1FAFA

Nmr structure of the n-terminal j domain of murine polyomavirus t antigens.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
MDRVLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNLRMNLGGTGFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the N-terminal J domain of murine polyomavirus T antigens. Implications for DnaJ-like domains and for mutations of T antigens.
pubmed doi rcsb
source organism Murine polyomavirus
molecule tags Viral protein
molecule keywords LARGE T ANTIGEN
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2000-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1fafA00
2Y4UA 4J7ZA 1FAFA 3APOA 2LGWA 2Y4TA 2EJ7A 4RWUA 2M6YA 1BQZA 2GUZB 4IT5A 3UO3A 2QWNB 1WJZA 1HDJA 2YUAA 2CTQA 2DN9A 2L6LA 2PF4E 3AG7A 2QWRB 2QWQB 3APQA 2CUGA 2KQXA 1NZ6A 2N05A 2QWOB 4J80A 2N04A 1XBLA 1BQ0A 2CTRA 2CTWA 1FPOA 3UO2A 2DMXA 2LO1A 3BVOA 3UCSC 2GUZA 1IURA 2OCHA 2CTPA 1N4CA 1GH6A 2QSAA 2QWPB 2YS8A
chains in the Genus database with same CATH superfamily
3CCUV 3OEEG 1FAFA 3SGIA 2BOCC 4OPAA 1HNXO 5KMGB 3LSQA 2BTQA 1AI7A 1KQSU 4LF5O 2X6AA 2CAZC 2W0XA 1HP8A 1THZA 3HKBB 2YEVA 3RVZA 1PM9A 3EHBB 2NLJC 1V54C 1J5EO 4K0KB 2H3OA 1S76D 1XI1A 1R3KC 2IU0A 3VQXA 3ZMTA 5L3GA 2EZOA 2YUAA 2VQEB 4FM1A 4PA4A 2DJVA 1KP2A 2QGNA 2W0FC 1OHHG 2JS5A 4GUNA 1AI5A 4PJ0Z 2AXTZ 3KZIZ 4MVQA 4PHZA 1PNKA 3CXHF 1ZL8A 1OCOC 1V55B 4PA7A 5JWPA 3S3WA 2KG7A 3CMAV 1ROPA 3KG2A 2FKXA 3L73H 2IH1C 3F7VC 2DYRB 1ZL8B 3JD1A 1LNQA 4TV8A 3E89A 4JI1B 2OYQA 3OMAB 2Y0PA 1CXZB 2F95B 1RSOB 4LFAB 3K58A 3UT5A 3QVNA 3ZHUA 5LGTA 4LH6A 2ODMA 5JVDA 1AJNA 3K04A 1YSCA 2VS0A 3JALB 3FYIB 2JDIG 3ETGA 1MOFA 3BA8A 3K0DA 1K9MW 2UUBB 3FB5C 5CA1B 1XOUA 3U10A 1AB3A 3WB2A 4I7ZB 4PI0A 5D5PA 2EIKB 5JQGB 4P30A 2Q67A 1B06A 3JD0A 4J7JA 4JI7O 1I5YA 1PNMA 4GX2A 1QQCA 4X64B 4DK1A 4K8XA 5CA1A 3CCSV 1IURA 3CCJV 1M1KW 3RYHA 1QU7A 3ZRVA 3ETDA 4H13B 1KECA 1BZKA 4UCOA 5EYPB 4J9YB 2EIKC 1FXVA 3OAAG 4LNUB 4NXNB 1K33A 2GUZB 4FJCC 2H94A 4K3AA 2ZT9B 2XAHA 4GYCB 1D5NA 1I94O 4UB6Z 1CEZA 2V4DA 2CTWA 3K0GA 1JA8A 3X2QC 2PZSA 4RUFA 4TQDA 5KA5A 1COWG 3RYIA 1H2SB 4YIPA 2WA4A 3B8MA 2WLLA 1Z5WA 3CMEV 1Y74A 2RJZA 1BCCH 3M8AA 1BSMA 4UV9A 1N33B 1TAEA 1IZ3A 1ORQC 3MHHC 1K97A 4OPHA 2EX3A 2QWRB 4MVOA 1SA0A 5EC2C 3ABUA 4DV7O 1Q86W 3BPZA 1XREA 4EEQA 5B1OA 3R65A 4X62O 4JI0B 5B1AB 3AG2B 2B9ZA 4YHHB 1NT2B 2RNBA 3JASB 1B6QA 1AP5A 2LGQA 1V55C 4BW5A 5L3BA 3CRQA 5KUMA 5A2QN 2ZIOA 2YIDA 3ZHTA 3B40A 5BY1A 5B1BC 5IYCO 4MTOA 2R70A 4WFHA 3SR2C 4WFFA 5IJ9B 4X8AA 3QNEA 4X20A 4X1IA 4DV3O 3OR7C 4X62B 1NH2B 5IJ0A 1NR1A 2Q6AA 4TV9B 4Q20A 1XNQB 1K3EA 4H33A 4ZHQB 1PP9H 4X66O 4I0XB 3MAQA 4YXWG 4DR7B 4NVPA 2EIJB 3RYCA 3VQWA 2FB5A 5LHHA 4JAAA 1B04A 4I4TB 4JI4O 3FB6C 1E1QG 3CRRA 3CRMA 4GX1A 4JI4B 2OTLV 5LA6A 2QA4V 1VQ9V 4JI7B 1VQOV 2B5UA 3RWRD 3JD3A 1URFA 2NNUA 4J9ZB 4EFEA 2E5LB 2Y0IA 2H8PC 1XNQO 4JV5B 5B3SC 2DOSA 1GH6A 2QSAA 1M93A 1VQ6V 3G80A 4J7KA 4MT8A 1SETA 1LR1A 4DV6B 3T4DA 1OCZB 3AK2A 3G6EV 3S3XA 4I9QA 3FX7A 1YCIA 1JJ2U 4IHJB 4DR5B 3OM3B 4FK5C 2EIJC 3IGAC 4JASA 4MVSA 3HKDA 1V9PA 1QVFU 3WG7C 2Y69C 3SPIA 4I50A 4E2LA 1AI6A 2DW4A 4WF9V 1KU9A 2WWWA 3H01A 4WBNA 3E86A 4EKWA 4B08A 5KUKA 5ITZA 3OMIB 4YY3B 1H2LA 4HYOA 2GDSA 4FLXA 4DYLA 3CB2A 4DV6O 4UB8Z 4DR6B 4I0XA 4YY3O 3D8CA 1XL6A 2KQXA 5B1NA 1IBMB 4F6RB 1SF9A 4P9OA 1SC5B 1P49A 2CGNA 3ZN1A 1BHBA 4TUYB 4E4EA 5KX5B 1BQZA 3TXSA 2WLIA 3VOUA 1VQ8V 1MA1A 5KMGA 4FLVA 3CCEV 5JCOC 3P3NA 4JYYA 2Q7GA 4DR4B 3K59A 3JYCA 5H2FZ 3SDLA 3T1HO 2DYRC 3SJQC 2HVKC 5FLXN 2IJIA 3HKCA 1EM1A 2QM4A 2YXYA 5LHGA 5LL6Y 1Q82W 4QE7A 2XHBA 3O65A 1I08A 3BHPA 2Z5UA 2LFRA 4NXMO 4PELA 1GM9A 5IY5C 4BIUA 1VIBA 2ZQMA 4NXMB 4Z2WA 3UCSC 1AP6A 2ITCC 4UCVA 3I5DA 4GKKO 5LMUB 1AI4A 1SQQH 4LP8A 2PYLA 3W7SA 2GV9A 4JI5B 3F7YC 4DUZB 3TETA 1UPGA 3CC4V 1YXBA 3K5OA 4ICGA 5DM6V 4O4HB 2QWQB 1QLEB 2Y48A 5LGNA 2F1MA 2WPDG 1QLEC 4MVMA 1Y67A 1SQXH 1W59A 2CH7A 2KSDA 1ENVA 4K8ZA 2LW7A 3HB3B 1HNXB 2LQTA 1ZWIC 3H1LH 