH 1Y8PB 4OWWB 2EYLA 3CRLC 2OQKA 1JQYD 4LF6Q 3VDYA 2Q8RE 1QVFA 2VQEL 3PUZA 1VQ7A 3ER0A 4XTCS 4HCSA 4YWKA 1SE8A 3GTJB 2F0GA 1VQOA 3KF8B 2I46A 5EBCA 4DV3Q 1PXUA 4X66Q 1L0YB 4LF7Q 3CPFA 2OEOA 4N9PA 4DAMA 3JAMi 1D8LA 4JI0Q 2CW0D 5ELEA 4DR4Q 4OWTB 2AWOA 2YTVA 4GOPA 4YWMA 3HOXG 1NR4A 1E0BA 5KNDA 4CKEA 1K8OA 1LT4D 3VA7A 1FGBD 4FP5D 4AQYL 4LF4Q 3G6JB 4N8X1 2K5NA 2PW7A 1CA5A 4X64L 3FP9A 2MP1A 2PQAA 4NP5A 4O0AA 4IUVA 4QIWB 3VYSA 4QCLA 1PYWD 1CI3M 1YNNC 4P72A 1WTPA 1IYJB 3UE1A 5GAHC 3FMCA 2ZTDA 3GO5A 4DA2A 3KUPA 3C1EA 3NQTA 5E7NA 4LMQD 1JJCB 1GUSA 1GUOA 1B9MA 1MHWC 2KCMA 3M7GA 4NXML 1QUQB 4HJ8A 2QA4A 1SXTA 3TREA 1EY9A 1RTNA 5D14A 1I4HA 4P75A 1EFID 4DUZQ 2B3GA 1X55A 1FNUA 1Z47A 2A6ED 4FNFA 2EPBA 5LMUL 3A8JE 1Y1VB 3G48A 3V2TA 4LFCL 1ENFA 1L1OC 1GKHA 5IP7G 3S1NB 1EZ6A 2Q8IB 1WOCA 1S5BD 1YJWA 1M8AA 1EYAA 1SNOA 1Y1VH 5IE8A 2N8NA 3S1NH 1OXXK 1PRTD 4KY5A 5C6AA 1G51A 5DM63 3LGJA 1YNJD 5JJKA 1WCMG 4BY1G 3BS1A 3IRBA 3TP5A 3BZCA 1OXVA 1SYEA 4DNIA 3J7YW 1HTPA 1B3QA 1CQVA 4KY7A 4ZCKA 4DUYL 4DFAA 3GTOB 2I5HA 3CCVA 4KJNA 5LMNW 4JI7Q 3GTQH 5EPLA 1YEZA 2FMMA 3L7ZC 1I50B 2L15A 1EY7A 4JV5L 2QGQA 3TDQA 3GTOH 4JCVE 1U5KA 4GOPC 3LWUA 3OSOA 1N36L 4QQBX 3AEVA 1I50H 1IBKQ 3OMCA 4KI0A 1BCPB 4KKSA 1BBUA 2KCNA 4RMFA 1XNRL 4ULLA 4MN3A 1SAPA 3HOXB 4GLXA 1VF7A 3EVQA 4CJ1B 4DV7Q 1PH8A 3HOWG 2PNRC 1PH4A 4UP8A 1EWCA 3C46A 3HGBA 5ELFA 2IY5B 5FKAC 3HOXH 2TSSA 3BVZA 5IWAQ 2NN6H 4L8JA 4JK1C 2UU9L 2D0PA 1MJCA 4RGTA 1ICFB 1DM0B 1STBA 1JE5A 1VQKA 1Z9FA 1HJPA 4OHJA 5IYCG 1TXYA 1PZKD 2VXWA 4LF8Q 1GHJA 1J9OA 4RCNA 1R9TB 1HNZQ 4LK1C 1A2UA 3J81j 2OWOA 1HUMA 1LTAD 1Y14B 2X69A 2EY6A 1B3AA 2K5QA 3L0OA 3RR5A 4LFBQ 3K59A 1EY8A 1R9TH 1TT2A 2F4VL 3DWQA 4IUPA 1HXYD 1XMOL 1SYDA 3A0JA 5IYDH 1H9JA 2YU9H 2KHIA 2IJ0A 4KTAA 2HDMA 2ZJQA 4L6TB 4HJ5A 2WB1B 2K75A 2TMPA 3E0EA 4XQJA 2EY2A 3FEWX 2NBFA 1V9PA 3K5MA 2VS1A 1ICWA 2K4KA 1Q3LA 1P8LA 2YTXA 1UE1A 1NJIC 2EXZA 2PI2E 3G7LA 5C3WA 1I6HB 2UUBL 2M2LA 4A3FG 5IP7H 4OO1I 2VNUD 1I4RA 1QNUA 1EIYB 1AZPA 1I6HH 4MTKA 3PF4A 1YHAA 2XN9C 4K2LA 4JVZA 3I3CA 1WCMB 2JYOA 4BY1B 4DR1L 1U4MA 2F0PA 3CRKC 4RFBA 2LXJA 4HJ9A 2WIIB 1LTTD 4JG2A 3W2DA 5M3MG 5C4JB 4XT3B 1WCMH 2K50A 4BY1H 2G9HD 1HR0Q 2UXBQ 3F1ZA 5C4JH 4B3RQ 1SE4A 4GLAC 5JVH3 3TP7A 1GUTA 5J1ZA 1SNMA 1LTSD 1V8QA 3G71A 3BU2A 5HY6A 4OX9Q 3I4MG 4HR7B 2A5HA 1JWMD 4A3EG 2K52A 4FXKC 4DAYA 1H95A 1STEA 4APVA 5HGTA 1DOLA 3T1YQ 2FFKB 1JOQA 1SNCA 3OIQA 1KTKA 2CQAA 3RMHA 5TSSA 3SVMA 3VR5A 2B8GA 4AYBG 5BR8L 1A0IA 3ND8A 1XJVA 2G5DA 2MO0A 5COYA 4ZKBB 3I56A 2JA9A 4YY3Q 4QIWE 1VF5C 1CQFA 3SGIA 3PIPA 4XYQA 1EZ8A 2F03A 3NHHA 4K8IA 3P75A 4JBKA 2MQHA 5J3BA 3PUYA 1E2ZA 5JPNC 1TWHB 4IN3A 1G6PA 4IFDI 3J80i 4IUUA 2K7VA 1JE4A 3I4NB 2J4XA 3SHLA 1TWGB 1TWHH 3KLRA 1I4QA 1ZEQX 2CWAA 4LF5L 5IIFA 4P74A 5KGUA 2B2WA 3MFYA 3E9IA 3I4NH 3EROA 5IYCH 1TWGH 3RLFA 5ELCA 4R9WA 3HOVB 3NBHA 1HZAA 2VL6A 4DK6C 4F88A 2DN8A 4GN4B 1GJXA 2N88A 2E75C 3CC4A 2EE1A 1HFGA 1X9NA 3K5NA 3HOVH 4FDBA 5JEAJ 4LF6L 4FF1A 2HUGA 1EL0A 3HOZG 2O4XA 3OW2A 3E3XA 2V4DA 1EQQA 5L37A 3Q6SA 3CCSA 1AEXA 3CD6A 1S40A 4RGOS 2K28A 4DV3L 3JC66 4X66L 1XMQQ 3J7A5 4LF7L 2F0OA 2KOLA 3TZUA 2JA6B 5GADC 1SSOA 4A3GB 4JI0L 4DR4L 1CUKA 1HRJA 1IL8A 1RJTA 3S1RB 4LWCA 2JN4A 4DK1A 2KEDA 2RDHA 2ICIA 5D3DA 2JA6H 1R4PB 1XX8A 4A3GH 3FDTA 2LSSA 4L5TA 5CMDA 3S1RH 5EBDA 3M4YA 3J81c 4DR7Q 2E2DC 2N3SA 5IGEA 1VQGA 2EQSA 2DJGC 3CF5A 2J7ZA 1KHIA 5E4XA 4ZUJA 3AFPA 4J15A 4UAIA 4A3EB 3FPUB 2BA0A 1IW7D 3NELA 3J81E 1SJHD 1M4VA 3H6MA 5FJ8H 4A3EH 4G7ZC 4UHVA 2D9UA 4A3LG 1SNDA 3CPWA 3NENA 1VQBA 1DXMA 1JCKB 5JJIA 2B63B 4C56C 4AH6A 2MGSA 3NK9A 2R92G 2Z6KA 2X6GA 1TWFB 3F2BA 5M9OA 1I94Q 2F0NA 1SR3A 2WFWA 4A75A 1KNAA 1UEBA 3HG9A 3KDFB 5JEAG 3GQBA 5C5MA 3BYTB 1TWFH 2B2WC 4HIOA 2NVYB 2CQOA 2N49A 2KCCA 2LFNA 1IYUA 2EJMA 3KDFA 4ZUIA 2NVXB 2J0TD 4JI2Q 3PV0A 2NVYH 3G4SA 3H94A 1CZGA 1JJGA 3CHBD 1I4XA 1ASYA 2A19A 5KYLA 4S3SA 1V43A 1S4ZA 3S2DH 4BBSG 1G6ZA 1PTOB 1VQEA 2NVXH 3H3VC 2VZAA 3MEHA 1CKNB 3HZXA 1CKOA 1QNKA 1YI2A 3SK8A 1U4LA 4LUVA 4BS9A 1GVPA 4CJ0B 5I2YA 4BA2I 1NAPA 4OL7A 2EY5A 1NMFA 3HOZB 4JI7L 4CDDC 4HMJA 4IPHA 4WJWA 5KYIA 2PPBC 5ELOA 2KHSA 2WAQG 4DV6Q 3HOZH 2NVQB 1E3PA 2E8GA 1ONLA 3CP0A 4DK0A 1Y69U 4JI3Q 2VB3X 3A7LA 4PZ8A 1RTOA 2EIFA 1IBKL 2MHVA 2JEAI 2NVQH 1VQ9A 1X6OA 1SBBB 2QEJC 1JC7A 3L3OC 3QR8A 4A3DG 2RBMA 3B6YA 1B70B 1U4RA 1Q1EA 3H0GG 4DV7L 5T1IA 4RWSC 1RKNA 2RHQB 3DWPA 3MXNA 5IWAL 1PV4A 3OMGA 1UNSA 2Z4IA 1PDQA 3TZDA 5HGQA 1A6XA 3T56B 4Y7NH 1KLGD 3FKIB 5M5WH 2CKZB 1Q8KA 3CCEA 2XNAC 3K0XA 3ZJYC 5NUCA 4LF8L 3OWEB 1HNZL 3FVQA 3CMEA 1LT5D 2C5CA 4BA1I 2QEXA 3R3OA 1O78A 4XXEA 2OXPA 4LFBL 4QGUA 4FXDA 2JA5G 2KEEA 3S16B 5CR3A 5I2XA 3NSWA 2PNHA 4A3KG 3QG1A 4A3LH 2E5LQ 4A3IG 1E24A 1T5EA 4BWGB 2NVTB 4L5QA 2Z6BA 4LF9Q 3S16H 2K6AA 2R7ZG 3MA2B 4GS3A 1FR3A 1OO9B 3R2IA 1AE3A 3T1HQ 1F2LA 2NVTH 2VQFQ 1Y1WB 3E6ZX 5JEAH 1IL2A 2HCIA 3BJUA 3RLNA 1TY0A 2B2YC 2F0UA 3RZDH 5CV6A 1Y1WH 4FYDA 1X3EA 1O7ZA 4UPAA 1OXSC 1F2ZA 1AN8A
chains in the Genus database with same CATH topology
1STNA 2BA1A 4I7ZC 4MHEA 1BF4A 4CKCA 3H09A 1AP0A 2L12A 3EQLC 1I3QB 2CW0C 2IX1A 1VMPA 4KK7A 3BVMA 3J7AV 3R2TA 3NXWA 1TWCB 1PTOD 4CBVA 4K2KA 2OT2A 4LJZC 1WTQA 5CYUA 1O80A 5DM73 4A3BB 2EVBA 3GD7A 3JAME 4TSSA 3EA6A 1CHPD 5G3LD 1I4GA 3KF8A 4IURA 5I6YA 1HHVA 4DN4M 3BZDB 3J81L 2H1EA 5FO9B 5JJZA 3WOFA 5BN3A 4WRDA 4QF4A 3SR1A 2MUYA 1JOKA 2R3ZA 3F2UA 3N52A 5KNBA 3MWYW 1QB5D 4TKOB 3TP6A 4NKLA 1CK1A 4OO1G 2IL8A 4HTHA 1F9QA 1LO5D 4C3JG 5K36G 4QB4A 2A6EC 4KD3A 5C3XA 3ZYYX 4QMGA 1HTLD 5JOBA 4CKBA 2JXMB 2I07B 4ZAIA 2XRQD 2JA5B 5T1GA 3K0YA 1PRTC 4A3KB 1AW7A 1JOOA 1MD2D 1YNJC 4A3IB 2B2TA 4DNRB 2WKCA 4PNYA 4X3KA 2QCPX 2SDFA 1A2TA 3QB3A 2R7ZB 1DZ1A 4O1NA 5EKIA 3VR4A 2EYHA 1DJRD 1TKWB 5M3FB 2VUMB 1OXUA 4K6DA 2B2VA 3MZ5A 3LWEA 3VA5A 3A7AB 1EOTA 3BG3A 3ONAB 3S15B 1MSGA 2AQ1B 3SEBA 1EY0A 1PRTF 4B9XA 1SYCA 3NUCA 1STGA 4A3MB 1MGSA 4EGVA 3GTQB 3QIAA 3RZOB 3ND9A 3QJYA 4IFDG 1LT3D 4C2MB 3HKZB 4F87A 1SNPA 3SK6A 3WOEA 1XXGA 4V190 2WP8J 3Q23A 1WTVA 2AUKA 1FYCA 4RGNA 5CBAE 4Q5VA 1SYFA 1QE6A 1SEBD 3PIP3 3PUWA 1GXDC 5F2DA 1WTOA 2F0WA 3NTKA 3K57A 3DWAA 2E76C 3BDLA 2EYFA 1QJOA 4XQNA 4FF3A 3ERQA 5I9OA 1EQTA 3SK4A 3U9SA 1C48A 2PO4A 2KJXA 4RA8A 4DXFA 4U68A 2JE6I 1HA5A 5DAUA 1WTXA 5KNCA 1NR2A 3GTKB 1EEFD 2D62A 2B2TC 2F0IA 4H44C 2XRSD 2YU9B 1QG7A 3WDNA 3MTSA 4U673 5IGGA 3HP3A 1G91A 3BDOA 2NWGA 3FPPA 3PUXA 5DNFA 2B2VC 3J7AF 5EKLA 2F0MA 2QDBA 4TRDA 5K5PA 1CM9A 2DNCA 4KHVA 1R4QB 4KN4C 1HQMC 2K1BA 2AQ2B 3MAQA 1ZKOA 4XQQA 1B1ZA 3NTIA 4K5VA 3S1QB 2NZ1D 2NN6I 4Z9CB 4KD4A 2IX3A 3JAML 1NSNS 5D3IB 1D6EC 1HPCA 4RHRA 3NWTA 3D4WA 3K7AB 1STYA 4BY7B 1TR5A 1X3QA 3MXGA 5FO8B 2BOSA 2E74C 5C0XJ 1TS5A 4IFDH 1G8ZD 1SJED 3QOJA 1VCIA 2XVSA 2K5WA 4KKTA 1XTCD 2SEBD 4K8JA 4M1UB 3DXJC 3HOWB 2L5TA 3VR3A 1BCPD 2F0JA 4FF4A 1FD7D 3J80E 1SMYD 2K32A 3NBIA 2F1MA 