1FAAA

Crystal structure of thioredoxin f from spinach chloroplast (long form)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
121
structure length
121
Chain Sequence
LELALGTQEMEAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN F
publication title Crystal structures of two functionally different thioredoxins in spinach chloroplasts.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Electron transport
total genus 36
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2000-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1faaA00
1WWJA 4MABA 1PMTA 1M2BA 4DSQA 1XWBA 4YQVA 1SJ6A 3GKMA 2BMXA 2LQQA 4G2EA 2H1DA 1ILOA 3GKKA 3A5WA 2DLXA 4RUVA 1VF1A 4FYBA 3A2XA 3EU3A 3GTUA 1Q98A 3L4NA 2N5AA 5D9TA 1X9MB 2F51A 2QGVA 2MYGA 2HZEA 4MA9A 1IYHA 3TGZA 2IMEA 4XS1A 2VM1A 2YP6A 4HI7A 2G2QA 2OADA 5FWGA 1B9YC 5G5EA 4TOPA 4EUYA 1RW1A 4GQCA 1BX9A 3GMFA 4ZILA 1SK1A 1YJ6A 1TOFA 1HNAA 4ID0A 3UIWA 1WJKA 2C3TA 16GSA 1PL1A 1GUKA 2LS5A 2EIRA 3UVTA 4IQ1A 4NXIA 2F3MA 3F4SA 18GSA 3ZFBA 2XBIA 3PR8A 2YWOA 3VWWA 1HQOA 4TXOA 4F82A 3IAM2 1WP0A 3D6IA 1GWCA 1GSDA 4JE1A 2YV7A 3HDCA 1GTBA 3VI5A 2YWMA 3DVXA 3GX0A 1H75A 2IIYA 4Z7XA 4POLA 1SKSB 4O32A 4PQ1A 4EVMA 1XW6A 4LLRA 3G7YA 4F03A 4WR5A 3GSTA 2VD0A 2H66A 19GSA 5F0GA 3QAWA 5F06A 4IJIA 3PINA 3GV1A 3TKQA 4POMA 5A4UA 2CV4A 4Q5RA 4MJBA 5IOXA 2MBSA 4JR6A 1TJDA 1Z6NA 1XW5A 3O76A 2H76A 3DXBA 1TDIA 9GSSA 1FG4A 5EL8A 1U87A 1GSUA 1ZOFA 2NPBA 1EZKA 3D4MA 1B48A 2L57A 3UEMA 1SYRA 2V32A 2PBJA 3DGQA 1GSEA 2VCZA 2GSSA 2CT6A 4GXZA 1O7UA 1V57A 3FR6A 1R5PA 4TKYA 4OFTA 3LGCA 1TU8A 3EINA 2PUKC 4RI6A 3ZTLA 5KN0A 5A4VA 3KH7A 2RUEA 4KSMA 1XIYA 2XPEA 2CA8A 2FLSA 5GAPD 3L9SA 5AIXA 3CYNA 3ZL5A 4GSSA 5GZZB 1XXUA 2FA4A 1EV4A 4V1Ag 1UA5A 3EMXA 2V6KA 2X64A 2FY6A 4WKWA 1EOGA 1BG5A 2B1LA 5ECPB 4IHUA 2B5XA 4GSTA 1VGLA 4XRDA 1S3CA 2EIQA 1V2AA 2HSHA 3LG6A 2IN3A 4ECJA 1NHYA 1FW1A 2O87A 5EY6A 3H93A 5LNKe 1B8XA 2AV4A 3F3QA 1JHBA 2DSAA 1LJRA 1A2MA 4ILFA 1GUHA 2DJ2A 1R26A 1OVNA 4MH3A 5EPFA 3EYTA 5J9BA 4IBPA 4HQSA 3ZRDA 4ZB6A 4O7HA 2WRTA 12GSA 1EV9A 1USBA 4KCAA 1X9WB 4K0NA 4OMVA 2QSIA 1JLVA 4WXTA 1AIUA 2IWTA 3H79A 4D73A 4GWRA 1XW9A 3FY7A 1TTZA 1WRYA 2A2RA 4F9ZA 1GL8A 2K9FA 2WFCA 2IFQB 1M0UA 4XCSA 4EDZA 4ZIJA 2YZUA 1SJIA 5D93A 3ZFLA 2CAQA 2DC5A 5DQYA 3JCML 2ZUPA 2C0DA 1S3AA 4J56E 1THOA 3GL3A 4KE3A 2EIOA 5IMAA 3GH6A 3KXOA 2K18A 2H0GA 2YN1A 5B6MA 2R3XA 5H5SA 3DMLA 2H19A 2X99A 4HUAA 1X5DA 2OACA 4IS0A 5ECIB 4ZBAA 5E59A 4DSRA 4V2NA 1FOVA 2L5OA 1GNWA 5E4WA 1SJZA 3WGDA 4KW6A 4MPFA 3D21A 5A5KA 4TN8A 4KCEA 3APOA 5ID2A 4NHZA 3EU4A 4O92A 3M9JA 2RLIA 3EVIA 2LKUA 1K0DA 3A2WA 4QQ7A 4KDUA 3TJBA 1TRUA 4ZL9A 2HT9A 2HNLA 3QOUA 4HU9A 3GX8A 3M8NA 3H4KA 4GLTA 5IMVA 4YH2A 4JU5A 3HXSA 1T4YA 1O81A 1THXA 2ON7A 2JL4A 2GVPA 2PERA 1YEPA 3DRNA 2GT6A 3VFIA 1PX6A 3H1NA 5J4UA 2B6MA 3CMIA 4IKHA 3L78A 4OFMA 3CBUA 4HOJA 1LU4A 2FGXA 2CVDA 2KP1A 3DWVA 3IR4A 4XS6A 3WYWA 4KUNA 2O8VB 1T7PB 5G1KA 3P8WA 5J9CA 1G6WA 1UC7A 3DYRA 6GSYA 4ECBA 4OCFA 3FKFA 6GSWA 4MK3A 4N30A 2H8LA 1HD2A 2KOKA 1ABAA 2B3SA 1KTEA 1HNCA 1T4ZA 3M9KA 4ZBBA 5ECNB 4KX4A 2IL3A 1QK8A 1OKDA 4JZQA 5HFGA 3I6AA 2GSTA 5JCWA 3KZQA 2FCHA 3HKRA 3ZVJA 4XS4B 5ECMB 3IXRA 3TKSE 3CSJA 1QFNA 4GF0A 3IHQA 1NW2A 3HZ8A 2VCVA 1N8JA 4XRAA 4K7NA 3GTUB 1YDKA 2ES7A 1K0CA 3HZ4A 4NV5A 5DDLA 6GSXA 5DJLA 4K7OA 2HZFA 1Z9HA 1V9WA 3MSZA 2CX4A 2HZEB 1DE1A 3GRXA 5CRHA 1SYXA 2I81A 4PNFA 1VRSD 5KN1A 1UN2A 5DVBA 5FHIA 4JR4A 4V1Ap 2HXKA 3HYPA 2WDUA 3RHBA 5HR2A 3WT2A 2MMZA 4FYUA 3GH9A 1FO5A 5CYYA 4WEYA 2DBCA 1K0AA 1F37A 5HR0A 2PVOC 2DJKA 5CREA 3LYPA 4WBRD 2PWJA 4KDYA 2E2MA 3RPNA 1BEDA 2VLUA 2C3NA 3F63A 2C80A 4TXOB 5D9WA 2KUCA 1AQXA 1MTCA 3BOAA 5DALA 3RAZA 1SL0B 1WIKA 1GRXA 3VPQA 5AGYA 4FIWA 2RM6A 3GA4A 4ZB8A 3V1WA 3IBHA 4K7IA 4NMUA 4HS1A 1TK8B 2F9SA 1FVJA 4FYCA 4AGSA 3N9JA 4TR1B 3QDNA 4RI7A 2B7JA 5C04A 3IPZA 1J0FA 4NV2A 1ZYEA 3GNJA 1A2JA 3KM6A 1ZGNA 2AAWA 17GSA 1ZCPA 3FYGA 3G7IA 3VPTA 3K8NA 1F9MA 3EWLA 5DAKB 1EP7A 5KN3A 1C72A 5KEJA 5KN2A 5D73A 4P3YB 1I5GA 3CXGA 3VLNA 3DIEA 1U6TA 2H74A 1GTUA 1URMA 14GSA 4L8EA 1R5AA 2PU9C 1OC9A 2LTKA 3ERWA 3GKXA 1GUMA 4FH8A 2F8AA 1TP9A 1K0OA 3A2VA 2V41A 1YQ1A 4LA1A 1X9SB 4E8HA 5ELGA 4KNDA 2RUFA 4G9HA 2AHEA 2IMKA 1A8YA 4DVCA 1TRVA 3APSA 2EC4A 2B5YA 4J2FA 3CTGA 5G31A 1YKCA 1T00A 1AAZA 13GSA 4MCUA 1SENA 3TUEA 1JLWA 2JU5A 3TDGA 4AJ7A 2PN8A 2YPMA 3ERGA 4PQHA 1DBYA 2LJKA 1TW9A 2H1BA 2A4VA 1V98A 3KIJA 3KP8A 3ZVJD 5IMZA 1QXHA 4HDEA 3H8QA 2YJ7A 3QMXA 4J57E 4DEJA 3MAKA 3S9FA 3F9UA 4K9ZA 4H86A 2MMOA 1LBKA 2LSTA 5IQYA 1GH2A 1XVWA 1CQGA 3PH9A 1XOAA 3LWAA 2NDOA 2DMLA 2P0GA 3LQ7A 1F3BA 1TK5B 2FA8A 4ML1A 4TVEA 10GSA 2E0QA 3ZZXA 4MZWA 2IMFA 1WE0A 4F0BA 1BQ7A 3CSIA 3NIVA 5FT3A 3CRUA 2BJXA 4G19A 1GLPA 1MDJA 3GHAA 2FWEA 5ECOB 4YAVA 3TRXA 2NTOA 4QL9A 2V1MA 5JWRB 2YJHA 4MF5A 2JACA 4L5OA 4OFNA 2H70A 4O5RA 3M1GA 4Q5QA 4I6XA 4MJCA 22GSA 1YZXA 5B6NA 3GL5A 3IE3A 3EURA 1T1VA 2HLSA 4K8MA 5D96A 2R5GA 3IK9A 2YWIA 1N2AA 1EP8A 5B8BA 3GUSA 1U88A 5GSTA 4MF6A 5ID2B 4HEA2 4GCIA 4EO3A 2H0IA 2VM2A 5COHA 5IIZA 1E6BA 1WPIA 2FNOA 1K3LA 1TI1A 3N5OA 2GZYA 1QMVA 2ZNMA 2XBQA 4TW5A 2OJLA 1R7HA 2C1YA 2DJJA 1XVQA 3TJGA 2FHEA 3HY2A 5ENUA 3CRTA 1UVZA 3US3A 1AUCA 1ML6A 4LL1B 4WETA 2CZ3A 1OC3A 2AJQB 4EXJA 1G7EA 4KH7A 2DJ1A 5ECRB 1SD8A 5HR3A 1ACVA 2YANA 1ERWA 3KEBA 3ZIVA 2L6CA 3GSSA 2J23A 3TJFA 3W8SA 4MMMA 3G9BA 3D5JA 2B7KA 3ZLPA 4MH2A 2OE3A 5HR1A 4KDXA 4LMVA 2IMIA 2DJ3A 3UBLA 2YV9A 5D9XA 5D9VA 2AYTA 2J9HA 2XC2A 1PN9A 4TRXA 5ECHB 1GTIA 2GZPA 1A23A 2C0EA 2E2GA 3DEXA 5J41A 4RQXA 2BTOT 2R37A 2VAFA 4BVXA 5B7CA 4K2DA 1JZOA 3OR5A 4TR3A 4NWYA 5CNWA 3Q19A 1AXDA 5ECKB 2HYXA 3UBKA 1K0NA 4ECCA 4RQRA 3RBTA 5JWOB 5CRWA 3EMPA 3EE2A 2MBTA 1M99A 2H01A 2GDRA 2M80A 4IVFA 1H4OA 1OKTA 1O6JA 2KLXA 3FRCA 3J7Yb 4K1FA 1EEJA 1V58A 5G2ZA 4XTSA 3IOSA 1Z7PA 7GSSA 1DE2A 2WULA 4PUFC 5IMDA 6GSUA 1QUWA 1GTAA 4I2TA 2FWGA 2HRFA 2FD3A 3E0UA 1O73A 1XWGA 2VUPA 4BWSA 1HNBA 2M72A 1Z5YE 3Q6OA 3P2AA 2AB6A 5B8AA 3TOTA 5G5FA 4YQMA 1XFLA 1TXXA 1AQWA 2OE0A 2V2GA 3D0ZA 2OBKA 3UOMA 3ZMKA 2ON5A 3KJYA 3L9UA 3C1SA 2YWNA 4MDCA 3FR3A 3D22A 3TRPA 1B9XC 1PA3A 1MD4A 3VWXA 1MEKA 5AISA 4AJ6A 2C0FA 2GQKA 3P7XA 2H1GA 3QCPA 1OE8A 1TRSA 5L71A 4K0GA 3FW2A 1TI3A 1JZWA 2O7KA 2XPDA 2L4QA 2GZZA 3GURA 2L5LA 4OCEA 3C7MA 2PVQA 1F6MC 3KMNA 1J08A 3I43A 3QR6A 3EC3A 5J3RA 3CSHA 1GSQA 4TR0A 4EE0A 5IO2A 1PQNA 2JSYA 2OKAA 3GIXA 3TRQA 2VCQA 1TRWA 1XPVA 2LJAA 2N5BA 1XOBA 2IPAA 4N0ZA 1TU7A 5F05A 2K8SA 2HE3A 2CAIA 2WGRA 4PGTA 1G6YA 4EDYA 1U3IA 3QAVA 5J5NA 5EVOA 1OC9B 1HYUA 1V40A 3D4TA 1A24A 2LNTA 2LRTA 1EGRA 2VO4A 1I9DA 4XHMA 2H6ZA 3GFKA 1QQ2A 1KBNA 2X8HA 3ERFA 4PUAA 5CP1A 3HA9A 1ST9A 4DSSA 1R4WA 1XWKA 3HVVA 4ISDA 3LXZA 2B5EA 3KH9A 3F3RA 3ZMLA 3ZITA 3F6DA 4ZB9A 3E9JB 4YAPA 1XBSA 5A4WA 1O85A 4EF0A 1OC8A 2CX3A 3WT1A 3A3TA 1W4VA 3BCKA 4KB3A 3LXTA 1X0RA 3FK8A 1FB0A 1M2DA 1YEXA 3UARA 1YY7A 1JFUA 1GSFA 1EWXA 2C4JA 4Q5NA 2WS2A 1T8EB 4ECIA 3KMOA 3UJ1A 1FB6A 2TRXA 2H72A 2R2JA 1QGVA 2FWHA 4JRRA 3U6VA 5F8BA 2X8GA 2C0GA 2VLTA 1G0TA 2XHFA 2JZRA 1BJXA 3W6GA 5H5QA 1XWAA 1GP1A 3LYKA 4XS4A 3UMAA 2H1AA 2LNSA 3GN3A 1ZL9A 1A8LA 4CDOA 2O89A 1JZRA 2FUG2 1BAYA 2I3YA 1Y6EA 3E3EA 2V6OA 3HJOA 4WBJA 1SD9A 1A0FA 3GKNA 3QD9A 4NPBA 1GNEA 3APQA 2WCIA 3L9VA 5AN1A 2H73A 3HHVA 4IJ3A 4I8BA 1B4PA 3FZ4A 3HCZA 4GQFA 2I4AA 1B4QA 3HD5A 3SBCA 3TOUA 3TCOA 1K3OA 3KGKA 1S3DA 3J7Yk 4X1UA 4MP4A 2P5QA 1FVKA 3IK7A 1NHOA 2JADA 1YKAA 4JBBA 1PD21 4CHSA 2CVKA 5LCZA 2LRNA 1VF4A 3HJMA 1ERVA 1GLQA 4IGJA 3Q74A 4N10A 1Z6MA 2AUVA 2A2SA 2E7PA 3IV4A 4HU7A 3G7JA 4OO4A 5H5RA 1J9BA 1E2YA 3L0HA 3KTBA 1XZOA 4ULXA 11GSA 2LQOA 4PQIA 3TKSA 2PPTA 4MPGA 4E8EA 1SL1B 3BJ5A 1Y25A 2NBSA 3I9V2 3QAGA 1G7OA 1O8WA 4HQZA 2QC7A 4HZ2A 3ZYWA 1ZZYA 4TR1A 5IOWA 5CO3A 4WR4A 4LMWA 3PGTA 2MMAA 4I97A 4CW9A 4HJMA 2OA7A 4PXOA 5IMCA 5D8IA 3IC4A 2Z9SA 1OE7A 4ZL7A 5ECSA 5DAKA 4D73B 3KD0A 3TB2A 3BBYA 4IELA 3O3TA 3TKPA 3R2QA 4V2MA 4KA0A 4HZ4A 4MLYA 1M9BA 2TRCP 1EEMA 2VCTA 4K6XA 2IMDA 3VURA 3FZ5A 1MDIA 3C71A 2VOCA 5ABRA 4L5LA 1ERUA 5G1LA 3MNGA 1M2AA 4PX1A 2CQ9A 2VCXA 1EOHA 4MZBA 1Q4JA 4EL1A 1XWCA 2CZ2A 3C8EA 4KSOA 4TR4A 4POBA 2VIMA 2VL9A 1KEBA 3FEUA 4L0UA 1K0BA 1FAAA 2I9HA 2IJYA 3C73A 2WB9A 1AQVA 1ZYQB 2P5RA 5HFKA 2LRCA 2C3QA 1OAZA 3F4TA 3GYKA 3DVWA 5CRDA 2ZCTA 2LV3A 4WF5A 4KGIA 2O85A 3ZIJA 3TKRA 1YF0A 2QKEA 1WOUA 2YOIA 2LUSA 1NM3A 4NAXA 3IAS2 2D2ZA 1WMJA 2RIIA 1SK0A 2GSRA 3I69A 3VWUA 3RPPA 1BYEA 3RDWA 5DJMA 3VI7A 5F07A 2VL2A 4MJAA 1AW9A 3ME7A 3O6TA 1VF3A 1ERTA 3FR9A 3Q18A 3W8JA 1PX7A 4KAEA 2P31A 1PKZA 1SK2A 2TIRA 3WGXA 2DMMA 3F0IA 5IO0A 2H71A 3HJPA 5ECLB 4F0CA 5IM9A 3LEFA 1PL2A 2B1KA 5C00A 4PURA 2HSYA 4AJ8A 3WGEA 2MMNA 1K3YA 4YQUA 3M0FA 3VWVA 2M46A 4GSNA 4I2UA 4BA7A 3LJRA 2R4VA 3BD2A 2C8UA 3UVHA 1KNGA 4N0VA 3KP9A 4IN0A 1A0RP 2YNXA 2I1UA 4BL7A 3FZAA 4X0XA 3ISOA 2HI7A 4QL7A 4ZL8A 5IPGA 5ELAA 5AIVA 1A2LA 3BCIA 2H75A 2VD1A 2OBIA 3U5RE 2JSZA 1SKRB 3UL3A 4IP6A 4X43A 5CAXA 1F2EA 1IYIA 3KTLA 4N11A 8GSSA 4MZCA 4POKA 2VLVA 3LSZA 3TJJA 1PRXA 3QFBC 1TK0B 3IRAA 1CQHA 1MD3A 2YZHA 2GLRA 1SL2B 3TKSC 4WF4A 3MWHA 4MJEA 2F8FA 6GSVA 2OE1A 2JZTA 4IP1A 2ALBA 4F2IA 2H0HA 5JCGA 4DSSB 3NOFA 3M3MA 1GSYA 5HQPA 3KCMA 2REMA 2IFQA 1M9AA 20GSA 1DUGA 4V2LA 4GTUA 3UAPA 4AF2A 2VL3A 3LFLA 1VF2A 1TKDB 3IA1A 2FWFA 2KP2A 5JCUA 2LEGA 3HVSA 5IMFA 5DALB 3VK9A 2K6VA 3WD6A 5GSSA 1PGTA 1SU9A 5JWQB 1PSQA 2RM5A 2G0FA 5LD0A 1RK4A 3SWLA 1YF1A 2H6XA 1RQMA 1XCCA 1O8XA 3F4RA 3QFAC 3DD3A 3LORA 4IQAA 5DBQA 2K8VA 1NSWA 2GQMA 5HFIA 3TJKA 2CVBA 2GTUA 3QPMA 3ME8A 5DCGA 4OO5A 4G10A 1X5EA 2GSQA 2H30A 2HRNA 1W89A 5IPHA 1AC1A 3AY8A 1T3BA 3ED3A 2DIZA 3P90A 3CTFA 2GQLA 1Z3EA 4BPYA 2WJUA 1PKWA 1ZMAA 1F3AA 5DQSA 2KHPA 2YCDA 3FHKA 4I5QA 4BWQA 2MZCA 2R6KA 2X8CA 4IW9A 2PGTA 2H6YA 4L0WA 4NHWA 2HFDA 4TXVA 4JEDA 1GULA 1K0MA 2LJRA 2WZ9A 2DIYA 5ECQB 4Q5FA 3NZNA 5GAND 3FZ9A 2PMTA 3MDKA 1Z7RA 1SKWB 1DSBA 2N5FA 1M7TA 4EKZA 4HJ2A 6GSSA 5DCHA 4ZXGA 2L4CA 2NVLA 5G30A 3ZREA 2VCWA 6GSTA 3F8UA 4ML6A 1MDKA 3HVXA 4LL4B 2JZSA 2DJ0A 1FHEA 1EGOA 1OYJA 1X5CA 3IDVA 2GGTA 4XIHA 2L59A 4MF7A 4PNGA 2GS3A 5CRGA 2L6DA 4GRFA 4OD7A 4EC0A 1GSSA 2VL2C 1ON4A 4FO5A 1U3AA 1JZDA 4OWYA 2GT5A 4ZBDA 3RHCA 4BVYA 4ACSA 3F6FA 5INYA 3C1RA 3DKSA