2WLLB 3K5NA 5IYDO 1PPJH 1ZLZA 2CK3G 3MD0A 1RSOA 4X64O 5D5QA 4KXRA 3ABMC 3W7UA 2CTRA 3RBZA 2GUZA 4JPRA 3FB7C 3M7MX 1XMOB 3EVKA 4AI8A 4HZ3A 1R1BA 3ASNC 2M6YA 3U0ZA 4TSFG 4BAYA 2IJHA 5IE9A 1YJNV 1KKDA 2QWOB 2EILC 4O4JB 1HNZB 1FPOA 4LBEC 5LMNB 4MTGA 1M4UA 1VQNV 2FMLA 4PA9A 1EZJA 4UV8A 2EJ7A 2X7RB 3A2FA 3ZEDA 3C3TA 1FXKC 1H2MA 1WP7A 2EILB 1F23A 3CRAA 3JAWA 1TA8A 4IGGA 5LMUO 3M99B 5EIBC 1BQ0A 1EZVH 5H6QA 4RQEA 4I9WA 2Q68A 3HKCB 4JZ2A 2YC0A 1N4CA 1QVGU 1OCCB 2QR4A 2PUSA 1TVKB 4FPPA 3JAMN 2JGDA 5DEDA 1Z5VA 4W4LA 4ASUG 3DXRB 2Q8VA 2X6BA 1VP7A 2UU9O 4B3MO 2Q0AA 3D3QA 2L6LA 2P06A 1Y74B 3ZMUA 1BHAA 3BABA 3STZC 2QM7A 1SQBH 3ZHQA 1U97A 4K35A 5A9GA 2FYUH 3W7XA 2BSKB 1WA8A 2JRIA 3HPLC 4DW1A 5BR8O 4DV2O 1JVMA 2GTSA 1P7GA 2VQFB 4OXSA 2PF4E 4DV4B 3X2QB 2ZDIA 1YIJV 1Q7YW 1XEQA 4KHPB 5LHIA 4D7SA 4FFBB 1GN4A 1NJIW 1R6TA 1YEWA 4RO2A 1Q43A 1S77D 1KC8W 1ZSPA 4MVZA 1FXKB 4DUYO 2NR5A 3ETQA 3QG5A 1MNGA 4G2KA 1NKDA 2Q73A 2D2CB 5EC1C 3SPJA 5KHJA 2R9IA 2WSSG 5B66Z 4PV1B 1YTFB 3CCVV 1N34B 3LDEA 1YVWA 4ABMA 5K1XA 4MSWC 1JFFA 5H9CA 2A06H 4KL1A 3I56V 2AZ0A 4B7KA 2DWDC 3ZRWB 3JD4A 1J5EB 2JJ2G 1NTZH 5LMNO 1JFFB 2YS8A 4DR2O 1W0JG 3CCQV 2QM8A 5B5EZ 3IJ4A 5BMVB 2EULA 4DR2B 2BTOA 4R50A 2KG7B 2EINC 4BR6A 5BMVA 4QGPA 3K5MA 1EFRG 1F7YA 3TJTA 3T1YO 1GK9A 1FJGO 1XBLA 1FD9A 1RPRA 4FLTA 3K06A 4B3SB 2HR3A 4UVBA 2CGOA 3A0HZ 3ASOC 1V54B 4CH3A 2ADQB 1EN6A 4N21A 2Q9LA 1IX9A 1NZ6A 4XBFA 1RP3B 2XUMA 1OCZC 1VQ7V 1FKAO 4YJ3B 4CS3A 4IIJB 1BMFG 1WA8B 4BIOA 4YIOA 1U96A 1MMMA 4X88A 4ZI7B 2UXDB 3LSSA 3UKMA 3OFNG 3WG7B 4CH5A 4IYIA 2NN4A 1Q5OA 1S72V 1GAXA 4RAIA 1HR0B 2B1GA 3AG2C 3E22A 3ZMVA 4RQFA 3LDCA 2V1DA 1NTKH 1N32B 3OE7G 3GVMA 1XHXA 3SPCA 1TVKA 2F4VO 1H8HG 1Q6HA 2YEVB 4MW3A 5CB4B 2E74B 1M57B 4ZKIA 2Q7EA 4H37A 2O57A 3FKSG 3RN4A 4WFEA 5LP6C 4LF8O 1SQGA 1TUBB 4O2AB 2A0LA 2IBZH 1GO3F 1F4NA 3AG3B 4PA6A 2UUBO 2RN9A 3OTOO 2OCCB 2AW9A 3R66A 4JI3B 3APQA 4DV1B 3IC9A 3JATA 1W0KG 1QR8A 1UFIA 4FMTA 2JK5C 3BVOA 5FNVB 4O2BB 5L3CA 2Y69B 1OV9A 1US6A 2ZM6B 3K9AA 3CYOA 2K1EA 1DK1A 2OCCC 4O4IB 2JGUA 4LR3A 1IXBA 2X6CA 4GKJO 4HNAB 4PDLA 4O4IA 2VRZA 1HW7A 1HNWB 1G6UA 2ZCEA 3BAAA 1SQVH 2W6JG 3E2EA 2EIMC 2XAGA 3CX5F 5LGUA 3U11A 1CP9A 3UO2A 3C90A 2D3OW 1FXKA 1DGSA 2AHYA 4PI2A 4QNHB 1R3LC 1I94B 5CA0A 3ABKB 2ZKOA 2UXCB 3G67A 3N2GA 1N0NA 5GONA 1F51A 4NYKA 4EFBA 4DR1O 2WLMA 2A79B 4XDKA 3ZHSA 1P84F 4X1YB 3LUTB 2KKWA 1I7FA 4FVMA 1QCEA 4IL6Z 3I55V 5JQGA 1RM1B 2OIEA 2HJFC 2JVDA 4L87A 4QIWF 2LJ2A 5LA6B 1JJOA 5EBLC 4QPKA 4CH6A 2B1IA 1AVMA 3BY6A 4DR3B 1OCOB 2LW1A 3E8BA 5LOVA 1Q6IA 1N0JA 2P4KA 5L3FA 1JX9A 1HR0O 2RQ6A 2JJ1G 3SYPA 2HLDG 3G71V 3E83A 2WLKA 4NB5A 1S3JA 3K79A 2UUAB 2A3QA 2GBOA 3CWBH 3T1HB 1WN7A 4UCUA 2ZDIC 3SYAA 4LF6O 2JIZG 2GSMB 5KHIA 3H1KH 4UCTA 1M57C 1GKFA 3LNMB 3F5TA 1PD3A 3CRCA 1BGYH 3LNNA 1UJWB 5GW7A 1GRJA 1YDXA 4DO2A 2ARHA 2WLJA 4LC1A 1IDSA 3RGBA 1VF7A 4DR7O 5JVDB 1WLEA 4JYBA 4OX9B 5LP6A 2GHYA 5FNVA 2UUCO 1Q6UA 3AG7A 4O2BA 5JH7A 4MVUA 5KLVH 4TV8B 4JI6O 3VQYA 4AILC 3RW0A 1G4YB 2HKOA 4O4LB 5J2TA 2XAJA 1P4RA 3OGCC 4GKJB 1WNSA 1YHQV 2AHZA 3LSUA 3ZX6A 1N34O 4DRXB 2WLIB 4TQFA 3P3PA 2ZE8A 4LF8B 5KX5A 3BA9A 5IJ0B 2HFEC 3JARA 4JI8B 2VWJA 4XDJA 3L74H 4YHHO 3RYIB 4LF4O 4B3TO 4F6EA 1K34A 4G27B 3ICXA 1W2BU 4Q6GA 3ZJZA 5LYJA 1XILA 2Y4UA 4CZZA 5GTIZ 3RYCB 3GWOA 2QWNB 4JAUA 1D5AA 4LFBO 1GM8A 2QEXV 5CN0A 3CCLV 2YIAA 3HKEA 2E75B 4QE9A 4HBNA 4UUJC 3ASNB 3E8GA 1FFXB 1YZBA 1BT8A 4TOIA 1L0LH 5IYBO 3ASOB 1YITV 1IXMA 4JI0O 2A9HA 4U7NA 4DR3O 2EZPA 2ATKC 1IBLB 2UXCO 1KKCA 1R3JC 2MK3A 5FPOA 4CS4A 4KFMA 1K92A 5J2TB 2QJ1A 3A0RA 4X89A 2LP7A 4L8JA 4B3RO 3JCUZ 2JGDB 1AR1B 2RCVA 4LF6B 2UUCB 2DE0X 2EINB 4X1IB 2ITDC 1EN4A 1MZFA 4UFZA 1IBKB 5FL7G 1HWYA 4LFAO 2FL4A 1JOYA 3MDSA 1YTFD 1E1RG 1E79G 1IVSA 3ZMSA 3VBBA 4HAMA 4RUEA 4JI5O 5C8YA 3N27A 4FFBA 5TISZ 4MTFA 5CBFA 3T1CA 2QTSA 1HNWO 3OD4A 4UVCA 1YI2V 1VEWA 5J2UA 1Q8IA 1XL4A 2IJJA 5FPRA 3ZHVA 1VQPV 4LF5B 2OTJV 4B3TB 5HFLA 3RFRA 2F23A 1VQKV 1H2KA 2CDYA 