1FADA

Death domain of fas-associated death domain protein, residues 89-183
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
95
Chain Sequence
AAPPGEAYLQVAFDIVCDNVGRDWKRLARELKVSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEAQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of FADD death domain. Structural basis of death domain interactions of Fas and FADD.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
molecule keywords PROTEIN (FADD PROTEIN)
total genus 30
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1fadA00
4JUPA 4M9SA 4IZ5E 3EZQA 4FH0A 4E9MA 1D2ZB 4O9LA 4N1JA 2O71A 4F42A 2NAQA 3MOPG 1A1ZA 4ZBWA 3YGSC 4RHWE 2M5VA 2B1WA 2D96A 2BBRA 2GF5A 2MPCA 2MN4A 2G7RA 3QF2A 1A1WA 2YVIA 1NGRA 3YGSP 3CL3A 4A2WA 3CRDA 4O9FA 4M9ZA 2OF5H 1FADA 1ICHA 1C15A 1WXPA 1WH4A 3J6JA 2N1FA 2L6AA 3T6PA 2LWEA 4QOBA 1CY5A 2P1HA 4EWIA 3MOPK 2VGQA 4RHWA 4A2QA 1DDFA 2N97A 3LQRA 2DBDA 2L9MA 2F1SA 3J63A 2YU0A 4UZ0A 4IZ7B 4M9XA 4NQKA 3KATA 2N00A 2N80A 2MS7A 4D8OA 1WMGA 4JQWA 2DBFA 2DBHA 4DWNA 1PN5A 2NSNA 2NZ7A 2DO9A 4F44A 3MOPA 2N83A 1Z6TA 4LWDA 1DGNA 2A9IA 2LS7A 4O6XA 2KN6A 2BBZA 2IB1A 1YGOA 2A5YB 2YQFA 1N3KA 2DBGA 2YGSA 1UCPA 2LWDA 4I16A 4N1KA 2OF5A 1E41A 1D2ZA 2KM6A 2N7ZA 1CWWA 3EZQB 4IZAB 4O7QA 4P4HI 2HM2Q 2MB9A 4N1LA 4P4HA 3LQQA 1E3YA 2MS8A
chains in the Genus database with same CATH superfamily
4JUPA 4M9SA 4IZ5E 3EZQA 4FH0A 4E9MA 1D2ZB 4O9LA 4N1JA 2O71A 4F42A 2NAQA 3MOPG 1A1ZA 4ZBWA 3YGSC 4RHWE 2M5VA 2B1WA 2D96A 2BBRA 2GF5A 2MPCA 2MN4A 2G7RA 3QF2A 1A1WA 2YVIA 1NGRA 3YGSP 3CL3A 4A2WA 3CRDA 4O9FA 4M9ZA 2OF5H 1FADA 1ICHA 1C15A 1WXPA 1WH4A 3J6JA 2N1FA 2L6AA 3T6PA 2LWEA 4QOBA 1CY5A 2P1HA 4EWIA 3MOPK 2VGQA 4RHWA 4A2QA 1DDFA 2N97A 2XV9A 2DBDA 3LQRA 2L9MA 2F1SA 3J63A 2YU0A 4UZ0A 4IZ7B 4M9XA 4NQKA 3KATA 2N00A 2N80A 2MS7A 4D8OA 1WMGA 4JQWA 2DBFA 2DBHA 4DWNA 1PN5A 2NSNA 2NZ7A 2DO9A 4F44A 3MOPA 2N83A 1Z6TA 4LWDA 1DGNA 2A9IA 2LS7A 4O6XA 2KN6A 2BBZA 2IB1A 1YGOA 2A5YB 2YQFA 1N3KA 2DBGA 2YGSA 1UCPA 2LWDA 4I16A 4N1KA 2OF5A 1E41A 2MJMA 1D2ZA 2KM6A 2N7ZA 1CWWA 3EZQB 4IZAB 4O7QA 4P4HI 2HM2Q 2MB9A 4N1LA 4P4HA 3LQQA 1E3YA 2MS8A
chains in the Genus database with same CATH topology