2D5DA 2ZT9C 1TS3A 3DEOA 2L9HA 1A3UA 2F0TA 4C1NK 5BN4A 2K04A 1PZJD 3R93A 5EPJA 1E2WA 1G2TA 4PV1C 1SFOB 2KVMA 2NUCA 3MXPA 1V1OA 3N6RA 4A93B 4EVOA 3M3YB 3URYA 2C9OA 3K58A 1CFMA 3OPOA 1ET9A 2A6HD 1X32A 4R8IA 3NP8A 4HN7A 4X3SA 1KDAA 1HCZA 4PMBA 3I4LA 5C0XG 2R6GA 3BVGA 3HS0C 2EY1A 5DEHA 2BE5C 4A3FB 4H13C 1I4PA 4DXGA 3NQIA 4RAUC 5KIXA 3M85A 3D6CA 4C1NI 1MSHA 2EYPA 3E5SA 4K6LA 3D4RA 1IW7C 5EPKA 5M3MB 2D2CC 3I90A 4IQZA 1RF2D 1WD1A 1IKLA 2F0VA 4GZYC 5D65A 3GV3A 2LKVA 4ZRZA 3I4MB 1TS4A 5I4DA 1HA6A 2Z8LA 4YIJA 1SYGA 4OGQC 5LL6X 2A68D 2AUJD 1DYQA 1CA6A 1SE3A 3QOLA 5I6WA 2N55A 4AYBB 1RCVD 1QCBD 2QF7A 3A56A 1XWEA 3IKJA 3MC0B 2FINB 3T4AC 3OOCA 1BQQT 1WTRA 3PMFA 1JWSD 4HAEA 1KDCA 5C4HA 4H7BA 2L11A 1VDZA 1PZID 4C3IG 2PW5A 5IOCA 4QUFA 1E2VA 5A35A 3S2DB 4IUNA 2L0CA 1Q8IA 4KKUA 3D31A 1EIGA 3KK7A 4OIKA 5FLXE 2XWJB 2PZUA 1NCVA 1ESFA 1TQOA 2RA4A 2XSCA 4RCOA 1F9PA 1ESRA 4MIUA 1U4PA 2EYJA 1V1PB 1LABA 3ITPA 4JBWA 5FOBB 1GOZA 2F0KA 4WORA 4DF7A 5JAVA 5C0XH 2JEBI 1C8CA 1IHZA 1RHPA 1ZYRD 3GP7A 1DOMA 3MXUA 1LTGD 1TU2B 2XIWA 2KQ3A 2F3VA 4Y7NB 2RKSA 5LL6S 5M5WB 1G2SA 1B4OA 1ET6A 4ID6A 1H9SB 3SXHA 3V05A 1TIID 3D4DA 4DAVA 1GHKA 2G9DA 5EQ0A 1TY2A 3C3LA 1AZQA 2HCCA 3J80L 3Q0AA 1F9SA 5KEEA 4H0LC 2RDGA 1LLRD 3AU7A 4RHSA 3A55A 2R92B 2NB0A 2EDGA 1Y8NB 2BCOA 1K8MA 4F8MA 3DHQA 3VYRA 1Q12A 2IT1A 1Q90A 3M4OB 1BDOA 1SE2A 3SE0A 2CHBD 2MPMA 3RZDB 3CKIB 2XWBB 4HCEA 2O5IC 4EQNA 2K05A 2F0LA 1RODA 2EYOA 1PTOC 3DUZA 2DNEA 1PRTB 2BDNA 4M8AA 4BBSB 5CV8A 1PLFA 2SNSA 3W3AA 5E3FA 1STHA 4HEDA 3NWSA 4ME5A 3TBIB 1CZWA 5EKKA 1IYVA 4I65A 5JPMC 2VB2X 4X3UA 4FO2A 3AMUA 3S14B 5IT9E 1BXTA 1DD2A 2EYMA 2WAQB 3I91A 2NTTA 1PTOF 2QILA 1LACA 2JA7B 1J8IA 2IW3A 4XYOA 4PQXA 3C2PA 2SOBA 1MI2A 5E1FA 2JA8B 4A3DB 3A54A 4KMUC 1A3VA 5G3LF 4UDUC 1ZXTA 2RQXA 3V96A 3H0GB 4IFDJ 2A69D 1BOSA 1SYBA 2K01A 2IX0A 3A8KE 4R8NA 5EGTA 1UAPA 4C3HG 3M7NA 2IPKD 3X3MA 4XDXA 2NN6G 1BNZA 3OW7A 1KNEA 1JORA 4IUTA 4FXGC 3IAYA 3D3RA 1RDPD 1Y8OB 5C4ZA 2QKIC 1LTBD 1PMRA 1JR0D 5FLXL 4V0BA 2ZXRA 5FK9C 2K5DA 3EFXD 4B9WA 1WD0A 3MHBA 4HSVA 3CQZB 3MFGA 2Q8TA 2MJ8A 3MVVA 1PFMA 2RDFA 1DONA 3GTGB 2RSNA 1D1KA 5ELBA 5IGBA 4CGYB 4ZYSA 1YNND 1S5FD 1H9KA 3GTMB 1F2MA 3BDCA 1L0XB 3S2HB 1XYIA 1C4QA 2F0FA 4ODGA 1CHQD 2ZXPA 2F3WA 1H9MA 3HOUB 5FO7B 4L63B 2BDOA 3GV6A 1W6KA 4LAAA 3U9OA 4BBRB 3P7JA 3P20A 3E0JA 4HMIA 5E4WC 3SK5A 1HQRD 4KN7C 5ELDA 1OXTA 1EU4A 1S5DD 3CU7A 1EYCA 1LTID 2Y0SB 4QUCA 5J39A 4C3HB 1AFPA 3KLSA 3SDZA 4C3JB 1Z6HA 3HOYB 2L4NA 1ILPA 5C44B 2LMCB 4OO1H 4WFN3 2K03A 3FRPB 5K36H 2R93B 2O5JC 4HSPA 1JICA 2CVRA 5C5LA 3VR2A 2B2UA 2F4IA 5CV9A 1SNQA 1EQVA 3Q24A 4K5WA 4Q0FA 1STAA 2A73B 2M9VA 4J8QA 5CBEE 1BR9A 5CC4A 4RKBA 1GUWA 1D5ZC 1BO0A 2NTSA 1O7YA 1PFNA 2R61A 5IT9L 3KBXA 5J22A 5JVG3 1RD9D 2F0QA 5CGKA 1D5MC 2FMCA 3TMEA 1ML0D 1U9RA 2DY7A 2LS01 1KDBA 4EQOA 3OIPA 1HUNA 1BUVT 2ICEC 1A15A 3H91A 4ZK9B 1QOHA 2WKDA 4J6HA 4IUQA 1FNVA 1JB3A 1O7LA 4DGZA 2PQEA 3K6OA 1BCPC 1B44D 1SMYC 5HURA 2O2LD 3VYTA 4RGMA 4TQUS 1ILQA 3I70A 4OIJA 1EYDA 2HQEA 1EIHA 5CV4A 3KBGA 4ZQ3A 1T5XD 1JWUD 4PMCA 2ENBA 2PZTA 3D6WA 3P1HA 3UI2A 3BYYB 1NUCA 3NTHA 3IL8A 1CT1D 2IWHA 1BCPF 2B2UC 2A6HC 4KHZA 2E2JB 3PO3B 3D8GA 1Q1BA 5C3EB 4KY6A 5ISRA 3QWNA 2EOTA 3K5LA 1WTWA 2E2HB 1II3A 2ID0A 1F9RA 1I6VC 3K5OA 3AB9A 3S9WA 3T16A 2AQ3B 2AWNA 2KECA 1IKMA 5I9PA 4E6IA 4EQPA 3L9AX 1TS2A 4PMWA 1F2YA 2M00A 5A2QE 1D2BA 2F0SA 4IZ8A 5BN5A 1A3TA 1B2TA 2A68C 4ILWA 4G7HC 2L1BA 1GUGA 3O13A 1EU3A 2B39A 1G291 5KRUA 2ZXOA 3LX0A 4XT1B 4NW2A 4ABNA 3Q22A 2JSOA 3T13A 1Z7TA 2JP1A 2WINB 4DU9A 1DOKA 3LNNA 3NE5B 2H4OA 4A3JB 1LTRD 1TWAB 3S1MB 4CHTB 2YYZA 3DEPA 1EWHA 3T51B 3TN2A 4G57A 2BE5D 4G7OC 3S17B 4XIGS 1H9RA 1WVLA 1VMCA 2EJGC 4X3TA 3PUVA 1KABA 1UEAB 2FJ2A 1SDFA 1QILA 1EEID 4FF2A 1EY5A 2F0DA 3TP8A 2X6LA 4KJOA 4ZKCB 2SNMA 3OWFA 4B08A 4N9TA 2L55A 5CV5A 1LT6D 1EY4A 3IFDA 3T53B 1CTMA 5IGCA 2PCFB 1QWYA 2NYZD 1ZYRC 5EJWA 5LHY1 3RUZA 2EZVA 2KUMA 4K14A 2K33A 1HFNA 4RH6A 1V1PA 3VR6A 1PTOH 1UUPA 2B2YA 1X3PA 1B53A 1LV9A 2GA4B 4G4KA 2B8FA 3HRZC 1FNWA 1K83B 4K5XA 1EY6A 1KAAA 2E2IB 2RVLA 1TVXA 5IODA 1B50A 2RSOA 5IGFA 1D1IA 3DMUA 3PO2B 1F77A 4F7XA 3EJIA 1H9SA 2HDLA 2PYKA 1KLUD 1DCZA 2F0HA 1W6JA 3I73A 2FHTA 1S5ED 3QO2A 3TSSA 3I72A 4CJ2C 4J1MA 1ENAA 5M5XB 4P2CB 5C4XB 1MBYA 5AFWA 4DNTB 2OF1A 1PFBA 2WV6D 4RKLA 3I8ZA 1D5XC 3NPPA 3PIO3 1GUNA 4DAPA 3X3NA 3VYUA 5C0XI 5CORA 2EJFC 2PZWA 5IGDA 1BBXC 1ENCA 3RD4A 3OHXC 4C3IB 2PMZB 4ZLTF 3C1FA 3HEJA 4NDXA 3KLSX 3A8IE 4O42A 3DM1A 2A74C 2KA7A 3R8BA 4NMZA 4KV6A 2F0EA 5A2QL 3GTLB 5CV7A 4FVMA 1S5CD 2WACA 4IALA 5M5YB 3IFTA 2LY7A 2Z4HA 3GTPB 2A69C 2DY8A 2Z1CA 1B9NA 1Y8PB 2EYLA 3CRLC 1JQYD 2Q8RE 3PUZA 4XTCS 4HCSA 3GTJB 2F0GA 2I46A 5EBCA 1PXUA 1L0YB 2OEOA 4N9PA 2CW0D 5ELEA 2AWOA 1NR4A 1E0BA 5KNDA 4CKEA 1K8OA 1LT4D 3VA7A 1FGBD 4FP5D 3G6JB 2PW7A 1CA5A 2MP1A 4NP5A 4IUVA 4QIWB 3VYSA 4QCLA 1PYWD 1CI3M 1YNNC 1WTPA 3FMCA 4DA2A 3GO5A 3KUPA 3C1EA 3NQTA 4LMQD 1GUSA 1GUOA 1B9MA 3M7GA 1SXTA 1EY9A 1RTNA 5D14A 1I4HA 1EFID 1FNUA 1Z47A 2A6ED 4FNFA 2EPBA 3A8JE 1Y1VB 3V2TA 1ENFA 3S1NB 1EZ6A 2Q8IB 1S5BD 1M8AA 1EYAA 1SNOA 1OXXK 1PRTD 4KY5A 5C6AA 5DM63 1YNJD 3BS1A 3TP5A 1OXVA 1SYEA 3J7YW 1HTPA 1CQVA 4KY7A 4DFAA 3GTOB 4KJNA 5EPLA 2FMMA 3L7ZC 1I50B 1EY7A 3TDQA 3LWUA 3OSOA 3OMCA 4KI0A 1BCPB 4KKSA 2KCNA 4ULLA 4MN3A 1SAPA 3HOXB 1VF7A 3EVQA 4CJ1B 2PNRC 1EWCA 3C46A 3HGBA 5ELFA 5FKAC 2TSSA 3BVZA 2NN6H 4L8JA 4JK1C 4RGTA 1DM0B 1STBA 4OHJA 2VXWA 1PZKD 1GHJA 1J9OA 4RCNA 1R9TB 4LK1C 1A2UA 1HUMA 1LTAD 2X69A 2EY6A 1B3AA 2K5QA 3K59A 1EY8A 1TT2A 3DWQA 4IUPA 1HXYD 1SYDA 1H9JA 2IJ0A 4KTAA 2HDMA 4L6TB 2WB1B 2TMPA 4XQJA 2EY2A 3FEWX 2NBFA 3K5MA 1ICWA 1Q3LA 2EXZA 3G7LA 5C3WA 1I6HB 2M2LA 4OO1I 2VNUD 1I4RA 1QNUA 1AZPA 4K2LA 2XN9C 3I3CA 1WCMB 2JYOA 4BY1B 1U4MA 2F0PA 3CRKC 4RFBA 2WIIB 1LTTD 3W2DA 5C4JB 4XT3B 2G9HD 1SE4A 5JVH3 3TP7A 1GUTA 5J1ZA 1SNMA 1LTSD 1V8QA 4HR7B 2A5HA 1JWMD 4FXKC 4DAYA 1STEA 5HGTA 1DOLA 2FFKB 1JOQA 1SNCA 3OIQA 1KTKA 2CQAA 3RMHA 5TSSA 3SVMA 3VR5A 2B8GA 3ND8A 5COYA 4ZKBB 1VF5C 1CQFA 4XYQA 1EZ8A 2F03A 3NHHA 4K8IA 3P75A 3PUYA 1E2ZA 5JPNC 1TWHB 4IN3A 4IFDI 4IUUA 2K7VA 1JE4A 3I4NB 2J4XA 3SHLA 1TWGB 3KLRA 1I4QA 1ZEQX 5IIFA 5KGUA 2B2WA 3MFYA 3EROA 3RLFA 5ELCA 4R9WA 3HOVB 3NBHA 4F88A 2DN8A 1GJXA 2N88A 2E75C 2EE1A 1HFGA 3K5NA 5JEAJ 4FF1A 2HUGA 1EL0A 2O4XA 2V4DA 3Q6SA 1AEXA 4RGOS 2K28A 2F0OA 2KOLA 3TZUA 2JA6B 1SSOA 4A3GB 1HRJA 1IL8A 1RJTA 3S1RB 4DK1A 2KEDA 2RDHA 2ICIA 5D3DA 1R4PB 1XX8A 3FDTA 5CMDA 5EBDA 3M4YA 2E2DC 5IGEA 2J7ZA 5E4XA 4ZUJA 4UAIA 4A3EB 3FPUB 2BA0A 1IW7D 3J81E 1SJHD 1M4VA 3H6MA 4G7ZC 2D9UA 1SNDA 1DXMA 1JCKB 2B63B 4C56C 2MGSA 3NK9A 2X6GA 1TWFB 5M9OA 2F0NA 1KNAA 3HG9A 5JEAG 3GQBA 5C5MA 3BYTB 2B2WC 2NVYB 2KCCA 2LFNA 1IYUA 2EJMA 4ZUIA 2NVXB 2J0TD 3PV0A 3H94A 1CZGA 3CHBD 1I4XA 5KYLA 4S3SA 1V43A 1S4ZA 1G6ZA 1PTOB 3H3VC 3MEHA 3HZXA 1QNKA 3SK8A 1U4LA 