1TUEB 4N23A 3MHSC 4K0KO 1YJ9V 1Q3EA 1L0NH 3WB0A 4FM2A 5JCOA 2DQ0A 4HNAA 4A5UB 1VF6C 2QWPB 1I0HA 4DR1B 3L75H 4MTXA 4EB6B 5LXTA 1N8RW 2Y4TA 1FXHA 3QO7A 3AEIA 3TCUA 1BE3H 2ZXWB 4WCEV 3STLC 1HDJA 3H9VA 3H1HH 3GB7C 1FFXA 2N04A 3OW2U 3E35A 2LO1A 4JI8O 1SQFA 4AQYB 2P5OA 2JS3A 1S0VA 3RVYA 3AG1B 4AQYO 1IBLO 4C7UA 3CC2V 1OCRC 2BSKA 1S5HC 1NI8A 2OWOA 3RYFB 2Q7HA 5CA3A 2XAQA 1B3QA 1GN2A 3E22B 2BCCH 5KHGA 1S5JA 3AG3C 2EBOA 2G38A 3FYEB 2XASA 4B3RB 3B09A 3W7TA 1OJHA 1GM7A 3NXSA 3B2EE 4DV2B 1WJZA 4DXWA 1BL8A 5EZYA 2P7TC 4YJ2A 1WPBA 2OCHA 2ZE5A 3CC7V 4WFGA 4NTXA 5JJEB 4O4LA 3OR6C 2PI4A 3AK1A 3SJAC 4X9QA 2R72A 2XAFA 3L9DA 4IIJA 5CBGA 3H1IH 3ZRXA 2PY5A 1QLNA 4BWAA 3WFVA 4JTCB 3T4ZA 1AR4A 3BFRA 1NU1H 2XT9A 2HHHB 3W7WA 2ZE7A 2BTQB 4UCRA 4PD4F 5E1AC 5LYJB 4O4HA 2HEPA 2IM9A 3G4SV 4GKKB 3UO3A 2K9PA 2YXHA 2UXXA 2ZR2A 2QTOA 1WB7A 2R9AA 4LFCB 2FTKA 4GX5A 3SYOA 3TXQA 4LFCO 1KMIZ 2WLHA 5L3EA 1YF2A 1AILA 1R6NA 1O9HA 3J80N 1VF6A 5ITZB 4CBCA 3T1YB 2AZ2A 4PDMA 3JASA 3QO5A 2ZD9A 4D7TA 4B3SO 2CUGA 1MABG 3C3SA 1Q90D 4DR6O 3ML0A 3KCXA 4UVAA 4J11A 5IT9N 3CJHA 1VQMV 1BS3A 1VQ4V 2WAMA 1DF4A 2DWEC 3CSXA 5IJ9A 4LH7A 4X65O 1RFYA 5B1AC 1N33O 4DK0A 3J81N 3DSQA 4FZ1A 2OT5A 4MW8A 4BW9A 2HP8A 5CA0B 3CD6V 2JEXA 1PL0A 1WB8A 4I55A 4J7ZA 3K03A 4DV7B 3T2MA 4GLXA 3RT3C 1PL4A 4UCSA 1XHZA 2Q4PA 4JTAB 1WP8A 2UU9B 4B3MB 5C93A 2PGGA 4D6TH 5CBHA 3ZCCA 3F5WC 1NVPD 5IWAB 4W4KA 3SYCA 3CCRV 2R9RB 3FAVB 3IAYA 2F4VB 4NR1A 2DYSB 3ZRWA 1SESA 4DV4O 2P67A 3KCYA 2YXLA 3FAVA 3HR0A 2VQFO 3K08A 5F2VO 4WFAV 4KHPO 4LWSB 2BOBC 2YIBD 2ETNA 3UM7A 4H44B 4J10A 2Q69A 3NR7A 4LF9B 3APOA 5GTHZ 3B77A 4JGSA 5HFMA 3OTOB 4I50B 4XDLA 3EXAA 3SYQA 1WAZA 2ZIMA 3JSLA 1VF5B 5LBQA 1K4CC 1F4MA 1M5IA 4QPJA 5J2UB 1XMOO 4ZBMA 2UXBO 1ZUQA 3KKYA 4FM0A 3FB8C 1G1XB 2HHHO 2AGAA 2IU3A 4WBNB 1DTOA 3QF7A 4ZHQA 4U3FH 3N2GB 2XTAA 1MZEA 3CE2A 1QNMA 4GZRB 1AROP 1GMGA 4O4JA 4TUYA 3H1JH 3Q4HA 3CJHB 3DC5A 3JD2A 2YIBA 4FLUA 4NKGB 3IC7A 1NVPB 3OEHG 5KHHA 1M56B 2HJDA 1XMQB 2VQEO 2ZINA 3L70H 4GCZA 1SZXA 1L8DA 4QJFB 2PTMA 2DYSC 3OMNB 2ZNJA 3FFQA 1EN5A 2UXDO 2MW2B 2E3CA 1EBOA 3TK1A 3CCMV 1H2GA 3DTUB 1FFTB 2IJKA 4ZOLA 1NH2D 1VQ5V 5CMUA 2ZR3A 3L71H 5H5NA 4RWUA 1LUVA 4JTDB 3HKEB 1XQ8A 2KB1A 2QKAA 1TUBA 3QTCA 4O2AA 4EB6A 5LXTB 2UXNA 3J7AU 4X65B 1Y4MA 1JPXA 5IYZB 4GT1A 1FJGB 4DR4O 5BR8B 1Y66A 3ZN0A 2ZXWC 1KB9F 4B7EA 2P6JA 2P90A 1K4DC 1NBMG 4DV3B 1L1FA 2XOKG 3K3WA 4KP4A 1K73W 4YJ3A 4DV0B 4JAVA 5EYPA 1S5LZ 1NTMH 2DMXA 2CTPA 3AG4C 1WPXA 3ZRSA 1M90W 2ADPA 1MSWD 2E76B 4FLZA 4U3JA 4YJ2B 5EZYB 4DV5O 1MG1A 4OX9O 4TV9A 1N36O 2YI8A 2HG5C 4FLWA 3D36A 4JI6B 1H38A 4TWKA 5K1PA 5KAIZ 4JYCA 4U7OA 5EK0A 4ZI7A 1OCRB 1GN3A 2E5LO 4JV5O 2JEUA 3P32A 2N74A 4H0LB 4NTWA 3D3IA 4NXNO 1Y76A 2RMKB 1AR5A 2F66C 4JYAO 3RYHB 1JR9A 1XNRB 2ZNIA 1ZTEA 1XUQA 3SJCC 3ABTA 3B8NA 4JF3A 5IY5B 4R8CA 3K5LA 3FD9A 5IYZA 1H2NA 3THOA 1KD1W 5KAFZ 1M9NA 3CEIA 4MVRA 4R7CA 1RPOA 3OTFA 2P22C 4X1KB 4FLYA 1AJQA 2ILMA 3ABMB 1FS0G 3JSNA 1P7BA 2WLNA 1Q81W 3O9OA 2QKSA 4R6ZA 4J41A 2C2AA 2M7WA 5EBMC 4CC6A 4X1KA 2A7WA 2N05A 2Q0OC 1IBMO 4J42A 4ZOLB 4DR5O 1R73A 3UT5B 5CB4A 1LUWA 1K5QA 4F4LA 3AK3A 5BZBA 3ABKC 1D2DA 2ZM6O 1X4TA 1JCHA 2QKCA 4PA3A 3JAKA 2UUAO 3A0BZ 3B4SA 2F43G 4Z1VA 2P4VA 4DW0A 3PN1A 1R6KA 1AJPA 1K7DA 3JATB 1SS3A 3ZMZA 4P2ZA 4I4TA 5C8YB 2PI5A 4PDRA 1SZTA 4Z1MG 2X0LA 1CPYA 2DQ3A 4LF7O 1O9GA 1KYOF 1QBZA 1GTOA 1FYJA 3AG1C 1PNLA 3E8FA 5DN6G 4TT3G 1H8EG 4NTYA 5IWAO 3JAWB 3RYFA 1SRYA 3QO8A 4P9PA 2YICA 1Y6XA 1SKVA 3CXCU 5LOVB 3K9SA 4FFKA 1J95A 4X20B 1DF5A 4I5SA 3CP1A 3BEHA 1XDCA 3HKBA 4I55B 3ABLC 1JMKC 3ABLB 3PJSK 4IHJA 1Y76B 1ZX3A 3D36C 3OUSA 4AHCA 1PKXA 1OCCC 2QDOA 2EIMB 2V7QG 4LWSA 3ETEA 1XNRO 3CPWU 3E8HA 4JI3O 3A8TA 2DN9A 3JCZA 4J80A 3VQVA 4DUZO 4DUYB 2WA3A 1G8MA 3ZIAG 5BXZA 2ZE6A 4IYHA 1XMQO 3CHXA 4OGQB 4DRXA 3ZS8C 2UXBB 1NR7A 5IDJA 3WU2Z 1RM1C 1Z2GA 3IFXA 2CH7B 4LCUC 5AG2A 4JI2B 4LF9O 5KHKA 1ZAUA 3DGEA 4KUMA 3SPHA 4WFBV 2YDEA 4JI2O 4JYAB 4MS2A 3SJBC 3L72H 3OUFA 