4JUPA 4M9SA 4IZ5E 3EZQA 4FH0A 4E9MA 1D2ZB 4O9LA 4N1JA 2O71A 4F42A 2NAQA 3MOPG 1A1ZA 4ZBWA 3YGSC 4RHWE 2M5VA 2B1WA 2D96A 2BBRA 2GF5A 2MPCA 2MN4A 2G7RA 3QF2A 1A1WA 2YVIA 1NGRA 3YGSP 3CL3A 4A2WA 3CRDA 4O9FA 4M9ZA 2OF5H 1FADA 1ICHA 1C15A 1WXPA 1WH4A 3J6JA 2N1FA 2L6AA 3T6PA 2LWEA 4QOBA 1CY5A 2P1HA 4EWIA 3MOPK 2VGQA 4RHWA 4A2QA 1DDFA 2N97A 2XV9A 2DBDA 3LQRA 2L9MA 2F1SA 3J63A 2YU0A 4UZ0A 4IZ7B 4M9XA 4NQKA 3KATA 2N00A 2N80A 2MS7A 4D8OA 1WMGA 4JQWA 2DBFA 2DBHA 4DWNA 1PN5A 2NSNA 2NZ7A 2DO9A 4F44A 3MOPA 2N83A 1Z6TA 4LWDA 1DGNA 2A9IA 2LS7A 4O6XA 2KN6A 2BBZA 2IB1A 1YGOA 2A5YB 2YQFA 1N3KA 2DBGA 2YGSA 1UCPA 2LWDA 4I16A 4N1KA 2OF5A 1E41A 2MJMA 1D2ZA 2KM6A 2N7ZA 1CWWA 3EZQB 4IZAB 4O7QA 4P4HI 2HM2Q 2MB9A 4N1LA 4P4HA 3LQQA 1E3YA 2MS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JUP A;  4M9S A;  4IZ5 E;  3EZQ A;  4FH0 A;  4E9M A;  1D2Z B;  4O9L A;  4N1J A;  2O71 A;  4F42 A;  2NAQ A;  3MOP G;  1A1Z A;  4ZBW A;  3YGS C;  4RHW E;  2M5V A;  2B1W A;  2D96 A;  2BBR A;  2GF5 A;  2MPC A;  2MN4 A;  2G7R A;  3QF2 A;  1A1W A;  2YVI A;  1NGR A;  3YGS P;  3CL3 A;  4A2W A;  3CRD A;  4O9F A;  4M9Z A;  2OF5 H;  1FAD A;  1ICH A;  1C15 A;  1WXP A;  1WH4 A;  3J6J A;  2N1F A;  2L6A A;  3T6P A;  2LWE A;  4QOB A;  1CY5 A;  2P1H A;  4EWI A;  3MOP K;  2VGQ A;  4RHW A;  4A2Q A;  1DDF A;  2N97 A;  3LQR A;  2DBD A;  2L9M A;  2F1S A;  3J63 A;  2YU0 A;  4UZ0 A;  4IZ7 B;  4M9X A;  4NQK A;  3KAT A;  2N00 A;  2N80 A;  2MS7 A;  4D8O A;  1WMG A;  4JQW A;  2DBF A;  2DBH A;  4DWN A;  1PN5 A;  2NSN A;  2NZ7 A;  2DO9 A;  4F44 A;  3MOP A;  2N83 A;  1Z6T A;  4LWD A;  1DGN A;  2A9I A;  2LS7 A;  4O6X A;  2KN6 A;  2BBZ A;  2IB1 A;  1YGO A;  2A5Y B;  2YQF A;  1N3K A;  2DBG A;  2YGS A;  1UCP A;  2LWD A;  4I16 A;  4N1K A;  2OF5 A;  1E41 A;  1D2Z A;  2KM6 A;  2N7Z A;  1CWW A;  3EZQ B;  4IZA B;  4O7Q A;  4P4H I;  2HM2 Q;  2MB9 A;  4N1L A;  4P4H A;  3LQQ A;  1E3Y A;  2MS8 A; 
#chains in the Genus database with same CATH topology