4BS9A 4CJ0B 5I2YA 4BA2I 1NAPA 4OL7A 2EY5A 3HOZB 4HMJA 4WJWA 5KYIA 2PPBC 2KHSA 2NVQB 1ONLA 4DK0A 1Y69U 2VB3X 3A7LA 1RTOA 2MHVA 2JEAI 1SBBB 2QEJC 1JC7A 3L3OC 2RBMA 1U4RA 1Q1EA 5T1IA 4RWSC 1RKNA 3DWPA 3MXNA 3OMGA 1UNSA 2Z4IA 1PDQA 3TZDA 1A6XA 3T56B 1KLGD 3FKIB 2XNAC 5NUCA 3OWEB 3FVQA 1LT5D 2C5CA 4BA1I 3R3OA 1O78A 4XXEA 2OXPA 4FXDA 2KEEA 3S16B 5CR3A 5I2XA 3NSWA 3QG1A 1T5EA 4BWGB 2NVTB 2K6AA 3MA2B 1FR3A 1OO9B 3R2IA 1F2LA 1Y1WB 3E6ZX 5JEAH 2HCIA 1TY0A 2B2YC 2F0UA 5CV6A 4FYDA 1O7ZA 1OXSC 1F2ZA 1AN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K28 A;  1G2T A;  2KVM A;  5EPL A;  1U4M A;  2HDL A;  2L4N A;  4MHE A;  1BF4 A;  1WVL A;  1ILP A;  3D6W A;  2FMM A;  1CM9 A;  2L12 A;  2KOL A;  1AP0 A;  3UI2 A;  1EOT A;  2FHT A;  3ONA B;  4XT3 B;  1SSO A;  1EIG A;  1MSG A;  1VMC A;  2K03 A;  3QO2 A;  4OIK A;  4X3T A;  1IL8 A;  1RJT A;  3IL8 A;  2MPM A;  4CJ2 C;  1HRJ A;  1VMP A;  1JIC A;  2K1B A;  5AFW A;  2KED A;  2CVR A;  1X32 A;  1NR4 A;  1E0B A;  2K05 A;  2B2U C;  1NCV A;  1ROD A;  1SDF A;  2FJ2 A;  1RTO A;  4X3S A;  4R8I A;  1WD0 A;  1MGS A;  1XX8 A;  1PFB A;  1B50 A;  2B2U A;  3FDT A;  4HSV A;  3I8Z A;  5CMD A;  2RA4 A;  1CA6 A;  2NZ1 D;  1WTQ A;  2BDN A;  1O80 A;  1F9P A;  4MN3 A;  2Q8T A;  1CA5 A;  1SAP A;  2J7Z A;  1ESR A;  1U4R A;  2MJ8 A;  1PFM A;  1U4P A;  1PLF A;  1DOL A;  4CJ1 B;  2FFK B;  5CBE E;  2EOT A;  5T1I A;  1DON A;  5COR A;  1WTW A;  5E4X A;  2RSN A;  4RAU C;  4RWS C;  4HED A;  3SVM A;  1BBX C;  2MP1 A;  4UAI A;  2X6L A;  1F9R A;  4IUV A;  4IUR A;  1HHV A;  4ZKC B;  1MSH A;  1GUW A;  3FPU B;  1X3Q A;  4DN4 M;  1PDQ A;  3TZD A;  5COY A;  1WTV A;  4ZKB B;  1WTP A;  5EPK A;  4ZLT F;  4X3U A;  1BO0 A;  2H1E A;  1O7Y A;  5CBA E;  1PFN A;  4O42 A;  5JJZ A;  1XYI A;  1QE6 A;  3DM1 A;  3IFD A;  1C8C A;  3KUP A;  4LMQ D;  2R3Z A;  3I90 A;  3KBX A;  2D9U A;  2KEC A;  3F2U A;  1IKM A;  1RHP A;  3I91 A;  1WD1 A;  1J8I A;  2NYZ D;  1WTO A;  1IKL A;  2VXW A;  3N52 A;  3MWY W;  5EJW A;  1DOM A;  1J9O A;  5D65 A;  2MGS A;  3GV3 A;  2XIW A;  1RTN A;  5D14 A;  2X6G A;  2IL8 A;  2KUM A;  4QUF A;  1F9Q A;  4IUU A;  1HFN A;  1HUM A;  1HA6 A;  1MI2 A;  2X69 A;  1G2S A;  1JE4 A;  1B3A A;  1ML0 D;  1B4O A;  3GV6 A;  2EPB A;  1B2T A;  1ZXT A;  1KNA A;  2KEE A;  2DY7 A;  2L1B A;  4IUP A;  2B2W C;  2B2Y A;  1X3P A;  1EQT A;  1HUN A;  3P7J A;  2B2W A;  4RA8 A;  1B53 A;  1A15 A;  2HDM A;  2K01 A;  3H91 A;  4NW2 A;  4U68 A;  4XT1 B;  2N55 A;  5EQ0 A;  4ZAI A;  4ZK9 B;  1M8A A;  2DY8 A;  4IUQ A;  4R9W A;  1LV9 A;  2JP1 A;  1WTX A;  1AZQ A;  2HCC A;  2N88 A;  5E4W C;  1NR2 A;  5T1G A;  1EL0 A;  1ICW A;  1Q3L A;  2B2T C;  1DOK A;  1HFG A;  1F2L A;  2EE1 A;  2FIN B;  1S4Z A;  3G7L A;  1F9S A;  2B2T A;  2RVL A;  1G6Z A;  1QG7 A;  1TVX A;  2HUG A;  2Q8R E;  2M2L A;  3MTS A;  4X3K A;  1ILQ A;  2RSO A;  2HCI A;  2SDF A;  3HP3 A;  4XDX A;  1BNZ A;  4HAE A;  1G91 A;  1QNK A;  3DEO A;  2L9H A;  1KNE A;  3DEP A;  1DZ1 A;  1U4L A;  2B2Y C;  2NWG A;  4IUT A;  4HCS A;  2K04 A;  5DNF A;  5EKI A;  4QUC A;  2B2V C;  4OIJ A;  1O7Z A;  2L11 A;  3Q6S A;  3R93 A;  3TN2 A;  4CJ0 B;  1WTR A;  1AZP A;  1NAP A;  5EPJ A;  2B2V A;  3I3C A;  1EIH A;  3LWE A;  2JYO A; 
#chains in the Genus database with same CATH topology
 1STN A;  2BA1 A;  4I7Z C;  4MHE A;  1BF4 A;  4CKC A;  1X56 A;  4A3M G;  3H09 A;  1AP0 A;  2L12 A;  3EQL C;  2I5M X;  1I3Q B;  2CW0 C;  2GN5 A;  2IHE A;  2IX1 A;  3JAM c;  1VMP A;  4KK7 A;  3W5O A;  1HR0 L;  2UXB L;  3BVM A;  3J7A V;  3R2T A;  3NXW A;  3HKZ G;  1JMC A;  1TWC B;  4B3R L;  1PTO D;  1EIF A;  4GKK Q;  1I3Q H;  4CBV A;  4K2K A;  2OT2 A;  3W1G A;  4LJZ C;  1WTQ A;  1KL9 A;  5CYU A;  4GKJ Q;  1O80 A;  2HHH L;  5DM7 3;  4JPB W;  1TWC H;  4A3B B;  2EVB A;  3S24 A;  3GD7 A;  4GN3 B;  3JAM E;  3T1Y L;  4TSS A;  3EA6 A;  1CHP D;  1YJ9 A;  5G3L D;  4JOI A;  1NE3 A;  1I4G A;  3KF8 A;  4IUR A;  5I6Y A;  4A3B H;  1HHV A;  4JW0 A;  4DN4 M;  3BZD B;  3J81 L;  2H1E A;  5FO9 B;  4YY3 L;  5JJZ A;  3WOF A;  5BN3 A;  4WRD A;  4A3D H;  1SRO A;  4QF4 A;  3SR1 A;  4DR3 Q;  2MUY A;  1JOK A;  2R3Z A;  1KXL A;  3F2U A;  3HFZ B;  3PGZ A;  3F2C A;  3N52 A;  5KNB A;  3MWY W;  1QB5 D;  4TKO B;  3TP6 A;  4AYB E;  4X62 Q;  4NKL A;  1CK1 A;  4OO1 G;  2IL8 A;  4HTH A;  2Q2H A;  2UXC Q;  4HID A;  1F9Q A;  2A8V A;  1LO5 D;  4C3J G;  3E9H A;  5K36 G;  3HOY G;  4QB4 A;  2A6E C;  4KD3 A;  5C3X A;  3ZYY X;  1NBW A;  4QMG A;  1HTL D;  4I7A A;  4JI5 Q;  4YCV A;  5JOB A;  4CKB A;  2R93 G;  2JXM B;  2I07 B;  4ZAI A;  2XRQ D;  4L5R C;  4OXP A;  2JA5 B;  5T1G A;  3K0Y A;  1HNX Q;  1PRT C;  4A3K B;  1AW7 A;  1JOO A;  1MD2 D;  1YNJ C;  4A3I B;  2B2T A;  4DNR B;  2WKC A;  4PNY A;  4X3K A;  2JA5 H;  2QCP X;  2SDF A;  1A2T A;  3QB3 A;  2R7Z B;  1QUQ A;  4A3K H;  3H15 A;  1DZ1 A;  3PIO A;  4O1N A;  4A3I H;  5EKI A;  3VR4 A;  2EYH A;  1DJR D;  1TKW B;  5M3F B;  2VUM B;  1OXU A;  4K6D A;  2B2V A;  2R7Z H;  1E1T A;  3MZ5 A;  3LWE A;  2ES2 A;  1XMQ L;  5M3F H;  2VUM H;  3VA5 A;  3A74 A;  3A7A B;  1EOT A;  3BG3 A;  3ONA B;  2I0Q A;  3S15 B;  1MSG A;  2AQ1 B;  3SEB A;  1EY0 A;  1PRT F;  4B9X A;  1SYC A;  3NUC A;  1NMG A;  4R4I A;  1STG A;  4DV0 Q;  1U0L A;  3S15 H;  1IXR A;  1MGS A;  4A3M B;  4EGV A;  3GTQ B;  3QIA A;  3RZO B;  4DR5 Q;  3ND9 A;  3QJY A;  1QVG A;  4IFD G;  4DR7 L;  3I2Z A;  4BY7 G;  1LT3 D;  3CCQ A;  4A3M H;  4C2M B;  1YIT A;  3HKZ B;  1XPR A;  4LW1 A;  4F87 A;  3RZO H;  2EXD A;  1SNP A;  3SK6 A;  3WOE A;  1XXG A;  1EUJ A;  4UP9 A;  4V19 0;  4C2M H;  2WP8 J;  3Q23 A;  1PH1 A;  1WTV A;  2HIV A;  2AUK A;  1FYC A;  4RGN A;  5CBA E;  4Q5V A;  1SYF A;  1QE6 A;  1SEB D;  1N8R C;  3PIP 3;  1JJ2 A;  2UXD Q;  3PUW A;  1GXD C;  5F2D A;  1WTO A;  2DJF C;  2F0W A;  3NTK A;  4K0K Q;  3K57 A;  1VQ4 A;  3DWA A;  2E76 C;  3BDL A;  2EYF A;  1QJO A;  1I94 L;  4XQN A;  1YHQ A;  4FF3 A;  2OTL A;  3ERQ A;  5I9O A;  1NNX A;  1EQT A;  3SK4 A;  1C48 A;  3U9S A;  2PO4 A;  2KJX A;  4RA8 A;  4DXF A;  4B3T Q;  4U68 A;  2JE6 I;  1HA5 A;  5DAU A;  1X54 A;  1WTX A;  1X3G A;  5KNC A;  4JI2 L;  1NR2 A;  3PO3 G;  3GTK B;  1EEF D;  2D62 A;  1GM5 A;  1UE6 A;  2B2T C;  2F0I A;  3K80 C;  5C3E G;  1RIP A;  4H44 C;  2XRS D;  3HOY H;  2YU9 B;  1QG7 A;  3WDN A;  3MTS A;  4U67 3;  3GTK H;  5IGG A;  3HP3 A;  1G91 A;  3BDO A;  1FJG Q;  3M4Q A;  1M90 C;  4A93 G;  1L0W A;  2NWG A;  3M9B A;  1KC8 C;  1LYL A;  3FPP A;  3PUX A;  5DNF A;  2R93 H;  2B2V C;  3J7A F;  5EKL A;  2F0M A;  2QDB A;  2UUC Q;  4TRD A;  3ULL A;  5K5P A;  1CM9 A;  2DNC A;  3CCM A;  4KHV A;  1R4Q B;  4KN4 C;  1K3R A;  4JBM A;  4DV6 L;  1HQM C;  2V1C C;  2K1B A;  4JI3 L;  1SMX A;  2AQ2 B;  3MAQ A;  1PVO A;  1ZKO A;  4XQQ A;  1HZC A;  1B1Z A;  4IOC A;  3NTI A;  5FLM G;  4K5V A;  