chains in the Genus database with same CATH superfamily
2UZ8A 1WWJA 4MABA 1PMTA 1M2BA 4DSQA 1XWBA 4YQVA 1SJ6A 3GKMA 2BMXA 2LQQA 4G2EA 2H1DA 1ILOA 3GKKA 3A5WA 2DLXA 4RUVA 1VF1A 4FYBA 3A2XA 3EU3A 3GTUA 1Q98A 3L4NA 2N5AA 5D9TA 1X9MB 2F51A 2QGVA 2MYGA 2HZEA 4MA9A 1IYHA 2R0GA 3TGZA 2IMEA 4XS1A 2VM1A 2YP6A 4HI7A 2G2QA 2OADA 5FWGA 1B9YC 5G5EA 4TOPA 4EUYA 1RW1A 4GQCA 1BX9A 3GMFA 4ZILA 1SK1A 1YJ6A 1TOFA 1HNAA 4ID0A 3UIWA 1WJKA 2C3TA 16GSA 1PL1A 1GUKA 2LS5A 2EIRA 3UVTA 4IQ1A 3EPTA 4NXIA 2F3MA 3F4SA 18GSA 3ZFBA 2XBIA 3PR8A 2YWOA 3VWWA 1HQOA 4TXOA 4F82A 3IAM2 1WP0A 3D6IA 1GWCA 1GSDA 4JE1A 2YV7A 3HDCA 1GTBA 3VI5A 2YWMA 3DVXA 3GX0A 1H75A 2IIYA 4Z7XA 4POLA 1SKSB 4O32A 4PQ1A 4EVMA 1XW6A 4LLRA 3G7YA 4F03A 4WR5A 3GSTA 2VD0A 2H66A 19GSA 5F0GA 3QAWA 5F06A 4IJIA 3PINA 3GV1A 3TKQA 4POMA 5A4UA 2CV4A 4Q5RA 4MJBA 5IOXA 2MBSA 4JR6A 1TJDA 1Z6NA 1XW5A 3O76A 2H76A 3DXBA 1TDIA 9GSSA 1FG4A 5EL8A 1U87A 1GSUA 1ZOFA 2NPBA 1EZKA 3D4MA 1B48A 2L57A 3UEMA 1SYRA 2V32A 2PBJA 3DGQA 1GSEA 2VCZA 2GSSA 2CT6A 4GXZA 1O7UA 1V57A 3FR6A 1R5PA 4TKYA 4OFTA 3LGCA 1TU8A 3MYDA 3EINA 2PUKC 4RI6A 3ZTLA 5KN0A 5A4VA 3KH7A 2RUEA 4KSMA 1XIYA 2XPEA 2CA8A 2FLSA 5GAPD 3L9SA 5AIXA 4G0LA 3CYNA 3ZL5A 4GSSA 5GZZB 1XXUA 2FA4A 1EV4A 4USSA 4V1Ag 1UA5A 3EMXA 2V6KA 2X64A 2FY6A 4WKWA 1EOGA 1BG5A 2B1LA 5ECPB 4IHUA 2B5XA 4BVXB 4GSTA 1VGLA 4XRDA 1S3CA 2EIQA 1V2AA 2HSHA 3LG6A 2IN3A 4ECJA 1NHYA 1FW1A 2O87A 5EY6A 1S3RA 3H93A 5LNKe 1B8XA 2AV4A 3F3QA 1JHBA 2DSAA 1LJRA 1A2MA 4ILFA 1GUHA 2DJ2A 1R26A 4Z2RA 1OVNA 4MH3A 5EPFA 3EYTA 5J9BA 4IBPA 4HQSA 3ZRDA 4ZB6A 4O7HA 2WRTA 12GSA 1EV9A 1USBA 4KCAA 1X9WB 4K0NA 4OMVA 2QSIA 1JLVA 4WXTA 1AIUA 2IWTA 3H79A 4D73A 4GWRA 1XW9A 3FY7A 1TTZA 1WRYA 2A2RA 4F9ZA 1GL8A 2K9FA 2WFCA 2IFQB 1M0UA 4XCSA 4EDZA 3R3EA 4ZIJA 1PN0A 2YZUA 1SJIA 5D93A 3ZFLA 2CAQA 2DC5A 5DQYA 3JCML 2ZUPA 2C0DA 1S3AA 4J56E 1THOA 3GL3A 4KE3A 2EIOA 5IMAA 3GH6A 3KXOA 2K18A 2H0GA 2YN1A 4HSCX 5B6MA 2R3XA 5H5SA 3DMLA 2H19A 2X99A 4HUAA 1X5DA 2OACA 4IS0A 5ECIB 4ZBAA 5E59A 4DSRA 4V2NA 1FOVA 2L5OA 1GNWA 5E4WA 5BRTA 1SJZA 3WGDA 4KW6A 4MPFA 3D21A 5A5KA 4TN8A 2QA1A 4KCEA 3APOA 5ID2A 4NHZA 3EU4A 4O92A 3M9JA 2X49A 2RLIA 3EVIA 2LKUA 1K0DA 3A2WA 4QQ7A 4KDUA 3TJBA 1TRUA 4ZL9A 2HT9A 2HNLA 3QOUA 4HU9A 3GX8A 3M8NA 3H4KA 4GLTA 5IMVA 4YH2A 4JU5A 3HXSA 1T4YA 1O81A 1THXA 2ON7A 2JL4A 2GVPA 3FMWA 2PERA 1YEPA 3DRNA 2GT6A 2X4AA 3VFIA 1PX6A 3H1NA 5J4UA 2B6MA 3CMIA 4IKHA 3L78A 4OFMA 3CBUA 4HOJA 1LU4A 2FGXA 2CVDA 2KP1A 3DWVA 3IR4A 4XS6A 3WYWA 4KUNA 2O8VB 1T7PB 5G1KA 3P8WA 5J9CA 1G6WA 1UC7A 3DYRA 6GSYA 4ECBA 4OCFA 3FKFA 6GSWA 4MK3A 4N30A 2H8LA 1HD2A 2KOKA 1ABAA 2B3SA 1KTEA 1HNCA 1T4ZA 3M9KA 4ZBBA 5ECNB 4KX4A 2IL3A 1QK8A 1OKDA 4JZQA 5HFGA 3I6AA 3MIXA 2GSTA 5JCWA 3KZQA 2FCHA 3HKRA 3ZVJA 4XS4B 5ECMB 3IXRA 3TKSE 3CSJA 1QFNA 4GF0A 4FQUA 3IHQA 1NW2A 3HZ8A 2VCVA 1N8JA 4XRAA 4K7NA 3GTUB 1YDKA 2ES7A 1K0CA 3HZ4A 4NV5A 5DDLA 1FOHA 6GSXA 5DJLA 4K7OA 2HZFA 1Z9HA 1V9WA 3MSZA 2CX4A 2HZEB 1DE1A 3GRXA 5CRHA 1SYXA 2I81A 4PNFA 1VRSD 5KN1A 1UN2A 3IC8A 5DVBA 5FHIA 4JR4A 4V1Ap 2HXKA 3HYPA 2WDUA 3RHBA 5HR2A 3WT2A 2MMZA 4FYUA 3GH9A 1FO5A 5CYYA 4WEYA 2DBCA 1K0AA 1F37A 5HR0A 2PVOC 2DJKA 5CREA 3LYPA 4WBRD 2PWJA 4KDYA 2E2MA 3RPNA 1BEDA 2VLUA 2C3NA 3F63A 2C80A 4TXOB 5D9WA 2KUCA 1AQXA 1MTCA 3BOAA 5DALA 3RAZA 1SL0B 1WIKA 1GRXA 3VPQA 5AGYA 4FIWA 2RM6A 3GA4A 4ZB8A 3V1WA 3IBHA 4K7IA 4MNNA 4NMUA 4HS1A 1TK8B 2F9SA 1FVJA 4FYCA 4AGSA 3N9JA 4TR1B 3QDNA 4RI7A 2B7JA 5C04A 3IPZA 1J0FA 4NV2A 1ZYEA 3GNJA 1A2JA 3KM6A 1ZGNA 2AAWA 17GSA 1ZCPA 3FYGA 3G7IA 3VPTA 3K8NA 4G0KA 1F9MA 3EWLA 5DAKB 1EP7A 5KN3A 1C72A 5KEJA 5KN2A 5D73A 4P3YB 1I5GA 3CXGA 3VLNA 3DIEA 1U6TA 2H74A 1GTUA 1URMA 14GSA 4L8EA 1R5AA 2PU9C 1OC9A 2R0PA 2LTKA 3ERWA 3GKXA 1GUMA 4FH8A 2F8AA 1TP9A 1K0OA 3A2VA 2V41A 1YQ1A 4LA1A 1X9SB 4E8HA 5ELGA 4KNDA 2RUFA 4G9HA 2AHEA 2IMKA 1A8YA 4DVCA 1TRVA 3APSA 2EC4A 2B5YA 4J2FA 3HVNA 3CTGA 5G31A 1YKCA 1T00A 1AAZA 13GSA 4MCUA 1SENA 3TUEA 1JLWA 2JU5A 3TDGA 4AJ7A 2PN8A 2YPMA 3ERGA 4PQHA 1DBYA 1PFOA 2LJKA 1TW9A 2H1BA 2A4VA 1V98A 3KIJA 3KP8A 3ZVJD 4K5RA 4EIPA 1M3JA 5IMZA 1QXHA 4HDEA 3H8QA 2YJ7A 3QMXA 4J57E 4DEJA 3MAKA 3S9FA 3F9UA 4K9ZA 4H86A 2MMOA 1LBKA 2LSTA 5IQYA 1GH2A 1XVWA 1CQGA 3PH9A 1XOAA 3LWAA 2NDOA 2DMLA 2P0GA 3LQ7A 1F3BA 1TK5B 4K5SA 2FA8A 4ML1A 4TVEA 10GSA 2E0QA 3ZZXA 4MZWA 2IMFA 1WE0A 4F0BA 1BQ7A 3CSIA 3NIVA 5FT3A 4KF9A 3CRUA 2BJXA 4G19A 1GLPA 1MDJA 3GHAA 2FWEA 5ECOB 4YAVA 3TRXA 2NTOA 4QL9A 2V1MA 5JWRB 2YJHA 4MF5A 2JACA 4L5OA 4OFNA 2H70A 4O5RA 3M1GA 4Q5QA 4I6XA 4MJCA 4A5PA 22GSA 1YZXA 5B6NA 3GL5A 3IE3A 3EURA 1T1VA 2HLSA 4K8MA 5D96A 2R5GA 3IK9A 2YWIA 1N2AA 1EP8A 4BL7B 5B8BA 3GUSA 1U88A 5GSTA 4G0IA 4MF6A 5ID2B 4HEA2 4GCIA 4EO3A 2H0IA 2VM2A 5COHA 5IIZA 1E6BA 1WPIA 2FNOA 1K3LA 1TI1A 3N5OA 2GZYA 1QMVA 2ZNMA 2XBQA 4TW5A 2OJLA 1R7HA 2C1YA 2DJJA 1XVQA 3TJGA 2FHEA 3HY2A 5ENUA 3CRTA 1UVZA 3US3A 1AUCA 1ML6A 4LL1B 4ICYA 4WETA 2CZ3A 1OC3A 2AJQB 4EXJA 1G7EA 4KH7A 2DJ1A 5ECRB 1SD8A 5HR3A 1ACVA 2YANA 1ERWA 3KEBA 3ZIVA 2L6CA 3GSSA 2J23A 3TJFA 3W8SA 4MMMA 3G9BA 3D5JA 2B7KA 3ZLPA 4MH2A 2OE3A 5HR1A 4KDXA 4LMVA 2IMIA 2DJ3A 3UBLA 2YV9A 5D9XA 5D9VA 2AYTA 2J9HA 2XC2A 1PN9A 4TRXA 5ECHB 4Z2TA 1GTIA 2GZPA 1A23A 2C0EA 2E2GA 3DEXA 5J41A 4RQXA 2BTOT 2R37A 2VAFA 4BVXA 5B7CA 4K2DA 1JZOA 3OR5A 4TR3A 4NWYA 5CNWA 3Q19A 1AXDA 5ECKB 2HYXA 3UBKA 1K0NA 4ECCA 4RQRA 3RBTA 5JWOB 5CRWA 3EMPA 3EE2A 2MBTA 1M99A 2H01A 2GDRA 2M80A 4IVFA 1H4OA 1OKTA 1O6JA 2KLXA 3FRCA 3J7Yb 4K1FA 1EEJA 1V58A 5G2ZA 4XTSA 3IOSA 1Z7PA 7GSSA 1DE2A 2WULA 4PUFC 5IMDA 4K2XA 6GSUA 1QUWA 1GTAA 4I2TA 2FWGA 2HRFA 2FD3A 3E0UA 1O73A 1XWGA 2VUPA 4BWSA 1HNBA 2M72A 1Z5YE 3Q6OA 3P2AA 2AB6A 5B8AA 3TOTA 5G5FA 4YQMA 1XFLA 1TXXA 1AQWA 2OE0A 2V2GA 3D0ZA 2OBKA 3UOMA 2HSMA 3ZMKA 4Z2UA 2ON5A 3KJYA 3L9UA 3C1SA 2YWNA 4MDCA 3FR3A 3D22A 3TRPA 1B9XC 1PA3A 1MD4A 3VWXA 1MEKA 5AISA 4AJ6A 2A4HA 2C0FA 2GQKA 3P7XA 2H1GA 3QCPA 1OE8A 1TRSA 4X4JA 5L71A 4K0GA 4BVYB 3FW2A 1TI3A 1JZWA 2O7KA 2XPDA 4YKFA 2L4QA 2GZZA 3GURA 2L5LA 4OCEA 3C7MA 2PVQA 1F6MC 3KMNA 1J08A 3I43A 3QR6A 3EC3A 5J3RA 3CSHA 1GSQA 4TR0A 4EE0A 5IO2A 1PQNA 2JSYA 2OKAA 3GIXA 3TRQA 2VCQA 1TRWA 1XPVA 2LJAA 2N5BA 1XOBA 2IPAA 4N0ZA 1TU7A 5F05A 3A5IA 2K8SA 2HE3A 2CAIA 2WGRA 4PGTA 1G6YA 4EDYA 4BIKA 1U3IA 3QAVA 5J5NA 5EVOA 1OC9B 3PPUA 1HYUA 1V40A 3D4TA 1A24A 2LNTA 2LRTA 1EGRA 2VO4A 1I9DA 4XHMA 2H6ZA 3GFKA 1QQ2A 1XG8A 1KBNA 2A2PA 2X8HA 3ERFA 4PUAA 5CP1A 3HA9A 1ST9A 4DSSA 1R4WA 1XWKA 3HVVA 4ISDA 3LXZA 2B5EA 3KH9A 3F3RA 3ZMLA 3ZITA 3F6DA 4ZB9A 3E9JB 4YAPA 3IHGA 1XBSA 5A4WA 1O85A 4EF0A 1OC8A 2CX3A 5KOXA 3WT1A 3A3TA 1W4VA 3BCKA 4KB3A 3LXTA 1X0RA 3FK8A 3LW9A 1FB0A 1M2DA 1YEXA 3UARA 1YY7A 1JFUA 1GSFA 1EWXA 2C4JA 4Q5NA 2WS2A 1T8EB 4ECIA 3KMOA 2DKIA 3UJ1A 1FB6A 2TRXA 2H72A 2R2JA 1QGVA 2FWHA 4JRRA 3U6VA 5F8BA 2X8GA 2C0GA 2VLTA 1G0TA 2XHFA 2JZRA 1BJXA 3W6GA 5H5QA 1XWAA 1GP1A 3LYKA 4XS4A 3UMAA 2H1AA 2LNSA 3GN3A 1ZL9A 1A8LA 4CDOA 2O89A 1JZRA 2FUG2 1BAYA 2I3YA 1Y6EA 3E3EA 2V6OA 3HJOA 4WBJA 1SD9A 1A0FA 3GKNA 3QD9A 4NPBA 1GNEA 3APQA 2WCIA 3L9VA 5AN1A 5BMUA 2H73A 3HHVA 4IJ3A 4I8BA 1B4PA 3FZ4A 3HCZA 4GQFA 2I4AA 1B4QA 3HD5A 3SBCA 3TOUA 3TCOA 1K3OA 3KGKA 1S3DA 3J7Yk 4X1UA 4MP4A 2P5QA 1FVKA 3IK7A 1NHOA 2JADA 1YKAA 4JBBA 1PD21 4CHSA 2CVKA 5LCZA 2LRNA 1VF4A 3HJMA 1ERVA 1GLQA 4IGJA 3Q74A 4N10A 1Z6MA 2AUVA 2A2SA 2E7PA 3IV4A 4HU7A 3G7JA 4OO4A 5H5RA 1J9BA 1E2YA 3L0HA 3KTBA 1XZOA 4ULXA 11GSA 2LQOA 4PQIA 3TKSA 2PPTA 4MPGA 4E8EA 1SL1B 3BJ5A 1Y25A 2NBSA 3I9V2 3QAGA 1G7OA 1O8WA 4HQZA 2QC7A 4HZ2A 3ZYWA 1ZZYA 4TR1A 5IOWA 5CO3A 4WR4A 4LMWA 3PGTA 2MMAA 4I97A 4CW9A 4HJMA 2OA7A 4PXOA 4CY6A 5IMCA 5D8IA 3IC4A 2Z9SA 1OE7A 4ZL7A 5ECSA 5KOWA 5DAKA 4O5QA 4D73B 3KD0A 3TB2A 3BBYA 4IELA 3O3TA 3TKPA 3R2QA 4V2MA 4KA0A 4HZ4A 4MLYA 1M9BA 2TRCP 1EEMA 2VCTA 4K6XA 2IMDA 1ZYPA 3VURA 3FZ5A 1MDIA 4YKGA 3C71A 2VOCA 5ABRA 4L5LA 1ERUA 5G1LA 3MNGA 1M2AA 4PX1A 2CQ9A 2VCXA 1EOHA 4MZBA 1Q4JA 4EL1A 1XWCA 2CZ2A 3C8EA 4KSOA 4TR4A 4POBA 2VIMA 2VL9A 1KEBA 3FEUA 4L0UA 1K0BA 1FAAA 2I9HA 2IJYA 3C73A 2WB9A 1AQVA 1ZYQB 2P5RA 5HFKA 2LRCA 2C3QA 1OAZA 3F4TA 3GYKA 3DVWA 1ZYNA 5CRDA 2ZCTA 2LV3A 4WF5A 4KGIA 2O85A 3ZIJA 3TKRA 1YF0A 2QKEA 1WOUA 2HRKA 2YOIA 2LUSA 1NM3A 4NAXA 3IAS2 2D2ZA 1WMJA 2HRAA 2RIIA 1SK0A 2GSRA 3I69A 3VWUA 3RPPA 1BYEA 3RDWA 5DJMA 3VI7A 5F07A 2VL2A 4MJAA 1AW9A 1M3IA 3ME7A 3O6TA 1VF3A 1ERTA 3FR9A 3Q18A 3W8JA 1PX7A 4KAEA 2P31A 1PKZA 1SK2A 2TIRA 3WGXA 2DMMA 3F0IA 5IO0A 2H71A 3HJPA 5ECLB 4F0CA 5IM9A 3LEFA 1PL2A 2B1KA 5C00A 4PURA 2HSYA 4AJ8A 3WGEA 2MMNA 1K3YA 4YQUA 3M0FA 3VWVA 2M46A 4GSNA 4I2UA 