1FAFA

Nmr structure of the n-terminal j domain of murine polyomavirus t antigens.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
MDRVLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNLRMNLGGTGFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LARGE T ANTIGEN
publication title NMR structure of the N-terminal J domain of murine polyomavirus T antigens. Implications for DnaJ-like domains and for mutations of T antigens.
pubmed doi rcsb
source organism Murine polyomavirus
molecule tags Viral protein
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2000-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1fafA00
2CTQA 2GUZA 2YUAA 1NZ6A 1GH6A 2CTWA 3APOA 1XBLA 2GUZB 2N04A 2QWPB 3APQA 2CUGA 2PF4E 3AG7A 2OCHA 2QWQB 2M6YA 1FPOA 2YS8A 4IT5A 4RWUA 1FAFA 3UCSC 2QWNB 3BVOA 2DMXA 2DN9A 2QWOB 2EJ7A 2L6LA 2Y4UA 2CTPA 2Y4TA 2CTRA 1BQZA 2QSAA 1BQ0A 2QWRB 1HDJA 2LO1A 4J7ZA 2LGWA 3UO2A 4J80A 1N4CA 3UO3A 2N05A 2KQXA 1WJZA 1IURA
chains in the Genus database with same CATH superfamily
1M57B 1ZL8B 1EBOA 4DK0A 1PPJH 3OM3B 3HKEB 3D36A 2XTAA 4G27B 2QWQB 3CRMA 3CJHA 4X64O 2WLIB 2QWOB 5EYPB 4PI2A 5IDJA 4X66B 2DE0X 2WLHA 5JVDA 1HDJA 4QNHB 2XUMA 4K0KO 3J80N 2WLLB 1F51A 2VWJA 3SYAA 4LFAB 1OJHA 3ZRXA 1QR8A 3A0BZ 2W6IG 1H2NA 3I56V 4TV9B 4E4EA 4EFBA 3RYIB 4DV6B 3T1CA 2Y4TA 3KCXA 4MVOA 1FJGB 4MTFA 4FIPC 3OT7A 2JIZG 1UFIA 3AG1C 2R9IA 4B3RB 1TA8A 2K9PA 4DUYB 5CA1A 2DJVA 5IE9A 1SA0B 4U7NA 2YICA 3L9DA 4H33A 4FFBB 4Q6GA 3TK1A 1EM1A 3ZMTA 1R6NA 3VQXA 1KKCA 1OCZC 2A9HA 1IBKO 3J7AU 5B1BB 4BIUA 1RSOB 2KQXA 3ZMUA 4RUFA 1KUQA 4ZI7B 3O65A 3STLC 4UCTA 2EILB 3AEIA 2VWKA 4WFBV 4I0XB 3B2EE 1AI6A 1AR5A 2Q7EA 4I5SA 4LFBO 4U7OA 1N0JA 3ETDA 4J10A 5EBMC 4X9QA 3JCUZ 2JS3A 4PDRA 3DC6A 3ZHSA 2NNUA 1GKFA 3E8BA 1QQCA 2A79B 3SPCA 2Y0IA 4X89A 1K5QA 1NQTA 3APQA 3ABMB 3G6BA 5CBFA 4O4JB 4LF6B 2UUAB 3BRCA 4DV7O 3T4DA 4FM2A 1HR0O 1N34O 5LXTA 1HNZO 4I4TB 4NVPA 4F6RA 1GN6A 1US6A 4X62B 1GN3A 1YJWV 3ZRWB 1QNMA 2GTAA 5LHIA 1ZSPA 4IIJB 1XNRO 3M99B 4WFFA 3K3WA 3ABMC 3RYFB 2HP8A 4KL1A 4I9QA 1VQKV 2ZE7A 3LDDA 2LFRA 4OPHA 5ITZA 4R7CA 4X65B 5LGNA 3P3NA 4JI6B 1B04A 1BL8A 2ZKOA 4LFCB 3ABLC 2CTWA 3ASNB 1YSCA 2ZR2A 4IHJB 5LYJA 2EX3A 3ZIAG 3MHSC 2Z5UA 2MK3A 4MVSA 1JR9A 4F4LA 4JZGA 1G6UA 2GSMB 2M7WA 3HKBA 1ZUQA 2Q0OC 4FLTA 2BTQB 2AGAA 2HJDA 4DXWA 1P84F 2F1MA 1QVFU 1B06A 3SPGA 1FJGO 5CB4B 4DUZB 4KFMA 1RM1B 3CJHB 4YXWG 3UT5A 1BMFG 1AJPA 3OUFA 4RAIA 1KU9A 2QWRB 2UXDO 3FYEB 3H1IH 5JVDB 1I0HA 1DF4A 3LDEA 5B1AB 1Q86W 2JJ2G 2PZSA 4DR3B 2B5UA 1I7FA 5E1AC 5JH7A 3CPWU 1AJQA 5LBQA 1QU7A 2VQFB 3D36C 4MVQA 3W7WA 1WNSA 3T1YB 5HFLA 5KX5A 3BPZA 5CA3A 1EN4A 2WWWA 2YEVA 3CHXA 1NJIW 2ATKC 4I9WA 2QTOA 5B1AC 3K04A 5CA1B 2P06A 3GVMA 4PD4F 1U97A 4UVCA 2Z3YA 4B3TO 4QGPA 3S3XA 3SYCA 2UXNA 3U10A 1MSDA 4WFHA 3ZN0A 1M93A 1HW7A 1JCHA 1MABG 1SQPH 2CDYA 3QF7A 2B1GA 2CTQA 2UUAO 2YIAA 2H8PC 1MNGA 2G38A 5LMNB 4MW3A 2QKAA 4CH4A 4DV0B 4LC1A 3CRAA 4FLWA 2XAQA 1S77D 3DXRA 1RPOA 5GTIZ 3WB2A 4AILC 2OYQA 4GX2A 3AG3C 3B09A 1I94O 3K57A 1NR1A 3L75H 1IBMB 2QEXV 2Q73A 3BHPA 1FS0G 2IU3A 5BR8O 3BY6A 1K97A 2CGNA 1X4TA 1V55B 5IYCO 5EZYA 2E3CA 5KMGA 4JI6O 2QKSA 5DM6V 1EN5A 3W7SA 1FXVA 4U3JA 1FFTB 2FTKA 3H1KH 4LFCO 2UUCB 3RWRD 1SQVH 4ZOLA 2H3OA 4K8XA 5LXTB 1VF5B 4DR4O 1H2LA 1YI2V 4F6RB 2C2AA 2DWDC 5IY5B 1M1KW 5GW7A 4YJ3B 4E2LA 4AI8A 2QA4V 2GDSA 2XAFA 2YS8A 2LFSA 1V55C 4K35A 2QJ1A 4D7TA 5KUKA 4LF5O 3CRCA 3PN1A 1SETA 5ITZB 3E2EA 2X6BA 4G2KA 3P3PA 4GT1A 3HB3B 4NR1A 5J2UB 4CH3A 1NI8A 2YUAA 4ZHQA 3VQVA 1KYOF 4EFEA 3KCYA 4AQYO 2DWEC 1K33A 2E5LO 5LL6Y 5IY5C 1R3KC 4Z2WA 4QE9A 5LYJB 2L35A 2OCCB 4TUYA 3HPLC 1IBLB 4UCRA 2Y4UA 1RPRA 1OCOB 3HKBB 3JD3A 4IGGA 1Z2GA 2ZD9A 3DC5A 4WFAV 3NXSA 4PHZA 5BXZA 1N8RW 1AR4A 4TT3G 3AG4B 3G6EV 3E8FA 4DV5B 1VQ5V 4PELA 2OCCC 3JATA 4MS2A 1GO3F 2RDCA 5BY1A 5L3FA 2KG7A 2FL4A 4YY3B 1XHZA 1TUEB 1Y76A 2F95B 2PYJA 2HJFC 4J7JA 1VQLV 3R65A 1K92A 2ZXWC 5JH7B 3GB7C 3IFXA 1W2BU 1NTKH 3ABKC 3QVNA 