3EN2 A;  3S1Q B;  4PZ6 A;  2NZ1 D;  1J6Q A;  4L5S A;  2NN6 I;  4Z9C B;  1HR0 W;  4KD4 A;  1A8V A;  1PYS B;  5DLQ E;  1VQN A;  2IX3 A;  2K5H A;  3JAM L;  1NSN S;  2WAQ E;  5D3I B;  3S1Q H;  2H5X A;  1D6E C;  1X3F A;  1HPC A;  1WI5 A;  4RHR A;  3NWT A;  3D4W A;  3K7A B;  1STY A;  4BY7 B;  1TR5 A;  4BXX G;  1X3Q A;  3MXG A;  5FO8 B;  2BOS A;  2E74 C;  1E7Z A;  2ZTE A;  4DKA C;  5C0X J;  1TS5 A;  3K7A H;  4IFD H;  4BY7 H;  4A3J G;  1G8Z D;  1SJE D;  3QOJ A;  1VCI A;  1PH2 A;  2ALY B;  2XVS A;  2K5W A;  4KKT A;  3ULP A;  1XTC D;  2SEB D;  1AE2 A;  4IJH A;  4K8J A;  4M1U B;  1PFS A;  3DXJ C;  3J80 c;  2BH2 A;  4WJ4 A;  3HOW B;  2L5T A;  2E5L L;  1WTH A;  1KRS A;  4LF9 L;  3VR3 A;  1B7Y B;  1BCP D;  2F0J A;  4FF4 A;  3HOW H;  1FD7 D;  4IPD A;  2ZTC A;  3J80 E;  1SMY D;  2HIX A;  1YBY A;  4DV1 Q;  2K32 A;  4OWX B;  3T1H L;  1KQS A;  2N78 A;  3NBI A;  2VQF L;  2F1M A;  3CCR A;  2D5D A;  4POF A;  4O2D A;  2ZT9 C;  1TS3 A;  3DEO A;  4UP7 A;  2L9H A;  1A3U A;  2F0T A;  4C1N K;  5BN4 A;  2K04 A;  1PZJ D;  3R93 A;  4HIM A;  5EPJ A;  4MZ9 A;  4P73 A;  1E2W A;  4X6A H;  1G2T A;  4PV1 C;  1SFO B;  2KVM A;  4DV4 Q;  1V1Q A;  2NUC A;  3MXP A;  1V1O A;  3N6R A;  4A93 B;  3W1B A;  4EVO A;  3M3Y B;  3URY A;  2C9O A;  1FGU A;  3K58 A;  1CFM A;  1SFO H;  1BVS A;  3OPO A;  1ET9 A;  2A6H D;  3DLL A;  1EFW A;  1X32 A;  4A93 H;  4R8I A;  3M3Y H;  3NP8 A;  4HN7 A;  4X3S A;  1KDA A;  4GKK L;  1HCZ A;  4PMB A;  3I4L A;  4A4I A;  5C0X G;  2XTI A;  2R6G A;  4GKJ L;  3BVG A;  5IY0 A;  5GAE C;  2BH8 A;  3FHW A;  3HS0 C;  2EY1 A;  5DEH A;  2BE5 C;  4A3F B;  4H13 C;  1I4P A;  3KOJ A;  4DXG A;  3NQI A;  4RAU C;  5KIX A;  3M85 A;  4DV5 Q;  3D6C A;  4C1N I;  3HKZ E;  1VQP A;  3H3V H;  1MSH A;  3ICE A;  2EYP A;  5LMU Q;  3E5S A;  4K6L A;  4A3F H;  3D4R A;  1KAW A;  1IW7 C;  5EPK A;  5GQO A;  5FLM H;  2Z0S A;  5M3M B;  2D2C C;  4DR3 L;  1N9W A;  3I90 A;  4IQZ A;  1EYG A;  1RF2 D;  1LUZ A;  1WJJ A;  1WD1 A;  4LF4 L;  1IKL A;  1PYB A;  2F0V A;  4GZY C;  5M3M H;  5D65 A;  3GV3 A;  1K9M C;  4X62 L;  2LKV A;  2UXC L;  1YIJ A;  4BXX H;  4JC0 A;  4ZRZ A;  3I4M B;  1TS4 A;  5I4D A;  1HA6 A;  2CH4 A;  4Y52 H;  2Z8L A;  4YIJ A;  1SYG A;  2Q2I A;  4OGQ C;  5LL6 X;  3KF6 B;  2A68 D;  2AUJ D;  2A1A A;  1XTD A;  1DYQ A;  4A3J H;  3I4M H;  4JI5 L;  3S1M H;  1CA6 A;  5C4X G;  1SE3 A;  3QOL A;  5I6W A;  2N55 A;  4AYB B;  1IZ6 A;  1GD7 A;  1RCV D;  2D0O A;  4R4Q A;  1QCB D;  2QF7 A;  2UUA Q;  3A56 A;  1HNX L;  3RN2 A;  1XWE A;  3IKJ A;  3MC0 B;  2FIN B;  3T4A C;  3OOC A;  4OEL B;  4DUZ L;  1BQQ T;  3S17 H;  1WTR A;  3PMF A;  1JWS D;  2AHO B;  4HAE A;  4X65 Q;  1KDC A;  5C4H A;  5FLX c;  4LUZ A;  4H7B A;  2L11 A;  1VDZ A;  4P71 A;  3TS2 A;  1WYD A;  1PZI D;  4C3I G;  2PW5 A;  3KYH C;  1K73 C;  5IOC A;  4QUF A;  1E2V A;  5A35 A;  3S2D B;  4IUN A;  2L0C A;  4JBJ A;  1Q82 C;  1Q8I A;  4KKU A;  3D31 A;  1EIG A;  3KK7 A;  4OIK A;  5FLX E;  1K0R A;  2XWJ B;  1N33 Q;  2MO1 A;  3CXC A;  2PZU A;  1NCV A;  4DV0 L;  1ESF A;  3CC2 A;  4GNX B;  2HD3 A;  1K0S A;  1TQO A;  3GDE A;  4POG A;  2RA4 A;  1A63 A;  2XSC A;  4RCO A;  1CKN A;  2F3I A;  1F9P A;  3EBE A;  1ESR A;  4MIU A;  3AQQ A;  1U4P A;  2EYJ A;  2DGY A;  1V1P B;  1LAB A;  3ITP A;  4JBW A;  5FOB B;  1GOZ A;  2F0K A;  4WOR A;  2JA7 G;  4EQ5 A;  4DF7 A;  5JAV A;  2MNA A;  3CMA A;  5C0X H;  2CH4 W;  2JEB I;  4CDC C;  3UE0 A;  1C8C A;  1IHZ A;  2OTJ A;  2JA8 G;  1RHP A;  2UXD L;  1ZYR D;  2ZJR A;  4LFA Q;  3GP7 A;  3NEM A;  4IJL A;  1DOM A;  3MXU A;  1LTG D;  4K0K L;  1TU2 B;  3Q8D A;  1RL2 A;  2XIW A;  2KQ3 A;  2F3V A;  2I5L X;  4Y7N B;  2RKS A;  5LL6 S;  1K3B C;  5M5W B;  3STB D;  1G2S A;  1K83 H;  1B4O A;  4JYA Q;  1ET6 A;  4ID6 A;  1H9S B;  1Q46 A;  3SXH A;  3V05 A;  3CCL A;  1TII D;  1VQL A;  3D4D A;  4DAV A;  4B3T L;  1GHK A;  2G9D A;  5EQ0 A;  1TY2 A;  3C3L A;  2Q2U A;  1AZQ A;  1CKM A;  1XPO A;  2HCC A;  1N34 Q;  2Z6K C;  3J80 L;  3Q0A A;  5AJ3 Q;  1F9S A;  5KEE A;  2RF4 A;  4H0L C;  2RDG A;  3CAM A;  3K8A A;  1LLR D;  3AU7 A;  1FJG L;  4RHS A;  2R7F A;  3A55 A;  1MJE A;  3U50 C;  1Q7Y C;  2R92 B;  5C4X H;  1S3O A;  3KJO A;  2NB0 A;  4N8F A;  2EDG A;  1Y8N B;  2BCO A;  1K8M A;  1UWV A;  4F8M A;  2HQL A;  3DHQ A;  3VYR A;  1Q12 A;  2IT1 A;  2UUC L;  2R92 H;  1Q90 A;  3M4O B;  1BDO A;  1SE2 A;  3SE0 A;  2CHB D;  2MPM A;  3RZD B;  1P16 A;  3CKI B;  2XWB B;  4HCE A;  2O5I C;  5IP9 G;  4EQN A;  2K05 A;  2F0L A;  1ROD A;  4QL5 A;  3M4O H;  2EYO A;  4DPG A;  1PTO C;  3DUZ A;  2DNE A;  1PRT B;  1YZ6 A;  2BDN A;  4M8A A;  4BBS B;  5CV8 A;  3A5Z B;  1HH2 P;  1Q86 C;  5IT9 c;  2CWP A;  1PLF A;  1VQJ A;  1KD1 C;  2SNS A;  4JI6 Q;  3W3A A;  5E3F A;  4BBS H;  1STH A;  4HED A;  3NWS A;  4ME5 A;  4R1J A;  3TBI B;  1L1O B;  1CZW A;  4JI1 Q;  5EKK A;  3U58 A;  1IYV A;  4I65 A;  5JPM C;  2PI2 A;  3I4O A;  2VB2 X;  4X3U A;  4FO2 A;  1XPU A;  3AMU A;  3S14 B;  3HOU G;  5IT9 E;  1BXT A;  5IYB G;  4OX9 L;  1DD2 A;  2EYM A;  2FXQ A;  2WAQ B;  4QY7 A;  5GAG C;  3I91 A;  2NTT A;  1PTO F;  2QIL A;  1LAC A;  2JA7 B;  1J8I A;  2IW3 A;  3S14 H;  3CC7 A;  4BBR G;  1J5E Q;  3A5U A;  4XYO A;  4PQX A;  4JI4 Q;  2KEN A;  3RNU A;  3C2P A;  2JA7 H;  2SOB A;  1MI2 A;  1X65 A;  5E1F A;  2JA8 B;  4A3D B;  3A54 A;  2DUD A;  4KMU C;  1A3V A;  5G3L F;  4UDU C;  1ZXT A;  2RQX A;  3V96 A;  3UDF A;  3H0G B;  1JT8 A;  4IFD J;  2A69 D;  1BOS A;  2JA8 H;  4ME3 A;  3AYH B;  1SYB A;  2K01 A;  1N32 Q;  2IX0 A;  3TS0 A;  3TRZ A;  3A8K E;  3PCO B;  3H0G H;  4GOP B;  2AKW B;  4R8N A;  3J7Z C;  5EGT A;  3GTJ H;  1UAP A;  4DV1 L;  2Y0S G;  4C3H G;  3M7N A;  2GVB A;  2IPK D;  3X3M A;  4XDX A;  2NN6 G;  1BNZ A;  3OW7 A;  4NXN Q;  1QZG A;  1KNE A;  5C44 G;  1JOR A;  4IUT A;  4FXG C;  3IAY A;  1K8G A;  3D3R A;  1RDP D;  3U4Z A;  2PQA B;  1Y8O B;  5C4Z A;  2QKI C;  4CDE C;  4DV4 L;  1VQC A;  1LTB D;  1FVI A;  1Q81 C;  1PMR A;  1JR0 D;  5FLX L;  4V0B A;  2ZXR A;  4PG3 A;  5FK9 C;  4DR6 Q;  2K5D A;  3EFX D;  4B9W A;  1WD0 A;  1C9O A;  3MHB A;  1HNW Q;  1VQM A;  4HSV A;  1PH6 A;  2RCN A;  2CFM A;  2Z9H A;  3CQZ B;  1NY4 A;  3RLO A;  3MFG A;  5IYD G;  4YHH Q;  1OTC A;  4B3M Q;  2Q8T A;  3L2P A;  2MJ8 A;  3MVV A;  4KLK A;  1PFM A;  5EAY A;  3CQZ H;  2RDF A;  4KHP Q;  4HJA A;  2RCF A;  1DON A;  4TVA B;  3GTG B;  2RSN A;  2ATW A;  1D1K A;  5ELB A;  4DV5 L;  5IGB A;  2WB1 G;  4CGY B;  4ZYS A;  4IPG A;  5IP9 H;  1YNN D;  1S5F D;  1VQ8 A;  1H9K A;  4B3S Q;  3GTM B;  2ZM6 Q;  3GTG H;  1F2M A;  2XGT A;  3BDC A;  1L0X B;  3S2H B;  1XYI A;  1C4Q A;  3GTM H;  2F0F A;  4ODG A;  1CHQ D;  4GN5 A;  3S2H H;  2K5V A;  2ZXP A;  3OTO Q;  2F3W A;  1H9M A;  1SRU A;  4JOI C;  3HOU B;  5FO7 B;  4L63 B;  3F8T A;  1BBW A;  2R7D A;  2BDO