1FAIL

Three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEHEDIATYFCQQGSTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA R19.9 FAB (LIGHT CHAIN)
publication title Three-dimensional structure of two crystal forms of FabR19.9 from a monoclonal anti-arsonate antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiL01
2V5SA 4LLMA 3MOAL 4R8WH 7FABH 4WHDA 2X89D 5GGSY 3P0VH 5F3HB 5ICZB 2BSSB 3VWKC 4AH2B 1N7MH 4PP1D 4EVNB 3P4MA 3WO4B 1IM9D 4R7DA 2PYEA 3C5JB 2I5YL 5GSRA 3CZJA 1SJHA 5EH1A 3JV6A 4C59B 5L0QC 2Z93A 2V7NB 5D8JH 1EJ6A 1QR4A 3Q1SL 4N1CA 1FVDB 2IQ9H 4WJ5B 3QXAA 3U46A 1EVTC 1IGML 1IC1A 1HWHB 4QXTA 5D1QD 2Q8BH 1MCHA 4Z7QF 1OGTA 4PRAA 2C5DC 4K3EL 5F71A 4KVCH 5DEFA 3F12B 2AXGB 1UQSA 3QUXB 3TVMC 3I2CL 4LLAA 4ZTPH 2WV3A 5MEPA 5H35B 1G7PB 1YEGL 1ZV5A 2E9BA 4NUJA 1V8HA 1YMME 5C3LD 3ZDYF 2W60B 3SDXF 1JIBA 2VE6B 3CMGA 5HYFA 3ZKMD 1DQMH 4I9WD 5IB3B 3CLEH 5HDQL 4HW6A 4X6BA 2VDML 4K7PL 1CD9B 3INUH 5C0CD 2NZ9C 5IBTH 1XR9A 5F1NA 5IB2B 2EE3A 2C1OA 4QRRE 3U1SL 1HHKA 3DXAB 5T33L 3NFNA 3GMNB 2ZUWA 4L4TE 4YHNB 5HHOA 2AS5M 1H8NA 1JWSA 5D70L 3EYQC 1RIVH 4QHNA 2GJ6D 3HZVA 4HCRL 5F88B 3FAWA 4J8RA 1U8NA 4PJBB 5I1JH 3ESUF 3PWNB 1WIUA 3ARFC 1AH1A 4H25A 1S9KC 3DI3B 1XGYH 2XTJC 5T1DH 3FB5B 4OIIL 2D31A 4TNVK 5FUCC 2GT9A 3MRQB 3BKYL 1PDKA 1TZHB 4N0CD 1RUMH 1AGFB 4L8SB 4M7JL 4ISVA 4QNPF 2FNBA 2X4OA 1T04A 3BGMB 5J89A 1TPXC 3QA3A 3O2VH 35C8L 4YHOL 1YEDA 3MYJA 3QIWB 5D7SH 5EZJB 4IRSC 3U7AA 3W9EB 2KPNA 1MCKA 4Y5YB 3RY5A 2P7TA 3ZL4H 1T7YA 4NO0D 4E42A 1RUPL 2NTFA 2FB4H 1U92B 2DQEH 1LE9A 4P3DB 4XNYH 3RP1A 1EXUB 1OTSC 3CSYB 2XRAH 4KTDH 3B3IB 3LMJL 2IEPA 3IFOA 5JA8B 2XY1A 2FO4A 3PL6D 4G42A 5KANI 3MRNA 4LLWB 3QEHA 4HX1A 4PJHA 5F1IA 3V7AE 2I26N 1JFQH 2HN7B 4NHCL 3MJ8B 1LP9A 3S36L 3BFOA 5GGUA 4KJYB 2A6KA 2YRPA 1MIEH 4NHUA 3UC0H 1R3HB 4O2EA 3QUZA 3TM6A 5GGVL 1H0DA 1PKQA 2A1WH 