1FADA

Death domain of fas-associated death domain protein, residues 89-183
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
95
Chain Sequence
AAPPGEAYLQVAFDIVCDNVGRDWKRLARELKVSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEAQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of FADD death domain. Structural basis of death domain interactions of Fas and FADD.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
molecule keywords PROTEIN (FADD PROTEIN)
total genus 30
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1fadA00
1WXPA 2N7ZA 2L6AA 2IB1A 4O9FA 2LS7A 3EZQA 2MPCA 3LQQA 4O9LA 2MB9A 4E9MA 2HM2Q 2BBRA 2OF5H 4JQWA 1A1WA 1D2ZB 3LQRA 2L9MA 2KM6A 1Z6TA 3MOPG 2F1SA 4JUPA 4F44A 4O6XA 1E3YA 2LWEA 3KATA 2MN4A 4NQKA 1ICHA 2NAQA 2A5YB 4EWIA 3EZQB 1NGRA 1DGNA 4M9ZA 2MS7A 4A2QA 2N80A 3CL3A 2N1FA 2DBDA 3CRDA 4QOBA 2NZ7A 2VGQA 4N1JA 2MS8A 4A2WA 2YU0A 2A9IA 2DBFA 4M9XA 1A1ZA 4UZ0A 2G7RA 4IZ5E 3MOPA 3YGSC 1WMGA 2M5VA 2YVIA 2N97A 4RHWA 4LWDA 4P4HI 3J6JA 1E41A 4F42A 1DDFA 1YGOA 1D2ZA 4N1LA 4O7QA 3MOPK 2OF5A 1FADA 4ZBWA 2N00A 2B1WA 4I16A 4RHWE 4P4HA 2LWDA 2DBGA 3T6PA 4N1KA 3J63A 2BBZA 1WH4A 4D8OA 2NSNA 2YGSA 2DBHA 2DO9A 4IZAB 2O71A 1CY5A 4DWNA 4M9SA 3YGSP 2GF5A 1UCPA 4FH0A 2P1HA 1PN5A 3QF2A 2N83A 1N3KA 2D96A 1CWWA 2YQFA 2KN6A 1C15A 4IZ7B
chains in the Genus database with same CATH superfamily
1WXPA 2N7ZA 2L6AA 2IB1A 4O9FA 2LS7A 2XV9A 3EZQA 2MPCA 3LQQA 4O9LA 2MB9A 4E9MA 2HM2Q 2BBRA 2OF5H 4JQWA 1A1WA 1D2ZB 3LQRA 2L9MA 2KM6A 1Z6TA 3MOPG 2F1SA 4JUPA 4F44A 4O6XA 1E3YA 2LWEA 3KATA 2MN4A 4NQKA 1ICHA 2NAQA 2A5YB 4EWIA 3EZQB 1NGRA 1DGNA 4M9ZA 2MS7A 4A2QA 2N80A 3CL3A 2N1FA 2DBDA 3CRDA 4QOBA 2NZ7A 2VGQA 4N1JA 2MS8A 4A2WA 2YU0A 2A9IA 2DBFA 4M9XA 1A1ZA 4UZ0A 2G7RA 4IZ5E 3MOPA 3YGSC 1WMGA 2M5VA 2YVIA 2N97A 4RHWA 4LWDA 4P4HI 3J6JA 1E41A 4F42A 1DDFA 1YGOA 1D2ZA 4N1LA 4O7QA 3MOPK 2OF5A 1FADA 4ZBWA 2N00A 2B1WA 4I16A 4RHWE 4P4HA 2LWDA 2DBGA 3T6PA 4N1KA 3J63A 2BBZA 1WH4A 4D8OA 2NSNA 2YGSA 2DBHA 2DO9A 4IZAB 2O71A 1CY5A 4DWNA 4M9SA 3YGSP 2GF5A 1UCPA 4FH0A 2P1HA 1PN5A 3QF2A 2N83A 2MJMA 1N3KA 2D96A 1CWWA 2YQFA 2KN6A 1C15A 4IZ7B
chains in the Genus database with same CATH topology