A;  3TEH B;  3GV6 A;  1W6K A;  3HOU H;  4LAA A;  3U9O A;  4BBR B;  1GO3 E;  5IYB H;  3I55 A;  1VQH A;  4UY8 C;  3P7J A;  3P20 A;  4BBR H;  3E0J A;  3G6E A;  2UUA L;  4HMI A;  2NZH A;  5E4W C;  3SK5 A;  4A76 A;  1HQR D;  4KN7 C;  1LTL A;  4R4T A;  5ELD A;  1OXT A;  1EU4 A;  1S5D D;  5LMN Q;  3CU7 A;  4X65 L;  1EYC A;  5JJL A;  1VQI A;  1LTI D;  4DR2 Q;  2Y0S B;  4QUC A;  5J39 A;  4C3H B;  1AFP A;  3KLS A;  3SDZ A;  4C3J B;  2OCE A;  1Z6H A;  3HOY B;  2L4N A;  1ILP A;  1YHB A;  5C44 B;  2LMC B;  4C3H H;  4OO1 H;  4MNO A;  4WFN 3;  3UDI A;  2K03 A;  3FRP B;  4C3J H;  1EWI A;  5K36 H;  1N33 L;  2R93 B;  2O5J C;  4HSP A;  1JIC A;  5C44 H;  2QDL A;  2CVR A;  5C5L A;  3VR2 A;  4AIM A;  1QVC A;  4JI8 Q;  2B2U A;  2F4I A;  5CV9 A;  1SNQ A;  2PMZ E;  1EQV A;  3RN5 A;  3Q24 A;  4K5W A;  4Q0F A;  3I4N G;  1VQF A;  4IO9 A;  1O7I A;  1STA A;  1XNQ Q;  4EX5 A;  4IOA A;  2A73 B;  4OEM B;  2M9V A;  4J8Q A;  5CBE E;  1K28 A;  1BR9 A;  5CC4 A;  4RKB A;  2AMC B;  3HOV G;  1GUW A;  1IBM Q;  1D5Z C;  1BO0 A;  2NTS A;  1O7Y A;  1PFN A;  2R61 A;  3K81 C;  5IT9 L;  3KBX A;  5J22 A;  5JVG 3;  4LFA L;  1RD9 D;  2F0Q A;  4CDF C;  5CGK A;  3PF5 A;  1D5M C;  2FMC A;  3TME A;  1C0A A;  1ML0 D;  2ZJP A;  4JYA L;  1U9R A;  2DY7 A;  2LS0 1;  2YV5 A;  1KDB A;  4EQO A;  1PHJ A;  2JA6 G;  4A3G G;  4DV2 Q;  3OIP A;  1HUN A;  1BUV T;  2ICE C;  4MTN A;  1A15 A;  3H91 A;  4ZK9 B;  1QOH A;  2WKD A;  4J6H A;  2OQ0 A;  4IUQ A;  1IBL Q;  1FNV A;  1JB3 A;  1O7L A;  4DGZ A;  1N34 L;  2PQE A;  3K6O A;  1BCP C;  1B44 D;  1SMY C;  4YCW A;  5HUR A;  5AJ3 L;  2O2L D;  3VYT A;  4RGM A;  4R4O A;  4TQU S;  1ILQ A;  4DAY B;  2VQE Q;  1E1O A;  3I70 A;  3EIV A;  5FJ8 G;  1KRT A;  3UDG A;  4OIJ A;  1EYD A;  2HQE A;  1T9H A;  2HHH Q;  1EIH A;  5CV4 A;  3KBG A;  4IPC A;  4ZQ3 A;  3WWV A;  1T5X D;  1JWU D;  4PMC A;  2ENB A;  2PZT A;  3D6W A;  3P1H A;  3UI2 A;  3KFU A;  3BYY B;  4RG1 A;  1NUC A;  3NTH A;  3IL8 A;  1CT1 D;  2IWH A;  1BCP F;  2GVA A;  2B63 G;  2B2U C;  2A6H C;  1EOV A;  4LUO A;  4KHZ A;  2E2J B;  2LXK A;  3PO3 B;  3D8G A;  1SN8 A;  1K8A C;  1Q1B A;  5C3E B;  4KY6 A;  4A3C G;  4AQY Q;  5ISR A;  3QWN A;  4R4C A;  2E2J H;  3PO3 H;  1MIU A;  2EOT A;  4X64 Q;  3K5L A;  5C3E H;  4YCU A;  1WTW A;  4JI6 L;  2E2H B;  3UDX A;  1VQ6 A;  1II3 A;  2ID0 A;  2MFI A;  1F9R A;  4JI1 L;  3U4V A;  1I6V C;  3K5O A;  1YNX A;  3AB9 A;  3NBH B;  3S9W A;  2E2H H;  2B29 A;  1VQD A;  3T16 A;  1PH3 A;  2AQ3 B;  2AWN A;  2KEC A;  1IKM A;  5I9P A;  4E6I A;  4EQP A;  1J5E L;  4NXM Q;  3L9A X;  1TS2 A;  4PMW A;  3CCJ A;  1F2Y A;  4JI4 L;  2M00 A;  5A2Q E;  2ASB A;  1A62 A;  2JK8 A;  1BKB A;  1D2B A;  2F0S A;  4IZ8 A;  4GLV B;  1A3T A;  5BN5 A;  1B2T A;  3M4P A;  2A68 C;  4ILW A;  4G7H C;  4LFC Q;  2L1B A;  1GUG A;  3O13 A;  1EU3 A;  2B39 A;  1G29 1;  3HKS A;  2CCZ A;  2IHF A;  5KRU A;  2ZXO A;  3LX0 A;  1MKH A;  4NW2 A;  4XT1 B;  4ABN A;  2JSO A;  3T13 A;  4YWL A;  3Q22 A;  1N32 L;  1Z7T A;  2JP1 A;  4DK3 C;  2WIN B;  4DU9 A;  1YVC A;  1DOK A;  3LNN A;  3NE5 B;  3PO2 G;  2H4O A;  4A3J B;  1LTR D;  1TWA B;  3S1M B;  1S72 A;  4NXN L;  1VS0 A;  4CHT B;  2YYZ A;  3DEP A;  1EWH A;  1WFQ A;  3PSI A;  3T51 B;  3TN2 A;  1TWA H;  4G57 A;  3TQY A;  4DUY Q;  1EQR A;  3KF6 A;  2BE5 D;  4G7O C;  2Y0S E;  3S17 B;  4XIG S;  1H9R A;  2P5Z X;  3KLW A;  3FKI G;  1WVL A;  4JV5 Q;  1VMC A;  2EJG C;  4X3T A;  1VQ5 A;  1QZH A;  4DR6 L;  1N36 Q;  3PUV A;  1KAB A;  1UEA B;  2FJ2 A;  1SDF A;  1HNW L;  1QIL A;  2RHS B;  1EEI D;  3J81 i;  2HT1 A;  4YHH L;  2JQO A;  3H3V I;  4B3M L;  1XNR Q;  1I5F A;  4FF2 A;  1EY5 A;  2JJQ A;  4KHP L;  1HZ9 A;  2F0D A;  3TP8 A;  2X6L A;  2B63 H;  4KJO A;  1W3S A;  4ZKC B;  2SNM A;  4B3S L;  3OWF A;  4B08 A;  4N9T A;  2L55 A;  5CV5 A;  5GRO A;  1LT6 D;  2ZM6 L;  1EY4 A;  4NPS A;  2UU9 Q;  5H1S E;  1YJN A;  4A3C H;  3IFD A;  3T53 B;  1Y1W G;  1CTM A;  5IGC A;  4DR5 L;  3CW2 C;  1HZB A;  2PCF B;  1QWY A;  2NYZ D;  4GNX A;  1ZYR C;  5EJW A;  5LHY 1;  1DGS A;  1UE5 A;  3OTO L;  3RUZ A;  1D7Q A;  2WB1 E;  2EZV A;  1ASZ A;  1LM0 A;  1C7Y A;  2KUM A;  4K14 A;  1E22 A;  2K33 A;  4HJ7 A;  1HFN A;  1PH9 A;  3K7U C;  4RH6 A;  2VW9 A;  3STB C;  4NB3 A;  1V1P A;  2F4V Q;  3BZK A;  3PQI A;  3VR6 A;  1XMO Q;  1PTO H;  1UUP A;  2B2Y A;  1X3P A;  1B53 A;  3F2D A;  1LV9 A;  2GA4 B;  4G4K A;  2B8F A;  3HRZ C;  1FNW A;  1K83 B;  4K5X A;  1CSQ A;  1EY6 A;  1KAA A;  2E2I B;  2RVL A;  1CSP A;  3MEF A;  1TVX A;  5IOD A;  4A3B G;  2UUB Q;  1B50 A;  2RSO A;  3AFQ A;  5LMN L;  5IGF A;  1D1I A;  2Q2T A;  2NZO A;  2E2I H;  3DMU A;  4DR2 L;  1L2F A;  4WJ3 M;  1FL0 A;  2F52 A;  1PA6 A;  3PO2 B;  1F77 A;  3MXN B;  4DR1 Q;  1JB7 A;  4F7X A;  3EJI A;  1H9S A;  2HDL A;  2PYK A;  1KLU D;  1DCZ A;  2F0H A;  1W6J A;  3I73 A;  3PO2 H;  2FHT A;  3ERS X;  1S5E D;  3QO2 A;  3TSS A;  3I72 A;  4CJ2 C;  4J1M A;  1ENA A;  5M5X B;  4P2C B;  5C4X B;  1MBY A;  3D0F A;  5AFW A;  3KJP A;  4DNT B;  2KHJ A;  2OF1 A;  1PFB A;  4JI8 L;  2WV6 D;  4RKL A;  3I8Z A;  5M5X H;  4H02 A;  1W2B A;  1D5X C;  3NPP A;  2QW7 A;  3PIO 3;  1GUN A;  4DAP A;  3FKI H;  3X3N A;  1XNQ L;  3VYU A;  4LNQ A;  3I7F A;  5C0X I;  5COR A;  2EJF C;  2PZW A;  5IGD A;  1BBX C;  1ENC A;  3RD4 A;  4OON A;  1PH5 A;  3OHX C;  5BR8 Q;  4C3I B;  1M1K C;  1IBM L;  2PMZ B;  2K14 A;  4ZLT F;  2VY3 A;  3C1F A;  3HEJ A;  4NDX A;  3KLS X;  3A8I E;  4O42 A;  4HIK A;  5ELN A;  1B8A A;  2C35 B;  3DM1 A;  3DM3 A;  4C3I H;  2A74 C;  2KA7 A;  3CCU A;  3R8B A;  3ULJ A;  4GNX C;  4NMZ A;  2YTY A;  3OYY A;  1NTG A;  1Y1V G;  4KV6 A;  2F0E A;  1PH7 A;  5M3F G;  2VUM G;  5A2Q L;  3GTL B;  5CV7 A;  4FVM A;  2KCT A;  1S5C D;  2WAC A;  4ALP A;  4IAL A;  5M5Y B;  3IFT A;  4LF5 Q;  2LY7 A;  3GTL H;  1KIX A;  2Z4H A;  3GTP B;  4PZ7 A;  4QJF A;  4DV2 L;  1L1O A;  1UE7 A;  2A69 C;  1SLJ A;  5M5Y H;  1AH9 A;  2DY8 A;  1IBL L;  2KBN A;  2Z1C A;  1VQA A;  1B9N A;  3GTP H;  1Y8P B;  4OWW B;  2EYL A;  3CRL C;  2OQK A;  1JQY D;  4LF6 Q;  3VDY A;  2Q8R E;  1QVF A;  2VQE L;  3PUZ A;  1VQ7 A;  3ER0 A;  4XTC S;  4HCS A;  4YWK A;  1SE8 A;  3GTJ B;  2F0G A;  1VQO A;  3KF8 B;  2I46 A;  5EBC A;  4DV3 Q;  1PXU A;  4X66 Q;  1L0Y B;  4LF7 Q;  3CPF A;  2OEO A;  4N9P A;  4DAM A;  3JAM i;  1D8L A;  4JI0 Q;  2CW0 D;  5ELE A;  4DR4 Q;  4OWT B;  2AWO A;  2YTV A;  4GOP A;  4YWM A;  3HOX G;  1NR4 A;  1E0B A;  5KND A;  4CKE A;  1K8O A;  1LT4 D;  3VA7 A;  1FGB D;  4FP5 D;  4AQY L;  4LF4 Q;  3G6J B;  4N8X 1;  2K5N A;  2PW7 A;  1CA5 A;  4X64 L;  3FP9 A;  2MP1 A;  2PQA A;  4NP5 A;  4O0A A;  4IUV A;  4QIW B;  3VYS A;  4QCL A;  1PYW D;  1CI3 M;  1YNN C;  4P72 A;  1WTP A;  1IYJ B;  3UE1 A;  5GAH C;  3FMC A;  2ZTD A;  3GO5 A;  4DA2 A;  3KUP A;  3C1E A;  3NQT