1JZ6A 4GKSB 5K9OB 2FGWH 2W0LA 3VWJB 3GGWB 2OL3A 3MNWA 4HJ0C 3VD3A 5FO9B 2B1HL 4FQ2H 1AD0B 3UYOD 4F7EA 4R3SA 2AI0L 1TJHH 3RWJB 4L3EE 2CSPA 4JAMA 2YOCA 3LDBC 1KCRH 3O41B 1FYTB 2Q7NA 3H3PH 5ACMA 1H3GA 1ZLUK 2XWTB 2OMBA 4R7NA 1LEGA 3N85H 4JFOA 3U7YH 3G5VB 1OP5K 3EHBC 3DETD 4EDWL 4DOHB 2BNQD 2AEWA 4Y4KC 3ULVC 2HFFB 4JG1H 3T04D 2FSEB 3WUWA 3EDKA 5HYIA 1N59A 2WW8A 4PGJA 1VGEL 2F19L 3BKMH 3PGCB 1R0AL 2V7HA 1XIWC 5KS9B 4LKXA 4NN5B 2DWEB 5ERWB 3IETB 3MGOB 1MCPH 3ARVA 3U4BL 4I5BA 3K80A 2XWBA 1P69B 1PD6A 2OQJB 4PRPD 3C60B 3RIAK 4R9HA 3TJEH 1AHWA 4LSSL 5HD8C 4HH9B 4R4ND 5HGDA 1H3TA 2HLFC 3BPNC 4G43A 5AUMA 1NGZA 2G5BA 1M7DA 2KUTA 3BYTA 5BJTA 1FNSH 4OZHF 3VCLB 3JTTA 3W5NA 1F58H 3VXUB 4NYLB 3RWCA 2GSGA 1FFOA 2QHRL 4K8RH 4RWYH 1WZ1L 1OAZH 3Q3GA 4P0DA 2K7QA 1NDGA 1G7MA 4XXCC 4LLVA 3SJVA 2OK0H 3OR6A 1LO0L 3MLYH 4FFYH 1MOEA 4HIXL 3S4SG 3VMPA 4QRRD 2D2OA 4RGMB 3OX8A 2X7LA 4LCYA 3T4YA 5F6HJ 5B4MC 1U6AH 1PLGL 4GXVH 4X4XA 1G0XA 2V2TB 5JOEA 2DQGH 3P0VL 5LJYH 1OOAA 1G7HB 1PQZA 5KN5A 5T5FH 2YWYA 3CX5J 3ARZA 5D7JC 5IQ7H 1DUYB 4G9FE 4KPHL 1J8KA 3IYLW 4D2NA 4QRPE 3VFTA 4Z76B 2NXZB 1TXKA 3HZYB 1EHLL 5DD1L 1S7TA 3UPAA 1H15A 1JTOA 1X4ZA 1A47A 4HDIB 1A4JB 3EOAA 3SDAA 4XCYB 5D8JL 1U0QA 4RMVA 4Y5VC 2EIZB 1BQHB 5F1OB 5L9DH 2IH1A 2E7BA 2IQAB 3WYRA 4XNQB 3UBXI 2DLHA 2R9HD 3BEWB 2E7LC 3W0WA 5IP4A 2AJZB 4JVWA 2P4AB 1AXTL 5E00B 3VFNA 5HPOA 2LTQB 4J3XA 1BVKA 1INDH 3KJ6L 3MLRL 1CL7L 1JHKL 3OKYA 4MAYA 2KQMA 5ITFB 1ZAGA 3BIKA 3JWDC 4LCCC 3OL2A 3GIVA 2VDRH 4AJ0A 1WUNT 5L2KA 4F7MB 2ADFL 3BMVA 1XF3B 1XF4B 4L29B 1L7IH 1KB9J 5D1QB 2AJYH 4JVPA 3NH7H 5GJTL 4BSJA 4PRIA 3V6ZA 1JWMB 3I6LD 5EOTB 3FQTB 3D3VA 2VDOL 4ODXA 1YC7A 5JA9A 2ATKA 5TE6H 3AU1A 5IK3A 1NFDB 2VXSH 1QSVA 4LMQI 4YUEL 2NPLX 4AQOA 4LU5H 5F3BB 1M7XA 3MRRA 4U1GC 1NDMA 3P4NA 1R3LA 4K23H 4MLIA 4IHOB 1UT9A 5I1JL 3RY6C 1KV3A 2X9XA 1OQOA 5EO0A 