1WXPA 2N7ZA 2L6AA 2IB1A 4O9FA 2LS7A 2XV9A 3EZQA 2MPCA 3LQQA 4O9LA 2MB9A 4E9MA 2HM2Q 2BBRA 2OF5H 4JQWA 1A1WA 1D2ZB 3LQRA 2L9MA 2KM6A 1Z6TA 3MOPG 2F1SA 4JUPA 4F44A 4O6XA 1E3YA 2LWEA 3KATA 2MN4A 4NQKA 1ICHA 2NAQA 2A5YB 4EWIA 3EZQB 1NGRA 1DGNA 4M9ZA 2MS7A 4A2QA 2N80A 3CL3A 2N1FA 2DBDA 3CRDA 4QOBA 2NZ7A 2VGQA 4N1JA 2MS8A 4A2WA 2YU0A 2A9IA 2DBFA 4M9XA 1A1ZA 4UZ0A 2G7RA 4IZ5E 3MOPA 3YGSC 1WMGA 2M5VA 2YVIA 2N97A 4RHWA 4LWDA 4P4HI 3J6JA 1E41A 4F42A 1DDFA 1YGOA 1D2ZA 4N1LA 4O7QA 3MOPK 2OF5A 1FADA 4ZBWA 2N00A 2B1WA 4I16A 4RHWE 4P4HA 2LWDA 2DBGA 3T6PA 4N1KA 3J63A 2BBZA 1WH4A 4D8OA 2NSNA 2YGSA 2DBHA 2DO9A 4IZAB 2O71A 1CY5A 4DWNA 4M9SA 3YGSP 2GF5A 1UCPA 4FH0A 2P1HA 1PN5A 3QF2A 2N83A 2MJMA 1N3KA 2D96A 1CWWA 2YQFA 2KN6A 1C15A 4IZ7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXP A;  2N7Z A;  2L6A A;  2IB1 A;  4O9F A;  2LS7 A;  3EZQ A;  2MPC A;  3LQQ A;  4O9L A;  2MB9 A;  4E9M A;  2HM2 Q;  2BBR A;  2OF5 H;  4JQW A;  1A1W A;  1D2Z B;  3LQR A;  2L9M A;  2KM6 A;  1Z6T A;  3MOP G;  2F1S A;  4JUP A;  4F44 A;  4O6X A;  1E3Y A;  2LWE A;  3KAT A;  2MN4 A;  4NQK A;  1ICH A;  2NAQ A;  2A5Y B;  4EWI A;  3EZQ B;  1NGR A;  1DGN A;  4M9Z A;  2MS7 A;  4A2Q A;  2N80 A;  3CL3 A;  2N1F A;  2DBD A;  3CRD A;  4QOB A;  2NZ7 A;  2VGQ A;  4N1J A;  2MS8 A;  4A2W A;  2YU0 A;  2A9I A;  2DBF A;  4M9X A;  1A1Z A;  4UZ0 A;  2G7R A;  4IZ5 E;  3MOP A;  3YGS C;  1WMG A;  2M5V A;  2YVI A;  2N97 A;  4RHW A;  4LWD A;  4P4H I;  3J6J A;  1E41 A;  4F42 A;  1DDF A;  1YGO A;  1D2Z A;  4N1L A;  4O7Q A;  3MOP K;  2OF5 A;  1FAD A;  4ZBW A;  2N00 A;  2B1W A;  4I16 A;  4RHW E;  4P4H A;  2LWD A;  2DBG A;  3T6P A;  4N1K A;  3J63 A;  2BBZ A;  1WH4 A;  4D8O A;  2NSN A;  2YGS A;  2DBH A;  2DO9 A;  4IZA B;  2O71 A;  1CY5 A;  4DWN A;  4M9S A;  3YGS P;  2GF5 A;  1UCP A;  4FH0 A;  2P1H A;  1PN5 A;  3QF2 A;  2N83 A;  1N3K A;  2D96 A;  1CWW A;  2YQF A;  2KN6 A;  1C15 A;  4IZ7 B; 
#chains in the Genus database with same CATH topology