1YJWV 3P30A 1HNZO 4FZ0A 4UXNA 5EBWC 5DECA 5B3SB 3ZBHA 2VWKA 2Z3YA 3OGIB 4LNUA 2L35A 3Q4HB 1SA0B 1TGOA 3BCCH 4FIPC 3JARB 4BIZA 3LDDA 3SPGA 4CS2A 3UQ8A 5E79Z 1N32O 4PDVA 3EFFK 4LFBB 3GWKC 2OIGA 2BE3A 2CE4A 4JZGA 5JJJB 5H6RA 3TGUH 5JH7B 4U3JB 5L3DA 1VMGA 2YI9A 2CTQA 2W6IG 4CC5A 2IW5A 4LF7B 3N2KB 5KA6A 2Z0AA 3G6BA 3OT7A 1KP3A 5J9PC 1OZ0A 4ZIBA 4G28B 4DV5B 3N2KA 4CH4A 1VQLV 1SQPH 1A32A 2F93B 3DXRA 5B1BB 2LGWA 2HVJC 1I5XA 2LFSA 2YSUB 1JQ0A 1GN6A 3AG4B 4IT5A 1X59A 4DV0O 1NS1A 2PYJA 1R3IC 1M56C 1K5SA 3BRCA 4GX0A 3K57A 3CS5A 5EIBD 5GONB 2XNDG 1MSDA 3JALA 4X66B 3ZHRA 3JAKB 1SERA 3DC6A 1T5EA 1QHTA 1QR9A 3WB1A 1NQTA 2QE7G 4DV1O 3HKDB 2GTAA 4F6RA 4JI1O 4LF4B 1K8AW 5LP6B 1KUQA 1N36B 2Q5ZA 1IBKO 1DLBA 2RDCA 2EJRA 5JJNB 1KBHA 1PV0A 4X1YA 2IH3C 1VARA
chains in the Genus database with same CATH topology
2Y4UA 4J7ZA 1FAFA 3APOA 2LGWA 2Y4TA 2EJ7A 4RWUA 2M6YA 1BQZA 2GUZB 4IT5A 3UO3A 2QWNB 1WJZA 1HDJA 2YUAA 2CTQA 2DN9A 2L6LA 2PF4E 3AG7A 2QWRB 2QWQB 3APQA 2CUGA 2KQXA 1NZ6A 2N05A 2QWOB 4J80A 2N04A 1XBLA 1BQ0A 2CTRA 2CTWA 1FPOA 3UO2A 2DMXA 2LO1A 3BVOA 3UCSC 2GUZA 1IURA 2OCHA 2CTPA 1N4CA 1GH6A 2QSAA 2QWPB 2YS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  4J7Z A;  1FAF A;  3APO A;  2LGW A;  2Y4T A;  2EJ7 A;  4RWU A;  2M6Y A;  1BQZ A;  2GUZ B;  4IT5 A;  3UO3 A;  2QWN B;  1WJZ A;  1HDJ A;  2YUA A;  2CTQ A;  2DN9 A;  2L6L A;  2PF4 E;  3AG7 A;  2QWR B;  2QWQ B;  3APQ A;  2CUG A;  2KQX A;  1NZ6 A;  2N05 A;  2QWO B;  4J80 A;  2N04 A;  1XBL A;  1BQ0 A;  2CTR A;  2CTW A;  1FPO A;  3UO2 A;  2DMX A;  2LO1 A;  3BVO A;  3UCS C;  2GUZ A;  1IUR A;  2OCH A;  2CTP A;  1N4C A;  1GH6 A;  2QSA A;  2QWP B;  2YS8 A; 
#chains in the Genus database with same CATH topology
 3CCU V;  3OEE G;  1FAF A;  3SGI A;  2BOC C;  4OPA A;  1HNX O;  5KMG B;  3LSQ A;  2BTQ A;  1AI7 A;  1KQS U;  4LF5 O;  2X6A A;  2CAZ C;  2W0X A;  1HP8 A;  1THZ A;  3HKB B;  2YEV A;  3RVZ A;  1PM9 A;  3EHB B;  2NLJ C;  1V54 C;  1J5E O;  4K0K B;  2H3O A;  1S76 D;  1XI1 A;  1R3K C;  2IU0 A;  3VQX A;  3ZMT A;  5L3G A;  2EZO A;  2YUA A;  2VQE B;  4FM1 A;  4PA4 A;  2DJV A;  1KP2 A;  2QGN A;  2W0F C;  1OHH G;  2JS5 A;  4GUN A;  1AI5 A;  4PJ0 Z;  2AXT Z;  3KZI Z;  4MVQ A;  4PHZ A;  1PNK A;  3CXH F;  1ZL8 A;  1OCO C;  1V55 B;  4PA7 A;  5JWP A;  3S3W A;  2KG7 A;  3CMA V;  1ROP A;  3KG2 A;  2FKX A;  3L73 H;  2IH1 C;  3F7V C;  2DYR B;  1ZL8 B;  3JD1 A;  1LNQ A;  4TV8 A;  3E89 A;  4JI1 B;  2OYQ A;  3OMA B;  2Y0P A;  1CXZ B;  2F95 B;  1RSO B;  4LFA B;  3K58 A;  3UT5 A;  3QVN A;  3ZHU A;  5LGT A;  4LH6 A;  2ODM A;  5JVD A;  1AJN A;  3K04 A;  1YSC A;  2VS0 A;  3JAL B;  3FYI B;  2JDI G;  3ETG A;  1MOF A;  3BA8 A;  3K0D A;  1K9M W;  2UUB B;  3FB5 C;  5CA1 B;  1XOU A;  3U10 A;  1AB3 A;  3WB2 A;  4I7Z B;  4PI0 A;  5D5P A;  2EIK B;  5JQG B;  4P30 A;  2Q67 A;  1B06 A;  3JD0 A;  4J7J A;  4JI7 O;  1I5Y A;  1PNM A;  4GX2 A;  1QQC A;  4X64 B;  4DK1 A;  4K8X A;  5CA1 A;  3CCS V;  1IUR A;  3CCJ V;  1M1K W;  3RYH A;  1QU7 A;  3ZRV A;  3ETD A;  4H13 B;  1KEC A;  1BZK A;  4UCO A;  5EYP B;  4J9Y B;  2EIK C;  1FXV A;  3OAA G;  4LNU B;  4NXN B;  1K33 A;  2GUZ B;  4FJC C;  2H94 A;  4K3A A;  2ZT9 B;  2XAH A;  4GYC B;  1D5N A;  1I94 O;  4UB6 Z;  1CEZ A;  2V4D A;  2CTW A;  3K0G A;  1JA8 A;  3X2Q C;  2PZS A;  4RUF A;  4TQD A;  5KA5 A;  1COW G;  3RYI A;  1H2S B;  4YIP A;  2WA4 A;  3B8M A;  2WLL A;  1Z5W A;  3CME V;  1Y74 A;  2RJZ A;  1BCC H;  3M8A A;  1BSM A;  4UV9 A;  1N33 B;  1TAE A;  1IZ3 A;  1ORQ C;  3MHH C;  1K97 A;  4OPH A;  2EX3 A;  2QWR B;  4MVO A;  1SA0 A;  5EC2 C;  3ABU A;  4DV7 O;  1Q86 W;  3BPZ A;  1XRE A;  4EEQ A;  5B1O A;  3R65 A;  4X62 O;  4JI0 B;  5B1A B;  3AG2 B;  2B9Z A;  4YHH B;  1NT2 B;  2RNB A;  3JAS B;  1B6Q A;  1AP5 A;  2LGQ A;  1V55 C;  4BW5 A;  5L3B A;  3CRQ A;  5KUM A;  5A2Q N;  2ZIO A;  2YID A;  3ZHT A;  3B40 A;  5BY1 A;  5B1B C;  5IYC O;  4MTO A;  2R70 A;  4WFH A;  3SR2 