4BA7A 3LJRA 2R4VA 3BD2A 2C8UA 3UVHA 1KNGA 4N0VA 2QA2A 3KP9A 4IN0A 1A0RP 3CQFA 2YNXA 2I1UA 4BL7A 3FZAA 4X0XA 3ISOA 2HI7A 4QL7A 4ZL8A 5IPGA 5ELAA 5AIVA 1A2LA 3BCIA 2H75A 2VD1A 2OBIA 3U5RE 2JSZA 4PTSA 1SKRB 3UL3A 4IP6A 4X43A 5CAXA 1F2EA 1IYIA 3KTLA 4N11A 8GSSA 4MZCA 4POKA 2VLVA 3LSZA 3TJJA 1PRXA 3QFBC 1TK0B 3IRAA 1CQHA 1MD3A 2YZHA 2GLRA 1SL2B 3TKSC 4WF4A 3MWHA 4MJEA 2F8FA 6GSVA 2OE1A 2JZTA 4IP1A 2ALBA 4F2IA 2H0HA 5JCGA 4DSSB 3NOFA 3M3MA 1GSYA 5HQPA 3KCMA 2REMA 2IFQA 1M9AA 20GSA 1DUGA 4V2LA 4GTUA 3UAPA 4AF2A 2VL3A 3LFLA 1VF2A 1TKDB 2DKHA 3IA1A 2FWFA 2KP2A 5JCUA 2LEGA 3HVSA 5IMFA 5DALB 3VK9A 2K6VA 3WD6A 5GSSA 1PGTA 4EIQA 1SU9A 5JWQB 1PSQA 2RM5A 2G0FA 5LD0A 1RK4A 3SWLA 1YF1A 2H6XA 1RQMA 1XCCA 1O8XA 3F4RA 3QFAC 3DD3A 3LORA 4IQAA 5DBQA 2K8VA 1NSWA 2GQMA 5HFIA 3TJKA 2R0CA 4CY8A 2CVBA 2GTUA 3QPMA 3ME8A 5DCGA 4OO5A 4G10A 1X5EA 2GSQA 2H30A 2HRNA 1W89A 5IPHA 1AC1A 3AY8A 1T3BA 3ED3A 2DIZA 3P90A 3CTFA 2GQLA 1Z3EA 4BPYA 2WJUA 1PKWA 1ZMAA 1F3AA 5DQSA 2KHPA 2YCDA 3FHKA 4I5QA 4BWQA 2MZCA 2R6KA 2X8CA 4IW9A 2PGTA 2H6YA 4L0WA 4NHWA 2HFDA 4TXVA 4JEDA 1GULA 1K0MA 2LJRA 2WZ9A 2DIYA 5ECQB 4Q5FA 3NZNA 5GAND 3FZ9A 2PMTA 3MDKA 1Z7RA 1SKWB 4O5UA 1DSBA 2N5FA 1M7TA 4EKZA 4HJ2A 6GSSA 5DCHA 4ZXGA 2L4CA 2NVLA 5G30A 3ZREA 2VCWA 6GSTA 3F8UA 4ML6A 1MDKA 3HVXA 4LL4B 2JZSA 2DJ0A 1FHEA 1EGOA 1OYJA 1X5CA 3IDVA 2GGTA 4XIHA 2L59A 4MF7A 4PNGA 2GS3A 5CRGA 2L6DA 4GRFA 4OD7A 4EC0A 1GSSA 2VL2C 1ON4A 4FO5A 1U3AA 1JZDA 4OWYA 2GT5A 4ZBDA 3RHCA 4BVYA 4ACSA 3F6FA 5INYA 3C1RA 3DKSA
chains in the Genus database with same CATH topology
2UZ8A 1WWJA 4MABA 1PMTA 1M2BA 4DSQA 1XWBA 4YQVA 1SJ6A 3GKMA 2BMXA 2LQQA 4G2EA 2H1DA 1ILOA 3GKKA 3A5WA 2DLXA 4RUVA 1VF1A 4FYBA 3A2XA 3EU3A 3GTUA 1Q98A 3L4NA 2N5AA 5D9TA 1X9MB 2F51A 2QGVA 2MYGA 2HZEA 4MA9A 1IYHA 2R0GA 3TGZA 2IMEA 4XS1A 2VM1A 2YP6A 4HI7A 2G2QA 2OADA 5FWGA 1B9YC 5G5EA 4TOPA 4EUYA 1RW1A 4GQCA 1BX9A 3GMFA 4ZILA 1SK1A 1YJ6A 1TOFA 1HNAA 4ID0A 3UIWA 1WJKA 2C3TA 16GSA 1PL1A 1GUKA 2LS5A 2EIRA 3UVTA 4IQ1A 3EPTA 4NXIA 2F3MA 3F4SA 18GSA 3ZFBA 2XBIA 3PR8A 2YWOA 3VWWA 1HQOA 4TXOA 4F82A 3IAM2 1WP0A 3D6IA 1GWCA 1GSDA 4JE1A 2YV7A 3HDCA 1GTBA 3VI5A 2YWMA 3DVXA 3GX0A 1H75A 2IIYA 4Z7XA 4POLA 1SKSB 4O32A 4PQ1A 4EVMA 1XW6A 4LLRA 3G7YA 4F03A 4WR5A 3GSTA 2VD0A 2H66A 19GSA 5F0GA 3QAWA 5F06A 4IJIA 3PINA 3GV1A 3TKQA 4POMA 5A4UA 2CV4A 4Q5RA 4MJBA 5IOXA 2MBSA 4JR6A 1TJDA 1Z6NA 1XW5A 3O76A 2H76A 3DXBA 1TDIA 9GSSA 1FG4A 5EL8A 1U87A 1GSUA 1ZOFA 2NPBA 1EZKA 3D4MA 1B48A 2L57A 3UEMA 1SYRA 2V32A 2PBJA 3DGQA 1GSEA 2VCZA 2GSSA 2CT6A 4GXZA 1O7UA 1V57A 3FR6A 1R5PA 4TKYA 4OFTA 3LGCA 1TU8A 3MYDA 3EINA 2PUKC 4RI6A 3ZTLA 5KN0A 5A4VA 3KH7A 2RUEA 4KSMA 1XIYA 2XPEA 2CA8A 2FLSA 5GAPD 3L9SA 5AIXA 4G0LA 3CYNA 3ZL5A 4GSSA 5GZZB 1XXUA 2FA4A 1EV4A 4USSA 4V1Ag 1UA5A 3EMXA 2V6KA 2X64A 2FY6A 4WKWA 1EOGA 1BG5A 2B1LA 5ECPB 4IHUA 2B5XA 4BVXB 4GSTA 1VGLA 4XRDA 1S3CA 2EIQA 1V2AA 2HSHA 3LG6A 2IN3A 4ECJA 1NHYA 1FW1A 2O87A 5EY6A 3H93A 5LNKe 1B8XA 2AV4A 3F3QA 1JHBA 2DSAA 1LJRA 1A2MA 4ILFA 1GUHA 2DJ2A 1R26A 4Z2RA 1OVNA 4MH3A 5EPFA 3EYTA 5J9BA 4IBPA 4HQSA 3ZRDA 4ZB6A 4O7HA 2WRTA 12GSA 1EV9A 1USBA 4KCAA 1X9WB 4K0NA 4OMVA 2QSIA 1JLVA 4WXTA 1AIUA 2IWTA 3H79A 4D73A 4GWRA 1XW9A 3FY7A 1TTZA 1WRYA 2A2RA 4F9ZA 1GL8A 2K9FA 2WFCA 2IFQB 1M0UA 4XCSA 4EDZA 3R3EA 4ZIJA 1PN0A 2YZUA 1SJIA 5D93A 3ZFLA 2CAQA 2DC5A 5DQYA 3JCML 2ZUPA 2C0DA 1S3AA 4J56E 1THOA 3GL3A 4KE3A 2EIOA 5IMAA 3GH6A 3KXOA 2K18A 2H0GA 2YN1A 5B6MA 2R3XA 5H5SA 3DMLA 2H19A 2X99A 4HUAA 1X5DA 2OACA 4IS0A 5ECIB 4ZBAA 5E59A 4DSRA 4V2NA 1FOVA 2L5OA 1GNWA 5E4WA 5BRTA 1SJZA 3WGDA 4KW6A 4MPFA 3D21A 5A5KA 4TN8A 2QA1A 4KCEA 3APOA 5ID2A 4NHZA 3EU4A 4O92A 3M9JA 2X49A 2RLIA 3EVIA 2LKUA 1K0DA 3A2WA 4QQ7A 4KDUA 3TJBA 1TRUA 4ZL9A 2HT9A 2HNLA 3QOUA 4HU9A 3GX8A 3M8NA 3H4KA 4GLTA 5IMVA 4YH2A 4JU5A 3HXSA 1T4YA 1O81A 1THXA 2ON7A 2JL4A 2GVPA 3FMWA 2PERA 1YEPA 3DRNA 2GT6A 2X4AA 3VFIA 1PX6A 3H1NA 5J4UA 2B6MA 3CMIA 4IKHA 3L78A 4OFMA 3CBUA 4HOJA 1LU4A 2FGXA 2CVDA 2KP1A 3DWVA 3IR4A 4XS6A 3WYWA 4KUNA 2O8VB 1T7PB 5G1KA 3P8WA 5J9CA 1G6WA 1UC7A 3DYRA 6GSYA 4ECBA 4OCFA 3FKFA 6GSWA 4MK3A 4N30A 2H8LA 1HD2A 2KOKA 1ABAA 2B3SA 1KTEA 1HNCA 1T4ZA 3M9KA 4ZBBA 5ECNB 4KX4A 2IL3A 1QK8A 1OKDA 4JZQA 5HFGA 3I6AA 3MIXA 2GSTA 5JCWA 3KZQA 2FCHA 3HKRA 3ZVJA 4XS4B 5ECMB 3IXRA 3TKSE 3CSJA 1QFNA 4GF0A 4FQUA 3IHQA 1NW2A 3HZ8A 2VCVA 1N8JA 4XRAA 4K7NA 3GTUB 1YDKA 2ES7A 1K0CA 3HZ4A 4NV5A 5DDLA 1FOHA 6GSXA 5DJLA 4K7OA 2HZFA 1Z9HA 1V9WA 3MSZA 2CX4A 2HZEB 1DE1A 3GRXA 5CRHA 1SYXA 2I81A 4PNFA 1VRSD 5KN1A 1UN2A 3IC8A 5DVBA 5FHIA 4JR4A 4V1Ap 2HXKA 3HYPA 2WDUA 3RHBA 5HR2A 3WT2A 2MMZA 4FYUA 3GH9A 1FO5A 5CYYA 4WEYA 2DBCA 1K0AA 1F37A 5HR0A 2PVOC 2DJKA 5CREA 3LYPA 4WBRD 2PWJA 4KDYA 2E2MA 3RPNA 1BEDA 2VLUA 2C3NA 3F63A 2C80A 4TXOB 5D9WA 2KUCA 1AQXA 1MTCA 3BOAA 5DALA 3RAZA 1SL0B 1WIKA 1GRXA 3VPQA 5AGYA 4FIWA 2RM6A 3GA4A 4ZB8A 3V1WA 3IBHA 4K7IA 4MNNA 4NMUA 4HS1A 1TK8B 2F9SA 1FVJA 4FYCA 4AGSA 3N9JA 4TR1B 3QDNA 4RI7A 2B7JA 5C04A 3IPZA 1J0FA 4NV2A 1ZYEA 3GNJA 1A2JA 3KM6A 1ZGNA 2AAWA 17GSA 1ZCPA 3FYGA 3G7IA 3VPTA 3K8NA 4G0KA 1F9MA 3EWLA 5DAKB 1EP7A 5KN3A 1C72A 5KEJA 5KN2A 5D73A 4P3YB 1I5GA 3CXGA 3VLNA 3DIEA 1U6TA 2H74A 1GTUA 1URMA 14GSA 4L8EA 1R5AA 2PU9C 1OC9A 2R0PA 2LTKA 3ERWA 3GKXA 1GUMA 4FH8A 2F8AA 1TP9A 1K0OA 3A2VA 2V41A 1YQ1A 4LA1A 1X9SB 4E8HA 5ELGA 4KNDA 2RUFA 4G9HA 2AHEA 2IMKA 1A8YA 4DVCA 1TRVA 3APSA 2EC4A 2B5YA 4J2FA 3CTGA 5G31A 1YKCA 1T00A 1AAZA 13GSA 4MCUA 1SENA 3TUEA 1JLWA 2JU5A 3TDGA 4AJ7A 2PN8A 2YPMA 3ERGA 4PQHA 1DBYA 2LJKA 1TW9A 2H1BA 2A4VA 1V98A 3KIJA 3KP8A 3ZVJD 4K5RA 4EIPA 5IMZA 1QXHA 4HDEA 3H8QA 2YJ7A 3QMXA 4J57E 4DEJA 3MAKA 3S9FA 3F9UA 4K9ZA 4H86A 2MMOA 1LBKA 2LSTA 5IQYA 1GH2A 1XVWA 1CQGA 3PH9A 1XOAA 3LWAA 2NDOA 2DMLA 2P0GA 3LQ7A 1F3BA 1TK5B 4K5SA 2FA8A 4ML1A 4TVEA 10GSA 2E0QA 3ZZXA 4MZWA 2IMFA 1WE0A 4F0BA 1BQ7A 3CSIA 3NIVA 5FT3A 4KF9A 3CRUA 2BJXA 4G19A 1GLPA 1MDJA 3GHAA 2FWEA 5ECOB 4YAVA 3TRXA 2NTOA 4QL9A 2V1MA 5JWRB 2YJHA 4MF5A 2JACA 4L5OA 4OFNA 2H70A 4O5RA 3M1GA 4Q5QA 4I6XA 4MJCA 4A5PA 22GSA 1YZXA 5B6NA 3GL5A 3IE3A 3EURA 1T1VA 2HLSA 4K8MA 5D96A 2R5GA 3IK9A 2YWIA 1N2AA 1EP8A 4BL7B 5B8BA 3GUSA 1U88A 5GSTA 4G0IA 4MF6A 5ID2B 4HEA2 4GCIA 4EO3A 2H0IA 2VM2A 5COHA 5IIZA 1E6BA 1WPIA 2FNOA 1K3LA 1TI1A 3N5OA 2GZYA 1QMVA 2ZNMA 2XBQA 4TW5A 2OJLA 1R7HA 2C1YA 2DJJA 1XVQA 3TJGA 2FHEA 3HY2A 5ENUA 3CRTA 1UVZA 3US3A 1AUCA 1ML6A 4LL1B 4ICYA 4WETA 2CZ3A 1OC3A 2AJQB 4EXJA 1G7EA 4KH7A 2DJ1A 5ECRB 1SD8A 5HR3A 1ACVA 2YANA 1ERWA 3KEBA 3ZIVA 2L6CA 3GSSA 2J23A 3TJFA 3W8SA 4MMMA 3G9BA 3D5JA 2B7KA 3ZLPA 4MH2A 2OE3A 5HR1A 4KDXA 4LMVA 2IMIA 2DJ3A 3UBLA 2YV9A 5D9XA 5D9VA 2AYTA 2J9HA 2XC2A 1PN9A 4TRXA 5ECHB 4Z2TA 1GTIA 2GZPA 1A23A 2C0EA 2E2GA 3DEXA 5J41A 4RQXA 2BTOT 2R37A 2VAFA 4BVXA 5B7CA 4K2DA 1JZOA 3OR5A 4TR3A 4NWYA 5CNWA 3Q19A 1AXDA 5ECKB 2HYXA 3UBKA 1K0NA 4ECCA 4RQRA 3RBTA 5JWOB 5CRWA 3EMPA 3EE2A 2MBTA 1M99A 2H01A 2GDRA 2M80A 4IVFA 1H4OA 1OKTA 1O6JA 2KLXA 3FRCA 3J7Yb 4K1FA 1EEJA 1V58A 5G2ZA 4XTSA 3IOSA 1Z7PA 7GSSA 1DE2A 2WULA 4PUFC 5IMDA 4K2XA 6GSUA 1QUWA 1GTAA 4I2TA 2FWGA 2HRFA 2FD3A 3E0UA 1O73A 1XWGA 2VUPA 4BWSA 1HNBA 2M72A 1Z5YE 3Q6OA 3P2AA 2AB6A 5B8AA 3TOTA 5G5FA 4YQMA 1XFLA 1TXXA 1AQWA 2OE0A 2V2GA 3D0ZA 2OBKA 3UOMA 2HSMA 3ZMKA 4Z2UA 2ON5A 3KJYA 3L9UA 3C1SA 2YWNA 4MDCA 3FR3A 3D22A 3TRPA 1B9XC 1PA3A 1MD4A 3VWXA 1MEKA 5AISA 4AJ6A 2A4HA 2C0FA 2GQKA 3P7XA 2H1GA 3QCPA 1OE8A 1TRSA 4X4JA 5L71A 4K0GA 4BVYB 3FW2A 1TI3A 1JZWA 2O7KA 2XPDA 4YKFA 2L4QA 2GZZA 3GURA 2L5LA 4OCEA 3C7MA 2PVQA 1F6MC 3KMNA 1J08A 3I43A 3QR6A 3EC3A 5J3RA 3CSHA 1GSQA 4TR0A 4EE0A 5IO2A 1PQNA 2JSYA 2OKAA 3GIXA 3TRQA 2VCQA 1TRWA 1XPVA 2LJAA 2N5BA 1XOBA 2IPAA 4N0ZA 1TU7A 5F05A 3A5IA 2K8SA 2HE3A 2CAIA 2WGRA 4PGTA 1G6YA 4EDYA 1U3IA 3QAVA 5J5NA 5EVOA 1OC9B 3PPUA 1HYUA 1V40A 3D4TA 1A24A 2LNTA 2LRTA 1EGRA 2VO4A 1I9DA 4XHMA 2H6ZA 3GFKA 1QQ2A 1KBNA 2A2PA 2X8HA 3ERFA 4PUAA 5CP1A 3HA9A 1ST9A 4DSSA 1R4WA 1XWKA 3HVVA 4ISDA 3LXZA 2B5EA 3KH9A 3F3RA 3ZMLA 3ZITA 3F6DA 4ZB9A 3E9JB 4YAPA 3IHGA 1XBSA 5A4WA 1O85A 4EF0A 1OC8A 2CX3A 5KOXA 3WT1A 3A3TA 1W4VA 3BCKA 4KB3A 3LXTA 1X0RA 3FK8A 3LW9A 1FB0A 1M2DA 1YEXA 3UARA 1YY7A 1JFUA 1GSFA 1EWXA 2C4JA 4Q5NA 2WS2A 1T8EB 4ECIA 3KMOA 2DKIA 3UJ1A 1FB6A 2TRXA 2H72A 2R2JA 1QGVA 2FWHA 4JRRA 3U6VA 5F8BA 2X8GA 2C0GA 2VLTA 1G0TA 2XHFA 2JZRA 1BJXA 3W6GA 5H5QA 1XWAA 1GP1A 3LYKA 4XS4A 3UMAA 2H1AA 2LNSA 3GN3A 1ZL9A 1A8LA 4CDOA 2O89A 1JZRA 2FUG2 1BAYA 2I3YA 1Y6EA 3E3EA 2V6OA 3HJOA 4WBJA 1SD9A 1A0FA 3GKNA 3QD9A 4NPBA 1GNEA 3APQA 2WCIA 3L9VA 5AN1A 5BMUA 2H73A 3HHVA 4IJ3A 4I8BA 1B4PA 3FZ4A 3HCZA 4GQFA 2I4AA 1B4QA 3HD5A 3SBCA 3TOUA 3TCOA 1K3OA 3KGKA 1S3DA 3J7Yk 4X1UA 4MP4A 2P5QA 1FVKA 3IK7A 1NHOA 2JADA 1YKAA 4JBBA 1PD21 4CHSA 2CVKA 5LCZA 2LRNA 1VF4A 3HJMA 1ERVA 1GLQA 4IGJA 3Q74A 4N10A 1Z6MA 2AUVA 2A2SA 2E7PA 3IV4A 4HU7A 3G7JA 4OO4A 5H5RA 1J9BA 1E2YA 3L0HA 3KTBA 1XZOA 4ULXA 11GSA 2LQOA 4PQIA 3TKSA 2PPTA 4MPGA 4E8EA 1SL1B 3BJ5A 1Y25A 2NBSA 3I9V2 3QAGA 1G7OA 1O8WA 4HQZA 2QC7A 4HZ2A 3ZYWA 1ZZYA 4TR1A 5IOWA 5CO3A 4WR4A 4LMWA 3PGTA 2MMAA 4I97A 4CW9A 4HJMA 2OA7A 4PXOA 4CY6A 5IMCA 5D8IA 3IC4A 2Z9SA 1OE7A 4ZL7A 5ECSA 5KOWA 5DAKA 4O5QA 4D73B 3KD0A 3TB2A 3BBYA 4IELA 3O3TA 3TKPA 3R2QA 4V2MA 4KA0A 4HZ4A 4MLYA 1M9BA 2TRCP 1EEMA 2VCTA 4K6XA 2IMDA 1ZYPA 3VURA 3FZ5A 1MDIA 4YKGA 3C71A 2VOCA 5ABRA 4L5LA 1ERUA 5G1LA 3MNGA 1M2AA 4PX1A 