 1WXP A;  2N7Z A;  2L6A A;  2IB1 A;  4O9F A;  2LS7 A;  2XV9 A;  3EZQ A;  2MPC A;  3LQQ A;  4O9L A;  2MB9 A;  4E9M A;  2HM2 Q;  2BBR A;  2OF5 H;  4JQW A;  1A1W A;  1D2Z B;  3LQR A;  2L9M A;  2KM6 A;  1Z6T A;  3MOP G;  2F1S A;  4JUP A;  4F44 A;  4O6X A;  1E3Y A;  2LWE A;  3KAT A;  2MN4 A;  4NQK A;  1ICH A;  2NAQ A;  2A5Y B;  4EWI A;  3EZQ B;  1NGR A;  1DGN A;  4M9Z A;  2MS7 A;  4A2Q A;  2N80 A;  3CL3 A;  2N1F A;  2DBD A;  3CRD A;  4QOB A;  2NZ7 A;  2VGQ A;  4N1J A;  2MS8 A;  4A2W A;  2YU0 A;  2A9I A;  2DBF A;  4M9X A;  1A1Z A;  4UZ0 A;  2G7R A;  4IZ5 E;  3MOP A;  3YGS C;  1WMG A;  2M5V A;  2YVI A;  2N97 A;  4RHW A;  4LWD A;  4P4H I;  3J6J A;  1E41 A;  4F42 A;  1DDF A;  1YGO A;  1D2Z A;  4N1L A;  4O7Q A;  3MOP K;  2OF5 A;  1FAD A;  4ZBW A;  2N00 A;  2B1W A;  4I16 A;  4RHW E;  4P4H A;  2LWD A;  2DBG A;  3T6P A;  4N1K A;  3J63 A;  2BBZ A;  1WH4 A;  4D8O A;  2NSN A;  2YGS A;  2DBH A;  2DO9 A;  4IZA B;  2O71 A;  1CY5 A;  4DWN A;  4M9S A;  3YGS P;  2GF5 A;  1UCP A;  4FH0 A;  2P1H A;  1PN5 A;  3QF2 A;  2N83 A;  2MJM A;  1N3K A;  2D96 A;  1CWW A;  2YQF A;  2KN6 A;  1C15 A;  4IZ7 B; 
#chains in the Genus database with same CATH homology
 1WXP A;  2N7Z A;  2L6A A;  2IB1 A;  4O9F A;  2LS7 A;  2XV9 A;  3EZQ A;  2MPC A;  3LQQ A;  4O9L A;  2MB9 A;  4E9M A;  2HM2 Q;  2BBR A;  2OF5 H;  4JQW A;  1A1W A;  1D2Z B;  3LQR A;  2L9M A;  2KM6 A;  1Z6T A;  3MOP G;  2F1S A;  4JUP A;  4F44 A;  4O6X A;  1E3Y A;  2LWE A;  3KAT A;  2MN4 A;  4NQK A;  1ICH A;  2NAQ A;  2A5Y B;  4EWI A;  3EZQ B;  1NGR A;  1DGN A;  4M9Z A;  2MS7 A;  4A2Q A;  2N80 A;  3CL3 A;  2N1F A;  2DBD A;  3CRD A;  4QOB A;  2NZ7 A;  2VGQ A;  4N1J A;  2MS8 A;  4A2W A;  2YU0 A;  2A9I A;  2DBF A;  4M9X A;  1A1Z A;  4UZ0 A;  2G7R A;  4IZ5 E;  3MOP A;  3YGS C;  1WMG A;  2M5V A;  2YVI A;  2N97 A;  4RHW A;  4LWD A;  4P4H I;  3J6J A;  1E41 A;  4F42 A;  1DDF A;  1YGO A;  1D2Z A;  4N1L A;  4O7Q A;  3MOP K;  2OF5 A;  1FAD A;  4ZBW A;  2N00 A;  2B1W A;  4I16 A;  4RHW E;  4P4H A;  2LWD A;  2DBG A;  3T6P A;  4N1K A;  3J63 A;  2BBZ A;  1WH4 A;  4D8O A;  2NSN A;  2YGS A;  2DBH A;  2DO9 A;  4IZA B;  2O71 A;  1CY5 A;  4DWN A;  4M9S A;  3YGS P;  2GF5 A;  1UCP A;  4FH0 A;  2P1H A;  1PN5 A;  3QF2 A;  2N83 A;  2MJM A;  1N3K A;  2D96 A;  1CWW A;  2YQF A;  2KN6 A;  1C15 A;  4IZ7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...