C;  4WFF A;  5IJ9 B;  4X8A A;  3QNE A;  4X20 A;  4X1I A;  4DV3 O;  3OR7 C;  4X62 B;  1NH2 B;  5IJ0 A;  1NR1 A;  2Q6A A;  4TV9 B;  4Q20 A;  1XNQ B;  1K3E A;  4H33 A;  4ZHQ B;  1PP9 H;  4X66 O;  4I0X B;  3MAQ A;  4YXW G;  4DR7 B;  4NVP A;  2EIJ B;  3RYC A;  3VQW A;  2FB5 A;  5LHH A;  4JAA A;  1B04 A;  4I4T B;  4JI4 O;  3FB6 C;  1E1Q G;  3CRR A;  3CRM A;  4GX1 A;  4JI4 B;  2OTL V;  5LA6 A;  2QA4 V;  1VQ9 V;  4JI7 B;  1VQO V;  2B5U A;  3RWR D;  3JD3 A;  1URF A;  2NNU A;  4J9Z B;  4EFE A;  2E5L B;  2Y0I A;  2H8P C;  1XNQ O;  4JV5 B;  5B3S C;  2DOS A;  1GH6 A;  2QSA A;  1M93 A;  1VQ6 V;  3G80 A;  4J7K A;  4MT8 A;  1SET A;  1LR1 A;  4DV6 B;  3T4D A;  1OCZ B;  3AK2 A;  3G6E V;  3S3X A;  4I9Q A;  3FX7 A;  1YCI A;  1JJ2 U;  4IHJ B;  4DR5 B;  3OM3 B;  4FK5 C;  2EIJ C;  3IGA C;  4JAS A;  4MVS A;  3HKD A;  1V9P A;  1QVF U;  3WG7 C;  2Y69 C;  3SPI A;  4I50 A;  4E2L A;  1AI6 A;  2DW4 A;  4WF9 V;  1KU9 A;  2WWW A;  3H01 A;  4WBN A;  3E86 A;  4EKW A;  4B08 A;  5KUK A;  5ITZ A;  3OMI B;  4YY3 B;  1H2L A;  4HYO A;  2GDS A;  4FLX A;  4DYL A;  3CB2 A;  4DV6 O;  4UB8 Z;  4DR6 B;  4I0X A;  4YY3 O;  3D8C A;  1XL6 A;  2KQX A;  5B1N A;  1IBM B;  4F6R B;  1SF9 A;  4P9O A;  1SC5 B;  1P49 A;  2CGN A;  3ZN1 A;  1BHB A;  4TUY B;  4E4E A;  5KX5 B;  1BQZ A;  3TXS A;  2WLI A;  3VOU A;  1VQ8 V;  1MA1 A;  5KMG A;  4FLV A;  3CCE V;  5JCO C;  3P3N A;  4JYY A;  2Q7G A;  4DR4 B;  3K59 A;  3JYC A;  5H2F Z;  3SDL A;  3T1H O;  2DYR C;  3SJQ C;  2HVK C;  5FLX N;  2IJI A;  3HKC A;  1EM1 A;  2QM4 A;  2YXY A;  5LHG A;  5LL6 Y;  1Q82 W;  4QE7 A;  2XHB A;  3O65 A;  1I08 A;  3BHP A;  2Z5U A;  2LFR A;  4NXM O;  4PEL A;  1GM9 A;  5IY5 C;  4BIU A;  1VIB A;  2ZQM A;  4NXM B;  4Z2W A;  3UCS C;  1AP6 A;  2ITC C;  4UCV A;  3I5D A;  4GKK O;  5LMU B;  1AI4 A;  1SQQ H;  4LP8 A;  2PYL A;  3W7S A;  2GV9 A;  4JI5 B;  3F7Y C;  4DUZ B;  3TET A;  1UPG A;  3CC4 V;  1YXB A;  3K5O A;  4ICG A;  5DM6 V;  4O4H B;  2QWQ B;  1QLE B;  2Y48 A;  5LGN A;  2F1M A;  2WPD G;  1QLE C;  4MVM A;  1Y67 A;  1SQX H;  1W59 A;  2CH7 A;  2KSD A;  1ENV A;  4K8Z A;  2LW7 A;  3HB3 B;  1HNX B;  2LQT A;  1ZWI C;  3H1L H;  2WLL B;  3K5N A;  5IYD O;  1PPJ H;  1ZLZ A;  2CK3 G;  3MD0 A;  1RSO A;  4X64 O;  5D5Q A;  4KXR A;  3ABM C;  3W7U A;  2CTR A;  3RBZ A;  2GUZ A;  4JPR A;  3FB7 C;  3M7M X;  1XMO B;  3EVK A;  4AI8 A;  4HZ3 A;  1R1B A;  3ASN C;  2M6Y A;  3U0Z A;  4TSF G;  4BAY A;  2IJH A;  5IE9 A;  1YJN V;  1KKD A;  2QWO B;  2EIL C;  4O4J B;  1HNZ B;  1FPO A;  4LBE C;  5LMN B;  4MTG A;  1M4U A;  1VQN V;  2FML A;  4PA9 A;  1EZJ A;  4UV8 A;  2EJ7 A;  2X7R B;  3A2F A;  3ZED A;  3C3T A;  1FXK C;  1H2M A;  1WP7 A;  2EIL B;  1F23 A;  3CRA A;  3JAW A;  1TA8 A;  4IGG A;  5LMU O;  3M99 B;  5EIB C;  1BQ0 A;  1EZV H;  5H6Q A;  4RQE A;  4I9W A;  2Q68 A;  3HKC B;  4JZ2 A;  2YC0 A;  1N4C A;  1QVG U;  1OCC B;  2QR4 A;  2PUS A;  1TVK B;  4FPP A;  3JAM N;  2JGD A;  5DED A;  1Z5V A;  4W4L A;  4ASU G;  3DXR B;  2Q8V A;  2X6B A;  1VP7 A;  2UU9 O;  4B3M O;  2Q0A A;  3D3Q A;  2L6L A;  2P06 A;  1Y74 B;  3ZMU A;  1BHA A;  3BAB A;  3STZ C;  2QM7 A;  1SQB H;  3ZHQ A;  1U97 A;  4K35 A;  5A9G A;  2FYU H;  3W7X A;  2BSK B;  1WA8 A;  2JRI A;  3HPL C;  4DW1 A;  5BR8 O;  4DV2 O;  1JVM A;  2GTS A;  1P7G A;  2VQF B;  4OXS A;  2PF4 E;  4DV4 B;  3X2Q B;  2ZDI A;  1YIJ V;  1Q7Y W;  1XEQ A;  4KHP B;  5LHI A;  4D7S A;  4FFB B;  1GN4 A;  1NJI W;  1R6T A;  1YEW A;  4RO2 A;  1Q43 A;  1S77 D;  1KC8 W;  1ZSP A;  4MVZ A;  1FXK B;  4DUY O;  2NR5 A;  3ETQ A;  3QG5 A;  1MNG A;  4G2K A;  1NKD A;  2Q73 A;  2D2C B;  5EC1 C;  3SPJ A;  5KHJ A;  2R9I A;  2WSS G;  5B66 Z;  4PV1 B;  1YTF B;  3CCV V;  1N34 B;  3LDE A;  1YVW A;  4ABM A;  5K1X A;  4MSW C;  1JFF A;  5H9C A;  2A06 H;  4KL1 A;  3I56 V;  2AZ0 A;  4B7K A;  2DWD C;  3ZRW B;  3JD4 A;  1J5E B;  2JJ2 G;  1NTZ H;  5LMN O;  1JFF B;  2YS8 A;  4DR2 O;  1W0J G;  3CCQ V;  2QM8 A;  5B5E