2CQ9A 2VCXA 1EOHA 4MZBA 1Q4JA 4EL1A 1XWCA 2CZ2A 3C8EA 4KSOA 4TR4A 4POBA 2VIMA 2VL9A 1KEBA 3FEUA 4L0UA 1K0BA 1FAAA 2I9HA 2IJYA 3C73A 2WB9A 1AQVA 1ZYQB 2P5RA 5HFKA 2LRCA 2C3QA 1OAZA 3F4TA 3GYKA 3DVWA 1ZYNA 5CRDA 2ZCTA 2LV3A 4WF5A 4KGIA 2O85A 3ZIJA 3TKRA 1YF0A 2QKEA 1WOUA 2HRKA 2YOIA 2LUSA 1NM3A 4NAXA 3IAS2 2D2ZA 1WMJA 2HRAA 2RIIA 1SK0A 2GSRA 3I69A 3VWUA 3RPPA 1BYEA 3RDWA 5DJMA 3VI7A 5F07A 2VL2A 4MJAA 1AW9A 3ME7A 3O6TA 1VF3A 1ERTA 3FR9A 3Q18A 3W8JA 1PX7A 4KAEA 2P31A 1PKZA 1SK2A 2TIRA 3WGXA 2DMMA 3F0IA 5IO0A 2H71A 3HJPA 5ECLB 4F0CA 5IM9A 3LEFA 1PL2A 2B1KA 5C00A 4PURA 2HSYA 4AJ8A 3WGEA 2MMNA 1K3YA 4YQUA 3M0FA 3VWVA 2M46A 4GSNA 4I2UA 4BA7A 3LJRA 2R4VA 3BD2A 2C8UA 3UVHA 1KNGA 4N0VA 2QA2A 3KP9A 4IN0A 1A0RP 2YNXA 2I1UA 4BL7A 3FZAA 4X0XA 3ISOA 2HI7A 4QL7A 4ZL8A 5IPGA 5ELAA 5AIVA 1A2LA 3BCIA 2H75A 2VD1A 2OBIA 3U5RE 2JSZA 4PTSA 1SKRB 3UL3A 4IP6A 4X43A 5CAXA 1F2EA 1IYIA 3KTLA 4N11A 8GSSA 4MZCA 4POKA 2VLVA 3LSZA 3TJJA 1PRXA 3QFBC 1TK0B 3IRAA 1CQHA 1MD3A 2YZHA 2GLRA 1SL2B 3TKSC 4WF4A 3MWHA 4MJEA 2F8FA 6GSVA 2OE1A 2JZTA 4IP1A 2ALBA 4F2IA 2H0HA 5JCGA 4DSSB 3NOFA 3M3MA 1GSYA 5HQPA 3KCMA 2REMA 2IFQA 1M9AA 20GSA 1DUGA 4V2LA 4GTUA 3UAPA 4AF2A 2VL3A 3LFLA 1VF2A 1TKDB 2DKHA 3IA1A 2FWFA 2KP2A 5JCUA 2LEGA 3HVSA 5IMFA 5DALB 3VK9A 2K6VA 3WD6A 5GSSA 1PGTA 4EIQA 1SU9A 5JWQB 1PSQA 2RM5A 2G0FA 5LD0A 1RK4A 3SWLA 1YF1A 2H6XA 1RQMA 1XCCA 1O8XA 3F4RA 3QFAC 3DD3A 3LORA 4IQAA 5DBQA 2K8VA 1NSWA 2GQMA 5HFIA 3TJKA 2R0CA 4CY8A 2CVBA 2GTUA 3QPMA 3ME8A 5DCGA 4OO5A 4G10A 1X5EA 2GSQA 2H30A 2HRNA 1W89A 5IPHA 1AC1A 3AY8A 1T3BA 3ED3A 2DIZA 3P90A 3CTFA 2GQLA 1Z3EA 4BPYA 2WJUA 1PKWA 1ZMAA 1F3AA 5DQSA 2KHPA 2YCDA 3FHKA 4I5QA 4BWQA 2MZCA 2R6KA 2X8CA 4IW9A 2PGTA 2H6YA 4L0WA 4NHWA 2HFDA 4TXVA 4JEDA 1GULA 1K0MA 2LJRA 2WZ9A 2DIYA 5ECQB 4Q5FA 3NZNA 5GAND 3FZ9A 2PMTA 3MDKA 1Z7RA 1SKWB 4O5UA 1DSBA 2N5FA 1M7TA 4EKZA 4HJ2A 6GSSA 5DCHA 4ZXGA 2L4CA 2NVLA 5G30A 3ZREA 2VCWA 6GSTA 3F8UA 4ML6A 1MDKA 3HVXA 4LL4B 2JZSA 2DJ0A 1FHEA 1EGOA 1OYJA 1X5CA 3IDVA 2GGTA 4XIHA 2L59A 4MF7A 4PNGA 2GS3A 5CRGA 2L6DA 4GRFA 4OD7A 4EC0A 1GSSA 2VL2C 1ON4A 4FO5A 1U3AA 1JZDA 4OWYA 2GT5A 4ZBDA 3RHCA 4BVYA 4ACSA 3F6FA 5INYA 3C1RA 3DKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWJ A;  4MAB A;  1PMT A;  1M2B A;  4DSQ A;  1XWB A;  4YQV A;  1SJ6 A;  3GKM A;  2BMX A;  2LQQ A;  4G2E A;  2H1D A;  1ILO A;  3GKK A;  3A5W A;  2DLX A;  4RUV A;  1VF1 A;  4FYB A;  3A2X A;  3EU3 A;  3GTU A;  1Q98 A;  3L4N A;  2N5A A;  5D9T A;  1X9M B;  2F51 A;  2QGV A;  2MYG A;  2HZE A;  4MA9 A;  1IYH A;  3TGZ A;  2IME A;  4XS1 A;  2VM1 A;  2YP6 A;  4HI7 A;  2G2Q A;  2OAD A;  5FWG A;  1B9Y C;  5G5E A;  4TOP A;  4EUY A;  1RW1 A;  4GQC A;  1BX9 A;  3GMF A;  4ZIL A;  1SK1 A;  1YJ6 A;  1TOF A;  1HNA A;  4ID0 A;  3UIW A;  1WJK A;  2C3T A;  16GS A;  1PL1 A;  1GUK A;  2LS5 A;  2EIR A;  3UVT A;  4IQ1 A;  4NXI A;  2F3M A;  3F4S A;  18GS A;  3ZFB A;  2XBI A;  3PR8 A;  2YWO A;  3VWW A;  1HQO A;  4TXO A;  4F82 A;  3IAM 2;  1WP0 A;  3D6I A;  1GWC A;  1GSD A;  4JE1 A;  2YV7 A;  3HDC A;  1GTB A;  3VI5 A;  2YWM A;  3DVX A;  3GX0 A;  1H75 A;  2IIY A;  4Z7X A;  4POL A;  1SKS B;  4O32 A;  4PQ1 A;  4EVM A;  1XW6 A;  4LLR A;  3G7Y A;  4F03 A;  4WR5 A;  3GST A;  2VD0 A;  2H66 A;  19GS A;  5F0G A;  3QAW A;  5F06 A;  4IJI A;  3PIN A;  3GV1 A;  3TKQ A;  4POM A;  5A4U A;  2CV4 A;  4Q5R A;  4MJB A;  5IOX A;  2MBS A;  4JR6 A;  1TJD A;  1Z6N A;  1XW5 A;  3O76 A;  2H76 A;  3DXB A;  1TDI A;  9GSS A;  1FG4 A;  5EL8 A;  1U87 A;  1GSU A;  1ZOF A;  2NPB A;  1EZK A;  3D4M A;  1B48 A;  2L57 A;  3UEM A;  1SYR A;  2V32 A;  2PBJ A;  3DGQ A;  1GSE A;  2VCZ A;  2GSS A;  2CT6 A;  4GXZ A;  1O7U A;  1V57 A;  3FR6 A;  1R5P A;  4TKY A;  4OFT A;  3LGC A;  1TU8 A;  3EIN A;  2PUK C;  4RI6 A;  3ZTL A;  5KN0 A;  5A4V A;  3KH7 A;  2RUE A;  4KSM A;  1XIY A;  2XPE A;  2CA8 A;  2FLS A;  5GAP D;  3L9S A;  5AIX A;  3CYN A;  3ZL5 A;  4GSS A;  5GZZ B;  1XXU A;  2FA4 A;  1EV4 A;  4V1A g;  1UA5 A;  3EMX A;  2V6K A;  2X64 A;  2FY6 A;  4WKW A;  1EOG A;  1BG5 A;  2B1L A;  5ECP B;  4IHU A;  2B5X A;  4GST A;  1VGL A;  4XRD A;  1S3C A;  2EIQ A;  1V2A A;  2HSH A;  3LG6 A;  2IN3 A;  4ECJ A;  1NHY A;  1FW1 A;  2O87 A;  5EY6 A;  3H93 A;  5LNK e;  1B8X A;  2AV4 A;  3F3Q A;  1JHB A;  2DSA A;  1LJR A;  1A2M A;  4ILF A;  1GUH A;  2DJ2 A;  1R26 A;  1OVN A;  4MH3 A;  5EPF A;  3EYT A;  5J9B A;  4IBP A;  4HQS A;  3ZRD A;  4ZB6 A;  4O7H A;  2WRT A;  12GS A;  1EV9 A;  1USB A;  4KCA A;  1X9W B;  4K0N A;  4OMV A;  2QSI A;  1JLV A;  4WXT A;  1AIU A;  2IWT A;  3H79 A;  4D73 A;  4GWR A;  1XW9 A;  3FY7 A;  1TTZ A;  1WRY A;  2A2R A;  4F9Z A;  1GL8 A;  2K9F A;  2WFC A;  2IFQ B;  1M0U A;  4XCS A;  4EDZ A;  4ZIJ A;  2YZU A;  1SJI A;  5D93 A;  3ZFL A;  2CAQ A;  2DC5 A;  5DQY A;  3JCM L;  2ZUP A;  2C0D A;  1S3A A;  4J56 E;  1THO A;  3GL3 A;  4KE3 A;  2EIO A;  5IMA A;  3GH6 A;  3KXO A;  2K18 A;  2H0G A;  2YN1 A;  5B6M A;  2R3X A;  5H5S A;  3DML A;  2H19 A;  2X99 A;  4HUA A;  1X5D A;  2OAC A;  4IS0 A;  5ECI B;  4ZBA A;  5E59 A;  4DSR A;  4V2N A;  1FOV A;  2L5O A;  1GNW A;  5E4W A;  1SJZ A;  3WGD A;  4KW6 A;  4MPF A;  3D21 A;  5A5K A;  4TN8 A;  4KCE A;  3APO A;  5ID2 A;  4NHZ A;  3EU4 A;  4O92 A;  3M9J A;  2RLI A;  3EVI A;  2LKU A;  1K0D A;  3A2W A;  4QQ7 A;  4KDU A;  3TJB A;  1TRU A;  4ZL9 A;  2HT9 A;  2HNL A;  3QOU A;  4HU9 A;  3GX8 A;  3M8N A;  3H4K A;  4GLT A;  5IMV A;  4YH2 A;  4JU5 A;  3HXS A;  1T4Y A;  1O81 A;  1THX A;  2ON7 A;  2JL4 A;  2GVP A;  2PER A;  1YEP A;  3DRN A;  2GT6 A;  3VFI A;  1PX6 A;  3H1N A;  5J4U A;  2B6M A;  3CMI A;  4IKH A;  3L78 A;  4OFM A;  3CBU A;  4HOJ A;  1LU4 A;  2FGX A;  2CVD A;  2KP1 A;  3DWV A;  3IR4 A;  4XS6 A;  3WYW A;  4KUN A;  2O8V B;  1T7P B;  5G1K A;  3P8W A;  5J9C A;  1G6W A;  1UC7 A;  3DYR A;  6GSY A;  4ECB A;  4OCF A;  3FKF A;  6GSW A;  4MK3 A;  4N30 A;  2H8L A;  1HD2 A;  2KOK A;  1ABA A;  2B3S A;  1KTE A;  1HNC A;  1T4Z A;  3M9K A;  4ZBB A;  5ECN B;  4KX4 A;  2IL3 A;  1QK8 A;  1OKD A;  4JZQ A;  5HFG A;  3I6A A;  2GST A;  5JCW A;  3KZQ A;  2FCH A;  3HKR A;  3ZVJ A;  4XS4 B;  5ECM B;  3IXR A;  3TKS E;  3CSJ A;  1QFN A;  4GF0 A;  3IHQ A;  1NW2 A;  3HZ8 A;  2VCV A;  1N8J A;  4XRA A;  4K7N A;  3GTU B;  1YDK A;  2ES7 A;  1K0C A;  3HZ4 A;  4NV5 A;  5DDL A;  6GSX A;  5DJL A;  4K7O A;  2HZF A;  1Z9H A;  1V9W A;  3MSZ A;  2CX4 A;  2HZE B;  1DE1 A;  3GRX A;  5CRH A;  1SYX A;  2I81 A;  4PNF A;  1VRS D;  5KN1 A;  1UN2 A;  5DVB A;  5FHI A;  4JR4 A;  4V1A p;  2HXK A;  3HYP A;  2WDU A;  3RHB A;  5HR2 A;  3WT2 A;  2MMZ A;  4FYU A;  3GH9 A;  1FO5 A;  5CYY A;  4WEY A;  2DBC A;  1K0A A;  1F37 A;  5HR0 A;  2PVO C;  2DJK A;  5CRE A;  3LYP A;  4WBR D;  2PWJ A;  4KDY A;  2E2M A;  3RPN A;  1BED A;  2VLU A;  2C3N A;  3F63 A;  2C80 A;  4TXO B;  5D9W A;  2KUC A;  1AQX A;  1MTC A;  3BOA A;  5DAL A;  3RAZ A;  1SL0 B;  1WIK A;  1GRX A;  3VPQ A;  5AGY A;  4FIW A;  2RM6 A;  3GA4 A;  4ZB8 A;  3V1W A;  3IBH A;  4K7I A;  4NMU A;  4HS1 A;  1TK8 B;  2F9S A;  1FVJ A;  4FYC A;  4AGS A;  3N9J A;  4TR1 B;  3QDN A;  4RI7 A;  2B7J A;  5C04 A;  3IPZ A;  1J0F A;  4NV2 A;  1ZYE A;  3GNJ A;  1A2J A;  3KM6 A;  1ZGN A;  2AAW A;  17GS A;  1ZCP A;  3FYG A;  3G7I A;  3VPT A;  3K8N A;  1F9M A;  3EWL A;  5DAK B;  1EP7 A;  5KN3 A;  1C72 A;  5KEJ A;  5KN2 A;  5D73 A;  4P3Y B;  1I5G A;  3CXG A;  3VLN A;  3DIE A;  1U6T A;  2H74 A;  1GTU A;  1URM A;  14GS A;  4L8E A;  1R5A A;  2PU9 C;  1OC9 A;  2LTK A;  3ERW A;  3GKX A;  1GUM A;  4FH8 A;  2F8A A;  1TP9 A;  1K0O A;  3A2V A;  2V41 A;  1YQ1 A;  4LA1 A;  1X9S B;  4E8H A;  5ELG A;  4KND A;  2RUF A;  4G9H A;  2AHE A;  2IMK A;  1A8Y A;  4DVC A;  1TRV A;  3APS A;  2EC4 A;  2B5Y A;  4J2F A;  3CTG A;  5G31 A;  1YKC A;  1T00 A;  1AAZ A;  13GS A;  4MCU A;  1SEN A;  3TUE A;  1JLW A;  2JU5 A;  3TDG A;  4AJ7 A;  2PN8 A;  2YPM A;  3ERG A;  4PQH A;  1DBY A;  2LJK A;  1TW9 A;  2H1B A;  2A4V A;  1V98 A;  3KIJ A;  3KP8 A;  3ZVJ D;  5IMZ A;  1QXH A;  4HDE A;  3H8Q A;  2YJ7 A;  3QMX A;  4J57 E;  4DEJ A;  3MAK A;  3S9F A;  3F9U A;  4K9Z A;  4H86 A;  2MMO A;  1LBK A;  2LST A;  5IQY A;  1GH2 A;  1XVW A;  1CQG A;  3PH9 A;  1XOA A;  3LWA A;  2NDO A;  2DML A;  2P0G A;  3LQ7 A;  1F3B A;  1TK5 B;  2FA8 A;  4ML1 A;  4TVE A;  10GS A;  2E0Q A;  3ZZX A;  4MZW A;  2IMF A;  1WE0 A;  4F0B A;  1BQ7 A;  3CSI A;  3NIV A;  5FT3 A;  3CRU A;  2BJX A;  4G19 A;  1GLP A;  1MDJ A;  3GHA A;  2FWE A;  5ECO B;  4YAV A;  3TRX A;  2NTO A;  4QL9 A;  2V1M A;  5JWR B;  2YJH A;  4MF5 A;  2JAC A;  4L5O A;  4OFN A;  2H70 A;  4O5R A;  3M1G A;  4Q5Q A;  4I6X A;  4MJC A;  22GS A;  1YZX A;  5B6N A;  3GL5 A;  3IE3 A;  3EUR A;  1T1V A;  2HLS A;  4K8M A;  5D96 A;  2R5G A;  3IK9 A;  2YWI A;  1N2A A;  1EP8 A;  5B8B A;  3GUS A;  1U88 A;  5GST A;  4MF6 A;  5ID2 B;  4HEA 2;  4GCI A;  4EO3 A;  2H0I A;  2VM2 A;  5COH A;  5IIZ A;  1E6B A;  1WPI A;  2FNO A;  1K3L A;  1TI1 A;  3N5O A;  2GZY A;  1QMV A;  2ZNM A;  2XBQ A;  4TW5 A;  2OJL A;  1R7H A;  2C1Y A;  2DJJ A;  1XVQ A;  3TJG A;  2FHE A;  3HY2 A;  5ENU A;  3CRT A;  1UVZ A;  3US3 A;  1AUC A;  1ML6 A;  4LL1 B;  4WET A;  2CZ3 A;  1OC3 A;  2AJQ B;  4EXJ A;  1G7E A;  4KH7 A;  2DJ1 A;  5ECR B;  1SD8 A;  5HR3 A;  1ACV A;  2YAN A;  1ERW A;  3KEB A;  3ZIV A;  2L6C A;  3GSS