4EEQA 4DR2O 5H5NA 4XDJA 1PNMA 1N32B 1KECA 3P32A 4X1IA 3ZHQA 2DYRB 3E22B 2N05A 4LH7A 1AVMA 1YTFB 2JDIG 2E74B 4FLZA 1YTFD 5EIBD 1D2DA 1WP7A 1GM7A 4NYKA 5IYBO 1S5JA 5BMVA 5KAFZ 3T1HB 1SC5B 1F4NA 3FB5C 2DYSC 4J41A 3ZJZA 2OTLV 3RYCA 2DYRC 3ICXA 2BE3A 3UM7A 4WFGA 2ZQMA 4OPAA 3JYCA 1J95A 2UUCO 3BCCH 3K79A 5EIBC 3A0RA 5BZBA 2A0LA 2Q4PA 4TV8A 4MVUA 2D2CB 3DXRB 3N27A 3FX7A 4O2BA 4NTXA 3T2MA 2CTRA 2UUBB 1K8AW 1AJNA 2HG5C 4RQFA 4FVMA 2ITCC 1YITV 1VMGA 4LF4O 2Y0PA 2IJIA 4HYOA 2ZM6O 4JI1O 3ETQA 4KHPO 4YHHO 1URFA 3FFQA 5EZYB 1Q5OA 5KMGB 2FB5A 1PV0A 4I50A 4U3JB 3TCUA 1DK1A 1Q8IA 1GAXA 4UVBA 2N74A 4GKKB 4JGSA 4EB6A 1TVKA 1VP7A 1ZTEA 1IBLO 4UCSA 4UCOA 3OD4A 2CK3G 3F7VC 2JGDA 4DK1A 4P2ZA 2ZE5A 1O9GA 1QLEC 4MT8A 3A8TA 4QIWF 1KKDA 1KBHA 2DMXA 1NTZH 4PA3A 4TSFG 4DV5O 1GM8A 4PDLA 1W0JG 3U11A 2BOBC 4JI4B 4R6ZA 3ZHRA 3CC7V 4JI8B 4ZHQB 3ABTA 2X0LA 1FPOA 5DECA 4LCUC 4FK5C 4PJ0Z 4Q20A 4TUYB 2K1EA 1RP3B 3VOUA 2B1IA 1DLBA 5LGTA 3ZS8C 1YIJV 1YCIA 2HKOA 3THOA 4O4IA 3CCVV 1WP8A 2GUZB 1I5YA 5B3SC 2N04A 4JI3B 5D5QA 4GKJO 1N32O 2VQEB 2Q7HA 4PDVA 3OUSA 5H2FZ 5FNVA 2YI9A 1L0NH 2CH7A 2QM8A 2P22C 3WFVA 1IVSA 1Q6UA 3AG1B 1SZTA 3JATB 3SYPA 2FYUH 3HKDA 4DW1A 2HEPA 1R3LC 3VQWA 5B66Z 3A0HZ 5A9GA 1Y76B 1B6QA 4H37A 3ZMZA 1DGSA 1WAZA 1UJWB 1M9NA 4MTGA 1VQ7V 4JI0B 1HNXB 4PA6A 1Q7YW 2HVKC 1OCZB 3LUTB 3D3QA 2OIGA 4MTOA 1K5SA 1NVPB 4UV9A 3WB1A 1XNQB 1Y4MA 1NVPD 4MVMA 3CC2V 1XREA 4DV2O 1I08A 2Q9LA 2UUBO 1JMKC 5IWAB 4OX9B 3SPIA 3F5TA 2QWNB 1AR1B 1AP6A 1YJ9V 2PY5A 2P7TC 3JD2A 5BMVB 4J9YB 4HNAA 3CMEV 2QM7A 2UXBO 2XAJA 3SPJA 3H9VA 3TXSA 3RYCB 2JS5A 2NLJC 1MSWD 1SQQH 1M90W 4NXNB 1F23A 3E8GA 3JASA 3OEEG 4DR5B 4TV8B 1YJNV 3SGIA 4JYAO 4Z1MG 2F93B 4O2BB 3IJ4A 3ZCCA 4O4HA 2WLMA 1BT8A 3ZEDA 3LSUA 4BAYA 4BW9A 5L3BA 2IBZH 4GYCB 1PD3A 3APOA 3RVYA 4NXMB 2UU9B 4DR1B 1WA8A 3CXHF 5EBLC 1M56B 5J9PC 2A7WA 4KXRA 4I50B 4X20A 4CBCA 3FKSG 1Q3EA 4BWAA 3ABLB 3TETA 4LR3A 4EB6B 5C8YB 2DOSA 1SQXH 1TVKB 2QE7G 2XNDG 3T4ZA 1Y74A 4FLUA 1V54B 2R70A 1Q6HA 2JGDB 3E89A 2Q0AA 3JAKA 2Q69A 4LNUA 4X1KA 4LF8O 1T5EA 4NTYA 4BIOA 2P4KA 2EJRA 5L3GA 1M56C 3K58A 3AG2C 4JV5B 3STZC 5LP6A 1VQPV 1QR9A 3SYOA 4WBNA 2WLKA 1YEWA 4X66O 4J42A 1V54C 5F2VO 2L6LA 4CZZA 3L74H 1K3EA 4LFAO 1M5IA 1GM9A 1TAEA 4JAUA 1WPXA 2X7RB 5KUMA 4DV6O 3ZRVA 3B8MA 4I55A 4O4IB 4XDKA 1MG1A 4B3RO 5FNVB 4J9ZB 2CH7B 3BABA 4DUYO 1BQZA 2RQ6A 2YXLA 1H8HG 1WB8A 1QVGU 4ZIBA 3K5LA 1VQMV 2EINC 4B3MB 3HKDB 1WLEA 4OX9O 4K3AA 3LDCA 2WAMA 1ENVA 2KB1A 3I55V 3CCMV 3L72H 4L8JA 4P30A 3ZHTA 1AP5A 1K4DC 3K9SA 1J5EB 2X6AA 3HR0A 3O9OA 3K08A 3OR6C 2RMKB 3ETGA 1XMOB 4NXNO 4DRXA 4W4KA 5LMUB 3AG7A 4YIOA 4XDLA 4LP8A 2D3OW 4HZ3A 3FB6C 5D5PA 3F5WC 3BVOA 4FLXA 2DN9A 1GRJA 3AG3B 4A5UB 4DO2A 4PA4A 2V1DA 1Q82W 4DR1O 5CBHA 2JJ1G 4LF6O 1BGYH 2YSUB 1IZ3A 3ASOB 3K5MA 3L70H 4CS2A 3JAMN 3EXAA 2WSSG 1F7YA 1QBZA 4QJFB 1H2MA 5IYZA 3JASB 1P7GA 2EIJC 4X62O 4X88A 1EZVH 4FM0A 2HHHB 4ABMA 5KHIA 1R73A 4FMTA 1ROPA 4EKWA 4IYHA 4LF9B 3ASOC 4PDMA 1KC8W 4X65O 1Q90D 1N33B 3N2KA 1WA8B 1MA1A 1AROP 3KG2A 2AHZA 4X20B 2Y48A 2YI8A 3CCJV 3KKYA 1HP8A 5LHHA 3CCRV 5GONA 2A3QA 2OCHA 1Y74B 3QO7A 2ZR3A 1OCCB 1Z5WA 3UCSC 3JAKB 4TQFA 2P90A 2YXYA 3OTOB 1JA8A 1MZEA 4IYIA 5KHKA 1THZA 4X1KB 2Q8VA 1IXBA 3ZMVA 2X6CA 1KB9F 2JRIA 1K9MW 1KD1W 4UFZA 1FYJA 2PTMA 1R3JC 4DUZO 2QTSA 3OGIB 2LJ2A 4LF7B 2HR3A 5IJ9A 4UV8A 3ZRSA 1OCCC 2YIDA 1YDXA 4ZKIA 4DR3O 1N4CA 4UB8Z 2NN4A 2VQFO 4YIPA 3CCEV 1BZKA 3SJBC 2YC0A 2ZXWB 5LP6C 1OV9A 4NKGB 2CAZC 3GWOA 1G4YB 3RFRA 5LA6A 4I55B 3T1YO 1JOYA 3QG5A 1J5EO 4B3SB 3ABKB 4GX1A 2ZDIC 3JSLA 1S3JA 5AG2A 2IU0A 1AB3A 3ABUA 2ZIOA 3UT5B 3OFNG 4MVRA 1W0KG 3G67A 3SPHA 3RW0A 2VS0A 1ZL8A 1VQNV 2MW2B 4KUMA 3AK2A 1BE3H 4UCVA 3EFFK 3MD0A 4JPRA 2HFEC 1BCCH 4AHCA 1Q43A 4DYLA 3JCZA 2Y69C 1E79G 4JAVA 2YIBA 5LMNO 3VBBA 2WLLA 2DYSB 1U96A 2VRZA 1O9HA 2QKCA 4J7ZA 4DV0O 3W7XA 4FZ0A 5KX5B 2F4VB 3JD4A 1SS3A 4PV1B 2YEVB 2EIKC 4YJ2A 3OR7C 2QR4A 3J81N 4MSWC 3E86A 4JYCA 1IBMO 1AI7A 3CE2A 1BQ0A 3CS5A 