3ETBF 3IAPA 1DDHB 4YDKL 2QSCH 5FOBB 4XP9H 4X8JA 4L8CA 1CE1H 4GS7B 1UB6A 2GY5A 4PJ7B 3JZ7A 3ULUE 2WIIB 2DI8A 2EDXA 4RFEB 1OLLA 1MHCA 1I8LA 4APQB 1MCFA 5F9AC 4X98A 1T7VA 5SWSA 3OKDB 5FYLE 2DQEL 4OCXL 4J3SA 4Q97A 4FQHB 5GS1B 4LSPH 5E4EC 4AK1A 2VQTA 4OB5H 2PTVA 3WFBL 4OF6A 3MA9H 3MV7D 5HVHB 5KSBF 2UWEE 1NEZA 5JXAH 5JDSA 4LHUB 3VRIB 4HWNA 3C87A 5JLZA 3MFFB 1R3JB 4NO3A 3I84A 3CC5A 2J4WL 1KIQB 4PJXA 3V5DA 3C8DA 5EB9A 3RNQA 4DKFH 4MSWA 1S7XB 3BE1L 1QLFA 2A1WL 4CDHA 2WAHA 3TIEB 4CL7A 5HYJE 4OV5B 1ADQH 1YEHH 2OTUA 1WWCA 1J05B 3E6FA 4ZFFA 2Q8AL 1CXLA 2DQUH 1I7TA 2AXFA 2Y7QA 3N1FC 4PLJC 2WWMD 1UZ8A 1KT2B 3HNVH 5DJXB 4ZUVA 3U82B 3QCUH 3GFUA 2I9LB 4WTXA 4H8WH 2NW3A 4ACPA 2YEZB 1NKRA 1U58A 2NR6D 2FATL 1FL6A 1UCTA 3N85L 2ICWJ 2HT4C 3BKCH 5C70A 1LD9A 1FLRL 2EKSB 1SJEA 3HNSH 2NYYC 1UYWH 4KHXH 1U95B 4JG1L 2OL3L 1EZVY 5C0BB 1MRFH 3P9MA 1HKLH 4QOKE 1AIFA 3F6LA 4KQ4H 3BKML 4NQTA 1S5HA 3BPCB 3DNKA 5J9PA 3EYUL 1C7TA 1PZUB 3MNVB 3AS1A 2AJ3B 3O6FD 4KMTL 3SE9H 3MRJB 1MLBB 2ICEB 2R23B 5ADOH 5ACZB 4LLUA 5HYEA 2DLEA 4YFLI 4GG8B 5GISL 3RAJH 4EI5D 4ZUSB 3MCG1 2ZPKL 4OD3L 2O5ZH 1NANH 3CX5K 4P5KB 1FNSL 3GSNL 1AJ7H 1U8JB 1FRGH 3S3JA 4XBPA 3REVA 5IQ9A 2NY5L 4YHYC 4Y4KA 4R96B 4UDUA 5CEZD 5IHZA 3U7WH 1A5FH 3GIZH 4MXWH 3L3KA 3N1MC 4KHTH 3WFCH 4BFIB 1I7ZB 2G2RA 3T8XA 4HUXB 4X7EC 1QSZA 5I66B 1YMHA 4IMLA 2ZSVB 1VPOH 3HUJE 4Z95H 4GXVL 5F1SA 4YPGB 2DQGL 3I9GL 3B4NA 3T0EA 5T3ZL 3GSUA 1MCOH 4ZUUA 4IIQB 3SDYH 4DKDC 5K9QG 5IQ7L 1EO7A 1CS6A 4HUKB 3ULVF 4OZFB 3G04A 5IROC 4HFUL 1KB9K 3EUUA 4QRRB 1TJGH 2VQUA 3MBEB 5GGSA 4HG4K 1QNZL 4TTGA 3TH2T 4XPAH 3GUTA 2ESVE 1G9NC 5ANMA 5L9DL 4HUVB 3QNYA 4L4TB 4BQ9A 2FIRT 5EFIA 4UILL 3BXNB 3KGRA 1P4LA 5IVZB 2OP4H 2YPLE 4KZEH 5CZVH 5FYLD 2HTLC 2X1XR 3G6JE 4Y4HA 5I2IA 3M17A 4LSVH 1INDL 1FH5H 3MRGB 4LIQE 2Z35B 5C0FB 1XT5A 2PUQT 5AG9A 3KPSE 2XKNB 3U36B 4IRJC 5FKAB 1CLYH 