A;  5E7N A;  4LMQ D;  1JJC B;  1GUS A;  1GUO A;  1B9M A;  1MHW C;  2KCM A;  3M7G A;  4NXM L;  1QUQ B;  4HJ8 A;  2QA4 A;  1SXT A;  3TRE A;  1EY9 A;  1RTN A;  5D14 A;  1I4H A;  4P75 A;  1EFI D;  4DUZ Q;  2B3G A;  1X55 A;  1FNU A;  1Z47 A;  2A6E D;  4FNF A;  2EPB A;  5LMU L;  3A8J E;  1Y1V B;  3G48 A;  3V2T A;  4LFC L;  1ENF A;  1L1O C;  1GKH A;  5IP7 G;  3S1N B;  1EZ6 A;  2Q8I B;  1WOC A;  1S5B D;  1YJW A;  1M8A A;  1EYA A;  1SNO A;  1Y1V H;  5IE8 A;  2N8N A;  3S1N H;  1OXX K;  1PRT D;  4KY5 A;  5C6A A;  1G51 A;  5DM6 3;  3LGJ A;  1YNJ D;  5JJK A;  1WCM G;  4BY1 G;  3BS1 A;  3IRB A;  3TP5 A;  3BZC A;  1OXV A;  1SYE A;  4DNI A;  3J7Y W;  1HTP A;  1B3Q A;  1CQV A;  4KY7 A;  4ZCK A;  4DUY L;  4DFA A;  3GTO B;  2I5H A;  3CCV A;  4KJN A;  5LMN W;  4JI7 Q;  3GTQ H;  5EPL A;  1YEZ A;  2FMM A;  3L7Z C;  1I50 B;  2L15 A;  1EY7 A;  4JV5 L;  2QGQ A;  3TDQ A;  3GTO H;  4JCV E;  1U5K A;  4GOP C;  3LWU A;  3OSO A;  1N36 L;  4QQB X;  3AEV A;  1I50 H;  1IBK Q;  3OMC A;  4KI0 A;  1BCP B;  4KKS A;  1BBU A;  2KCN A;  4RMF A;  1XNR L;  4ULL A;  4MN3 A;  1SAP A;  3HOX B;  4GLX A;  1VF7 A;  3EVQ A;  4CJ1 B;  4DV7 Q;  1PH8 A;  3HOW G;  2PNR C;  1PH4 A;  4UP8 A;  1EWC A;  3C46 A;  3HGB A;  5ELF A;  2IY5 B;  5FKA C;  3HOX H;  2TSS A;  3BVZ A;  5IWA Q;  2NN6 H;  4L8J A;  4JK1 C;  2UU9 L;  2D0P A;  1MJC A;  4RGT A;  1ICF B;  1DM0 B;  1STB A;  1JE5 A;  1VQK A;  1Z9F A;  1HJP A;  4OHJ A;  5IYC G;  1TXY A;  1PZK D;  2VXW A;  4LF8 Q;  1GHJ A;  1J9O A;  4RCN A;  1R9T B;  1HNZ Q;  4LK1 C;  1A2U A;  3J81 j;  2OWO A;  1HUM A;  1LTA D;  1Y14 B;  2X69 A;  2EY6 A;  1B3A A;  2K5Q A;  3L0O A;  3RR5 A;  4LFB Q;  3K59 A;  1EY8 A;  1R9T H;  1TT2 A;  2F4V L;  3DWQ A;  4IUP A;  1HXY D;  1XMO L;  1SYD A;  3A0J A;  5IYD H;  1H9J A;  2YU9 H;  2KHI A;  2IJ0 A;  4KTA A;  2HDM A;  2ZJQ A;  4L6T B;  4HJ5 A;  2WB1 B;  2K75 A;  2TMP A;  3E0E A;  4XQJ A;  2EY2 A;  3FEW X;  2NBF A;  1V9P A;  3K5M A;  2VS1 A;  1ICW A;  2K4K A;  1Q3L A;  1P8L A;  2YTX A;  1UE1 A;  1NJI C;  2EXZ A;  2PI2 E;  3G7L A;  5C3W A;  1I6H B;  2UUB L;  2M2L A;  4A3F G;  5IP7 H;  4OO1 I;  2VNU D;  1I4R A;  1QNU A;  1EIY B;  1AZP A;  1I6H H;  4MTK A;  3PF4 A;  1YHA A;  2XN9 C;  4K2L A;  4JVZ A;  3I3C A;  1WCM B;  2JYO A;  4BY1 B;  4DR1 L;  1U4M A;  2F0P A;  3CRK C;  4RFB A;  2LXJ A;  4HJ9 A;  2WII B;  1LTT D;  4JG2 A;  3W2D A;  5M3M G;  5C4J B;  4XT3 B;  1WCM H;  2K50 A;  4BY1 H;  2G9H D;  1HR0 Q;  2UXB Q;  3F1Z A;  5C4J H;  4B3R Q;  1SE4 A;  4GLA C;  5JVH 3;  3TP7 A;  1GUT A;  5J1Z A;  1SNM A;  1LTS D;  1V8Q A;  3G71 A;  3BU2 A;  5HY6 A;  4OX9 Q;  3I4M G;  4HR7 B;  2A5H A;  1JWM D;  4A3E G;  2K52 A;  4FXK C;  4DAY A;  1H95 A;  1STE A;  4APV A;  5HGT A;  1DOL A;  3T1Y Q;  2FFK B;  1JOQ A;  1SNC A;  3OIQ A;  1KTK A;  2CQA A;  3RMH A;  5TSS A;  3SVM A;  3VR5 A;  2B8G A;  4AYB G;  5BR8 L;  1A0I A;  3ND8 A;  1XJV A;  2G5D A;  2MO0 A;  5COY A;  4ZKB B;  3I56 A;  2JA9 A;  4YY3 Q;  4QIW E;  1VF5 C;  1CQF A;  3SGI A;  3PIP A;  4XYQ A;  1EZ8 A;  2F03 A;  3NHH A;  4K8I A;  3P75 A;  4JBK A;  2MQH A;  5J3B A;  3PUY A;  1E2Z A;  5JPN C;  1TWH B;  4IN3 A;  1G6P A;  4IFD I;  3J80 i;  4IUU A;  2K7V A;  1JE4 A;  3I4N B;  2J4X A;  3SHL A;  1TWG B;  1TWH H;  3KLR A;  1I4Q A;  1ZEQ X;  2CWA A;  4LF5 L;  5IIF A;  4P74 A;  5KGU A;  2B2W A;  3MFY A;  3E9I A;  3I4N H;  3ERO A;  5IYC H;  1TWG H;  3RLF A;  5ELC A;  4R9W A;  3HOV B;  3NBH A;  1HZA A;  2VL6 A;  4DK6 C;  4F88 A;  2DN8 A;  4GN4 B;  1GJX A;  2N88 A;  2E75 C;  3CC4 A;  2EE1 A;  1HFG A;  1X9N A;  3K5N A;  3HOV H;  4FDB A;  5JEA J;  4LF6 L;  4FF1 A;  2HUG A;  1EL0 A;  3HOZ G;  2O4X A;  3OW2 A;  3E3X A;  2V4D A;  1EQQ A;  5L37 A;  3Q6S A;  3CCS A;  1AEX A;  3CD6 A;  1S40 A;  4RGO S;  2K28 A;  4DV3 L;  3JC6 6;  4X66 L;  1XMQ Q;  3J7A 5;  4LF7 L;  2F0O A;  2KOL A;  3TZU A;  2JA6 B;  5GAD C;  1SSO A;  4A3G B;  4JI0 L;  4DR4 L;  1CUK A;  1HRJ A;  1IL8 A;  1RJT A;  3S1R B;  4LWC A;  2JN4 A;  4DK1 A;  2KED A;  2RDH A;  2ICI A;  5D3D A;  2JA6 H;  1R4P B;  1XX8 A;  4A3G H;  3FDT A;  2LSS A;  4L5T A;  5CMD A;  3S1R H;  5EBD A;  3M4Y A;  3J81 c;  4DR7 Q;  2E2D C;  2N3S A;  5IGE A;  1VQG A;  2EQS A;  2DJG C;  3CF5 A;  2J7Z A;  1KHI A;  5E4X A;  4ZUJ A;  3AFP A;  4J15 A;  4UAI A;  4A3E B;  3FPU B;  2BA0 A;  1IW7 D;  3NEL A;  3J81 E;  1SJH D;  1M4V A;  3H6M A;  5FJ8 H;  4A3E H;  4G7Z C;  4UHV A;  2D9U A;  4A3L G;  1SND A;  3CPW A;  3NEN A;  1VQB A;  1DXM A;  1JCK B;  5JJI A;  2B63 B;  4C56 C;  4AH6 A;  2MGS A;  3NK9 A;  2R92 G;  2Z6K A;  2X6G A;  1TWF B;  3F2B A;  5M9O A;  1I94 Q;  2F0N A;  1SR3 A;  2WFW A;  4A75 A;  1KNA A;  1UEB A;  3HG9 A;  3KDF B;  5JEA G;  3GQB A;  5C5M A;  3BYT B;  1TWF H;  2B2W C;  4HIO A;  2NVY B;  2CQO A;  2N49 A;  2KCC A;  2LFN A;  1IYU A;  2EJM A;  3KDF A;  4ZUI A;  2NVX B;  2J0T D;  4JI2 Q;  3PV0 A;  2NVY H;  3G4S A;  3H94 A;  1CZG A;  1JJG A;  3CHB D;  1I4X A;  1ASY A;  2A19 A;  5KYL A;  4S3S A;  1V43 A;  1S4Z A;  3S2D H;  4BBS G;  1G6Z A;  1PTO B;  1VQE A;  2NVX H;  3H3V C;  2VZA A;  3MEH A;  1CKN B;  3HZX A;  1CKO A;  1QNK A;  1YI2 A;  3SK8 A;  1U4L A;  4LUV A;  4BS9 A;  1GVP A;  4CJ0 B;  5I2Y A;  4BA2 I;  1NAP A;  4OL7 A;  2EY5 A;  1NMF A;  3HOZ B;  4JI7 L;  4CDD C;  4HMJ A;  4IPH A;  4WJW A;  5KYI A;  2PPB C;  5ELO A;  2KHS A;  2WAQ G;  4DV6 Q;  3HOZ H;  2NVQ B;  1E3P A;  2E8G A;  1ONL A;  3CP0 A;  4DK0 A;  1Y69 U;  4JI3 Q;  2VB3 X;  3A7L A;  4PZ8 A;  1RTO A;  2EIF A;  1IBK L;  2MHV A;  2JEA I;  2NVQ H;  1VQ9 A;  1X6O A;  1SBB B;  2QEJ C;  1JC7 A;  3L3O C;  3QR8 A;  4A3D G;  2RBM A;  3B6Y A;  1B70 B;  1U4R A;  1Q1E A;  3H0G G;  4DV7 L;  5T1I A;  4RWS C;  1RKN A;  2RHQ B;  3DWP A;  3MXN A;  5IWA L;  1PV4 A;  3OMG A;  1UNS A;  2Z4I A;  1PDQ A;  3TZD A;  5HGQ A;  1A6X A;  3T56 B;  4Y7N H;  1KLG D;  3FKI B;  5M5W H;  2CKZ B;  1Q8K A;  3CCE A;  2XNA C;  3K0X A;  3ZJY C;  5NUC A;  4LF8 L;  3OWE B;  1HNZ L;  3FVQ A;  3CME A;  1LT5 D;  2C5C A;  4BA1 I;  2QEX A;  3R3O A;  1O78 A;  4XXE A;  2OXP A;  4LFB L;  4QGU A;  4FXD A;  2JA5 G;  2KEE A;  3S16 B;  5CR3 A;  5I2X A;  3NSW A;  2PNH A;  4A3K G;  3QG1 A;  4A3L H;  2E5L Q;  4A3I G;  1E24 A;  1T5E A;  4BWG B;  2NVT B;  4L5Q A;  2Z6B A;  4LF9 Q;  3S16 H;  2K6A A;  2R7Z G;  3MA2 B;  4GS3 A;  1FR3 A;  1OO9 B;  3R2I A;  1AE3 A;  3T1H Q;  1F2L A;  2NVT H;  2VQF Q;  1Y1W B;  3E6Z X;  5JEA H;  1IL2 A;  2HCI A;  3BJU A;  3RLN A;  1TY0 A;  2B2Y C;  2F0U A;  3RZD H;  5CV6 A;  1Y1W H;  4FYD A;  1X3E A;  1O7Z A;  4UPA A;  1OXS C;  1F2Z A;  1AN8 A; 
#chains in the Genus database with same CATH homology