4TQDA 4Z1VA 4X64B 1Q6IA 1CXZB 5LHGA 1AILA 2WPDG 1N33O 1M4UA 4U3FH 3CB2A 3AK3A 4CS4A 5KHGA 5EC2C 5L3EA 4FFBA 4K0KB 1GTOA 2M6YA 4RWUA 3IC9A 4JI7B 3FB8C 3EVKA 5IYZB 2IJJA 4UCUA 1QHTA 2ZE6A 1EZJA 1Z5VA 2Q6AA 4ASUG 3CRRA 1IDSA 3OTOO 3JALA 4LBEC 4FLYA 1QLEB 3LNNA 3CP1A 4I0XA 3SDLA 3RYHA 1PL4A 4GX5A 1VQ8V 4CH6A 1XI1A 4HAMA 3N2KB 3WG7C 4DW0A 1NT2B 4HBNA 1JJOA 2IJKA 1K34A 4J80A 1D5NA 1XL4A 2R72A 1A32A 4P9OA 4LF7O 3K0GA 4B7KA 3LSSA 4ZOLB 3B8NA 3G4SV 1JVMA 4UUJC 2P4VA 3G80A 1IBKB 2WA4A 3L73H 5FL7G 2CUGA 4O2AA 5GONB 2ADPA 2YDEA 3OMAB 3RN4A 2RNBA 1OZ0A 5LGUA 5JCOA 4FFKA 3G71V 3CCSV 4I4TA 1FXKC 2Q67A 1ORQC 4X1YA 4ICGA 3QO8A 1UPGA 2DQ3A 4LFBB 2OIEA 3C3TA 4F6EA 5TISZ 3CD6V 4PI0A 5B3SB 1LUWA 4IIJA 2QWPB 4R8CA 3ZN1A 1VQ4V 3K06A 1YZBA 4GUNA 4B7EA 5IJ9B 4YY3O 2CTPA 4H0LB 2EIMC 5H6QA 2OT5A 1GK9A 2ILMA 3CX5F 1HR0B 4TOIA 1YVWA 2XASA 1HNZB 1VQ6V 2B9ZA 2GTSA 5LA6B 5B1NA 1XNRB 1JPXA 2IJHA 3CMAV 4JTAB 2H94A 1JFFA 3RT3C 1KMIZ 5KHJA 2KG7B 1GH6A 1YXBA 1S72V 4K8ZA 3D3IA 1EN6A 5CB4A 2HLDG 5E79Z 4ZBMA 3T1HO 1OCRB 5JJEB 1X59A 4G28B 3SR2C 2QSAA 4IL6Z 4X8AA 3I5DA 3BAAA 2W0FC 3C3SA 3FD9A 3B40A 2YIBD 4X1IB 5KA5A 2XAHA 4WCEV 3CSXA 5CMUA 4JI7O 3B4SA 1M57C 2DW4A 2GBOA 2EZPA 3ETEA 1GMGA 1OCRC 4YJ2B 1S76D 2GHYA 3KZIZ 2EULA 5FPOA 2LQTA 5KHHA 1Y6XA 3GWKC 2BSKA 1FD9A 1PM9A 3K03A 3RGBA 3IC7A 1BHBA 2LGWA 4JF3A 4C7UA 1LNQA 2FMLA 4DV1B 1TUBA 1KP2A 2UXDB 4FPPA 3ZHUA 1SESA 4RQEA 1XOUA 3QNEA 4CS3A 1K7DA 4GKKO 3VQYA 1PNLA 4LWSA 4DR6B 1NH2B 1N36B 5HFMA 3MHHC 2P5OA 1NH2D 2KSDA 3MAQA 4FLVA 4J7KA 4BW5A 3OMIB 1R6TA 3JALB 3PJSK 3RYHB 1VARA 1VF6C 1D5AA 5KAIZ 2IW5A 5CA0A 4JI4O 1HNWB 3AG2B 4B3TB 5JQGA 2CGOA 4JI8O 5JWPA 2V7QG 5B1BC 1XILA 3CCLV 2PUSA 3ZMSA 3FAVA 3WB0A 1XL6A 1SRYA 2XHBA 4H44B 1YHQV 2EILC 1S0VA 4O2AB 2WLJA 1YF2A 4I7ZB 3H1JH 1XDCA 3IGAC 4JI3O 4X1YB 2VQEO 4YJ3A 1G8MA 1I94B 4FZ1A 3SJAC 2ZDIA 3E83A 4B08A 1S5LZ 3CYOA 4QPJA 1H2SB 1NS1A 5BR8B 2ETNA 1H8EG 2DQ0A 2WA3A 1KP3A 3CC4V 3SJQC 5J2UA 3K5NA 5JCOC 2EINB 2ITDC 3CXCU 3JD1A 3H01A 4JI0O 3JAWA 4QE7A 1CEZA 4DR7B 1HNXO 2HVJC 3JARA 1SERA 2JVDA 4DR4B 4IT5A 4OXSA 1SF9A 2RCVA 2QGNA 4PA9A 3M8AA 1L1FA 1XNQO 2F23A 4TWKA 2Z0AA 2E76B 4JASA 2R9RB 2F43G 1JFFB 3N2GA 4LF5B 5IWAO 1ZX3A 1L0LH 1XBLA 4D6TH 1FXHA 3ASNC 2XT9A 3EHBB 4H13B 3K59A 2LGQA 1CP9A 1ZWIC 4AQYB 1AI4A 4DV1O 1XMQB 3H1HH 2E5LB 4JZ2A 4FJCC 3QO5A 2JEXA 2PYLA 2LO1A 1SQGA 5IJ0A 3LSQA 1BHAA 3TJTA 1WN7A 3QTCA 2LP7A 3Q4HA 2PI4A 3ML0A 4DR5O 3W7UA 1NKDA 3HKCA 4MW8A 1V9PA 1BS3A 4DR6O 1FAFA 2PI5A 3K9AA 1GN4A 3X2QB 1RM1C 1N36O 2EIJB 1VF7A 3E22A 1RFYA 4NTWA 3UO2A 2BSKB 2CE4A 3AK1A 4NXMO 2UXXA 1LR1A 3CCQV 2UU9O 4CC5A 1IURA 4HNAB 1SQBH 2JGUA 2A06H 1TUBB 2R9AA 3C90A 1ZLZA 5B5EZ 1HNWO 3BA9A 1P49A 2UXCB 4PA7A 3CWBH 5JJNB 3X2QC 1XHXA 1R3IC 2PGGA 2ZNIA 4LWSB 4CH5A 4DR2B 3DSQA 4O4HB 5K1PA 1TGOA 2IM9A 3TXQA 2ZE8A 2LW7A 4QPKA 1S5HC 1QLNA 2ZT9B 1K73W 4NB5A 2V4DA 5CN0A 1L8DA 1PP9H 4JAAA 2AHYA 1XQ8A 4JV5O 2F66C 3U0ZA 1FXKA 1E1RG 2EJ7A 1FFXA 1BSMA 5A2QN 5CA0B 1LUVA 5JQGB 3ZBHA 1KQSU 1MOFA 2NR5A 3FYIB 4JI5B 1G1XB 1SKVA 3FAVB 2EBOA 1SQFA 4GCZA 1R1BA 5KLVH 4DV4B 4O4LA 1JQ0A 5H6RA 5FLXN 1P7BA 1R6KA 1B3QA 4LNUB 2OWOA 4WF9V 4DR7O 3BEHA 3B77A 4GX0A 2JK5C 4GZRB 5LP6B 5L3CA 4WBNB 1SZXA 1EFRG 3BA8A 4LH6A 4R50A 4LF4B 3W7TA 2P6JA 4D7SA 2ZM6B 3JD0A 2E75B 4B3MO 1NR7A 4JI1B 4KHPB 4YHHB 4RUEA 3DGEA 3L71H 1F4MA 3CEIA 5DN6G 1VIBA 1XMQO 4UB6Z 3RVZA 5LOVA 3JAWB 2XAGA 3S3WA 1H2KA 5C93A 3TGUH 2AZ0A 3JARB 3WU2Z 3OE7G 5EBWC 2Y69B 4N21A 1XMOO 3E35A 2P67A 5J2TA 2XOKG 2IH3C 2W6JG 1PKXA 3MDSA 3A2FA 1WJZA 5LMUO 4JI2B 2GUZA 3HKEA 2QDOA 3N2GB 1I5XA 3OAAG 2ODMA 2EIKB 1IXMA 5L3DA 4MTXA 2FKXA 3FB7C 3UQ8A 1VQ9V 3NR7A 2WLIA 1Y66A 5EYPA 1NTMH 3DTUB 2AW9A 3ZX6A 5K1XA 1OHHG 5DEDA 1MZFA 1DF5A 1OCOC 2KKWA 2AXTZ 3E8HA 2ZIMA 4DV3B 4OGQB 5JJJB 1VQOV 5IJ0B 3H1LH 3Q4HB 2UXCO 3AG4C 4TV9A 3OEHG 3K0DA 3RYIA 4DRXB 3HKCB 2GV9A 1COWG 1GN2A 4P9PA 1Q81W 4GKJB 1NBMG 2HHHO 5EC1C 3UKMA 2AZ2A 2JEUA 4FM1A 4LF9O 3RBZA 1NZ6A 2W0XA 