Z;  3IJ4 A;  5BMV B;  2EUL A;  4DR2 B;  2BTO A;  4R50 A;  2KG7 B;  2EIN C;  4BR6 A;  5BMV A;  4QGP A;  3K5M A;  1EFR G;  1F7Y A;  3TJT A;  3T1Y O;  1GK9 A;  1FJG O;  1XBL A;  1FD9 A;  1RPR A;  4FLT A;  3K06 A;  4B3S B;  2HR3 A;  4UVB A;  2CGO A;  3A0H Z;  3ASO C;  1V54 B;  4CH3 A;  2ADQ B;  1EN6 A;  4N21 A;  2Q9L A;  1IX9 A;  1NZ6 A;  4XBF A;  1RP3 B;  2XUM A;  1OCZ C;  1VQ7 V;  1FKA O;  4YJ3 B;  4CS3 A;  4IIJ B;  1BMF G;  1WA8 B;  4BIO A;  4YIO A;  1U96 A;  1MMM A;  4X88 A;  4ZI7 B;  2UXD B;  3LSS A;  3UKM A;  3OFN G;  3WG7 B;  4CH5 A;  4IYI A;  2NN4 A;  1Q5O A;  1S72 V;  1GAX A;  4RAI A;  1HR0 B;  2B1G A;  3AG2 C;  3E22 A;  3ZMV A;  4RQF A;  3LDC A;  2V1D A;  1NTK H;  1N32 B;  3OE7 G;  3GVM A;  1XHX A;  3SPC A;  1TVK A;  2F4V O;  1H8H G;  1Q6H A;  2YEV B;  4MW3 A;  5CB4 B;  2E74 B;  1M57 B;  4ZKI A;  2Q7E A;  4H37 A;  2O57 A;  3FKS G;  3RN4 A;  4WFE A;  5LP6 C;  4LF8 O;  1SQG A;  1TUB B;  4O2A B;  2A0L A;  2IBZ H;  1GO3 F;  1F4N A;  3AG3 B;  4PA6 A;  2UUB O;  2RN9 A;  3OTO O;  2OCC B;  2AW9 A;  3R66 A;  4JI3 B;  3APQ A;  4DV1 B;  3IC9 A;  3JAT A;  1W0K G;  1QR8 A;  1UFI A;  4FMT A;  2JK5 C;  3BVO A;  5FNV B;  4O2B B;  5L3C A;  2Y69 B;  1OV9 A;  1US6 A;  2ZM6 B;  3K9A A;  3CYO A;  2K1E A;  1DK1 A;  2OCC C;  4O4I B;  2JGU A;  4LR3 A;  1IXB A;  2X6C A;  4GKJ O;  4HNA B;  4PDL A;  4O4I A;  2VRZ A;  1HW7 A;  1HNW B;  1G6U A;  2ZCE A;  3BAA A;  1SQV H;  2W6J G;  3E2E A;  2EIM C;  2XAG A;  3CX5 F;  5LGU A;  3U11 A;  1CP9 A;  3UO2 A;  3C90 A;  2D3O W;  1FXK A;  1DGS A;  2AHY A;  4PI2 A;  4QNH B;  1R3L C;  1I94 B;  5CA0 A;  3ABK B;  2ZKO A;  2UXC B;  3G67 A;  3N2G A;  1N0N A;  5GON A;  1F51 A;  4NYK A;  4EFB A;  4DR1 O;  2WLM A;  2A79 B;  4XDK A;  3ZHS A;  1P84 F;  4X1Y B;  3LUT B;  2KKW A;  1I7F A;  4FVM A;  1QCE A;  4IL6 Z;  3I55 V;  5JQG A;  1RM1 B;  2OIE A;  2HJF C;  2JVD A;  4L87 A;  4QIW F;  2LJ2 A;  5LA6 B;  1JJO A;  5EBL C;  4QPK A;  4CH6 A;  2B1I A;  1AVM A;  3BY6 A;  4DR3 B;  1OCO B;  2LW1 A;  3E8B A;  5LOV A;  1Q6I A;  1N0J A;  2P4K A;  5L3F A;  1JX9 A;  1HR0 O;  2RQ6 A;  2JJ1 G;  3SYP A;  2HLD G;  3G71 V;  3E83 A;  2WLK A;  4NB5 A;  1S3J A;  3K79 A;  2UUA B;  2A3Q A;  2GBO A;  3CWB H;  3T1H B;  1WN7 A;  4UCU A;  2ZDI C;  3SYA A;  4LF6 O;  2JIZ G;  2GSM B;  5KHI A;  3H1K H;  4UCT A;  1M57 C;  1GKF A;  3LNM B;  3F5T A;  1PD3 A;  3CRC A;  1BGY H;  3LNN A;  1UJW B;  5GW7 A;  1GRJ A;  1YDX A;  4DO2 A;  2ARH A;  2WLJ A;  4LC1 A;  1IDS A;  3RGB A;  1VF7 A;  4DR7 O;  5JVD B;  1WLE A;  4JYB A;  4OX9 B;  5LP6 A;  2GHY A;  5FNV A;  2UUC O;  1Q6U A;  3AG7 A;  4O2B A;  5JH7 A;  4MVU A;  5KLV H;  4TV8 B;  4JI6 O;  3VQY A;  4AIL C;  3RW0 A;  1G4Y B;  2HKO A;  4O4L B;  5J2T A;  2XAJ A;  1P4R A;  3OGC C;  4GKJ B;  1WNS A;  1YHQ V;  2AHZ A;  3LSU A;  3ZX6 A;  1N34 O;  4DRX B;  2WLI B;  4TQF A;  3P3P A;  2ZE8 A;  4LF8 B;  5KX5 A;  3BA9 A;  5IJ0 B;  2HFE C;  3JAR A;  4JI8 B;  2VWJ A;  4XDJ A;  3L74 H;  4YHH O;  3RYI B;  4LF4 O;  4B3T O;  4F6E A;  1K34 A;  4G27 B;  3ICX A;  1W2B U;  4Q6G A;  3ZJZ A;  5LYJ A;  1XIL A;  2Y4U A;  4CZZ A;  5GTI Z;  3RYC B;  3GWO A;  2QWN B;  4JAU A;  1D5A A;  4LFB O;  1GM8 A;  2QEX V;  5CN0 A;  3CCL V;  2YIA A;  3HKE A;  2E75 B;  4QE9 A;  4HBN A;  4UUJ C;  3ASN B;  3E8G A;  1FFX B;  1YZB A;  1BT8 A;  4TOI A;  1L0L H;  5IYB O;  3ASO B;  1YIT V;  1IXM A;  4JI0 O;  2A9H A;  4U7N A;  4DR3 O;  2EZP A;  2ATK C;  1IBL B;  2UXC O;  1KKC A;  1R3J C;  2MK3 A;  5FPO A;  4CS4 A;  4KFM A;  1K92 A;  5J2T B;  2QJ1 A;  3A0R A;  4X89 A;  2LP7 A;  4L8J A;  4B3R O;  3JCU Z;  2JGD B;  1AR1 B;  2RCV A;  4LF6 B;  2UUC B;  2DE0 X;  2EIN B;  4X1I B;  2ITD C;  1EN4 A;  1MZF A;  4UFZ A;  1IBK B;  5FL7 G;  1HWY A;  4LFA O;  2FL4 A;  1JOY A;  3MDS A;  1YTF D;  1E1R G;  1E79 G;  1IVS A;  3ZMS A;  3VBB A;  4HAM A;  4RUE A;  4JI5 O;  5C8Y A;  3N27 A;  4FFB A;  5TIS Z;  4MTF A;  5CBF A;  3T1C A;  2QTS