 4JUP A;  4M9S A;  4IZ5 E;  3EZQ A;  4FH0 A;  4E9M A;  1D2Z B;  4O9L A;  4N1J A;  2O71 A;  4F42 A;  2NAQ A;  3MOP G;  1A1Z A;  4ZBW A;  3YGS C;  4RHW E;  2M5V A;  2B1W A;  2D96 A;  2BBR A;  2GF5 A;  2MPC A;  2MN4 A;  2G7R A;  3QF2 A;  1A1W A;  2YVI A;  1NGR A;  3YGS P;  3CL3 A;  4A2W A;  3CRD A;  4O9F A;  4M9Z A;  2OF5 H;  1FAD A;  1ICH A;  1C15 A;  1WXP A;  1WH4 A;  3J6J A;  2N1F A;  2L6A A;  3T6P A;  2LWE A;  4QOB A;  1CY5 A;  2P1H A;  4EWI A;  3MOP K;  2VGQ A;  4RHW A;  4A2Q A;  1DDF A;  2N97 A;  2XV9 A;  2DBD A;  3LQR A;  2L9M A;  2F1S A;  3J63 A;  2YU0 A;  4UZ0 A;  4IZ7 B;  4M9X A;  4NQK A;  3KAT A;  2N00 A;  2N80 A;  2MS7 A;  4D8O A;  1WMG A;  4JQW A;  2DBF A;  2DBH A;  4DWN A;  1PN5 A;  2NSN A;  2NZ7 A;  2DO9 A;  4F44 A;  3MOP A;  2N83 A;  1Z6T A;  4LWD A;  1DGN A;  2A9I A;  2LS7 A;  4O6X A;  2KN6 A;  2BBZ A;  2IB1 A;  1YGO A;  2A5Y B;  2YQF A;  1N3K A;  2DBG A;  2YGS A;  1UCP A;  2LWD A;  4I16 A;  4N1K A;  2OF5 A;  1E41 A;  2MJM A;  1D2Z A;  2KM6 A;  2N7Z A;  1CWW A;  3EZQ B;  4IZA B;  4O7Q A;  4P4H I;  2HM2 Q;  2MB9 A;  4N1L A;  4P4H A;  3LQQ A;  1E3Y A;  2MS8 A; 
#chains in the Genus database with same CATH homology
 4JUP A;  4M9S A;  4IZ5 E;  3EZQ A;  4FH0 A;  4E9M A;  1D2Z B;  4O9L A;  4N1J A;  2O71 A;  4F42 A;  2NAQ A;  3MOP G;  1A1Z A;  4ZBW A;  3YGS C;  4RHW E;  2M5V A;  2B1W A;  2D96 A;  2BBR A;  2GF5 A;  2MPC A;  2MN4 A;  2G7R A;  3QF2 A;  1A1W A;  2YVI A;  1NGR A;  3YGS P;  3CL3 A;  4A2W A;  3CRD A;  4O9F A;  4M9Z A;  2OF5 H;  1FAD A;  1ICH A;  1C15 A;  1WXP A;  1WH4 A;  3J6J A;  2N1F A;  2L6A A;  3T6P A;  2LWE A;  4QOB A;  1CY5 A;  2P1H A;  4EWI A;  3MOP K;  2VGQ A;  4RHW A;  4A2Q A;  1DDF A;  2N97 A;  2XV9 A;  2DBD A;  3LQR A;  2L9M A;  2F1S A;  3J63 A;  2YU0 A;  4UZ0 A;  4IZ7 B;  4M9X A;  4NQK A;  3KAT A;  2N00 A;  2N80 A;  2MS7 A;  4D8O A;  1WMG A;  4JQW A;  2DBF A;  2DBH A;  4DWN A;  1PN5 A;  2NSN A;  2NZ7 A;  2DO9 A;  4F44 A;  3MOP A;  2N83 A;  1Z6T A;  4LWD A;  1DGN A;  2A9I A;  2LS7 A;  4O6X A;  2KN6 A;  2BBZ A;  2IB1 A;  1YGO A;  2A5Y B;  2YQF A;  1N3K A;  2DBG A;  2YGS A;  1UCP A;  2LWD A;  4I16 A;  4N1K A;  2OF5 A;  1E41 A;  2MJM A;  1D2Z A;  2KM6 A;  2N7Z A;  1CWW A;  3EZQ B;  4IZA B;  4O7Q A;  4P4H I;  2HM2 Q;  2MB9 A;  4N1L A;  4P4H A;  3LQQ A;  1E3Y A;  2MS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...