4P46B 2RAMA 5JW5A 2W9LA 2OYPA 5ISZD 4U3HA 3VFVA 4ZO9A 4Z5RA 3IS0X 4YWGH 4KZDH 3FT3B 5IG7A 3NH7L 4NDMB 1FORH 3L7FA 1MCRA 2UUDH 1BZ7B 2CRYA 1J8HA 3OXRA 2CH8A 3SCMB 2ORBH 3L3HA 3LKSA 4Z7VF 5HYJD 1RHHA 3EZ8A 5L8LB 5CEXB 5TE6L 4R26H 3GMMB 1FJ1B 4LPWA 4CNIB 5D2LF 2VXSL 4XC1H 1MH5B 1MHEA 4XCFH 1MUJB 4K23L 4NO2A 4RFNC 5IMOB 1PG7H 3WJLC 1F42A 5HI4D 4D9LL 1JPGB 1ZHBA 4MWFA 1OT1A 5TDPB 1NC2D 5E7FA 2AQ2A 2NY6B 4D8PB 1ZWIA 3HI6L 4M6ML 1KIPB 1KB5B 1CE1L 1FIEA 4XPGL 3W9DB 5ILTH 2W9DH 3VI3E 4PTTA 3PWUA 2Q87A 4JO4H 5HBBA 4OIBA 4PRDA 4FQCL 4O4YL 1JYWA 3DRTB 2H2SC 3JTSA 1IAOB 3V8CA 4EUPA 3J7HA 4G9DB 2BHYA 5HGBB 1RJYA 3RPIB 2EO9A 5E8OA 1XF2A 2VZVA 1CDGA 3K0WA 1FNHA 4G6AC 1G7JA 1U3HA 4OLZH 4PJ9A 1DANT 1A8JH 2W92A 3DV4B 3CFKA 2R29H 5BRZA 1AR1C 1S7QA 1A0QH 4U1JB 5LBSH 4JANB 2VXTL 3DRQA 1BF2A 1N4XL 1CGSH 4ZS6C 1GZQB 1PAMA 2A6DB 4EUPH 4WI6A 3CDYA 1JYXA 1MFEL 1RD6A 5L7XH 1KPVA 4IMKA 1ORQB 5DS8A 5CD3B 3TT1L 2R1YB 2EDNA 4ZFGH 4U6VL 5E6IA 4P9HL 1LK3H 3HRZA 1D9KC 3O3EA 4RBPH 4NC2B 1PVHA 3G5YB 5IEKB 3QH3B 5D7LD 3L3OB 1S7RA 4Y2OA 1NAMA 1R5WA 3QCUL 3GMPB 4PJAF 3W82A 3LKQB 3PHQB 4OAWA 2F58H 2V6HA 4POZC 4NKIL 3VDBA 1VFBA 4KV5E 4UUJA 4D9RD 3OHXA 1RMFL 3BKCL 3TCLB 5FO7B 1ROWA 1ZLSH 3T3ME 2FEDD 3S88H 3HNSL 3LN5B 1UYWL 4KHXL 4JJ5B 4HWEL 4X6EA 4WUKL 1MRFL 5LAXB 1HKLL 4KMQA 4KY1L 2VIRB 4KQ4L 3HLAB 2ESVD 2HVKB 3M1BA 5MERA 1QACA 2N4IA 1CU4H 5IHUH 3D39A 1NAMH 3QIUC 4XNMA 5DZLA 1Q94B 1BVLB 5IFHH 3PGFH 3UTTA 1JN6B 5I6XC 2EYRB 4LVOB 1MLCB 3HE6A 1GOGA 3V95A 3OXSA 3BH8B 5FB8B 3OKKA 5HPMA 2Z31C 3EYVB 4G9FB 3KPTA 2KH2B 2ERJB 4QRPB 2O5ZL 3MMEB 1QBAA 1CLZL 4NO5B 4NKOB 4Z7QE 5IMMA 3SE4A 3AB0C 1I7RB 5TF1L 3MJ7B 5CKGA 1BLNB 1CIDA 3GO1L 3X14B 4ALAH 3PV6B 3NCYP 1P2CA 4C54A 1R6VA 2ZSWB 3AMKA 4ZS7H 2RQ8A 3H42H 5DJ0A 4I48A 5DGQA 3L3DB 4BK5A 3GIZL 1EFXA 5CKAA 2WLZA 1AKJD 4QRSB 3WFCL 1HNFA 1UCBL 4NNYA 4Y16D 