A;  1HNW O;  3OD4 A;  4UVC A;  1YI2 V;  1VEW A;  5J2U A;  1Q8I A;  1XL4 A;  2IJJ A;  5FPR A;  3ZHV A;  1VQP V;  4LF5 B;  2OTJ V;  4B3T B;  5HFL A;  3RFR A;  2F23 A;  1VQK V;  1H2K A;  2CDY A;  1TUE B;  4N23 A;  3MHS C;  4K0K O;  1YJ9 V;  1Q3E A;  1L0N H;  3WB0 A;  4FM2 A;  5JCO A;  2DQ0 A;  4HNA A;  4A5U B;  1VF6 C;  2QWP B;  1I0H A;  4DR1 B;  3L75 H;  4MTX A;  4EB6 B;  5LXT A;  1N8R W;  2Y4T A;  1FXH A;  3QO7 A;  3AEI A;  3TCU A;  1BE3 H;  2ZXW B;  4WCE V;  3STL C;  1HDJ A;  3H9V A;  3H1H H;  3GB7 C;  1FFX A;  2N04 A;  3OW2 U;  3E35 A;  2LO1 A;  4JI8 O;  1SQF A;  4AQY B;  2P5O A;  2JS3 A;  1S0V A;  3RVY A;  3AG1 B;  4AQY O;  1IBL O;  4C7U A;  3CC2 V;  1OCR C;  2BSK A;  1S5H C;  1NI8 A;  2OWO A;  3RYF B;  2Q7H A;  5CA3 A;  2XAQ A;  1B3Q A;  1GN2 A;  3E22 B;  2BCC H;  5KHG A;  1S5J A;  3AG3 C;  2EBO A;  2G38 A;  3FYE B;  2XAS A;  4B3R B;  3B09 A;  3W7T A;  1OJH A;  1GM7 A;  3NXS A;  3B2E E;  4DV2 B;  1WJZ A;  4DXW A;  1BL8 A;  5EZY A;  2P7T C;  4YJ2 A;  1WPB A;  2OCH A;  2ZE5 A;  3CC7 V;  4WFG A;  4NTX A;  5JJE B;  4O4L A;  3OR6 C;  2PI4 A;  3AK1 A;  3SJA C;  4X9Q A;  2R72 A;  2XAF A;  3L9D A;  4IIJ A;  5CBG A;  3H1I H;  3ZRX A;  2PY5 A;  1QLN A;  4BWA A;  3WFV A;  4JTC B;  3T4Z A;  1AR4 A;  3BFR A;  1NU1 H;  2XT9 A;  2HHH B;  3W7W A;  2ZE7 A;  2BTQ B;  4UCR A;  4PD4 F;  5E1A C;  5LYJ B;  4O4H A;  2HEP A;  2IM9 A;  3G4S V;  4GKK B;  3UO3 A;  2K9P A;  2YXH A;  2UXX A;  2ZR2 A;  2QTO A;  1WB7 A;  2R9A A;  4LFC B;  2FTK A;  4GX5 A;  3SYO A;  3TXQ A;  4LFC O;  1KMI Z;  2WLH A;  5L3E A;  1YF2 A;  1AIL A;  1R6N A;  1O9H A;  3J80 N;  1VF6 A;  5ITZ B;  4CBC A;  3T1Y B;  2AZ2 A;  4PDM A;  3JAS A;  3QO5 A;  2ZD9 A;  4D7T A;  4B3S O;  2CUG A;  1MAB G;  3C3S A;  1Q90 D;  4DR6 O;  3ML0 A;  3KCX A;  4UVA A;  4J11 A;  5IT9 N;  3CJH A;  1VQM V;  1BS3 A;  1VQ4 V;  2WAM A;  1DF4 A;  2DWE C;  3CSX A;  5IJ9 A;  4LH7 A;  4X65 O;  1RFY A;  5B1A C;  1N33 O;  4DK0 A;  3J81 N;  3DSQ A;  4FZ1 A;  2OT5 A;  4MW8 A;  4BW9 A;  2HP8 A;  5CA0 B;  3CD6 V;  2JEX A;  1PL0 A;  1WB8 A;  4I55 A;  4J7Z A;  3K03 A;  4DV7 B;  3T2M A;  4GLX A;  3RT3 C;  1PL4 A;  4UCS A;  1XHZ A;  2Q4P A;  4JTA B;  1WP8 A;  2UU9 B;  4B3M B;  5C93 A;  2PGG A;  4D6T H;  5CBH A;  3ZCC A;  3F5W C;  1NVP D;  5IWA B;  4W4K A;  3SYC A;  3CCR V;  2R9R B;  3FAV B;  3IAY A;  2F4V B;  4NR1 A;  2DYS B;  3ZRW A;  1SES A;  4DV4 O;  2P67 A;  3KCY A;  2YXL A;  3FAV A;  3HR0 A;  2VQF O;  3K08 A;  5F2V O;  4WFA V;  4KHP O;  4LWS B;  2BOB C;  2YIB D;  2ETN A;  3UM7 A;  4H44 B;  4J10 A;  2Q69 A;  3NR7 A;  4LF9 B;  3APO A;  5GTH Z;  3B77 A;  4JGS A;  5HFM A;  3OTO B;  4I50 B;  4XDL A;  3EXA A;  3SYQ A;  1WAZ A;  2ZIM A;  3JSL A;  1VF5 B;  5LBQ A;  1K4C C;  1F4M A;  1M5I A;  4QPJ A;  5J2U B;  1XMO O;  4ZBM A;  2UXB O;  1ZUQ A;  3KKY A;  4FM0 A;  3FB8 C;  1G1X B;  2HHH O;  2AGA A;  2IU3 A;  4WBN B;  1DTO A;  3QF7 A;  4ZHQ A;  4U3F H;  3N2G B;  2XTA A;  1MZE A;  3CE2 A;  1QNM A;  4GZR B;  1ARO P;  1GMG A;  4O4J A;  4TUY A;  3H1J H;  3Q4H A;  3CJH B;  3DC5 A;  3JD2 A;  2YIB A;  4FLU A;  4NKG B;  3IC7 A;  1NVP B;  3OEH G;  5KHH A;  1M56 B;  2HJD A;  1XMQ B;  2VQE O;  2ZIN A;  3L70 H;  4GCZ A;  1SZX A;  1L8D A;  4QJF B;  2PTM A;  2DYS C;  3OMN B;  2ZNJ A;  3FFQ A;  1EN5 A;  2UXD O;  2MW2 B;  2E3C A;  1EBO A;  3TK1 A;  3CCM V;  1H2G A;  3DTU B;  1FFT B;  2IJK A;  4ZOL A;  1NH2 D;  1VQ5 V;  5CMU A;  2ZR3 A;  3L71 H;  5H5N A;  4RWU A;  1LUV A;  4JTD B;  3HKE B;  1XQ8 A;  2KB1 A;  2QKA A;  1TUB A;  3QTC A;  4O2A A;  4EB6 A;  5LXT B;  2UXN A;  3J7A U;  4X65 B;  1Y4M A;  1JPX A;  5IYZ B;  4GT1 A;  1FJG B;  4DR4 O;  5BR8 B;  1Y66 A;  3ZN0 A;  2ZXW C;  1KB9 F;  4B7E A;  2P6J A;  2P90 A;  1K4D C;  1NBM G;  4DV3 B;  1L1F A;  2XOK G;  3K3W A;  4KP4 A;  1K73 W;  4YJ3 A;  4DV0 B;  4JAV A;  5EYP A;  1S5L Z;  1NTM H;  2DMX A;  2CTP A;  3AG4 C;  1WPX A;  3ZRS A;  1M90 W;  2ADP A;  1MSW