4JTDB 2RN9A 2ZCEA 3OW2U 4L87A 1SA0A 3P30A 2Q7GA 1FKAO 1VF6A 3F7YC 5IYDO 4JTCB 3WG7B 1WPBA 1XUQA 1RSOA 4JI5O 1HWYA 4ZI7A 1N0NA 2Q68A 4DV4O 5B1OA 2BTOA 1CPYA 4UXNA 3R66A 2ZINA 3CRQA 2OTJV 1MMMA 1DTOA 2BCCH 4KP4A 1K4CC 4MVZA 4DV2B 1JJ2U 1PL0A 1FXKB 1VEWA 5IT9N 1XEQA 1E1QG 3UO3A 1FFXB 3OGCC 4WFEA 4UVAA 1JX9A 4O4JA 3ZHVA 3D8CA 4J11A 4GLXA 2UXBB 1P4RA 2LW1A 4CC6A 4O4LB 2EIMB 4LF8B 2Q5ZA 2O57A 5C8YA 4JYAB 4BR6A 5EK0A 2ADQB 1Y67A 4B3SO 1W59A 3ZRWA 2BOCC 1H38A 3SYQA 1QCEA 4W4LA 2PF4E 4JYYA 3RYFA 2IH1C 2ZNJA 2WLNA 1AI5A 4JI2O 5H9CA 4RO2A 2EZOA 2QM4A 5KA6A 3SJCC 1PNKA 4DV7B 5FPRA 3BFRA 1WB7A 5GTHZ 2RJZA 3K5OA 3LNMB 4IHJA 2YXHA 1ZAUA 4XBFA 1N34B 3CCUV 1NU1H 3OTFA 3OMNB 5LOVB 3IAYA 1H2GA 3JSNA 4DV3O 3M7MX 1IX9A 5CBGA 2F4VO 4N23A 2BTQA 2ARHA 4JYBA 5J2TB 4BIZA
chains in the Genus database with same CATH topology
2CTQA 2GUZA 2YUAA 1NZ6A 1GH6A 2CTWA 3APOA 1XBLA 2GUZB 2N04A 2QWPB 3APQA 2CUGA 2PF4E 3AG7A 2OCHA 2QWQB 2M6YA 1FPOA 2YS8A 4IT5A 4RWUA 1FAFA 3UCSC 2QWNB 3BVOA 2DMXA 2DN9A 2QWOB 2EJ7A 2L6LA 2Y4UA 2CTPA 2Y4TA 2CTRA 1BQZA 2QSAA 1BQ0A 2QWRB 1HDJA 2LO1A 4J7ZA 2LGWA 3UO2A 4J80A 1N4CA 3UO3A 2N05A 2KQXA 1WJZA 1IURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTQ A;  2GUZ A;  2YUA A;  1NZ6 A;  1GH6 A;  2CTW A;  3APO A;  1XBL A;  2GUZ B;  2N04 A;  2QWP B;  3APQ A;  2CUG A;  2PF4 E;  3AG7 A;  2OCH A;  2QWQ B;  2M6Y A;  1FPO A;  2YS8 A;  4IT5 A;  4RWU A;  1FAF A;  3UCS C;  2QWN B;  3BVO A;  2DMX A;  2DN9 A;  2QWO B;  2EJ7 A;  2L6L A;  2Y4U A;  2CTP A;  2Y4T A;  2CTR A;  1BQZ A;  2QSA A;  1BQ0 A;  2QWR B;  1HDJ A;  2LO1 A;  4J7Z A;  2LGW A;  3UO2 A;  4J80 A;  1N4C A;  3UO3 A;  2N05 A;  2KQX A;  1WJZ A;  1IUR A; 
#chains in the Genus database with same CATH topology
 1M57 B;  1ZL8 B;  1EBO A;  4DK0 A;  1PPJ H;  3OM3 B;  3HKE B;  3D36 A;  2XTA A;  4G27 B;  2QWQ B;  3CRM A;  3CJH A;  4X64 O;  2WLI B;  2QWO B;  5EYP B;  4PI2 A;  5IDJ A;  4X66 B;  2DE0 X;  2WLH A;  5JVD A;  1HDJ A;  4QNH B;  2XUM A;  4K0K O;  3J80 N;  2WLL B;  1F51 A;  2VWJ A;  3SYA A;  4LFA B;  1OJH A;  3ZRX A;  1QR8 A;  3A0B Z;  2W6I G;  1H2N A;  3I56 V;  4TV9 B;  4E4E A;  4EFB A;  3RYI B;  4DV6 B;  3T1C A;  2Y4T A;  3KCX A;  4MVO A;  1FJG B;  4MTF A;  4FIP C;  3OT7 A;  2JIZ G;  1UFI A;  3AG1 C;  2R9I A;  4B3R B;  1TA8 A;  2K9P A;  4DUY B;  5CA1 A;  2DJV A;  5IE9 A;  1SA0 B;  4U7N A;  2YIC A;  3L9D A;  4H33 A;  4FFB B;  4Q6G A;  3TK1 A;  1EM1 A;  3ZMT A;  1R6N A;  3VQX A;  1KKC A;  1OCZ C;  2A9H A;  1IBK O;  3J7A U;  5B1B B;  4BIU A;  1RSO B;  2KQX A;  3ZMU A;  4RUF A;  1KUQ A;  4ZI7 B;  3O65 A;  3STL C;  4UCT A;  2EIL B;  3AEI A;  2VWK A;  4WFB V;  4I0X B;  3B2E E;  1AI6 A;  1AR5 A;  2Q7E A;  4I5S A;  4LFB O;  4U7O A;  1N0J A;  3ETD A;  4J10 A;  5EBM C;  4X9Q A;  3JCU Z;  2JS3 A;  4PDR A;  3DC6 A;  3ZHS A;  2NNU A;  1GKF A;  3E8B A;  1QQC A;  2A79 B;  3SPC A;  2Y0I A;  4X89 A;  1K5Q A;  1NQT A;  3APQ A;  3ABM B;  3G6B A;  5CBF A;  4O4J B;  4LF6 B;  2UUA B;  3BRC A;  4DV7 O;  3T4D A;  4FM2 A;  1HR0 O;  1N34 O;  5LXT A;  1HNZ O;  4I4T B;  4NVP A;  4F6R A;  1GN6 A;  1US6 A;  4X62 B;  1GN3 A;  1YJW V;  3ZRW B;  1QNM A;  2GTA A;  5LHI A;  1ZSP A;  4IIJ B;  1XNR O;  3M99 B;  4WFF A;  3K3W A;  3ABM C;  3RYF B;  2HP8 A;  4KL1 A;  4I9Q A;  1VQK V;  2ZE7 A;  3LDD A;  2LFR A;  4OPH A;  5ITZ A;  4R7C A;  4X65 B;  5LGN A;  3P3N A;  4JI6 B;  1B04 A;  1BL8 A;  2ZKO A;  4LFC B;  3ABL C;  2CTW A;  3ASN B;  1YSC A;  2ZR2 A;  4IHJ B;  5LYJ A;  2EX3 A;  3ZIA G;  3MHS C;  2Z5U A;  2MK3 A;  4MVS A;  1JR9 A;  4F4L A;  4JZG A;  1G6U A;  2GSM B;  2M7W A;  3HKB A;  1ZUQ A;  2Q0O C;  4FLT A;  2BTQ B;  2AGA A;  2HJD A;  4DXW A;  1P84 F;  2F1M A;  1QVF U;  1B06 A;  3SPG A;  1FJG O;  5CB4 B;  4DUZ B;  4KFM A;  1RM1 B;  3CJH B;  4YXW G;  3UT5 A;  1BMF G;  1AJP A;  3OUF A;  4RAI A;  1KU9 A;  2QWR B;  2UXD O;  3FYE B;  3H1I H;  5JVD B;  1I0H A;  1DF4 A;  3LDE A;  5B1A B;  