3DO3A 2P5WE 2X1OA 3ZDYE 3PQYD 1J10A 3KS0H 5ICYB 4RA0C 1FAKT 3REWA 1N5YH 1HSAA 1ZS8B 4K9EH 4NQED 5C7XL 2MFNA 5C0GB 1MFDH 4YDIH 5SX5H 3RVXC 4WFGD 1KGCD 4NZUH 3SDYL 2XWJA 4XVTL 1DLHA 4DGYH 2J5LC 1JPFB 5CZXD 3QISA 1IILE 1QD0A 1E6OL 2FR4B 1DTUA 1OP3K 2OJEA 2VNCA 1X5XA 3IU4H 5F89B 3RDTB 3F6IA 1DUZB 2DM4A 1LNUA 1H5BA 2PXYB 2Y25A 4R2GC 3LIZH 3ME0A 1QO3A 2JB5H 4DCQA 2R2CA 1KN4H 1C1EH 2OP4L 1JZ3A 4KZEL 3KPMA 3HMWH 3KJ4B 4P4KB 1A3LH 1FGNL 4JFFA 3OSKA 4LSVL 2PYFB 2PCPA 3QIBB 4QYOA 3T2NH 1A1OA 1CR9L 1KTDA 4V1DA 5D93B 5I1CL 3RTQC 3T0DA 1CLYL 1JHTA 3VE0A 4HIIB 3UZQA 2GQHA 1RPQA 5C1MB 1A6UL 2C3XA 5FECB 1DEEB 4YWGL 1PX4A 4HLJA 2D03H 5DMKA 5KW9H 5IROA 1HSBA 2B20A 2EXYD 3IDYB 4W70A 5KSVA 3SDDD 2EDDA 3L6FA 4KGJA 2ORBL 4GRMB 1U8OA 4HS3B 1IGTB 5BVPH 1XGUA 4L4VA 1MJ8L 4XC1L 2FJGA 3TIDA 3WFEH 3P9LB 2XQYK 2UWEB 5DRNB 2CXKA 1OARL 2XICA 1FO0A 4U6HB 4XCFL 5DVNA 5HJ3B 3MRKB 3B6SB 3MODH 3D2UA 2NY2D 1DQTA 2AJVH 5DA0B 3NOIA 3WDHA 4ODWA 3D9AL 4JGMA 3VDCA 3V8OA 3MLWL 4UV7L 4AY0A 4AM0A 5FYJH 1J1PL 4HV8A 4XTRC 2BRRL 5HYJB 3ZT5A 1VACA 3IDMB 2ZOLB 3GM0A 4I0PA 1F3RB 2HT3D 2YSSA 4JO4L 5K59F 4U6XA 5C07D 4FQIH 4WFHE 3OKEB 1S9YB 4RISH 1JJUA 1FO0H 5CHNB 3TA3D 3C2SA 1LO2H 4OGYH 5DA4A 1EEYA 1I1AB 4U2YA 2H8PB 1IC5H 1KG0B 3WHXB 2Y36H 3VG9C 2HFEA 2J8UA 2DYPD 3WXWH 1MHPH 3CJJA 3MX0A 1XH3B 4OT1L 3MLUL 5F70A 4HK0A 2YPKB 3WNMA 3PDGA 4WENB 1CFBA 2D7TH 4P2YA 5LGJB 4OLWH 4QOKB 4M7ZB 2PO6C 5FDWA 1KJVB 1O0VA 1CGSL 1MF2L 4RGNE 4JY4B 4PFEA 3LEXA 5L7XL 4BYHA 5I1IL 2D4FA 5BW7A 1DN2A 4OZHE 1JE6A 1MCWM 3L5JA 4WW2C 1WLHA 5HHNB 3EOTH 3E2HC 3AAZA 3DX9B 5BV7C 1LK3L 1AO7A 1DQQA 1HXMA 4U0RC 4MXVF 4X6FA 3S97C 3T0XA 1DLFL 1PW3A 4BJLA 1FVCA 1ZMYA 2FECL 1EGJL 4HQQL 4NKDA 1UKQA 5I17B 4FQXB 4FFZH 3MJ9A 4F80A 4GBXD 4G6FD 4N0YL 3S88L 3NGBC 4FXKA 1AP2B 2X4SA 4Y4FA 2EDRA 3ARBC 3RGHA 4ZQKB 3FN0L 3BUYA 5BS0E 3ZTJG 1BEYH 4GMTL 