A;  2J23 A;  3TJF A;  3W8S A;  4MMM A;  3G9B A;  3D5J A;  2B7K A;  3ZLP A;  4MH2 A;  2OE3 A;  5HR1 A;  4KDX A;  4LMV A;  2IMI A;  2DJ3 A;  3UBL A;  2YV9 A;  5D9X A;  5D9V A;  2AYT A;  2J9H A;  2XC2 A;  1PN9 A;  4TRX A;  5ECH B;  1GTI A;  2GZP A;  1A23 A;  2C0E A;  2E2G A;  3DEX A;  5J41 A;  4RQX A;  2BTO T;  2R37 A;  2VAF A;  4BVX A;  5B7C A;  4K2D A;  1JZO A;  3OR5 A;  4TR3 A;  4NWY A;  5CNW A;  3Q19 A;  1AXD A;  5ECK B;  2HYX A;  3UBK A;  1K0N A;  4ECC A;  4RQR A;  3RBT A;  5JWO B;  5CRW A;  3EMP A;  3EE2 A;  2MBT A;  1M99 A;  2H01 A;  2GDR A;  2M80 A;  4IVF A;  1H4O A;  1OKT A;  1O6J A;  2KLX A;  3FRC A;  3J7Y b;  4K1F A;  1EEJ A;  1V58 A;  5G2Z A;  4XTS A;  3IOS A;  1Z7P A;  7GSS A;  1DE2 A;  2WUL A;  4PUF C;  5IMD A;  6GSU A;  1QUW A;  1GTA A;  4I2T A;  2FWG A;  2HRF A;  2FD3 A;  3E0U A;  1O73 A;  1XWG A;  2VUP A;  4BWS A;  1HNB A;  2M72 A;  1Z5Y E;  3Q6O A;  3P2A A;  2AB6 A;  5B8A A;  3TOT A;  5G5F A;  4YQM A;  1XFL A;  1TXX A;  1AQW A;  2OE0 A;  2V2G A;  3D0Z A;  2OBK A;  3UOM A;  3ZMK A;  2ON5 A;  3KJY A;  3L9U A;  3C1S A;  2YWN A;  4MDC A;  3FR3 A;  3D22 A;  3TRP A;  1B9X C;  1PA3 A;  1MD4 A;  3VWX A;  1MEK A;  5AIS A;  4AJ6 A;  2C0F A;  2GQK A;  3P7X A;  2H1G A;  3QCP A;  1OE8 A;  1TRS A;  5L71 A;  4K0G A;  3FW2 A;  1TI3 A;  1JZW A;  2O7K A;  2XPD A;  2L4Q A;  2GZZ A;  3GUR A;  2L5L A;  4OCE A;  3C7M A;  2PVQ A;  1F6M C;  3KMN A;  1J08 A;  3I43 A;  3QR6 A;  3EC3 A;  5J3R A;  3CSH A;  1GSQ A;  4TR0 A;  4EE0 A;  5IO2 A;  1PQN A;  2JSY A;  2OKA A;  3GIX A;  3TRQ A;  2VCQ A;  1TRW A;  1XPV A;  2LJA A;  2N5B A;  1XOB A;  2IPA A;  4N0Z A;  1TU7 A;  5F05 A;  2K8S A;  2HE3 A;  2CAI A;  2WGR A;  4PGT A;  1G6Y A;  4EDY A;  1U3I A;  3QAV A;  5J5N A;  5EVO A;  1OC9 B;  1HYU A;  1V40 A;  3D4T A;  1A24 A;  2LNT A;  2LRT A;  1EGR A;  2VO4 A;  1I9D A;  4XHM A;  2H6Z A;  3GFK A;  1QQ2 A;  1KBN A;  2X8H A;  3ERF A;  4PUA A;  5CP1 A;  3HA9 A;  1ST9 A;  4DSS A;  1R4W A;  1XWK A;  3HVV A;  4ISD A;  3LXZ A;  2B5E A;  3KH9 A;  3F3R A;  3ZML A;  3ZIT A;  3F6D A;  4ZB9 A;  3E9J B;  4YAP A;  1XBS A;  5A4W A;  1O85 A;  4EF0 A;  1OC8 A;  2CX3 A;  3WT1 A;  3A3T A;  1W4V A;  3BCK A;  4KB3 A;  3LXT A;  1X0R A;  3FK8 A;  1FB0 A;  1M2D A;  1YEX A;  3UAR A;  1YY7 A;  1JFU A;  1GSF A;  1EWX A;  2C4J A;  4Q5N A;  2WS2 A;  1T8E B;  4ECI A;  3KMO A;  3UJ1 A;  1FB6 A;  2TRX A;  2H72 A;  2R2J A;  1QGV A;  2FWH A;  4JRR A;  3U6V A;  5F8B A;  2X8G A;  2C0G A;  2VLT A;  1G0T A;  2XHF A;  2JZR A;  1BJX A;  3W6G A;  5H5Q A;  1XWA A;  1GP1 A;  3LYK A;  4XS4 A;  3UMA A;  2H1A A;  2LNS A;  3GN3 A;  1ZL9 A;  1A8L A;  4CDO A;  2O89 A;  1JZR A;  2FUG 2;  1BAY A;  2I3Y A;  1Y6E A;  3E3E A;  2V6O A;  3HJO A;  4WBJ A;  1SD9 A;  1A0F A;  3GKN A;  3QD9 A;  4NPB A;  1GNE A;  3APQ A;  2WCI A;  3L9V A;  5AN1 A;  2H73 A;  3HHV A;  4IJ3 A;  4I8B A;  1B4P A;  3FZ4 A;  3HCZ A;  4GQF A;  2I4A A;  1B4Q A;  3HD5 A;  3SBC A;  3TOU A;  3TCO A;  1K3O A;  3KGK A;  1S3D A;  3J7Y k;  4X1U A;  4MP4 A;  2P5Q A;  1FVK A;  3IK7 A;  1NHO A;  2JAD A;  1YKA A;  4JBB A;  1PD2 1;  4CHS A;  2CVK A;  5LCZ A;  2LRN A;  1VF4 A;  3HJM A;  1ERV A;  1GLQ A;  4IGJ A;  3Q74 A;  4N10 A;  1Z6M A;  2AUV A;  2A2S A;  2E7P A;  3IV4 A;  4HU7 A;  3G7J A;  4OO4 A;  5H5R A;  1J9B A;  1E2Y A;  3L0H A;  3KTB A;  1XZO A;  4ULX A;  11GS A;  2LQO A;  4PQI A;  3TKS A;  2PPT A;  4MPG A;  4E8E A;  1SL1 B;  3BJ5 A;  1Y25 A;  2NBS A;  3I9V 2;  3QAG A;  1G7O A;  1O8W A;  4HQZ A;  2QC7 A;  4HZ2 A;  3ZYW A;  1ZZY A;  4TR1 A;  5IOW A;  5CO3 A;  4WR4 A;  4LMW A;  3PGT A;  2MMA A;  4I97 A;  4CW9 A;  4HJM A;  2OA7 A;  4PXO A;  5IMC A;  5D8I A;  3IC4 A;  2Z9S A;  1OE7 A;  4ZL7 A;  5ECS A;  5DAK A;  4D73 B;  3KD0 A;  3TB2 A;  3BBY A;  4IEL A;  3O3T A;  3TKP A;  3R2Q A;  4V2M A;  4KA0 A;  4HZ4 A;  4MLY A;  1M9B A;  2TRC P;  1EEM A;  2VCT A;  4K6X A;  2IMD A;  3VUR A;  3FZ5 A;  1MDI A;  3C71 A;  2VOC A;  5ABR A;  4L5L A;  1ERU A;  5G1L A;  3MNG A;  1M2A A;  4PX1 A;  2CQ9 A;  2VCX A;  1EOH A;  4MZB A;  1Q4J A;  4EL1 A;  1XWC A;  2CZ2 A;  3C8E A;  4KSO A;  4TR4 A;  4POB A;  2VIM A;  2VL9 A;  1KEB A;  3FEU A;  4L0U A;  1K0B A;  1FAA A;  2I9H A;  2IJY A;  3C73 A;  2WB9 A;  1AQV A;  1ZYQ B;  2P5R A;  5HFK A;  2LRC A;  2C3Q A;  1OAZ A;  3F4T A;  3GYK A;  3DVW A;  5CRD A;  2ZCT A;  2LV3 A;  4WF5 A;  4KGI A;  2O85 A;  3ZIJ A;  3TKR A;  1YF0 A;  2QKE A;  1WOU A;  2YOI A;  2LUS A;  1NM3 A;  4NAX A;  3IAS 2;  2D2Z A;  1WMJ A;  2RII A;  1SK0 A;  2GSR A;  3I69 A;  3VWU A;  3RPP A;  1BYE A;  3RDW A;  5DJM A;  3VI7 A;  5F07 A;  2VL2 A;  4MJA A;  1AW9 A;  3ME7 A;  3O6T A;  1VF3 A;  1ERT A;  3FR9 A;  3Q18 A;  3W8J A;  1PX7 A;  4KAE A;  2P31 A;  1PKZ A;  1SK2 A;  2TIR A;  3WGX A;  2DMM A;  3F0I A;  5IO0 A;  2H71 A;  3HJP A;  5ECL B;  4F0C A;  5IM9 A;  3LEF A;  1PL2 A;  2B1K A;  5C00 A;  4PUR A;  2HSY A;  4AJ8 A;  3WGE A;  2MMN A;  1K3Y A;  4YQU A;  3M0F A;  3VWV A;  2M46 A;  4GSN A;  4I2U A;  4BA7 A;  3LJR A;  2R4V A;  3BD2 A;  2C8U A;  3UVH A;  1KNG A;  4N0V A;  3KP9 A;  4IN0 A;  1A0R P;  2YNX A;  2I1U A;  4BL7 A;  3FZA A;  4X0X A;  3ISO A;  2HI7 A;  4QL7 A;  4ZL8 A;  5IPG A;  5ELA A;  5AIV A;  1A2L A;  3BCI A;  2H75 A;  2VD1 A;  2OBI A;  3U5R E;  2JSZ A;  1SKR B;  3UL3 A;  4IP6 A;  4X43 A;  5CAX A;  1F2E A;  1IYI A;  3KTL A;  4N11 A;  8GSS A;  4MZC A;  4POK A;  2VLV A;  3LSZ A;  3TJJ A;  1PRX A;  3QFB C;  1TK0 B;  3IRA A;  1CQH A;  1MD3 A;  2YZH A;  2GLR A;  1SL2 B;  3TKS C;  4WF4 A;  3MWH A;  4MJE A;  2F8F A;  6GSV A;  2OE1 A;  2JZT A;  4IP1 A;  2ALB A;  4F2I A;  2H0H A;  5JCG A;  4DSS B;  3NOF A;  3M3M A;  1GSY A;  5HQP A;  3KCM A;  2REM A;  2IFQ A;  1M9A A;  20GS A;  1DUG A;  4V2L A;  4GTU A;  3UAP A;  4AF2 A;  2VL3 A;  3LFL A;  1VF2 A;  1TKD B;  3IA1 A;  2FWF A;  2KP2 A;  5JCU A;  2LEG A;  3HVS A;  5IMF A;  5DAL B;  3VK9 A;  2K6V A;  3WD6 A;  5GSS A;  1PGT A;  1SU9 A;  5JWQ B;  1PSQ A;  2RM5 A;  2G0F A;  5LD0 A;  1RK4 A;  3SWL A;  1YF1 A;  2H6X A;  1RQM A;  1XCC A;  1O8X A;  3F4R A;  3QFA C;  3DD3 A;  3LOR A;  4IQA A;  5DBQ A;  2K8V A;  1NSW A;  2GQM A;  5HFI A;  3TJK A;  2CVB A;  2GTU A;  3QPM A;  3ME8 A;  5DCG A;  4OO5 A;  4G10 A;  1X5E A;  2GSQ A;  2H30 A;  2HRN A;  1W89 A;  5IPH A;  1AC1 A;  3AY8 A;  1T3B A;  3ED3 A;  2DIZ A;  3P90 A;  3CTF A;  2GQL A;  1Z3E A;  4BPY A;  2WJU A;  1PKW A;  1ZMA A;  1F3A A;  5DQS A;  2KHP A;  2YCD A;  3FHK A;  4I5Q A;  4BWQ A;  2MZC A;  2R6K A;  2X8C A;  4IW9 A;  2PGT A;  2H6Y A;  4L0W A;  4NHW A;  2HFD A;  4TXV A;  4JED A;  1GUL A;  1K0M A;  2LJR A;  2WZ9 A;  2DIY A;  5ECQ B;  4Q5F A;  3NZN A;  5GAN D;  3FZ9 A;  2PMT A;  3MDK A;  1Z7R A;  1SKW B;  1DSB A;  2N5F A;  1M7T A;  4EKZ A;  4HJ2 A;  6GSS A;  5DCH A;  4ZXG A;  2L4C A;  2NVL A;  5G30 A;  3ZRE A;  2VCW A;  6GST A;  3F8U A;  4ML6 A;  1MDK A;  3HVX A;  4LL4 B;  2JZS A;  2DJ0 A;  1FHE A;  1EGO A;  1OYJ A;  1X5C A;  3IDV A;  2GGT A;  4XIH A;  2L59 A;  4MF7 A;  4PNG A;  2GS3 A;  5CRG A;  2L6D A;  4GRF A;  4OD7 A;  4EC0 A;  1GSS A;  2VL2 C;  1ON4 A;  4FO5 A;  1U3A A;  1JZD A;  4OWY A;  2GT5 A;  4ZBD A;  3RHC A;  4BVY A;  4ACS A;  3F6F A;  5INY A;  3C1R A;  3DKS A; 
#chains in the Genus database with same CATH topology
 2UZ8 A;  1WWJ A;  4MAB A;  1PMT A;  1M2B A;  4DSQ A;  1XWB A;  4YQV A;  1SJ6 A;  3GKM A;  2BMX A;  2LQQ A;  4G2E A;  2H1D A;  1ILO A;  3GKK A;  3A5W A;  2DLX A;  4RUV A;  1VF1 A;  4FYB A;  3A2X A;  3EU3 A;  3GTU A;  1Q98 A;  3L4N A;  2N5A A;  5D9T A;  1X9M B;  2F51 A;  2QGV A;  2MYG A;  2HZE A;  4MA9 A;  1IYH A;  2R0G A;  3TGZ A;  2IME A;  4XS1 A;  2VM1 A;  2YP6 A;  4HI7 A;  2G2Q A;  2OAD A;  5FWG A;  1B9Y C;  5G5E A;  4TOP A;  4EUY A;  1RW1 A;  4GQC A;  1BX9 A;  3GMF A;  4ZIL A;  1SK1 A;  1YJ6 A;  1TOF A;  1HNA A;  4ID0 A;  3UIW A;  1WJK A;  2C3T A;  16GS A;  1PL1 A;  1GUK A;  2LS5 A;  2EIR A;  3UVT A;  4IQ1 A;  3EPT A;  4NXI A;  2F3M A;  3F4S A;  18GS A;  3ZFB A;  2XBI A;  3PR8 A;  2YWO A;  3VWW A;  1HQO A;  4TXO A;  4F82 A;  3IAM 2;  1WP0 A;  3D6I A;  1GWC A;  1GSD A;  4JE1 A;  2YV7 A;  3HDC A;  1GTB A;  3VI5 A;  2YWM A;  3DVX A;  3GX0 A;  1H75 A;  2IIY A;  4Z7X A;  4POL A;  1SKS B;  4O32 A;  4PQ1 A;  4EVM A;  1XW6 A;  4LLR A;  3G7Y A;  4F03 A;  4WR5 A;  3GST A;  2VD0 A;  2H66 A;  19GS A;  5F0G A;  3QAW A;  5F06 A;  4IJI A;  3PIN A;  3GV1 A;  3TKQ A;  4POM A;  5A4U A;  2CV4 A;  4Q5R A;  4MJB A;  5IOX A;  2MBS A;  4JR6 A;  1TJD A;  1Z6N A;  1XW5 A;  3O76 A;  2H76 A;  3DXB A;  1TDI A;  9GSS A;  1FG4 A;  5EL8 A;  1U87 A;  1GSU A;  1ZOF A;  2NPB A;  1EZK A;  3D4M A;  1B48 A;  2L57 A;  3UEM A;  1SYR A;  2V32 A;  2PBJ A;  3DGQ A;  1GSE A;  2VCZ A;  2GSS A;  2CT6 A;  4GXZ A;  1O7U A;  1V57 A;  3FR6 A;  1R5P A;  4TKY A;  4OFT A;  3LGC A;  1TU8 A;  3MYD A;  3EIN A;  2PUK C;  4RI6 A;  3ZTL A;  5KN0 A;  5A4V A;  3KH7 A;  2RUE A;  4KSM A;  1XIY A;  2XPE A;  2CA8 A;  2FLS A;  5GAP D;  3L9S A;  5AIX A;  4G0L A;  3CYN A;  3ZL5 A;  4GSS A;  5GZZ B;  1XXU A;  2FA4 A;  1EV4 A;  4USS A;  4V1A g;  1UA5 A;  3EMX A;  2V6K A;  2X64 A;  2FY6 A;  4WKW A;  1EOG A;  1BG5 A;  2B1L A;  5ECP B;  4IHU A;  2B5X A;  4BVX B;  4GST A;  1VGL A;  4XRD A;  1S3C A;  2EIQ A;  1V2A A;  2HSH A;  3LG6 A;  2IN3 A;  4ECJ A;  