1Q86 W;  2JJ2 G;  2PZS A;  4DR3 B;  2B5U A;  1I7F A;  5E1A C;  5JH7 A;  3CPW U;  1AJQ A;  5LBQ A;  1QU7 A;  2VQF B;  3D36 C;  4MVQ A;  3W7W A;  1WNS A;  3T1Y B;  5HFL A;  5KX5 A;  3BPZ A;  5CA3 A;  1EN4 A;  2WWW A;  2YEV A;  3CHX A;  1NJI W;  2ATK C;  4I9W A;  2QTO A;  5B1A C;  3K04 A;  5CA1 B;  2P06 A;  3GVM A;  4PD4 F;  1U97 A;  4UVC A;  2Z3Y A;  4B3T O;  4QGP A;  3S3X A;  3SYC A;  2UXN A;  3U10 A;  1MSD A;  4WFH A;  3ZN0 A;  1M93 A;  1HW7 A;  1JCH A;  1MAB G;  1SQP H;  2CDY A;  3QF7 A;  2B1G A;  2CTQ A;  2UUA O;  2YIA A;  2H8P C;  1MNG A;  2G38 A;  5LMN B;  4MW3 A;  2QKA A;  4CH4 A;  4DV0 B;  4LC1 A;  3CRA A;  4FLW A;  2XAQ A;  1S77 D;  3DXR A;  1RPO A;  5GTI Z;  3WB2 A;  4AIL C;  2OYQ A;  4GX2 A;  3AG3 C;  3B09 A;  1I94 O;  3K57 A;  1NR1 A;  3L75 H;  1IBM B;  2QEX V;  2Q73 A;  3BHP A;  1FS0 G;  2IU3 A;  5BR8 O;  3BY6 A;  1K97 A;  2CGN A;  1X4T A;  1V55 B;  5IYC O;  5EZY A;  2E3C A;  5KMG A;  4JI6 O;  2QKS A;  5DM6 V;  1EN5 A;  3W7S A;  1FXV A;  4U3J A;  1FFT B;  2FTK A;  3H1K H;  4LFC O;  2UUC B;  3RWR D;  1SQV H;  4ZOL A;  2H3O A;  4K8X A;  5LXT B;  1VF5 B;  4DR4 O;  1H2L A;  1YI2 V;  4F6R B;  2C2A A;  2DWD C;  5IY5 B;  1M1K W;  5GW7 A;  4YJ3 B;  4E2L A;  4AI8 A;  2QA4 V;  2GDS A;  2XAF A;  2YS8 A;  2LFS A;  1V55 C;  4K35 A;  2QJ1 A;  4D7T A;  5KUK A;  4LF5 O;  3CRC A;  3PN1 A;  1SET A;  5ITZ B;  3E2E A;  2X6B A;  4G2K A;  3P3P A;  4GT1 A;  3HB3 B;  4NR1 A;  5J2U B;  4CH3 A;  1NI8 A;  2YUA A;  4ZHQ A;  3VQV A;  1KYO F;  4EFE A;  3KCY A;  4AQY O;  2DWE C;  1K33 A;  2E5L O;  5LL6 Y;  5IY5 C;  1R3K C;  4Z2W A;  4QE9 A;  5LYJ B;  2L35 A;  2OCC B;  4TUY A;  3HPL C;  1IBL B;  4UCR A;  2Y4U A;  1RPR A;  1OCO B;  3HKB B;  3JD3 A;  4IGG A;  1Z2G A;  2ZD9 A;  3DC5 A;  4WFA V;  3NXS A;  4PHZ A;  5BXZ A;  1N8R W;  1AR4 A;  4TT3 G;  3AG4 B;  3G6E V;  3E8F A;  4DV5 B;  1VQ5 V;  4PEL A;  2OCC C;  3JAT A;  4MS2 A;  1GO3 F;  2RDC A;  5BY1 A;  5L3F A;  2KG7 A;  2FL4 A;  4YY3 B;  1XHZ A;  1TUE B;  1Y76 A;  2F95 B;  2PYJ A;  2HJF C;  4J7J A;  1VQL V;  3R65 A;  1K92 A;  2ZXW C;  5JH7 B;  3GB7 C;  3IFX A;  1W2B U;  1NTK H;  3ABK C;  3QVN A;  4EEQ A;  4DR2 O;  5H5N A;  4XDJ A;  1PNM A;  1N32 B;  1KEC A;  3P32 A;  4X1I A;  3ZHQ A;  2DYR B;  3E22 B;  2N05 A;  4LH7 A;  1AVM A;  1YTF B;  2JDI G;  2E74 B;  4FLZ A;  1YTF D;  5EIB D;  1D2D A;  1WP7 A;  1GM7 A;  4NYK A;  5IYB O;  1S5J A;  5BMV A;  5KAF Z;  3T1H B;  1SC5 B;  1F4N A;  3FB5 C;  2DYS C;  4J41 A;  3ZJZ A;  2OTL V;  3RYC A;  2DYR C;  3ICX A;  2BE3 A;  3UM7 A;  4WFG A;  2ZQM A;  4OPA A;  3JYC A;  1J95 A;  2UUC O;  3BCC H;  3K79 A;  5EIB C;  3A0R A;  5BZB A;  2A0L A;  2Q4P A;  4TV8 A;  4MVU A;  2D2C B;  3DXR B;  3N27 A;  3FX7 A;  4O2B A;  4NTX A;  3T2M A;  2CTR A;  2UUB B;  1K8A W;  1AJN A;  2HG5 C;  4RQF A;  4FVM A;  2ITC C;  1YIT V;  1VMG A;  4LF4 O;  2Y0P A;  2IJI A;  4HYO A;  2ZM6 O;  4JI1 O;  3ETQ A;  4KHP O;  4YHH O;  1URF A;  3FFQ A;  5EZY B;  1Q5O A;  5KMG B;  2FB5 A;  1PV0 A;  4I50 A;  4U3J B;  3TCU A;  1DK1 A;  1Q8I A;  1GAX A;  4UVB A;  2N74 A;  4GKK B;  4JGS A;  4EB6 A;  1TVK A;  1VP7 A;  1ZTE A;  1IBL O;  4UCS A;  4UCO A;  3OD4 A;  2CK3 G;  3F7V C;  2JGD A;  4DK1 A;  4P2Z A;  2ZE5 A;  1O9G A;  1QLE C;  4MT8 A;  3A8T A;  4QIW F;  1KKD A;  1KBH A;  2DMX A;  1NTZ H;  4PA3 A;  4TSF G;  4DV5 O;  1GM8 A;  4PDL A;  1W0J G;  3U11 A;  2BOB C;  4JI4 B;  4R6Z A;  3ZHR A;  3CC7 V;  4JI8 B;  4ZHQ B;  3ABT A;  2X0L A;  1FPO A;  5DEC A;  4LCU C;  4FK5 C;  4PJ0 Z;  4Q20 A;  4TUY B;  2K1E A;  1RP3 B;  3VOU A;  2B1I A;  1DLB A;  5LGT A;  3ZS8 C;  1YIJ V;  1YCI A;  2HKO A;  3THO A;  4O4I A;  3CCV V;  1WP8 A;  2GUZ B;  1I5Y A;  5B3S C;  2N04 A;  4JI3 B;  5D5Q A;  4GKJ O;  1N32 O;  2VQE B;  2Q7H A;  4PDV A;  3OUS A;  5H2F Z;  5FNV A;  2YI9 A;  1L0N H;  2CH7 A;  2QM8 A;  2P22 C;  3WFV A;  1IVS A;  1Q6U A;  3AG1 B;  1SZT A;  3JAT B;  3SYP A;  2FYU H;  3HKD A;  4DW1 