3LQAC 3HUJB 5IHUL 1NAML 4KKAD 4CN1A 1QVOA 1WCBB 3QWOB 2XIDA 5IFHL 2MOVA 5DK0B 4EN3D 1D5IL 3D69A 1KIRB 5GHWL 3MLTB 3UPRA 3MJ9H 5GZOD 4FP8H 2OS7A 4ZFZA 1D5XB 3QJFB 4WV1A 4UINL 4JRXE 1GGIH 3IJHB 3VFUA 5DD5H 2B5IC 3QAZB 3WD5H 4MJ4A 3AS2A 5GGRB 1QFPA 2ESVB 4OTXH 1QG3A 4Z78B 1YEFH 3F58H 4PJEA 3U0WH 2DIJA 3H42L 2IAND 1BX2B 4UTAH 3MLZL 4HKJA 1A22B 2YPLB 5DK3A 3SDCC 4M6NL 3HR5A 2VXVL 3G6JB 4GH7B 1YUHB 5I8EB 2JJUA 2BNRA 1IGFL 4KKLD 1HHGB 1XCQA 3QCVL 4H88L 3KPSB 4K9EL 2JJTA 1MEXH 5B8CA 2OXHA 1MFDL 3H2WA 3ILPB 3PDOA 5HHPB 5DEZA 2RJMA 1YY8B 3PWLB 2Z92A 4OF3A 3WJJA 4ZAKB 1MQKH 3I3DA 2VZ3A 4K2UL 4NQDE 3MR9A 2BRQA 5LG1A 4NZTH 2P8MA 1IEBB 3IU4L 1N64L 4YHLH 4LPCA 3ARED 4P9MH 4RX4A 1HQRA 1TVDA 1DR9A 3VXTB 4CMMA 2E6QA 2Y1VA 3QSKB 5T5NG 2UY6A 1CFTB 1FNLA 3LIZL 3LCYA 5GZND 3CVHB 1FFQA 2XI9A 2IBGA 3OKMB 1NLBL 5A43C 1I9RH 2V9RA 1P9MC 4WU5A 1XCTA 1F13A 3HMWL 3ECBA 4TSCH 4OCWH 1HN1A 1A3LL 2HA1A 1UZ6E 1WAAA 5C09E 4S10A 3F7RA 5DSCB 1I3UA 3M8OH 4OJFH 2IAMB 3DX6B 1RIHH 5B3JE 4NZRL 3MRDB 4Z7UF 4H1LB 4WO4D 5IW6B 1HZHL 4B53A 2D03L 4F7PA 4F58H 3HI1A 3TZVD 4JM2B 3IF1A 3WLWD 2AV1A 4ODSL 4QRTA 1HHIB 5EBMB 1Y6MR 3EJJX 3MRHB 4MQ7B 5BVPL 5DFVC 5KTEH 2DLFH 4PV8B 3WFEL 3QZWG 3PWPD 4RMSA 3DTXA 5LKNA 3L1OL 4GRLD 1H3PL 3MOQA 2XN9E 2E7CA 3WDJA 2ATPA 3TV3L 5CCKL 3SDDB 1FSKB 3KPNA 2CIKB 3MLSL 1RU9H 2F54A 2YUVA 1S9WB 3NA4A 4XP6H 2VAAB 3MXWL 5KSAC 3RZCB 4FTVE 1D6EB 1MJJB 5I71B 1RULH 4Q9BA 1T20B 4Y19A 3QPQC 4RISL 5K33A 4LBEA 4XBGB 1ZLVH 3O6LH 2OM5A 4JHWL 4OGYL 4NZJA 1SYVB 4ERSL 3P4OB 5I15H 1IC5L 4U6YA 3GM8A 3B8YA 5MEOB 4K7FA 3RQ3A 1CDYA 3S98A 4QHUA 3PXHA 2CO7B 4M1CD 2NMSA 4XCEB 3SO3C 1FFNB 2MWCA 5LWYH 2D7TL 3H0TB 4Y8DC 3K81A 2OLDA 1CGTA 3UO1H 4HIJB 3K46A 2FYYA 1TIUA 4OLWL 4JKPH 3IDGA 4PLNC 1C5DB 3DOSA 4XAKE 3IFPA 4DVRH 2C26A 2Y6SD 4HMDA 5F7WC 3BVNA 4ZXBA 1K8IB 4U7SA 3CFDA 2DL2A 2FEEI 1RSFA 5D1ZB 2DYPB 