 1STN A;  2BA1 A;  4I7Z C;  4MHE A;  1BF4 A;  4CKC A;  3H09 A;  1AP0 A;  2L12 A;  3EQL C;  1I3Q B;  2CW0 C;  2IX1 A;  1VMP A;  4KK7 A;  3BVM A;  3J7A V;  3R2T A;  3NXW A;  1TWC B;  1PTO D;  4CBV A;  4K2K A;  2OT2 A;  4LJZ C;  1WTQ A;  5CYU A;  1O80 A;  5DM7 3;  4A3B B;  2EVB A;  3GD7 A;  3JAM E;  4TSS A;  3EA6 A;  1CHP D;  5G3L D;  1I4G A;  3KF8 A;  4IUR A;  5I6Y A;  1HHV A;  4DN4 M;  3BZD B;  3J81 L;  2H1E A;  5FO9 B;  5JJZ A;  3WOF A;  5BN3 A;  4WRD A;  4QF4 A;  3SR1 A;  2MUY A;  1JOK A;  2R3Z A;  3F2U A;  3N52 A;  5KNB A;  3MWY W;  1QB5 D;  4TKO B;  3TP6 A;  4NKL A;  1CK1 A;  4OO1 G;  2IL8 A;  4HTH A;  1F9Q A;  1LO5 D;  4C3J G;  5K36 G;  4QB4 A;  2A6E C;  4KD3 A;  5C3X A;  3ZYY X;  4QMG A;  1HTL D;  5JOB A;  4CKB A;  2JXM B;  2I07 B;  4ZAI A;  2XRQ D;  2JA5 B;  5T1G A;  3K0Y A;  1PRT C;  4A3K B;  1AW7 A;  1JOO A;  1MD2 D;  1YNJ C;  4A3I B;  2B2T A;  4DNR B;  2WKC A;  4PNY A;  4X3K A;  2QCP X;  2SDF A;  1A2T A;  3QB3 A;  2R7Z B;  1DZ1 A;  4O1N A;  5EKI A;  3VR4 A;  2EYH A;  1DJR D;  1TKW B;  5M3F B;  2VUM B;  1OXU A;  4K6D A;  2B2V A;  3MZ5 A;  3LWE A;  3VA5 A;  3A7A B;  1EOT A;  3BG3 A;  3ONA B;  3S15 B;  1MSG A;  2AQ1 B;  3SEB A;  1EY0 A;  1PRT F;  4B9X A;  1SYC A;  3NUC A;  1STG A;  4A3M B;  1MGS A;  4EGV A;  3GTQ B;  3QIA A;  3RZO B;  3ND9 A;  3QJY A;  4IFD G;  1LT3 D;  4C2M B;  3HKZ B;  4F87 A;  1SNP A;  3SK6 A;  3WOE A;  1XXG A;  4V19 0;  2WP8 J;  3Q23 A;  1WTV A;  2AUK A;  1FYC A;  4RGN A;  5CBA E;  4Q5V A;  1SYF A;  1QE6 A;  1SEB D;  3PIP 3;  3PUW A;  1GXD C;  5F2D A;  1WTO A;  2F0W A;  3NTK A;  3K57 A;  3DWA A;  2E76 C;  3BDL A;  2EYF A;  1QJO A;  4XQN A;  4FF3 A;  3ERQ A;  5I9O A;  1EQT A;  3SK4 A;  3U9S A;  1C48 A;  2PO4 A;  2KJX A;  4RA8 A;  4DXF A;  4U68 A;  2JE6 I;  1HA5 A;  5DAU A;  1WTX A;  5KNC A;  1NR2 A;  3GTK B;  1EEF D;  2D62 A;  2B2T C;  2F0I A;  4H44 C;  2XRS D;  2YU9 B;  1QG7 A;  3WDN A;  3MTS A;  4U67 3;  5IGG A;  3HP3 A;  1G91 A;  3BDO A;  2NWG A;  3FPP A;  3PUX A;  5DNF A;  2B2V C;  3J7A F;  5EKL A;  2F0M A;  2QDB A;  4TRD A;  5K5P A;  1CM9 A;  2DNC A;  4KHV A;  1R4Q B;  4KN4 C;  1HQM C;  2K1B A;  2AQ2 B;  3MAQ A;  1ZKO A;  4XQQ A;  1B1Z A;  3NTI A;  4K5V A;  3S1Q B;  2NZ1 D;  2NN6 I;  4Z9C B;  4KD4 A;  2IX3 A;  3JAM L;  1NSN S;  5D3I B;  1D6E C;  1HPC A;  4RHR A;  3NWT A;  3D4W A;  3K7A B;  1STY A;  4BY7 B;  1TR5 A;  1X3Q A;  3MXG A;  5FO8 B;  2BOS A;  2E74 C;  5C0X J;  1TS5 A;  4IFD H;  1G8Z D;  1SJE D;  3QOJ A;  1VCI A;  2XVS A;  2K5W A;  4KKT A;  1XTC D;  2SEB D;  4K8J A;  4M1U B;  3DXJ C;  3HOW B;  2L5T A;  3VR3 A;  1BCP D;  2F0J A;  4FF4 A;  1FD7 D;  3J80 E;  1SMY D;  2K32 A;  3NBI A;  2F1M A;  2D5D A;  2ZT9 C;  1TS3 A;  3DEO A;  2L9H A;  1A3U A;  2F0T A;  4C1N K;  5BN4 A;  2K04 A;  1PZJ D;  3R93 A;  5EPJ A;  1E2W A;  1G2T A;  4PV1 C;  1SFO B;  2KVM A;  2NUC A;  3MXP A;  1V1O A;  3N6R A;  4A93 B;  4EVO A;  3M3Y B;  3URY A;  2C9O A;  3K58 A;  1CFM A;  3OPO A;  1ET9 A;  2A6H D;  1X32 A;  4R8I A;  3NP8 A;  4HN7 A;  4X3S A;  1KDA A;  1HCZ A;  4PMB A;  3I4L A;  5C0X G;  2R6G A;  3BVG A;  3HS0 C;  2EY1 A;  5DEH A;  2BE5 C;  4A3F B;  4H13 C;  1I4P A;  4DXG A;  3NQI A;  4RAU C;  5KIX A;  3M85 A;  3D6C A;  4C1N I;  1MSH A;  2EYP A;  3E5S A;  4K6L A;  3D4R A;  1IW7 C;  5EPK A;  5M3M B;  2D2C C;  3I90 A;  4IQZ A;  1RF2 D;  1WD1 A;  1IKL A;  2F0V A;  4GZY C;  5D65 A;  3GV3 A;  2LKV A;  4ZRZ A;  3I4M B;  1TS4 A;  5I4D A;  1HA6 A;  2Z8L A;  4YIJ A;  1SYG A;  4OGQ C;  5LL6 X;  2A68 D;  2AUJ D;  1DYQ A;  1CA6 A;  1SE3 A;  3QOL A;  5I6W A;  2N55 A;  4AYB B;  1RCV D;  1QCB D;  2QF7 A;  3A56 A;  1XWE A;  3IKJ A;  3MC0 B;  2FIN B;  3T4A C;  3OOC A;  1BQQ T;  1WTR A;  3PMF A;  1JWS D;  4HAE A;  1KDC A;  5C4H A;  4H7B A;  2L11 A;  1VDZ A;  1PZI D;  4C3I G;  2PW5 A;  5IOC A;  4QUF A;  1E2V A;  5A35 A;  3S2D B;  4IUN A;  2L0C A;  1Q8I A;  4KKU A;  3D31 A;  1EIG A;  3KK7 A;  4OIK A;  5FLX E;  2XWJ B;  2PZU A;  1NCV A;  1ESF A;  1TQO A;  2RA4 A;  2XSC A;  4RCO A;  1F9P A;  1ESR A;  4MIU A;  1U4P A;  2EYJ A;  1V1P B;  1LAB A;  3ITP A;  4JBW A;  5FOB B;  1GOZ A;  2F0K A;  4WOR A;  4DF7 A;  5JAV A;  5C0X H;  2JEB I;  1C8C A;  1IHZ A;  1RHP A;  1ZYR D;  3GP7 A;  1DOM A;  3MXU A;  1LTG D;  1TU2 B;  2XIW A;  2KQ3 A;  2F3V A;  4Y7N B;  2RKS A;  5LL6 S;  5M5W B;  1G2S A;  1B4O A;  1ET6 A;  4ID6 A;  1H9S B;  3SXH A;  3V05 A;  1TII D;  3D4D A;  4DAV A;  1GHK A;  2G9D A;  5EQ0 A;  1TY2 A;  3C3L A;  1AZQ A;  2HCC A;  3J80 L;  3Q0A A;  1F9S A;  5KEE A;  4H0L C;  2RDG A;  1LLR D;  3AU7 A;  4RHS A;  3A55 A;  2R92 B;  2NB0 A;  2EDG A;  1Y8N B;  2BCO A;  1K8M A;  4F8M A;  3DHQ A;  3VYR A;  1Q12 A;  2IT1 A;  1Q90 A;  3M4O B;  1BDO A;  1SE2 A;  3SE0 A;  2CHB D;  2MPM A;  3RZD B;  3CKI B;  2XWB B;  4HCE A;  2O5I C;  4EQN A;  2K05 A;  2F0L A;  1ROD A;  2EYO A;  1PTO C;  3DUZ A;  2DNE A;  1PRT B;  2BDN A;  4M8A A;  4BBS B;  5CV8 A;  1PLF A;  2SNS A;  3W3A A;  5E3F A;  1STH A;  4HED A;  3NWS A;  4ME5 A;  3TBI B;  1CZW A;  5EKK A;  1IYV A;  4I65 A;  5JPM C;  2VB2 X;  4X3U A;  4FO2 A;  3AMU A;  3S14 B;  5IT9 E;  1BXT A;  1DD2 A;  2EYM A;  2WAQ B;  3I91 A;  2NTT A;  1PTO F;  2QIL A;  1LAC A;  2JA7 B;  1J8I A;  2IW3 A;  4XYO A;  4PQX A;  3C2P A;  2SOB A;  1MI2 A;  5E1F A;  2JA8 B;  4A3D B;  3A54 A;  4KMU C;  1A3V A;  5G3L F;  4UDU C;  1ZXT A;  2RQX A;  3V96 A;  3H0G B;  4IFD J;  2A69 D;  1BOS A;  1SYB A;  2K01 A;  2IX0 A;  3A8K E;  4R8N A;  5EGT A;  1UAP A;  4C3H G;  3M7N A;  2IPK D;  3X3M A;  4XDX A;  2NN6 G;  1BNZ A;  3OW7 A;  1KNE A;  1JOR A;  4IUT A;  4FXG C;  3IAY A;  3D3R A;  1RDP D;  1Y8O B;  5C4Z A;  2QKI C;  1LTB D;  1PMR A;  1JR0 D;  5FLX L;  4V0B A;  2ZXR A;  5FK9 C;  2K5D A;  3EFX D;  4B9W A;  1WD0 A;  3MHB A;  4HSV A;  3CQZ B;  3MFG A;  2Q8T A;  2MJ8 A;  3MVV A;  1PFM A;  2RDF A;  1DON A;  3GTG B;  2RSN A;  1D1K A;  5ELB A;  5IGB A;  4CGY B;  4ZYS A;  1YNN D;  1S5F D;  1H9K A;  3GTM B;  1F2M A;  3BDC A;  1L0X B;  3S2H B;  1XYI A;  1C4Q A;  2F0F A;  4ODG A;  1CHQ D;  2ZXP A;  2F3W A;  1H9M A;  3HOU B;  5FO7 B;  4L63 B;  2BDO A;  3GV6 A;  1W6K A;  4LAA A;  3U9O A;  4BBR B;  3P7J A;  3P20 A;  3E0J A;  4HMI A;  5E4W C;  3SK5 A;  1HQR D;  4KN7 C;  5ELD A;  1OXT A;  1EU4 A;  1S5D D;  3CU7 A;  1EYC A;  1LTI D;  2Y0S B;  4QUC A;  5J39 A;  4C3H B;  1AFP A;  3KLS A;  3SDZ A;  4C3J B;  1Z6H A;  3HOY B;  2L4N A;  1ILP A;  5C44 B;  2LMC B;  4OO1 H;  4WFN 3;  2K03 A;  3FRP B;  5K36 H;  2R93 B;  2O5J C;  4HSP A;  1JIC A;  2CVR A;  5C5L A;  3VR2 A;  2B2U A;  2F4I A;  5CV9 A;  1SNQ A;  1EQV A;  3Q24 A;  4K5W A;  4Q0F A;  1STA A;  2A73 B;  2M9V A;  4J8Q A;  5CBE E;  1BR9 A;  5CC4 A;  4RKB A;  1GUW A;  1D5Z C;  1BO0 A;  2NTS A;  1O7Y A;  1PFN A;  2R61 A;  5IT9 L;  3KBX A;  5J22 A;  5JVG 3;  1RD9 D;  2F0Q A;  5CGK A;  1D5M C;  2FMC A;  3TME A;  1ML0 D;  1U9R A;  2DY7 A;  2LS0 1;  1KDB A;  4EQO A;  3OIP A;  