1NHY A;  1FW1 A;  2O87 A;  5EY6 A;  1S3R A;  3H93 A;  5LNK e;  1B8X A;  2AV4 A;  3F3Q A;  1JHB A;  2DSA A;  1LJR A;  1A2M A;  4ILF A;  1GUH A;  2DJ2 A;  1R26 A;  4Z2R A;  1OVN A;  4MH3 A;  5EPF A;  3EYT A;  5J9B A;  4IBP A;  4HQS A;  3ZRD A;  4ZB6 A;  4O7H A;  2WRT A;  12GS A;  1EV9 A;  1USB A;  4KCA A;  1X9W B;  4K0N A;  4OMV A;  2QSI A;  1JLV A;  4WXT A;  1AIU A;  2IWT A;  3H79 A;  4D73 A;  4GWR A;  1XW9 A;  3FY7 A;  1TTZ A;  1WRY A;  2A2R A;  4F9Z A;  1GL8 A;  2K9F A;  2WFC A;  2IFQ B;  1M0U A;  4XCS A;  4EDZ A;  3R3E A;  4ZIJ A;  1PN0 A;  2YZU A;  1SJI A;  5D93 A;  3ZFL A;  2CAQ A;  2DC5 A;  5DQY A;  3JCM L;  2ZUP A;  2C0D A;  1S3A A;  4J56 E;  1THO A;  3GL3 A;  4KE3 A;  2EIO A;  5IMA A;  3GH6 A;  3KXO A;  2K18 A;  2H0G A;  2YN1 A;  4HSC X;  5B6M A;  2R3X A;  5H5S A;  3DML A;  2H19 A;  2X99 A;  4HUA A;  1X5D A;  2OAC A;  4IS0 A;  5ECI B;  4ZBA A;  5E59 A;  4DSR A;  4V2N A;  1FOV A;  2L5O A;  1GNW A;  5E4W A;  5BRT A;  1SJZ A;  3WGD A;  4KW6 A;  4MPF A;  3D21 A;  5A5K A;  4TN8 A;  2QA1 A;  4KCE A;  3APO A;  5ID2 A;  4NHZ A;  3EU4 A;  4O92 A;  3M9J A;  2X49 A;  2RLI A;  3EVI A;  2LKU A;  1K0D A;  3A2W A;  4QQ7 A;  4KDU A;  3TJB A;  1TRU A;  4ZL9 A;  2HT9 A;  2HNL A;  3QOU A;  4HU9 A;  3GX8 A;  3M8N A;  3H4K A;  4GLT A;  5IMV A;  4YH2 A;  4JU5 A;  3HXS A;  1T4Y A;  1O81 A;  1THX A;  2ON7 A;  2JL4 A;  2GVP A;  3FMW A;  2PER A;  1YEP A;  3DRN A;  2GT6 A;  2X4A A;  3VFI A;  1PX6 A;  3H1N A;  5J4U A;  2B6M A;  3CMI A;  4IKH A;  3L78 A;  4OFM A;  3CBU A;  4HOJ A;  1LU4 A;  2FGX A;  2CVD A;  2KP1 A;  3DWV A;  3IR4 A;  4XS6 A;  3WYW A;  4KUN A;  2O8V B;  1T7P B;  5G1K A;  3P8W A;  5J9C A;  1G6W A;  1UC7 A;  3DYR A;  6GSY A;  4ECB A;  4OCF A;  3FKF A;  6GSW A;  4MK3 A;  4N30 A;  2H8L A;  1HD2 A;  2KOK A;  1ABA A;  2B3S A;  1KTE A;  1HNC A;  1T4Z A;  3M9K A;  4ZBB A;  5ECN B;  4KX4 A;  2IL3 A;  1QK8 A;  1OKD A;  4JZQ A;  5HFG A;  3I6A A;  3MIX A;  2GST A;  5JCW A;  3KZQ A;  2FCH A;  3HKR A;  3ZVJ A;  4XS4 B;  5ECM B;  3IXR A;  3TKS E;  3CSJ A;  1QFN A;  4GF0 A;  4FQU A;  3IHQ A;  1NW2 A;  3HZ8 A;  2VCV A;  1N8J A;  4XRA A;  4K7N A;  3GTU B;  1YDK A;  2ES7 A;  1K0C A;  3HZ4 A;  4NV5 A;  5DDL A;  1FOH A;  6GSX A;  5DJL A;  4K7O A;  2HZF A;  1Z9H A;  1V9W A;  3MSZ A;  2CX4 A;  2HZE B;  1DE1 A;  3GRX A;  5CRH A;  1SYX A;  2I81 A;  4PNF A;  1VRS D;  5KN1 A;  1UN2 A;  3IC8 A;  5DVB A;  5FHI A;  4JR4 A;  4V1A p;  2HXK A;  3HYP A;  2WDU A;  3RHB A;  5HR2 A;  3WT2 A;  2MMZ A;  4FYU A;  3GH9 A;  1FO5 A;  5CYY A;  4WEY A;  2DBC A;  1K0A A;  1F37 A;  5HR0 A;  2PVO C;  2DJK A;  5CRE A;  3LYP A;  4WBR D;  2PWJ A;  4KDY A;  2E2M A;  3RPN A;  1BED A;  2VLU A;  2C3N A;  3F63 A;  2C80 A;  4TXO B;  5D9W A;  2KUC A;  1AQX A;  1MTC A;  3BOA A;  5DAL A;  3RAZ A;  1SL0 B;  1WIK A;  1GRX A;  3VPQ A;  5AGY A;  4FIW A;  2RM6 A;  3GA4 A;  4ZB8 A;  3V1W A;  3IBH A;  4K7I A;  4MNN A;  4NMU A;  4HS1 A;  1TK8 B;  2F9S A;  1FVJ A;  4FYC A;  4AGS A;  3N9J A;  4TR1 B;  3QDN A;  4RI7 A;  2B7J A;  5C04 A;  3IPZ A;  1J0F A;  4NV2 A;  1ZYE A;  3GNJ A;  1A2J A;  3KM6 A;  1ZGN A;  2AAW A;  17GS A;  1ZCP A;  3FYG A;  3G7I A;  3VPT A;  3K8N A;  4G0K A;  1F9M A;  3EWL A;  5DAK B;  1EP7 A;  5KN3 A;  1C72 A;  5KEJ A;  5KN2 A;  5D73 A;  4P3Y B;  1I5G A;  3CXG A;  3VLN A;  3DIE A;  1U6T A;  2H74 A;  1GTU A;  1URM A;  14GS A;  4L8E A;  1R5A A;  2PU9 C;  1OC9 A;  2R0P A;  2LTK A;  3ERW A;  3GKX A;  1GUM A;  4FH8 A;  2F8A A;  1TP9 A;  1K0O A;  3A2V A;  2V41 A;  1YQ1 A;  4LA1 A;  1X9S B;  4E8H A;  5ELG A;  4KND A;  2RUF A;  4G9H A;  2AHE A;  2IMK A;  1A8Y A;  4DVC A;  1TRV A;  3APS A;  2EC4 A;  2B5Y A;  4J2F A;  3HVN A;  3CTG A;  5G31 A;  1YKC A;  1T00 A;  1AAZ A;  13GS A;  4MCU A;  1SEN A;  3TUE A;  1JLW A;  2JU5 A;  3TDG A;  4AJ7 A;  2PN8 A;  2YPM A;  3ERG A;  4PQH A;  1DBY A;  1PFO A;  2LJK A;  1TW9 A;  2H1B A;  2A4V A;  1V98 A;  3KIJ A;  3KP8 A;  3ZVJ D;  4K5R A;  4EIP A;  1M3J A;  5IMZ A;  1QXH A;  4HDE A;  3H8Q A;  2YJ7 A;  3QMX A;  4J57 E;  4DEJ A;  3MAK A;  3S9F A;  3F9U A;  4K9Z A;  4H86 A;  2MMO A;  1LBK A;  2LST A;  5IQY A;  1GH2 A;  1XVW A;  1CQG A;  3PH9 A;  1XOA A;  3LWA A;  2NDO A;  2DML A;  2P0G A;  3LQ7 A;  1F3B A;  1TK5 B;  4K5S A;  2FA8 A;  4ML1 A;  4TVE A;  10GS A;  2E0Q A;  3ZZX A;  4MZW A;  2IMF A;  1WE0 A;  4F0B A;  1BQ7 A;  3CSI A;  3NIV A;  5FT3 A;  4KF9 A;  3CRU A;  2BJX A;  4G19 A;  1GLP A;  1MDJ A;  3GHA A;  2FWE A;  5ECO B;  4YAV A;  3TRX A;  2NTO A;  4QL9 A;  2V1M A;  5JWR B;  2YJH A;  4MF5 A;  2JAC A;  4L5O A;  4OFN A;  2H70 A;  4O5R A;  3M1G A;  4Q5Q A;  4I6X A;  4MJC A;  4A5P A;  22GS A;  1YZX A;  5B6N A;  3GL5 A;  3IE3 A;  3EUR A;  1T1V A;  2HLS A;  4K8M A;  5D96 A;  2R5G A;  3IK9 A;  2YWI A;  1N2A A;  1EP8 A;  4BL7 B;  5B8B A;  3GUS A;  1U88 A;  5GST A;  4G0I A;  4MF6 A;  5ID2 B;  4HEA 2;  4GCI A;  4EO3 A;  2H0I A;  2VM2 A;  5COH A;  5IIZ A;  1E6B A;  1WPI A;  2FNO A;  1K3L A;  1TI1 A;  3N5O A;  2GZY A;  1QMV A;  2ZNM A;  2XBQ A;  4TW5 A;  2OJL A;  1R7H A;  2C1Y A;  2DJJ A;  1XVQ A;  3TJG A;  2FHE A;  3HY2 A;  5ENU A;  3CRT A;  1UVZ A;  3US3 A;  1AUC A;  1ML6 A;  4LL1 B;  4ICY A;  4WET A;  2CZ3 A;  1OC3 A;  2AJQ B;  4EXJ A;  1G7E A;  4KH7 A;  2DJ1 A;  5ECR B;  1SD8 A;  5HR3 A;  1ACV A;  2YAN A;  1ERW A;  3KEB A;  3ZIV A;  2L6C A;  3GSS A;  2J23 A;  3TJF A;  3W8S A;  4MMM A;  3G9B A;  3D5J A;  2B7K A;  3ZLP A;  4MH2 A;  2OE3 A;  5HR1 A;  4KDX A;  4LMV A;  2IMI A;  2DJ3 A;  3UBL A;  2YV9 A;  5D9X A;  5D9V A;  2AYT A;  2J9H A;  2XC2 A;  1PN9 A;  4TRX A;  5ECH B;  4Z2T A;  1GTI A;  2GZP A;  1A23 A;  2C0E A;  2E2G A;  3DEX A;  5J41 A;  4RQX A;  2BTO T;  2R37 A;  2VAF A;  4BVX A;  5B7C A;  4K2D A;  1JZO A;  3OR5 A;  4TR3 A;  4NWY A;  5CNW A;  3Q19 A;  1AXD A;  5ECK B;  2HYX A;  3UBK A;  1K0N A;  4ECC A;  4RQR A;  3RBT A;  5JWO B;  5CRW A;  3EMP A;  3EE2 A;  2MBT A;  1M99 A;  2H01 A;  2GDR A;  2M80 A;  4IVF A;  1H4O A;  1OKT A;  1O6J A;  2KLX A;  3FRC A;  3J7Y b;  4K1F A;  1EEJ A;  1V58 A;  5G2Z A;  4XTS A;  3IOS A;  1Z7P A;  7GSS A;  1DE2 A;  2WUL A;  4PUF C;  5IMD A;  4K2X A;  6GSU A;  1QUW A;  1GTA A;  4I2T A;  2FWG A;  2HRF A;  2FD3 A;  3E0U A;  1O73 A;  1XWG A;  2VUP A;  4BWS A;  1HNB A;  2M72 A;  1Z5Y E;  3Q6O A;  3P2A A;  2AB6 A;  5B8A A;  3TOT A;  5G5F A;  4YQM A;  1XFL A;  1TXX A;  1AQW A;  2OE0 A;  2V2G A;  3D0Z A;  2OBK A;  3UOM A;  2HSM A;  3ZMK A;  4Z2U A;  2ON5 A;  3KJY A;  3L9U A;  3C1S A;  2YWN A;  4MDC A;  3FR3 A;  3D22 A;  3TRP A;  1B9X C;  1PA3 A;  1MD4 A;  3VWX A;  1MEK A;  5AIS A;  4AJ6 A;  2A4H A;  2C0F A;  2GQK A;  3P7X A;  2H1G A;  3QCP A;  1OE8 A;  1TRS A;  4X4J A;  5L71 A;  4K0G A;  4BVY B;  3FW2 A;  1TI3 A;  1JZW A;  2O7K A;  2XPD A;  4YKF A;  2L4Q A;  2GZZ A;  3GUR A;  2L5L A;  4OCE A;  3C7M A;  2PVQ A;  1F6M C;  3KMN A;  1J08 A;  3I43 A;  3QR6 A;  3EC3 A;  5J3R A;  3CSH A;  1GSQ A;  4TR0 A;  4EE0 A;  5IO2 A;  1PQN A;  2JSY A;  2OKA A;  3GIX A;  3TRQ A;  2VCQ A;  1TRW A;  1XPV A;  2LJA A;  2N5B A;  1XOB A;  2IPA A;  4N0Z A;  1TU7 A;  5F05 A;  3A5I A;  2K8S A;  2HE3 A;  2CAI A;  2WGR A;  4PGT A;  1G6Y A;  4EDY A;  4BIK A;  1U3I A;  3QAV A;  5J5N A;  5EVO A;  1OC9 B;  3PPU A;  1HYU A;  1V40 A;  3D4T A;  1A24 A;  2LNT A;  2LRT A;  1EGR A;  2VO4 A;  1I9D A;  4XHM A;  2H6Z A;  3GFK A;  1QQ2 A;  1XG8 A;  1KBN A;  2A2P A;  2X8H A;  3ERF A;  4PUA A;  5CP1 A;  3HA9 A;  1ST9 A;  4DSS A;  1R4W A;  1XWK A;  3HVV A;  4ISD A;  3LXZ A;  2B5E A;  3KH9 A;  3F3R A;  3ZML A;  3ZIT A;  3F6D A;  4ZB9 A;  3E9J B;  4YAP A;  3IHG A;  1XBS A;  5A4W A;  1O85 A;  4EF0 A;  1OC8 A;  2CX3 A;  5KOX A;  3WT1 A;  3A3T A;  1W4V A;  3BCK A;  4KB3 A;  3LXT A;  1X0R A;  3FK8 A;  3LW9 A;  1FB0 A;  1M2D A;  1YEX A;  3UAR A;  1YY7 A;  1JFU A;  1GSF A;  1EWX A;  2C4J A;  4Q5N A;  2WS2 A;  1T8E B;  4ECI A;  3KMO A;  2DKI A;  3UJ1 A;  1FB6 A;  2TRX A;  2H72 A;  2R2J A;  1QGV A;  2FWH A;  4JRR A;  3U6V A;  5F8B A;  2X8G A;  2C0G A;  2VLT A;  1G0T A;  2XHF A;  2JZR A;  1BJX A;  3W6G A;  5H5Q A;  1XWA A;  1GP1 A;  3LYK A;  4XS4 A;  3UMA A;  2H1A A;  2LNS A;  3GN3 A;  1ZL9 A;  1A8L A;  4CDO A;  2O89 A;  1JZR A;  2FUG 2;  1BAY A;  2I3Y A;  1Y6E A;  3E3E A;  2V6O A;  3HJO A;  4WBJ A;  1SD9 A;  1A0F A;  3GKN A;  3QD9 A;  4NPB A;  1GNE A;  3APQ A;  2WCI A;  3L9V A;  5AN1 A;  5BMU A;  2H73 A;  3HHV A;  4IJ3 A;  4I8B A;  1B4P A;  3FZ4 A;  3HCZ A;  4GQF A;  2I4A A;  1B4Q A;  3HD5 A;  3SBC A;  3TOU A;  3TCO A;  1K3O A;  3KGK A;  1S3D A;  3J7Y k;  4X1U A;  4MP4 A;  2P5Q A;  1FVK A;  3IK7 A;  1NHO A;  2JAD A;  1YKA A;  4JBB A;  1PD2 1;  4CHS A;  2CVK A;  5LCZ A;  2LRN A;  1VF4 A;  3HJM A;  1ERV A;  1GLQ A;  4IGJ A;  3Q74 A;  4N10 A;  1Z6M A;  2AUV A;  2A2S A;  2E7P A;  3IV4 A;  4HU7 A;  3G7J A;  4OO4 A;  5H5R A;  1J9B A;  1E2Y A;  3L0H A;  3KTB A;  1XZO A;  4ULX A;  11GS A;  2LQO A;  4PQI A;  3TKS A;  2PPT A;  4MPG A;  4E8E A;  1SL1 B;  3BJ5 A;  1Y25 A;  2NBS A;  3I9V 2;  3QAG A;  1G7O A;  1O8W A;  4HQZ A;  2QC7 A;  4HZ2 A;  3ZYW A;  1ZZY A;  4TR1 A;  5IOW A;  5CO3 A;  4WR4 A;  4LMW A;  3PGT A;  2MMA A;  4I97 A;  4CW9 A;  4HJM A;  2OA7 A;  4PXO A;  4CY6 A;  5IMC A;  5D8I A;  3IC4 A;  2Z9S A;  1OE7 A;  4ZL7 A;  5ECS A;  5KOW A;  