A;  2HEP A;  1R3L C;  3VQW A;  5B66 Z;  3A0H Z;  5A9G A;  1Y76 B;  1B6Q A;  4H37 A;  3ZMZ A;  1DGS A;  1WAZ A;  1UJW B;  1M9N A;  4MTG A;  1VQ7 V;  4JI0 B;  1HNX B;  4PA6 A;  1Q7Y W;  2HVK C;  1OCZ B;  3LUT B;  3D3Q A;  2OIG A;  4MTO A;  1K5S A;  1NVP B;  4UV9 A;  3WB1 A;  1XNQ B;  1Y4M A;  1NVP D;  4MVM A;  3CC2 V;  1XRE A;  4DV2 O;  1I08 A;  2Q9L A;  2UUB O;  1JMK C;  5IWA B;  4OX9 B;  3SPI A;  3F5T A;  2QWN B;  1AR1 B;  1AP6 A;  1YJ9 V;  2PY5 A;  2P7T C;  3JD2 A;  5BMV B;  4J9Y B;  4HNA A;  3CME V;  2QM7 A;  2UXB O;  2XAJ A;  3SPJ A;  3H9V A;  3TXS A;  3RYC B;  2JS5 A;  2NLJ C;  1MSW D;  1SQQ H;  1M90 W;  4NXN B;  1F23 A;  3E8G A;  3JAS A;  3OEE G;  4DR5 B;  4TV8 B;  1YJN V;  3SGI A;  4JYA O;  4Z1M G;  2F93 B;  4O2B B;  3IJ4 A;  3ZCC A;  4O4H A;  2WLM A;  1BT8 A;  3ZED A;  3LSU A;  4BAY A;  4BW9 A;  5L3B A;  2IBZ H;  4GYC B;  1PD3 A;  3APO A;  3RVY A;  4NXM B;  2UU9 B;  4DR1 B;  1WA8 A;  3CXH F;  5EBL C;  1M56 B;  5J9P C;  2A7W A;  4KXR A;  4I50 B;  4X20 A;  4CBC A;  3FKS G;  1Q3E A;  4BWA A;  3ABL B;  3TET A;  4LR3 A;  4EB6 B;  5C8Y B;  2DOS A;  1SQX H;  1TVK B;  2QE7 G;  2XND G;  3T4Z A;  1Y74 A;  4FLU A;  1V54 B;  2R70 A;  1Q6H A;  2JGD B;  3E89 A;  2Q0A A;  3JAK A;  2Q69 A;  4LNU A;  4X1K A;  4LF8 O;  1T5E A;  4NTY A;  4BIO A;  2P4K A;  2EJR A;  5L3G A;  1M56 C;  3K58 A;  3AG2 C;  4JV5 B;  3STZ C;  5LP6 A;  1VQP V;  1QR9 A;  3SYO A;  4WBN A;  2WLK A;  1YEW A;  4X66 O;  4J42 A;  1V54 C;  5F2V O;  2L6L A;  4CZZ A;  3L74 H;  1K3E A;  4LFA O;  1M5I A;  1GM9 A;  1TAE A;  4JAU A;  1WPX A;  2X7R B;  5KUM A;  4DV6 O;  3ZRV A;  3B8M A;  4I55 A;  4O4I B;  4XDK A;  1MG1 A;  4B3R O;  5FNV B;  4J9Z B;  2CH7 B;  3BAB A;  4DUY O;  1BQZ A;  2RQ6 A;  2YXL A;  1H8H G;  1WB8 A;  1QVG U;  4ZIB A;  3K5L A;  1VQM V;  2EIN C;  4B3M B;  3HKD B;  1WLE A;  4OX9 O;  4K3A A;  3LDC A;  2WAM A;  1ENV A;  2KB1 A;  3I55 V;  3CCM V;  3L72 H;  4L8J A;  4P30 A;  3ZHT A;  1AP5 A;  1K4D C;  3K9S A;  1J5E B;  2X6A A;  3HR0 A;  3O9O A;  3K08 A;  3OR6 C;  2RMK B;  3ETG A;  1XMO B;  4NXN O;  4DRX A;  4W4K A;  5LMU B;  3AG7 A;  4YIO A;  4XDL A;  4LP8 A;  2D3O W;  4HZ3 A;  3FB6 C;  5D5P A;  3F5W C;  3BVO A;  4FLX A;  2DN9 A;  1GRJ A;  3AG3 B;  4A5U B;  4DO2 A;  4PA4 A;  2V1D A;  1Q82 W;  4DR1 O;  5CBH A;  2JJ1 G;  4LF6 O;  1BGY H;  2YSU B;  1IZ3 A;  3ASO B;  3K5M A;  3L70 H;  4CS2 A;  3JAM N;  3EXA A;  2WSS G;  1F7Y A;  1QBZ A;  4QJF B;  1H2M A;  5IYZ A;  3JAS B;  1P7G A;  2EIJ C;  4X62 O;  4X88 A;  1EZV H;  4FM0 A;  2HHH B;  4ABM A;  5KHI A;  1R73 A;  4FMT A;  1ROP A;  4EKW A;  4IYH A;  4LF9 B;  3ASO C;  4PDM A;  1KC8 W;  4X65 O;  1Q90 D;  1N33 B;  3N2K A;  1WA8 B;  1MA1 A;  1ARO P;  3KG2 A;  2AHZ A;  4X20 B;  2Y48 A;  2YI8 A;  3CCJ V;  3KKY A;  1HP8 A;  5LHH A;  3CCR V;  5GON A;  2A3Q A;  2OCH A;  1Y74 B;  3QO7 A;  2ZR3 A;  1OCC B;  1Z5W A;  3UCS C;  3JAK B;  4TQF A;  2P90 A;  2YXY A;  3OTO B;  1JA8 A;  1MZE A;  4IYI A;  5KHK A;  1THZ A;  4X1K B;  2Q8V A;  1IXB A;  3ZMV A;  2X6C A;  1KB9 F;  2JRI A;  1K9M W;  1KD1 W;  4UFZ A;  1FYJ A;  2PTM A;  1R3J C;  4DUZ O;  2QTS A;  3OGI B;  2LJ2 A;  4LF7 B;  2HR3 A;  5IJ9 A;  4UV8 A;  3ZRS A;  1OCC C;  2YID A;  1YDX A;  4ZKI A;  4DR3 O;  1N4C A;  4UB8 Z;  2NN4 A;  2VQF O;  4YIP A;  3CCE V;  1BZK A;  3SJB C;  2YC0 A;  2ZXW B;  5LP6 C;  1OV9 A;  4NKG B;  2CAZ C;  3GWO A;  1G4Y B;  3RFR A;  5LA6 A;  4I55 B;  3T1Y O;  1JOY A;  3QG5 A;  1J5E O;  4B3S B;  3ABK B;  4GX1 A;  2ZDI C;  3JSL A;  1S3J A;  5AG2 A;  2IU0 A;  1AB3 A;  3ABU A;  2ZIO A;  3UT5 B;  3OFN G;  4MVR A;  1W0K G;  3G67 A;  3SPH A;  3RW0 A;  2VS0 A;  1ZL8 A;  1VQN V;  2MW2 B;  4KUM A;  3AK2 A;  1BE3 H;  4UCV A;  3EFF K;  3MD0 A;  4JPR A;  2HFE C;  1BCC H;  4AHC A;  1Q43 A;  4DYL A;  3JCZ A;  2Y69 C;  1E79 G;  4JAV A;  2YIB A;  5LMN O;  3VBB A;  2WLL A;  2DYS B;  1U96 A;  2VRZ A;  1O9H A;  2QKC A;  4J7Z A;  4DV0 O;  3W7X A;  