D;  2E76 B;  4FLZ A;  4U3J A;  4YJ2 B;  5EZY B;  4DV5 O;  1MG1 A;  4OX9 O;  4TV9 A;  1N36 O;  2YI8 A;  2HG5 C;  4FLW A;  3D36 A;  4JI6 B;  1H38 A;  4TWK A;  5K1P A;  5KAI Z;  4JYC A;  4U7O A;  5EK0 A;  4ZI7 A;  1OCR B;  1GN3 A;  2E5L O;  4JV5 O;  2JEU A;  3P32 A;  2N74 A;  4H0L B;  4NTW A;  3D3I A;  4NXN O;  1Y76 A;  2RMK B;  1AR5 A;  2F66 C;  4JYA O;  3RYH B;  1JR9 A;  1XNR B;  2ZNI A;  1ZTE A;  1XUQ A;  3SJC C;  3ABT A;  3B8N A;  4JF3 A;  5IY5 B;  4R8C A;  3K5L A;  3FD9 A;  5IYZ A;  1H2N A;  3THO A;  1KD1 W;  5KAF Z;  1M9N A;  3CEI A;  4MVR A;  4R7C A;  1RPO A;  3OTF A;  2P22 C;  4X1K B;  4FLY A;  1AJQ A;  2ILM A;  3ABM B;  1FS0 G;  3JSN A;  1P7B A;  2WLN A;  1Q81 W;  3O9O A;  2QKS A;  4R6Z A;  4J41 A;  2C2A A;  2M7W A;  5EBM C;  4CC6 A;  4X1K A;  2A7W A;  2N05 A;  2Q0O C;  1IBM O;  4J42 A;  4ZOL B;  4DR5 O;  1R73 A;  3UT5 B;  5CB4 A;  1LUW A;  1K5Q A;  4F4L A;  3AK3 A;  5BZB A;  3ABK C;  1D2D A;  2ZM6 O;  1X4T A;  1JCH A;  2QKC A;  4PA3 A;  3JAK A;  2UUA O;  3A0B Z;  3B4S A;  2F43 G;  4Z1V A;  2P4V A;  4DW0 A;  3PN1 A;  1R6K A;  1AJP A;  1K7D A;  3JAT B;  1SS3 A;  3ZMZ A;  4P2Z A;  4I4T A;  5C8Y B;  2PI5 A;  4PDR A;  1SZT A;  4Z1M G;  2X0L A;  1CPY A;  2DQ3 A;  4LF7 O;  1O9G A;  1KYO F;  1QBZ A;  1GTO A;  1FYJ A;  3AG1 C;  1PNL A;  3E8F A;  5DN6 G;  4TT3 G;  1H8E G;  4NTY A;  5IWA O;  3JAW B;  3RYF A;  1SRY A;  3QO8 A;  4P9P A;  2YIC A;  1Y6X A;  1SKV A;  3CXC U;  5LOV B;  3K9S A;  4FFK A;  1J95 A;  4X20 B;  1DF5 A;  4I5S A;  3CP1 A;  3BEH A;  1XDC A;  3HKB A;  4I55 B;  3ABL C;  1JMK C;  3ABL B;  3PJS K;  4IHJ A;  1Y76 B;  1ZX3 A;  3D36 C;  3OUS A;  4AHC A;  1PKX A;  1OCC C;  2QDO A;  2EIM B;  2V7Q G;  4LWS A;  3ETE A;  1XNR O;  3CPW U;  3E8H A;  4JI3 O;  3A8T A;  2DN9 A;  3JCZ A;  4J80 A;  3VQV A;  4DUZ O;  4DUY B;  2WA3 A;  1G8M A;  3ZIA G;  5BXZ A;  2ZE6 A;  4IYH A;  1XMQ O;  3CHX A;  4OGQ B;  4DRX A;  3ZS8 C;  2UXB B;  1NR7 A;  5IDJ A;  3WU2 Z;  1RM1 C;  1Z2G A;  3IFX A;  2CH7 B;  4LCU C;  5AG2 A;  4JI2 B;  4LF9 O;  5KHK A;  1ZAU A;  3DGE A;  4KUM A;  3SPH A;  4WFB V;  2YDE A;  4JI2 O;  4JYA B;  4MS2 A;  3SJB C;  3L72 H;  3OUF A;  1YJW V;  3P30 A;  1HNZ O;  4FZ0 A;  4UXN A;  5EBW C;  5DEC A;  5B3S B;  3ZBH A;  2VWK A;  2Z3Y A;  3OGI B;  4LNU A;  2L35 A;  3Q4H B;  1SA0 B;  1TGO A;  3BCC H;  4FIP C;  3JAR B;  4BIZ A;  3LDD A;  3SPG A;  4CS2 A;  3UQ8 A;  5E79 Z;  1N32 O;  4PDV A;  3EFF K;  4LFB B;  3GWK C;  2OIG A;  2BE3 A;  2CE4 A;  4JZG A;  5JJJ B;  5H6R A;  3TGU H;  5JH7 B;  4U3J B;  5L3D A;  1VMG A;  2YI9 A;  2CTQ A;  2W6I G;  4CC5 A;  2IW5 A;  4LF7 B;  3N2K B;  5KA6 A;  2Z0A A;  3G6B A;  3OT7 A;  1KP3 A;  5J9P C;  1OZ0 A;  4ZIB A;  4G28 B;  4DV5 B;  3N2K A;  4CH4 A;  1VQL V;  1SQP H;  1A32 A;  2F93 B;  3DXR A;  5B1B B;  2LGW A;  2HVJ C;  1I5X A;  2LFS A;  2YSU B;  1JQ0 A;  1GN6 A;  3AG4 B;  4IT5 A;  1X59 A;  4DV0 O;  1NS1 A;  2PYJ A;  1R3I C;  1M56 C;  1K5S A;  3BRC A;  4GX0 A;  3K57 A;  3CS5 A;  5EIB D;  5GON B;  2XND G;  1MSD A;  3JAL A;  4X66 B;  3ZHR A;  3JAK B;  1SER A;  3DC6 A;  1T5E A;  1QHT A;  1QR9 A;  3WB1 A;  1NQT A;  2QE7 G;  4DV1 O;  3HKD B;  2GTA A;  4F6R A;  4JI1 O;  4LF4 B;  1K8A W;  5LP6 B;  1KUQ A;  1N36 B;  2Q5Z A;  1IBK O;  1DLB A;  2RDC A;  2EJR A;  5JJN B;  1KBH A;  1PV0 A;  4X1Y A;  2IH3 C;  1VAR A; 
#chains in the Genus database with same CATH homology
 2Y4U A;  4J7Z A;  1FAF A;  3APO A;  2LGW A;  2Y4T A;  2EJ7 A;  4RWU A;  2M6Y A;  1BQZ A;  2GUZ B;  4IT5 A;  3UO3 A;  2QWN B;  1WJZ A;  1HDJ A;  2YUA A;  2CTQ A;  2DN9 A;  2L6L A;  2PF4 E;  3AG7 A;  2QWR B;  2QWQ B;  3APQ A;  2CUG A;  2KQX A;  1NZ6 A;  2N05 A;  2QWO B;  4J80 A;  2N04 A;  1XBL A;  1BQ0 A;  2CTR A;  2CTW A;  1FPO A;  3UO2 A;  2DMX A;  2LO1 A;  3BVO A;  3UCS C;  2GUZ A;  1IUR A;  2OCH A;  2CTP A;  1N4C A;  1GH6 A;  2QSA A;  2QWP B;  2YS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...