5DAK A;  4O5Q A;  4D73 B;  3KD0 A;  3TB2 A;  3BBY A;  4IEL A;  3O3T A;  3TKP A;  3R2Q A;  4V2M A;  4KA0 A;  4HZ4 A;  4MLY A;  1M9B A;  2TRC P;  1EEM A;  2VCT A;  4K6X A;  2IMD A;  1ZYP A;  3VUR A;  3FZ5 A;  1MDI A;  4YKG A;  3C71 A;  2VOC A;  5ABR A;  4L5L A;  1ERU A;  5G1L A;  3MNG A;  1M2A A;  4PX1 A;  2CQ9 A;  2VCX A;  1EOH A;  4MZB A;  1Q4J A;  4EL1 A;  1XWC A;  2CZ2 A;  3C8E A;  4KSO A;  4TR4 A;  4POB A;  2VIM A;  2VL9 A;  1KEB A;  3FEU A;  4L0U A;  1K0B A;  1FAA A;  2I9H A;  2IJY A;  3C73 A;  2WB9 A;  1AQV A;  1ZYQ B;  2P5R A;  5HFK A;  2LRC A;  2C3Q A;  1OAZ A;  3F4T A;  3GYK A;  3DVW A;  1ZYN A;  5CRD A;  2ZCT A;  2LV3 A;  4WF5 A;  4KGI A;  2O85 A;  3ZIJ A;  3TKR A;  1YF0 A;  2QKE A;  1WOU A;  2HRK A;  2YOI A;  2LUS A;  1NM3 A;  4NAX A;  3IAS 2;  2D2Z A;  1WMJ A;  2HRA A;  2RII A;  1SK0 A;  2GSR A;  3I69 A;  3VWU A;  3RPP A;  1BYE A;  3RDW A;  5DJM A;  3VI7 A;  5F07 A;  2VL2 A;  4MJA A;  1AW9 A;  1M3I A;  3ME7 A;  3O6T A;  1VF3 A;  1ERT A;  3FR9 A;  3Q18 A;  3W8J A;  1PX7 A;  4KAE A;  2P31 A;  1PKZ A;  1SK2 A;  2TIR A;  3WGX A;  2DMM A;  3F0I A;  5IO0 A;  2H71 A;  3HJP A;  5ECL B;  4F0C A;  5IM9 A;  3LEF A;  1PL2 A;  2B1K A;  5C00 A;  4PUR A;  2HSY A;  4AJ8 A;  3WGE A;  2MMN A;  1K3Y A;  4YQU A;  3M0F A;  3VWV A;  2M46 A;  4GSN A;  4I2U A;  4BA7 A;  3LJR A;  2R4V A;  3BD2 A;  2C8U A;  3UVH A;  1KNG A;  4N0V A;  2QA2 A;  3KP9 A;  4IN0 A;  1A0R P;  3CQF A;  2YNX A;  2I1U A;  4BL7 A;  3FZA A;  4X0X A;  3ISO A;  2HI7 A;  4QL7 A;  4ZL8 A;  5IPG A;  5ELA A;  5AIV A;  1A2L A;  3BCI A;  2H75 A;  2VD1 A;  2OBI A;  3U5R E;  2JSZ A;  4PTS A;  1SKR B;  3UL3 A;  4IP6 A;  4X43 A;  5CAX A;  1F2E A;  1IYI A;  3KTL A;  4N11 A;  8GSS A;  4MZC A;  4POK A;  2VLV A;  3LSZ A;  3TJJ A;  1PRX A;  3QFB C;  1TK0 B;  3IRA A;  1CQH A;  1MD3 A;  2YZH A;  2GLR A;  1SL2 B;  3TKS C;  4WF4 A;  3MWH A;  4MJE A;  2F8F A;  6GSV A;  2OE1 A;  2JZT A;  4IP1 A;  2ALB A;  4F2I A;  2H0H A;  5JCG A;  4DSS B;  3NOF A;  3M3M A;  1GSY A;  5HQP A;  3KCM A;  2REM A;  2IFQ A;  1M9A A;  20GS A;  1DUG A;  4V2L A;  4GTU A;  3UAP A;  4AF2 A;  2VL3 A;  3LFL A;  1VF2 A;  1TKD B;  2DKH A;  3IA1 A;  2FWF A;  2KP2 A;  5JCU A;  2LEG A;  3HVS A;  5IMF A;  5DAL B;  3VK9 A;  2K6V A;  3WD6 A;  5GSS A;  1PGT A;  4EIQ A;  1SU9 A;  5JWQ B;  1PSQ A;  2RM5 A;  2G0F A;  5LD0 A;  1RK4 A;  3SWL A;  1YF1 A;  2H6X A;  1RQM A;  1XCC A;  1O8X A;  3F4R A;  3QFA C;  3DD3 A;  3LOR A;  4IQA A;  5DBQ A;  2K8V A;  1NSW A;  2GQM A;  5HFI A;  3TJK A;  2R0C A;  4CY8 A;  2CVB A;  2GTU A;  3QPM A;  3ME8 A;  5DCG A;  4OO5 A;  4G10 A;  1X5E A;  2GSQ A;  2H30 A;  2HRN A;  1W89 A;  5IPH A;  1AC1 A;  3AY8 A;  1T3B A;  3ED3 A;  2DIZ A;  3P90 A;  3CTF A;  2GQL A;  1Z3E A;  4BPY A;  2WJU A;  1PKW A;  1ZMA A;  1F3A A;  5DQS A;  2KHP A;  2YCD A;  3FHK A;  4I5Q A;  4BWQ A;  2MZC A;  2R6K A;  2X8C A;  4IW9 A;  2PGT A;  2H6Y A;  4L0W A;  4NHW A;  2HFD A;  4TXV A;  4JED A;  1GUL A;  1K0M A;  2LJR A;  2WZ9 A;  2DIY A;  5ECQ B;  4Q5F A;  3NZN A;  5GAN D;  3FZ9 A;  2PMT A;  3MDK A;  1Z7R A;  1SKW B;  4O5U A;  1DSB A;  2N5F A;  1M7T A;  4EKZ A;  4HJ2 A;  6GSS A;  5DCH A;  4ZXG A;  2L4C A;  2NVL A;  5G30 A;  3ZRE A;  2VCW A;  6GST A;  3F8U A;  4ML6 A;  1MDK A;  3HVX A;  4LL4 B;  2JZS A;  2DJ0 A;  1FHE A;  1EGO A;  1OYJ A;  1X5C A;  3IDV A;  2GGT A;  4XIH A;  2L59 A;  4MF7 A;  4PNG A;  2GS3 A;  5CRG A;  2L6D A;  4GRF A;  4OD7 A;  4EC0 A;  1GSS A;  2VL2 C;  1ON4 A;  4FO5 A;  1U3A A;  1JZD A;  4OWY A;  2GT5 A;  4ZBD A;  3RHC A;  4BVY A;  4ACS A;  3F6F A;  5INY A;  3C1R A;  3DKS A; 
#chains in the Genus database with same CATH homology
 2UZ8 A;  1WWJ A;  4MAB A;  1PMT A;  1M2B A;  4DSQ A;  1XWB A;  4YQV A;  1SJ6 A;  3GKM A;  2BMX A;  2LQQ A;  4G2E A;  2H1D A;  1ILO A;  3GKK A;  3A5W A;  2DLX A;  4RUV A;  1VF1 A;  4FYB A;  3A2X A;  3EU3 A;  3GTU A;  1Q98 A;  3L4N A;  2N5A A;  5D9T A;  1X9M B;  2F51 A;  2QGV A;  2MYG A;  2HZE A;  4MA9 A;  1IYH A;  2R0G A;  3TGZ A;  2IME A;  4XS1 A;  2VM1 A;  2YP6 A;  4HI7 A;  2G2Q A;  2OAD A;  5FWG A;  1B9Y C;  5G5E A;  4TOP A;  4EUY A;  1RW1 A;  4GQC A;  1BX9 A;  3GMF A;  4ZIL A;  1SK1 A;  1YJ6 A;  1TOF A;  1HNA A;  4ID0 A;  3UIW A;  1WJK A;  2C3T A;  16GS A;  1PL1 A;  1GUK A;  2LS5 A;  2EIR A;  3UVT A;  4IQ1 A;  3EPT A;  4NXI A;  2F3M A;  3F4S A;  18GS A;  3ZFB A;  2XBI A;  3PR8 A;  2YWO A;  3VWW A;  1HQO A;  4TXO A;  4F82 A;  3IAM 2;  1WP0 A;  3D6I A;  1GWC A;  1GSD A;  4JE1 A;  2YV7 A;  3HDC A;  1GTB A;  3VI5 A;  2YWM A;  3DVX A;  3GX0 A;  1H75 A;  2IIY A;  4Z7X A;  4POL A;  1SKS B;  4O32 A;  4PQ1 A;  4EVM A;  1XW6 A;  4LLR A;  3G7Y A;  4F03 A;  4WR5 A;  3GST A;  2VD0 A;  2H66 A;  19GS A;  5F0G A;  3QAW A;  5F06 A;  4IJI A;  3PIN A;  3GV1 A;  3TKQ A;  4POM A;  5A4U A;  2CV4 A;  4Q5R A;  4MJB A;  5IOX A;  2MBS A;  4JR6 A;  1TJD A;  1Z6N A;  1XW5 A;  3O76 A;  2H76 A;  3DXB A;  1TDI A;  9GSS A;  1FG4 A;  5EL8 A;  1U87 A;  1GSU A;  1ZOF A;  2NPB A;  1EZK A;  3D4M A;  1B48 A;  2L57 A;  3UEM A;  1SYR A;  2V32 A;  2PBJ A;  3DGQ A;  1GSE A;  2VCZ A;  2GSS A;  2CT6 A;  4GXZ A;  1O7U A;  1V57 A;  3FR6 A;  1R5P A;  4TKY A;  4OFT A;  3LGC A;  1TU8 A;  3MYD A;  3EIN A;  2PUK C;  4RI6 A;  3ZTL A;  5KN0 A;  5A4V A;  3KH7 A;  2RUE A;  4KSM A;  1XIY A;  2XPE A;  2CA8 A;  2FLS A;  5GAP D;  3L9S A;  5AIX A;  4G0L A;  3CYN A;  3ZL5 A;  4GSS A;  5GZZ B;  1XXU A;  2FA4 A;  1EV4 A;  4USS A;  4V1A g;  1UA5 A;  3EMX A;  2V6K A;  2X64 A;  2FY6 A;  4WKW A;  1EOG A;  1BG5 A;  2B1L A;  5ECP B;  4IHU A;  2B5X A;  4BVX B;  4GST A;  1VGL A;  4XRD A;  1S3C A;  2EIQ A;  1V2A A;  2HSH A;  3LG6 A;  2IN3 A;  4ECJ A;  1NHY A;  1FW1 A;  2O87 A;  5EY6 A;  3H93 A;  5LNK e;  1B8X A;  2AV4 A;  3F3Q A;  1JHB A;  2DSA A;  1LJR A;  1A2M A;  4ILF A;  1GUH A;  2DJ2 A;  1R26 A;  4Z2R A;  1OVN A;  4MH3 A;  5EPF A;  3EYT A;  5J9B A;  4IBP A;  4HQS A;  3ZRD A;  4ZB6 A;  4O7H A;  2WRT A;  12GS A;  1EV9 A;  1USB A;  4KCA A;  1X9W B;  4K0N A;  4OMV A;  2QSI A;  1JLV A;  4WXT A;  1AIU A;  2IWT A;  3H79 A;  4D73 A;  4GWR A;  1XW9 A;  3FY7 A;  1TTZ A;  1WRY A;  2A2R A;  4F9Z A;  1GL8 A;  2K9F A;  2WFC A;  2IFQ B;  1M0U A;  4XCS A;  4EDZ A;  3R3E A;  4ZIJ A;  1PN0 A;  2YZU A;  1SJI A;  5D93 A;  3ZFL A;  2CAQ A;  2DC5 A;  5DQY A;  3JCM L;  2ZUP A;  2C0D A;  1S3A A;  4J56 E;  1THO A;  3GL3 A;  4KE3 A;  2EIO A;  5IMA A;  3GH6 A;  3KXO A;  2K18 A;  2H0G A;  2YN1 A;  5B6M A;  2R3X A;  5H5S A;  3DML A;  2H19 A;  2X99 A;  4HUA A;  1X5D A;  2OAC A;  4IS0 A;  5ECI B;  4ZBA A;  5E59 A;  4DSR A;  4V2N A;  1FOV A;  2L5O A;  1GNW A;  5E4W A;  5BRT A;  1SJZ A;  3WGD A;  4KW6 A;  4MPF A;  3D21 A;  5A5K A;  4TN8 A;  2QA1 A;  4KCE A;  3APO A;  5ID2 A;  4NHZ A;  3EU4 A;  4O92 A;  3M9J A;  2X49 A;  2RLI A;  3EVI A;  2LKU A;  1K0D A;  3A2W A;  4QQ7 A;  4KDU A;  3TJB A;  1TRU A;  4ZL9 A;  2HT9 A;  2HNL A;  3QOU A;  4HU9 A;  3GX8 A;  3M8N A;  3H4K A;  4GLT A;  5IMV A;  4YH2 A;  4JU5 A;  3HXS A;  1T4Y A;  1O81 A;  1THX A;  2ON7 A;  2JL4 A;  2GVP A;  3FMW A;  2PER A;  1YEP A;  3DRN A;  2GT6 A;  2X4A A;  3VFI A;  1PX6 A;  3H1N A;  5J4U A;  2B6M A;  3CMI A;  4IKH A;  3L78 A;  4OFM A;  3CBU A;  4HOJ A;  1LU4 A;  2FGX A;  2CVD A;  2KP1 A;  3DWV A;  3IR4 A;  4XS6 A;  3WYW A;  4KUN A;  2O8V B;  1T7P B;  5G1K A;  3P8W A;  5J9C A;  1G6W A;  1UC7 A;  3DYR A;  6GSY A;  4ECB A;  4OCF A;  3FKF A;  6GSW A;  4MK3 A;  4N30 A;  2H8L A;  1HD2 A;  2KOK A;  1ABA A;  2B3S A;  1KTE A;  1HNC A;  1T4Z A;  3M9K A;  4ZBB A;  5ECN B;  4KX4 A;  2IL3 A;  1QK8 A;  1OKD A;  4JZQ A;  5HFG A;  3I6A A;  3MIX A;  2GST A;  5JCW A;  3KZQ A;  2FCH A;  3HKR A;  3ZVJ A;  4XS4 B;  5ECM B;  3IXR A;  3TKS E;  3CSJ A;  1QFN A;  4GF0 A;  4FQU A;  3IHQ A;  1NW2 A;  3HZ8 A;  2VCV A;  1N8J A;  4XRA A;  4K7N A;  3GTU B;  1YDK A;  2ES7 A;  1K0C A;  3HZ4 A;  4NV5 A;  5DDL A;  1FOH A;  6GSX A;  5DJL A;  4K7O A;  2HZF A;  1Z9H A;  1V9W A;  3MSZ A;  2CX4 A;  2HZE B;  1DE1 A;  3GRX A;  5CRH A;  1SYX A;  2I81 A;  4PNF A;  1VRS D;  5KN1 A;  1UN2 A;  3IC8 A;  5DVB A;  5FHI A;  4JR4 A;  4V1A p;  2HXK A;  3HYP A;  2WDU A;  3RHB A;  5HR2 A;  3WT2 A;  2MMZ A;  4FYU A;  3GH9 A;  1FO5 A;  5CYY A;  4WEY A;  2DBC A;  1K0A A;  1F37 A;  5HR0 A;  2PVO C;  2DJK A;  5CRE A;  3LYP A;  4WBR D;  2PWJ A;  4KDY A;  2E2M A;  3RPN A;  1BED A;  2VLU A;  2C3N A;  3F63 A;  2C80 A;  4TXO B;  5D9W A;  2KUC A;  1AQX A;  1MTC A;  3BOA A;  5DAL A;  3RAZ A;  1SL0 B;  1WIK A;  1GRX A;  3VPQ A;  5AGY A;  4FIW A;  2RM6 A;  3GA4 A;  4ZB8 A;  3V1W A;  3IBH A;  4K7I A;  4MNN A;  4NMU A;  4HS1 A;  1TK8 B;  2F9S A;  1FVJ A;  4FYC A;  4AGS A;  3N9J A;  4TR1 B;  3QDN A;  4RI7 A;  2B7J A;  5C04 A;  3IPZ A;  1J0F A;  4NV2 A;  1ZYE A;  3GNJ A;  1A2J A;  3KM6 A;  1ZGN A;  2AAW A;  17GS A;  1ZCP A;  3FYG A;  3G7I A;  3VPT A;  3K8N A;  4G0K A;  1F9M A;  3EWL A;  5DAK B;  1EP7 A;  5KN3 A;  1C72 A;  5KEJ A;  5KN2 A;  5D73 A;  4P3Y B;  1I5G A;  3CXG A;  3VLN A;  3DIE A;  1U6T A;  2H74 A;  1GTU A;  1URM A;  14GS A;  4L8E A;  1R5A A;  2PU9 C;  1OC9 A;  2R0P A;  2LTK A;  3ERW A;  3GKX A;  1GUM A;  4FH8 A;  2F8A A;  1TP9 A;  1K0O A;  3A2V A;  2V41 A;  1YQ1 A;  4LA1 A;  1X9S B;  4E8H A;  5ELG A;  4KND A;  2RUF A;  4G9H