4FZ0 A;  5KX5 B;  2F4V B;  3JD4 A;  1SS3 A;  4PV1 B;  2YEV B;  2EIK C;  4YJ2 A;  3OR7 C;  2QR4 A;  3J81 N;  4MSW C;  3E86 A;  4JYC A;  1IBM O;  1AI7 A;  3CE2 A;  1BQ0 A;  3CS5 A;  4TQD A;  4Z1V A;  4X64 B;  1Q6I A;  1CXZ B;  5LHG A;  1AIL A;  2WPD G;  1N33 O;  1M4U A;  4U3F H;  3CB2 A;  3AK3 A;  4CS4 A;  5KHG A;  5EC2 C;  5L3E A;  4FFB A;  4K0K B;  1GTO A;  2M6Y A;  4RWU A;  3IC9 A;  4JI7 B;  3FB8 C;  3EVK A;  5IYZ B;  2IJJ A;  4UCU A;  1QHT A;  2ZE6 A;  1EZJ A;  1Z5V A;  2Q6A A;  4ASU G;  3CRR A;  1IDS A;  3OTO O;  3JAL A;  4LBE C;  4FLY A;  1QLE B;  3LNN A;  3CP1 A;  4I0X A;  3SDL A;  3RYH A;  1PL4 A;  4GX5 A;  1VQ8 V;  4CH6 A;  1XI1 A;  4HAM A;  3N2K B;  3WG7 C;  4DW0 A;  1NT2 B;  4HBN A;  1JJO A;  2IJK A;  1K34 A;  4J80 A;  1D5N A;  1XL4 A;  2R72 A;  1A32 A;  4P9O A;  4LF7 O;  3K0G A;  4B7K A;  3LSS A;  4ZOL B;  3B8N A;  3G4S V;  1JVM A;  4UUJ C;  2P4V A;  3G80 A;  1IBK B;  2WA4 A;  3L73 H;  5FL7 G;  2CUG A;  4O2A A;  5GON B;  2ADP A;  2YDE A;  3OMA B;  3RN4 A;  2RNB A;  1OZ0 A;  5LGU A;  5JCO A;  4FFK A;  3G71 V;  3CCS V;  4I4T A;  1FXK C;  2Q67 A;  1ORQ C;  4X1Y A;  4ICG A;  3QO8 A;  1UPG A;  2DQ3 A;  4LFB B;  2OIE A;  3C3T A;  4F6E A;  5TIS Z;  3CD6 V;  4PI0 A;  5B3S B;  1LUW A;  4IIJ A;  2QWP B;  4R8C A;  3ZN1 A;  1VQ4 V;  3K06 A;  1YZB A;  4GUN A;  4B7E A;  5IJ9 B;  4YY3 O;  2CTP A;  4H0L B;  2EIM C;  5H6Q A;  2OT5 A;  1GK9 A;  2ILM A;  3CX5 F;  1HR0 B;  4TOI A;  1YVW A;  2XAS A;  1HNZ B;  1VQ6 V;  2B9Z A;  2GTS A;  5LA6 B;  5B1N A;  1XNR B;  1JPX A;  2IJH A;  3CMA V;  4JTA B;  2H94 A;  1JFF A;  3RT3 C;  1KMI Z;  5KHJ A;  2KG7 B;  1GH6 A;  1YXB A;  1S72 V;  4K8Z A;  3D3I A;  1EN6 A;  5CB4 A;  2HLD G;  5E79 Z;  4ZBM A;  3T1H O;  1OCR B;  5JJE B;  1X59 A;  4G28 B;  3SR2 C;  2QSA A;  4IL6 Z;  4X8A A;  3I5D A;  3BAA A;  2W0F C;  3C3S A;  3FD9 A;  3B40 A;  2YIB D;  4X1I B;  5KA5 A;  2XAH A;  4WCE V;  3CSX A;  5CMU A;  4JI7 O;  3B4S A;  1M57 C;  2DW4 A;  2GBO A;  2EZP A;  3ETE A;  1GMG A;  1OCR C;  4YJ2 B;  1S76 D;  2GHY A;  3KZI Z;  2EUL A;  5FPO A;  2LQT A;  5KHH A;  1Y6X A;  3GWK C;  2BSK A;  1FD9 A;  1PM9 A;  3K03 A;  3RGB A;  3IC7 A;  1BHB A;  2LGW A;  4JF3 A;  4C7U A;  1LNQ A;  2FML A;  4DV1 B;  1TUB A;  1KP2 A;  2UXD B;  4FPP A;  3ZHU A;  1SES A;  4RQE A;  1XOU A;  3QNE A;  4CS3 A;  1K7D A;  4GKK O;  3VQY A;  1PNL A;  4LWS A;  4DR6 B;  1NH2 B;  1N36 B;  5HFM A;  3MHH C;  2P5O A;  1NH2 D;  2KSD A;  3MAQ A;  4FLV A;  4J7K A;  4BW5 A;  3OMI B;  1R6T A;  3JAL B;  3PJS K;  3RYH B;  1VAR A;  1VF6 C;  1D5A A;  5KAI Z;  2IW5 A;  5CA0 A;  4JI4 O;  1HNW B;  3AG2 B;  4B3T B;  5JQG A;  2CGO A;  4JI8 O;  5JWP A;  2V7Q G;  5B1B C;  1XIL A;  3CCL V;  2PUS A;  3ZMS A;  3FAV A;  3WB0 A;  1XL6 A;  1SRY A;  2XHB A;  4H44 B;  1YHQ V;  2EIL C;  1S0V A;  4O2A B;  2WLJ A;  1YF2 A;  4I7Z B;  3H1J H;  1XDC A;  3IGA C;  4JI3 O;  4X1Y B;  2VQE O;  4YJ3 A;  1G8M A;  1I94 B;  4FZ1 A;  3SJA C;  2ZDI A;  3E83 A;  4B08 A;  1S5L Z;  3CYO A;  4QPJ A;  1H2S B;  1NS1 A;  5BR8 B;  2ETN A;  1H8E G;  2DQ0 A;  2WA3 A;  1KP3 A;  3CC4 V;  3SJQ C;  5J2U A;  3K5N A;  5JCO C;  2EIN B;  2ITD C;  3CXC U;  3JD1 A;  3H01 A;  4JI0 O;  3JAW A;  4QE7 A;  1CEZ A;  4DR7 B;  1HNX O;  2HVJ C;  3JAR A;  1SER A;  2JVD A;  4DR4 B;  4IT5 A;  4OXS A;  1SF9 A;  2RCV A;  2QGN A;  4PA9 A;  3M8A A;  1L1F A;  1XNQ O;  2F23 A;  4TWK A;  2Z0A A;  2E76 B;  4JAS A;  2R9R B;  2F43 G;  1JFF B;  3N2G A;  4LF5 B;  5IWA O;  1ZX3 A;  1L0L H;  1XBL A;  4D6T H;  1FXH A;  3ASN C;  2XT9 A;  3EHB B;  4H13 B;  3K59 A;  2LGQ A;  1CP9 A;  1ZWI C;  4AQY B;  1AI4 A;  4DV1 O;  1XMQ B;  3H1H H;  2E5L B;  4JZ2 A;  4FJC C;  3QO5 A;  2JEX A;  2PYL A;  2LO1 A;  1SQG A;  5IJ0 A;  3LSQ A;  1BHA A;  3TJT A;  1WN7 A;  3QTC A;  2LP7 A;  3Q4H A;  2PI4 A;  3ML0 A;  4DR5 O;  3W7U A;  1NKD A;  3HKC A;  4MW8 A;  1V9P A;  1BS3 A;  4DR6 O;  1FAF A;  2PI5 A;  3K9A A;  1GN4 A;  