1HUN A;  1BUV T;  2ICE C;  1A15 A;  3H91 A;  4ZK9 B;  1QOH A;  2WKD A;  4J6H A;  4IUQ A;  1FNV A;  1JB3 A;  1O7L A;  4DGZ A;  2PQE A;  3K6O A;  1BCP C;  1B44 D;  1SMY C;  5HUR A;  2O2L D;  3VYT A;  4RGM A;  4TQU S;  1ILQ A;  3I70 A;  4OIJ A;  1EYD A;  2HQE A;  1EIH A;  5CV4 A;  3KBG A;  4ZQ3 A;  1T5X D;  1JWU D;  4PMC A;  2ENB A;  2PZT A;  3D6W A;  3P1H A;  3UI2 A;  3BYY B;  1NUC A;  3NTH A;  3IL8 A;  1CT1 D;  2IWH A;  1BCP F;  2B2U C;  2A6H C;  4KHZ A;  2E2J B;  3PO3 B;  3D8G A;  1Q1B A;  5C3E B;  4KY6 A;  5ISR A;  3QWN A;  2EOT A;  3K5L A;  1WTW A;  2E2H B;  1II3 A;  2ID0 A;  1F9R A;  1I6V C;  3K5O A;  3AB9 A;  3S9W A;  3T16 A;  2AQ3 B;  2AWN A;  2KEC A;  1IKM A;  5I9P A;  4E6I A;  4EQP A;  3L9A X;  1TS2 A;  4PMW A;  1F2Y A;  2M00 A;  5A2Q E;  1D2B A;  2F0S A;  4IZ8 A;  5BN5 A;  1A3T A;  1B2T A;  2A68 C;  4ILW A;  4G7H C;  2L1B A;  1GUG A;  3O13 A;  1EU3 A;  2B39 A;  1G29 1;  5KRU A;  2ZXO A;  3LX0 A;  4XT1 B;  4NW2 A;  4ABN A;  3Q22 A;  2JSO A;  3T13 A;  1Z7T A;  2JP1 A;  2WIN B;  4DU9 A;  1DOK A;  3LNN A;  3NE5 B;  2H4O A;  4A3J B;  1LTR D;  1TWA B;  3S1M B;  4CHT B;  2YYZ A;  3DEP A;  1EWH A;  3T51 B;  3TN2 A;  4G57 A;  2BE5 D;  4G7O C;  3S17 B;  4XIG S;  1H9R A;  1WVL A;  1VMC A;  2EJG C;  4X3T A;  3PUV A;  1KAB A;  1UEA B;  2FJ2 A;  1SDF A;  1QIL A;  1EEI D;  4FF2 A;  1EY5 A;  2F0D A;  3TP8 A;  2X6L A;  4KJO A;  4ZKC B;  2SNM A;  3OWF A;  4B08 A;  4N9T A;  2L55 A;  5CV5 A;  1LT6 D;  1EY4 A;  3IFD A;  3T53 B;  1CTM A;  5IGC A;  2PCF B;  1QWY A;  2NYZ D;  1ZYR C;  5EJW A;  5LHY 1;  3RUZ A;  2EZV A;  2KUM A;  4K14 A;  2K33 A;  1HFN A;  4RH6 A;  1V1P A;  3VR6 A;  1PTO H;  1UUP A;  2B2Y A;  1X3P A;  1B53 A;  1LV9 A;  2GA4 B;  4G4K A;  2B8F A;  3HRZ C;  1FNW A;  1K83 B;  4K5X A;  1EY6 A;  1KAA A;  2E2I B;  2RVL A;  1TVX A;  5IOD A;  1B50 A;  2RSO A;  5IGF A;  1D1I A;  3DMU A;  3PO2 B;  1F77 A;  4F7X A;  3EJI A;  1H9S A;  2HDL A;  2PYK A;  1KLU D;  1DCZ A;  2F0H A;  1W6J A;  3I73 A;  2FHT A;  1S5E D;  3QO2 A;  3TSS A;  3I72 A;  4CJ2 C;  4J1M A;  1ENA A;  5M5X B;  4P2C B;  5C4X B;  1MBY A;  5AFW A;  4DNT B;  2OF1 A;  1PFB A;  2WV6 D;  4RKL A;  3I8Z A;  1D5X C;  3NPP A;  3PIO 3;  1GUN A;  4DAP A;  3X3N A;  3VYU A;  5C0X I;  5COR A;  2EJF C;  2PZW A;  5IGD A;  1BBX C;  1ENC A;  3RD4 A;  3OHX C;  4C3I B;  2PMZ B;  4ZLT F;  3C1F A;  3HEJ A;  4NDX A;  3KLS X;  3A8I E;  4O42 A;  3DM1 A;  2A74 C;  2KA7 A;  3R8B A;  4NMZ A;  4KV6 A;  2F0E A;  5A2Q L;  3GTL B;  5CV7 A;  4FVM A;  1S5C D;  2WAC A;  4IAL A;  5M5Y B;  3IFT A;  2LY7 A;  2Z4H A;  3GTP B;  2A69 C;  2DY8 A;  2Z1C A;  1B9N A;  1Y8P B;  2EYL A;  3CRL C;  1JQY D;  2Q8R E;  3PUZ A;  4XTC S;  4HCS A;  3GTJ B;  2F0G A;  2I46 A;  5EBC A;  1PXU A;  1L0Y B;  2OEO A;  4N9P A;  2CW0 D;  5ELE A;  2AWO A;  1NR4 A;  1E0B A;  5KND A;  4CKE A;  1K8O A;  1LT4 D;  3VA7 A;  1FGB D;  4FP5 D;  3G6J B;  2PW7 A;  1CA5 A;  2MP1 A;  4NP5 A;  4IUV A;  4QIW B;  3VYS A;  4QCL A;  1PYW D;  1CI3 M;  1YNN C;  1WTP A;  3FMC A;  4DA2 A;  3GO5 A;  3KUP A;  3C1E A;  3NQT A;  4LMQ D;  1GUS A;  1GUO A;  1B9M A;  3M7G A;  1SXT A;  1EY9 A;  1RTN A;  5D14 A;  1I4H A;  1EFI D;  1FNU A;  1Z47 A;  2A6E D;  4FNF A;  2EPB A;  3A8J E;  1Y1V B;  3V2T A;  1ENF A;  3S1N B;  1EZ6 A;  2Q8I B;  1S5B D;  1M8A A;  1EYA A;  1SNO A;  1OXX K;  1PRT D;  4KY5 A;  5C6A A;  5DM6 3;  1YNJ D;  3BS1 A;  3TP5 A;  1OXV A;  1SYE A;  3J7Y W;  1HTP A;  1CQV A;  4KY7 A;  4DFA A;  3GTO B;  4KJN A;  5EPL A;  2FMM A;  3L7Z C;  1I50 B;  1EY7 A;  3TDQ A;  3LWU A;  3OSO A;  3OMC A;  4KI0 A;  1BCP B;  4KKS A;  2KCN A;  4ULL A;  4MN3 A;  1SAP A;  3HOX B;  1VF7 A;  3EVQ A;  4CJ1 B;  2PNR C;  1EWC A;  3C46 A;  3HGB A;  5ELF A;  5FKA C;  2TSS A;  3BVZ A;  2NN6 H;  4L8J A;  4JK1 C;  4RGT A;  1DM0 B;  1STB A;  4OHJ A;  2VXW A;  1PZK D;  1GHJ A;  1J9O A;  4RCN A;  1R9T B;  4LK1 C;  1A2U A;  1HUM A;  1LTA D;  2X69 A;  2EY6 A;  1B3A A;  2K5Q A;  3K59 A;  1EY8 A;  1TT2 A;  3DWQ A;  4IUP A;  1HXY D;  1SYD A;  1H9J A;  2IJ0 A;  4KTA A;  2HDM A;  4L6T B;  2WB1 B;  2TMP A;  4XQJ A;  2EY2 A;  3FEW X;  2NBF A;  3K5M A;  1ICW A;  1Q3L A;  2EXZ A;  3G7L A;  5C3W A;  1I6H B;  2M2L A;  4OO1 I;  2VNU D;  1I4R A;  1QNU A;  1AZP A;  4K2L A;  2XN9 C;  3I3C A;  1WCM B;  2JYO A;  4BY1 B;  1U4M A;  2F0P A;  3CRK C;  4RFB A;  2WII B;  1LTT D;  3W2D A;  5C4J B;  4XT3 B;  2G9H D;  1SE4 A;  5JVH 3;  3TP7 A;  1GUT A;  5J1Z A;  1SNM A;  1LTS D;  1V8Q A;  4HR7 B;  2A5H A;  1JWM D;  4FXK C;  4DAY A;  1STE A;  5HGT A;  1DOL A;  2FFK B;  1JOQ A;  1SNC A;  3OIQ A;  1KTK A;  2CQA A;  3RMH A;  5TSS A;  3SVM A;  3VR5 A;  2B8G A;  3ND8 A;  5COY A;  4ZKB B;  1VF5 C;  1CQF A;  4XYQ A;  1EZ8 A;  2F03 A;  3NHH A;  4K8I A;  3P75 A;  3PUY A;  1E2Z A;  5JPN C;  1TWH B;  4IN3 A;  4IFD I;  4IUU A;  2K7V A;  1JE4 A;  3I4N B;  2J4X A;  3SHL A;  1TWG B;  3KLR A;  1I4Q A;  1ZEQ X;  5IIF A;  5KGU A;  2B2W A;  3MFY A;  3ERO A;  3RLF A;  5ELC A;  4R9W A;  3HOV B;  3NBH A;  4F88 A;  2DN8 A;  1GJX A;  2N88 A;  2E75 C;  2EE1 A;  1HFG A;  3K5N A;  5JEA J;  4FF1 A;  2HUG A;  1EL0 A;  2O4X A;  2V4D A;  3Q6S A;  1AEX A;  4RGO S;  2K28 A;  2F0O A;  2KOL A;  3TZU A;  2JA6 B;  1SSO A;  4A3G B;  1HRJ A;  1IL8 A;  1RJT A;  3S1R B;  4DK1 A;  2KED A;  2RDH A;  2ICI A;  5D3D A;  1R4P B;  1XX8 A;  3FDT A;  5CMD A;  5EBD A;  3M4Y A;  2E2D C;  5IGE A;  2J7Z A;  5E4X A;  4ZUJ A;  4UAI A;  4A3E B;  3FPU B;  2BA0 A;  1IW7 D;  3J81 E;  1SJH D;  1M4V A;  3H6M A;  4G7Z C;  2D9U A;  1SND A;  1DXM A;  1JCK B;  2B63 B;  4C56 C;  2MGS A;  3NK9 A;  2X6G A;  1TWF B;  5M9O A;  2F0N A;  1KNA A;  3HG9 A;  5JEA G;  3GQB A;  5C5M A;  3BYT B;  2B2W C;  2NVY B;  2KCC A;  2LFN A;  1IYU A;  2EJM A;  4ZUI A;  2NVX B;  2J0T D;  3PV0 A;  3H94 A;  1CZG A;  3CHB D;  1I4X A;  5KYL A;  4S3S A;  1V43 A;  1S4Z A;  1G6Z A;  1PTO B;  3H3V C;  3MEH A;  3HZX A;  1QNK A;  3SK8 A;  1U4L A;  4BS9 A;  4CJ0 B;  5I2Y A;  4BA2 I;  1NAP A;  4OL7 A;  2EY5 A;  3HOZ B;  4HMJ A;  4WJW A;  5KYI A;  2PPB C;  2KHS A;  2NVQ B;  1ONL A;  4DK0 A;  1Y69 U;  2VB3 X;  3A7L A;  1RTO A;  2MHV A;  2JEA I;  1SBB B;  2QEJ C;  1JC7 A;  3L3O C;  2RBM A;  1U4R A;  1Q1E A;  5T1I A;  4RWS C;  1RKN A;  3DWP A;  3MXN A;  3OMG A;  1UNS A;  2Z4I A;  1PDQ A;  3TZD A;  1A6X A;  3T56 B;  1KLG D;  3FKI B;  2XNA C;  5NUC A;  3OWE B;  3FVQ A;  1LT5 D;  2C5C A;  4BA1 I;  3R3O A;  1O78 A;  4XXE A;  2OXP A;  4FXD A;  2KEE A;  3S16 B;  5CR3 A;  5I2X A;  3NSW A;  3QG1 A;  1T5E A;  4BWG B;  2NVT B;  2K6A A;  3MA2 B;  1FR3 A;  1OO9 B;  3R2I A;  1F2L A;  1Y1W B;  3E6Z X;  5JEA H;  2HCI A;  1TY0 A;  2B2Y C;  2F0U A;  5CV6 A;  4FYD A;  1O7Z A;  1OXS C;  1F2Z A;  1AN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...