A;  2AHE A;  2IMK A;  1A8Y A;  4DVC A;  1TRV A;  3APS A;  2EC4 A;  2B5Y A;  4J2F A;  3CTG A;  5G31 A;  1YKC A;  1T00 A;  1AAZ A;  13GS A;  4MCU A;  1SEN A;  3TUE A;  1JLW A;  2JU5 A;  3TDG A;  4AJ7 A;  2PN8 A;  2YPM A;  3ERG A;  4PQH A;  1DBY A;  2LJK A;  1TW9 A;  2H1B A;  2A4V A;  1V98 A;  3KIJ A;  3KP8 A;  3ZVJ D;  4K5R A;  4EIP A;  5IMZ A;  1QXH A;  4HDE A;  3H8Q A;  2YJ7 A;  3QMX A;  4J57 E;  4DEJ A;  3MAK A;  3S9F A;  3F9U A;  4K9Z A;  4H86 A;  2MMO A;  1LBK A;  2LST A;  5IQY A;  1GH2 A;  1XVW A;  1CQG A;  3PH9 A;  1XOA A;  3LWA A;  2NDO A;  2DML A;  2P0G A;  3LQ7 A;  1F3B A;  1TK5 B;  4K5S A;  2FA8 A;  4ML1 A;  4TVE A;  10GS A;  2E0Q A;  3ZZX A;  4MZW A;  2IMF A;  1WE0 A;  4F0B A;  1BQ7 A;  3CSI A;  3NIV A;  5FT3 A;  4KF9 A;  3CRU A;  2BJX A;  4G19 A;  1GLP A;  1MDJ A;  3GHA A;  2FWE A;  5ECO B;  4YAV A;  3TRX A;  2NTO A;  4QL9 A;  2V1M A;  5JWR B;  2YJH A;  4MF5 A;  2JAC A;  4L5O A;  4OFN A;  2H70 A;  4O5R A;  3M1G A;  4Q5Q A;  4I6X A;  4MJC A;  4A5P A;  22GS A;  1YZX A;  5B6N A;  3GL5 A;  3IE3 A;  3EUR A;  1T1V A;  2HLS A;  4K8M A;  5D96 A;  2R5G A;  3IK9 A;  2YWI A;  1N2A A;  1EP8 A;  4BL7 B;  5B8B A;  3GUS A;  1U88 A;  5GST A;  4G0I A;  4MF6 A;  5ID2 B;  4HEA 2;  4GCI A;  4EO3 A;  2H0I A;  2VM2 A;  5COH A;  5IIZ A;  1E6B A;  1WPI A;  2FNO A;  1K3L A;  1TI1 A;  3N5O A;  2GZY A;  1QMV A;  2ZNM A;  2XBQ A;  4TW5 A;  2OJL A;  1R7H A;  2C1Y A;  2DJJ A;  1XVQ A;  3TJG A;  2FHE A;  3HY2 A;  5ENU A;  3CRT A;  1UVZ A;  3US3 A;  1AUC A;  1ML6 A;  4LL1 B;  4ICY A;  4WET A;  2CZ3 A;  1OC3 A;  2AJQ B;  4EXJ A;  1G7E A;  4KH7 A;  2DJ1 A;  5ECR B;  1SD8 A;  5HR3 A;  1ACV A;  2YAN A;  1ERW A;  3KEB A;  3ZIV A;  2L6C A;  3GSS A;  2J23 A;  3TJF A;  3W8S A;  4MMM A;  3G9B A;  3D5J A;  2B7K A;  3ZLP A;  4MH2 A;  2OE3 A;  5HR1 A;  4KDX A;  4LMV A;  2IMI A;  2DJ3 A;  3UBL A;  2YV9 A;  5D9X A;  5D9V A;  2AYT A;  2J9H A;  2XC2 A;  1PN9 A;  4TRX A;  5ECH B;  4Z2T A;  1GTI A;  2GZP A;  1A23 A;  2C0E A;  2E2G A;  3DEX A;  5J41 A;  4RQX A;  2BTO T;  2R37 A;  2VAF A;  4BVX A;  5B7C A;  4K2D A;  1JZO A;  3OR5 A;  4TR3 A;  4NWY A;  5CNW A;  3Q19 A;  1AXD A;  5ECK B;  2HYX A;  3UBK A;  1K0N A;  4ECC A;  4RQR A;  3RBT A;  5JWO B;  5CRW A;  3EMP A;  3EE2 A;  2MBT A;  1M99 A;  2H01 A;  2GDR A;  2M80 A;  4IVF A;  1H4O A;  1OKT A;  1O6J A;  2KLX A;  3FRC A;  3J7Y b;  4K1F A;  1EEJ A;  1V58 A;  5G2Z A;  4XTS A;  3IOS A;  1Z7P A;  7GSS A;  1DE2 A;  2WUL A;  4PUF C;  5IMD A;  4K2X A;  6GSU A;  1QUW A;  1GTA A;  4I2T A;  2FWG A;  2HRF A;  2FD3 A;  3E0U A;  1O73 A;  1XWG A;  2VUP A;  4BWS A;  1HNB A;  2M72 A;  1Z5Y E;  3Q6O A;  3P2A A;  2AB6 A;  5B8A A;  3TOT A;  5G5F A;  4YQM A;  1XFL A;  1TXX A;  1AQW A;  2OE0 A;  2V2G A;  3D0Z A;  2OBK A;  3UOM A;  2HSM A;  3ZMK A;  4Z2U A;  2ON5 A;  3KJY A;  3L9U A;  3C1S A;  2YWN A;  4MDC A;  3FR3 A;  3D22 A;  3TRP A;  1B9X C;  1PA3 A;  1MD4 A;  3VWX A;  1MEK A;  5AIS A;  4AJ6 A;  2A4H A;  2C0F A;  2GQK A;  3P7X A;  2H1G A;  3QCP A;  1OE8 A;  1TRS A;  4X4J A;  5L71 A;  4K0G A;  4BVY B;  3FW2 A;  1TI3 A;  1JZW A;  2O7K A;  2XPD A;  4YKF A;  2L4Q A;  2GZZ A;  3GUR A;  2L5L A;  4OCE A;  3C7M A;  2PVQ A;  1F6M C;  3KMN A;  1J08 A;  3I43 A;  3QR6 A;  3EC3 A;  5J3R A;  3CSH A;  1GSQ A;  4TR0 A;  4EE0 A;  5IO2 A;  1PQN A;  2JSY A;  2OKA A;  3GIX A;  3TRQ A;  2VCQ A;  1TRW A;  1XPV A;  2LJA A;  2N5B A;  1XOB A;  2IPA A;  4N0Z A;  1TU7 A;  5F05 A;  3A5I A;  2K8S A;  2HE3 A;  2CAI A;  2WGR A;  4PGT A;  1G6Y A;  4EDY A;  1U3I A;  3QAV A;  5J5N A;  5EVO A;  1OC9 B;  3PPU A;  1HYU A;  1V40 A;  3D4T A;  1A24 A;  2LNT A;  2LRT A;  1EGR A;  2VO4 A;  1I9D A;  4XHM A;  2H6Z A;  3GFK A;  1QQ2 A;  1KBN A;  2A2P A;  2X8H A;  3ERF A;  4PUA A;  5CP1 A;  3HA9 A;  1ST9 A;  4DSS A;  1R4W A;  1XWK A;  3HVV A;  4ISD A;  3LXZ A;  2B5E A;  3KH9 A;  3F3R A;  3ZML A;  3ZIT A;  3F6D A;  4ZB9 A;  3E9J B;  4YAP A;  3IHG A;  1XBS A;  5A4W A;  1O85 A;  4EF0 A;  1OC8 A;  2CX3 A;  5KOX A;  3WT1 A;  3A3T A;  1W4V A;  3BCK A;  4KB3 A;  3LXT A;  1X0R A;  3FK8 A;  3LW9 A;  1FB0 A;  1M2D A;  1YEX A;  3UAR A;  1YY7 A;  1JFU A;  1GSF A;  1EWX A;  2C4J A;  4Q5N A;  2WS2 A;  1T8E B;  4ECI A;  3KMO A;  2DKI A;  3UJ1 A;  1FB6 A;  2TRX A;  2H72 A;  2R2J A;  1QGV A;  2FWH A;  4JRR A;  3U6V A;  5F8B A;  2X8G A;  2C0G A;  2VLT A;  1G0T A;  2XHF A;  2JZR A;  1BJX A;  3W6G A;  5H5Q A;  1XWA A;  1GP1 A;  3LYK A;  4XS4 A;  3UMA A;  2H1A A;  2LNS A;  3GN3 A;  1ZL9 A;  1A8L A;  4CDO A;  2O89 A;  1JZR A;  2FUG 2;  1BAY A;  2I3Y A;  1Y6E A;  3E3E A;  2V6O A;  3HJO A;  4WBJ A;  1SD9 A;  1A0F A;  3GKN A;  3QD9 A;  4NPB A;  1GNE A;  3APQ A;  2WCI A;  3L9V A;  5AN1 A;  5BMU A;  2H73 A;  3HHV A;  4IJ3 A;  4I8B A;  1B4P A;  3FZ4 A;  3HCZ A;  4GQF A;  2I4A A;  1B4Q A;  3HD5 A;  3SBC A;  3TOU A;  3TCO A;  1K3O A;  3KGK A;  1S3D A;  3J7Y k;  4X1U A;  4MP4 A;  2P5Q A;  1FVK A;  3IK7 A;  1NHO A;  2JAD A;  1YKA A;  4JBB A;  1PD2 1;  4CHS A;  2CVK A;  5LCZ A;  2LRN A;  1VF4 A;  3HJM A;  1ERV A;  1GLQ A;  4IGJ A;  3Q74 A;  4N10 A;  1Z6M A;  2AUV A;  2A2S A;  2E7P A;  3IV4 A;  4HU7 A;  3G7J A;  4OO4 A;  5H5R A;  1J9B A;  1E2Y A;  3L0H A;  3KTB A;  1XZO A;  4ULX A;  11GS A;  2LQO A;  4PQI A;  3TKS A;  2PPT A;  4MPG A;  4E8E A;  1SL1 B;  3BJ5 A;  1Y25 A;  2NBS A;  3I9V 2;  3QAG A;  1G7O A;  1O8W A;  4HQZ A;  2QC7 A;  4HZ2 A;  3ZYW A;  1ZZY A;  4TR1 A;  5IOW A;  5CO3 A;  4WR4 A;  4LMW A;  3PGT A;  2MMA A;  4I97 A;  4CW9 A;  4HJM A;  2OA7 A;  4PXO A;  4CY6 A;  5IMC A;  5D8I A;  3IC4 A;  2Z9S A;  1OE7 A;  4ZL7 A;  5ECS A;  5KOW A;  5DAK A;  4O5Q A;  4D73 B;  3KD0 A;  3TB2 A;  3BBY A;  4IEL A;  3O3T A;  3TKP A;  3R2Q A;  4V2M A;  4KA0 A;  4HZ4 A;  4MLY A;  1M9B A;  2TRC P;  1EEM A;  2VCT A;  4K6X A;  2IMD A;  1ZYP A;  3VUR A;  3FZ5 A;  1MDI A;  4YKG A;  3C71 A;  2VOC A;  5ABR A;  4L5L A;  1ERU A;  5G1L A;  3MNG A;  1M2A A;  4PX1 A;  2CQ9 A;  2VCX A;  1EOH A;  4MZB A;  1Q4J A;  4EL1 A;  1XWC A;  2CZ2 A;  3C8E A;  4KSO A;  4TR4 A;  4POB A;  2VIM A;  2VL9 A;  1KEB A;  3FEU A;  4L0U A;  1K0B A;  1FAA A;  2I9H A;  2IJY A;  3C73 A;  2WB9 A;  1AQV A;  1ZYQ B;  2P5R A;  5HFK A;  2LRC A;  2C3Q A;  1OAZ A;  3F4T A;  3GYK A;  3DVW A;  1ZYN A;  5CRD A;  2ZCT A;  2LV3 A;  4WF5 A;  4KGI A;  2O85 A;  3ZIJ A;  3TKR A;  1YF0 A;  2QKE A;  1WOU A;  2HRK A;  2YOI A;  2LUS A;  1NM3 A;  4NAX A;  3IAS 2;  2D2Z A;  1WMJ A;  2HRA A;  2RII A;  1SK0 A;  2GSR A;  3I69 A;  3VWU A;  3RPP A;  1BYE A;  3RDW A;  5DJM A;  3VI7 A;  5F07 A;  2VL2 A;  4MJA A;  1AW9 A;  3ME7 A;  3O6T A;  1VF3 A;  1ERT A;  3FR9 A;  3Q18 A;  3W8J A;  1PX7 A;  4KAE A;  2P31 A;  1PKZ A;  1SK2 A;  2TIR A;  3WGX A;  2DMM A;  3F0I A;  5IO0 A;  2H71 A;  3HJP A;  5ECL B;  4F0C A;  5IM9 A;  3LEF A;  1PL2 A;  2B1K A;  5C00 A;  4PUR A;  2HSY A;  4AJ8 A;  3WGE A;  2MMN A;  1K3Y A;  4YQU A;  3M0F A;  3VWV A;  2M46 A;  4GSN A;  4I2U A;  4BA7 A;  3LJR A;  2R4V A;  3BD2 A;  2C8U A;  3UVH A;  1KNG A;  4N0V A;  2QA2 A;  3KP9 A;  4IN0 A;  1A0R P;  2YNX A;  2I1U A;  4BL7 A;  3FZA A;  4X0X A;  3ISO A;  2HI7 A;  4QL7 A;  4ZL8 A;  5IPG A;  5ELA A;  5AIV A;  1A2L A;  3BCI A;  2H75 A;  2VD1 A;  2OBI A;  3U5R E;  2JSZ A;  4PTS A;  1SKR B;  3UL3 A;  4IP6 A;  4X43 A;  5CAX A;  1F2E A;  1IYI A;  3KTL A;  4N11 A;  8GSS A;  4MZC A;  4POK A;  2VLV A;  3LSZ A;  3TJJ A;  1PRX A;  3QFB C;  1TK0 B;  3IRA A;  1CQH A;  1MD3 A;  2YZH A;  2GLR A;  1SL2 B;  3TKS C;  4WF4 A;  3MWH A;  4MJE A;  2F8F A;  6GSV A;  2OE1 A;  2JZT A;  4IP1 A;  2ALB A;  4F2I A;  2H0H A;  5JCG A;  4DSS B;  3NOF A;  3M3M A;  1GSY A;  5HQP A;  3KCM A;  2REM A;  2IFQ A;  1M9A A;  20GS A;  1DUG A;  4V2L A;  4GTU A;  3UAP A;  4AF2 A;  2VL3 A;  3LFL A;  1VF2 A;  1TKD B;  2DKH A;  3IA1 A;  2FWF A;  2KP2 A;  5JCU A;  2LEG A;  3HVS A;  5IMF A;  5DAL B;  3VK9 A;  2K6V A;  3WD6 A;  5GSS A;  1PGT A;  4EIQ A;  1SU9 A;  5JWQ B;  1PSQ A;  2RM5 A;  2G0F A;  5LD0 A;  1RK4 A;  3SWL A;  1YF1 A;  2H6X A;  1RQM A;  1XCC A;  1O8X A;  3F4R A;  3QFA C;  3DD3 A;  3LOR A;  4IQA A;  5DBQ A;  2K8V A;  1NSW A;  2GQM A;  5HFI A;  3TJK A;  2R0C A;  4CY8 A;  2CVB A;  2GTU A;  3QPM A;  3ME8 A;  5DCG A;  4OO5 A;  4G10 A;  1X5E A;  2GSQ A;  2H30 A;  2HRN A;  1W89 A;  5IPH A;  1AC1 A;  3AY8 A;  1T3B A;  3ED3 A;  2DIZ A;  3P90 A;  3CTF A;  2GQL A;  1Z3E A;  4BPY A;  2WJU A;  1PKW A;  1ZMA A;  1F3A A;  5DQS A;  2KHP A;  2YCD A;  3FHK A;  4I5Q A;  4BWQ A;  2MZC A;  2R6K A;  2X8C A;  4IW9 A;  2PGT A;  2H6Y A;  4L0W A;  4NHW A;  2HFD A;  4TXV A;  4JED A;  1GUL A;  1K0M A;  2LJR A;  2WZ9 A;  2DIY A;  5ECQ B;  4Q5F A;  3NZN A;  5GAN D;  3FZ9 A;  2PMT A;  3MDK A;  1Z7R A;  1SKW B;  4O5U A;  1DSB A;  2N5F A;  1M7T A;  4EKZ A;  4HJ2 A;  6GSS A;  5DCH A;  4ZXG A;  2L4C A;  2NVL A;  5G30 A;  3ZRE A;  2VCW A;  6GST A;  3F8U A;  4ML6 A;  1MDK A;  3HVX A;  4LL4 B;  2JZS A;  2DJ0 A;  1FHE A;  1EGO A;  1OYJ A;  1X5C A;  3IDV A;  2GGT A;  4XIH A;  2L59 A;  4MF7 A;  4PNG A;  2GS3 A;  5CRG A;  2L6D A;  4GRF A;  4OD7 A;  4EC0 A;  1GSS A;  2VL2 C;  1ON4 A;  4FO5 A;  1U3A A;  1JZD A;  4OWY A;  2GT5 A;  4ZBD A;  3RHC A;  4BVY A;  4ACS A;  3F6F A;  5INY A;  3C1R A;  3DKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...