3X2Q B;  1RM1 C;  1N36 O;  2EIJ B;  1VF7 A;  3E22 A;  1RFY A;  4NTW A;  3UO2 A;  2BSK B;  2CE4 A;  3AK1 A;  4NXM O;  2UXX A;  1LR1 A;  3CCQ V;  2UU9 O;  4CC5 A;  1IUR A;  4HNA B;  1SQB H;  2JGU A;  2A06 H;  1TUB B;  2R9A A;  3C90 A;  1ZLZ A;  5B5E Z;  1HNW O;  3BA9 A;  1P49 A;  2UXC B;  4PA7 A;  3CWB H;  5JJN B;  3X2Q C;  1XHX A;  1R3I C;  2PGG A;  2ZNI A;  4LWS B;  4CH5 A;  4DR2 B;  3DSQ A;  4O4H B;  5K1P A;  1TGO A;  2IM9 A;  3TXQ A;  2ZE8 A;  2LW7 A;  4QPK A;  1S5H C;  1QLN A;  2ZT9 B;  1K73 W;  4NB5 A;  2V4D A;  5CN0 A;  1L8D A;  1PP9 H;  4JAA A;  2AHY A;  1XQ8 A;  4JV5 O;  2F66 C;  3U0Z A;  1FXK A;  1E1R G;  2EJ7 A;  1FFX A;  1BSM A;  5A2Q N;  5CA0 B;  1LUV A;  5JQG B;  3ZBH A;  1KQS U;  1MOF A;  2NR5 A;  3FYI B;  4JI5 B;  1G1X B;  1SKV A;  3FAV B;  2EBO A;  1SQF A;  4GCZ A;  1R1B A;  5KLV H;  4DV4 B;  4O4L A;  1JQ0 A;  5H6R A;  5FLX N;  1P7B A;  1R6K A;  1B3Q A;  4LNU B;  2OWO A;  4WF9 V;  4DR7 O;  3BEH A;  3B77 A;  4GX0 A;  2JK5 C;  4GZR B;  5LP6 B;  5L3C A;  4WBN B;  1SZX A;  1EFR G;  3BA8 A;  4LH6 A;  4R50 A;  4LF4 B;  3W7T A;  2P6J A;  4D7S A;  2ZM6 B;  3JD0 A;  2E75 B;  4B3M O;  1NR7 A;  4JI1 B;  4KHP B;  4YHH B;  4RUE A;  3DGE A;  3L71 H;  1F4M A;  3CEI A;  5DN6 G;  1VIB A;  1XMQ O;  4UB6 Z;  3RVZ A;  5LOV A;  3JAW B;  2XAG A;  3S3W A;  1H2K A;  5C93 A;  3TGU H;  2AZ0 A;  3JAR B;  3WU2 Z;  3OE7 G;  5EBW C;  2Y69 B;  4N21 A;  1XMO O;  3E35 A;  2P67 A;  5J2T A;  2XOK G;  2IH3 C;  2W6J G;  1PKX A;  3MDS A;  3A2F A;  1WJZ A;  5LMU O;  4JI2 B;  2GUZ A;  3HKE A;  2QDO A;  3N2G B;  1I5X A;  3OAA G;  2ODM A;  2EIK B;  1IXM A;  5L3D A;  4MTX A;  2FKX A;  3FB7 C;  3UQ8 A;  1VQ9 V;  3NR7 A;  2WLI A;  1Y66 A;  5EYP A;  1NTM H;  3DTU B;  2AW9 A;  3ZX6 A;  5K1X A;  1OHH G;  5DED A;  1MZF A;  1DF5 A;  1OCO C;  2KKW A;  2AXT Z;  3E8H A;  2ZIM A;  4DV3 B;  4OGQ B;  5JJJ B;  1VQO V;  5IJ0 B;  3H1L H;  3Q4H B;  2UXC O;  3AG4 C;  4TV9 A;  3OEH G;  3K0D A;  3RYI A;  4DRX B;  3HKC B;  2GV9 A;  1COW G;  1GN2 A;  4P9P A;  1Q81 W;  4GKJ B;  1NBM G;  2HHH O;  5EC1 C;  3UKM A;  2AZ2 A;  2JEU A;  4FM1 A;  4LF9 O;  3RBZ A;  1NZ6 A;  2W0X A;  4JTD B;  2RN9 A;  2ZCE A;  3OW2 U;  4L87 A;  1SA0 A;  3P30 A;  2Q7G A;  1FKA O;  1VF6 A;  3F7Y C;  5IYD O;  4JTC B;  3WG7 B;  1WPB A;  1XUQ A;  1RSO A;  4JI5 O;  1HWY A;  4ZI7 A;  1N0N A;  2Q68 A;  4DV4 O;  5B1O A;  2BTO A;  1CPY A;  4UXN A;  3R66 A;  2ZIN A;  3CRQ A;  2OTJ V;  1MMM A;  1DTO A;  2BCC H;  4KP4 A;  1K4C C;  4MVZ A;  4DV2 B;  1JJ2 U;  1PL0 A;  1FXK B;  1VEW A;  5IT9 N;  1XEQ A;  1E1Q G;  3UO3 A;  1FFX B;  3OGC C;  4WFE A;  4UVA A;  1JX9 A;  4O4J A;  3ZHV A;  3D8C A;  4J11 A;  4GLX A;  2UXB B;  1P4R A;  2LW1 A;  4CC6 A;  4O4L B;  2EIM B;  4LF8 B;  2Q5Z A;  2O57 A;  5C8Y A;  4JYA B;  4BR6 A;  5EK0 A;  2ADQ B;  1Y67 A;  4B3S O;  1W59 A;  3ZRW A;  2BOC C;  1H38 A;  3SYQ A;  1QCE A;  4W4L A;  2PF4 E;  4JYY A;  3RYF A;  2IH1 C;  2ZNJ A;  2WLN A;  1AI5 A;  4JI2 O;  5H9C A;  4RO2 A;  2EZO A;  2QM4 A;  5KA6 A;  3SJC C;  1PNK A;  4DV7 B;  5FPR A;  3BFR A;  1WB7 A;  5GTH Z;  2RJZ A;  3K5O A;  3LNM B;  4IHJ A;  2YXH A;  1ZAU A;  4XBF A;  1N34 B;  3CCU V;  1NU1 H;  3OTF A;  3OMN B;  5LOV B;  3IAY A;  1H2G A;  3JSN A;  4DV3 O;  3M7M X;  1IX9 A;  5CBG A;  2F4V O;  4N23 A;  2BTQ A;  2ARH A;  4JYB A;  5J2T B;  4BIZ A; 
#chains in the Genus database with same CATH homology
 2CTQ A;  2GUZ A;  2YUA A;  1NZ6 A;  1GH6 A;  2CTW A;  3APO A;  1XBL A;  2GUZ B;  2N04 A;  2QWP B;  3APQ A;  2CUG A;  2PF4 E;  3AG7 A;  2OCH A;  2QWQ B;  2M6Y A;  1FPO A;  2YS8 A;  4IT5 A;  4RWU A;  1FAF A;  3UCS C;  2QWN B;  3BVO A;  2DMX A;  2DN9 A;  2QWO B;  2EJ7 A;  2L6L A;  2Y4U A;  2CTP A;  2Y4T A;  2CTR A;  1BQZ A;  2QSA A;  1BQ0 A;  2QWR B;  1HDJ A;  2LO1 A;  4J7Z A;  2LGW A;  3UO2 A;  4J80 A;  1N4C A;  3UO3 A;  2N05 A;  2KQX A;  1WJZ A;  1IUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...