3DGCR 3GSRA 5H37H 3FB6B 1NBYB 4U05A 4JDVA 3ZYOA 1BBJB 4DUWA 5A40E 2B0SL 3HZMA 4NSKB 3BUTA 1C12A 3OG4B 2BVQA 2DS4A 1WZLA 2JK5B 2IFFH 4N90D 3WL9A 2R2EB 4TQEH 3RNKA 3HC0B 5EU7E 1IAKA 4YEFA 3RWDB 1I7UB 1PY4A 3SQBA 1DE4B 3MV9A 5T1LA 3KYAA 4JFED 3WO4C 4YNYB 4KUZH 1RZFH 3AY4C 4GQ9H 5E24E 2R4RH 3UJIL 1FPTH 2P5WB 3FRUA 3SDXB 3VWKD 1U93A 2VABA 1BEYL 3O8XB 4OZIA 4O00A 2HTKC 4YHPA 3ULVE 3WIFA 4WFFD 1WISA 4M93B 1F2QA 1YQVH 1B3JA 4X6CE 3QQ4A 1NC4B 5EBLA 4FFVC 1OW0C 3UBXA 4L1HA 4NNPH 1NGWB 1OTUC 2GK2A 1MPAH 3VXNA 1UC6A 4OBRA 4PJHF 3U0PB 5F7KC 3RVUD 1OTTC 2VDQL 4Y1AE 4C83B 3O4LE 3Q6GL 5LGHH 4FP8L 4KH2A 3QUXC 2EH8L 1M4KA 5HHXH 4U2ZA 3I3EA 2O5YH 5IJVB 2FZ3B 1LP9F 4HKBB 3N06B 5IF0B 1FVEA 1VDGA 5AYUL 1GGIL 1OD7A 1CI5A 4QF1A 2EEAA 4TOYH 3BN9C 3DIFA 5DURB 3GSVA 4JRWA 4XRCA 4PJ5A 1ED3B 3BP5A 1YEFL 3TVMD 4MXQC 2YD4A 1IVLA 3LQZB 1E28A 3CXDL 3MREB 4EIGB 3U0TA 4UTAL 1BQSA 4XGZA 3BP7B 4PY7B 3FO2A 2H9GA 1IM3A 4XWGH 1QKZH 2MQ0A 2BP3A 1MI5E 5E2JA 4K71C 1YNKH 4N9GA 5FM5O 4M61A 4OF8A 4LCWD 4U6TA 3OGCA 3WUWG 3VRJA 1KLUB 2NZ9D 5J11B 1E4XI 5D1XB 4Q9RL 1U91A 5ESVB 1DN0B 3QEUA 1U3YA 3VXMA 4Z7VE 4PJGA 2I27N 3IJYB 3VA6A 3O3AB 3EFFA 1Q38A 5D2LE 2XN9D 3ARDC 3FN3A 1IBGH 1MQKL 2APTA 2NY4B 4BFGA 1JZ8A 3EYQD 4OLEA 3VFSB 4Z7OF 3RY4A 2CKNA 2YD1A 4G8IB 3QUKA 4L8SC 5JO5A 3T77B 1H3VA 1TQBB 3P77A 4L3CB 1DJSA 3ARFD 4YO0A 1TFHA 4KUCF 4LKCB 2VLKE 2O93L 3QIWC 2XTJD 1CICA 4Y5YC 3KPRE 4ZFOA 4AMKH 1I9RL 2QL1A 5B39A 4TSCL 2ZG1A 2BVOB 3VU2A 1CGVA 3FQUB 3TYGL 1UXWA 2FWOA 2P5ED 4AIXA 3MCKA 4P3CH 2UVEA 1A14H 4XCCH 3D1MC 4PJCA 4JZNA 4JHZA 4NRXB 2ICWB 3M8OL 1RIHL 2VC2L 3LN4B 3NVQA 4WGWB 1QFUH 1RUQH 2EDLA 3MRLA 3AC0A 1OTSD 1MFCH 4OCSL 5DD6B 2F8VA 4FABH 3SGKA 5DRZB 4KDTC 4I0KA 3UDWA 1FZJA 1A6VL 1AFVH 1I85A 3I75A 3SKJH 1OCWL 2YRLA 2DQCL 5AZ2H 2CLVA 4XAWH 3BEVA 3MA7A 2DAVA 4L8DB 3RGVB 1T4KA 4F7TA 4MA8H 2B4CH 1G6RA 2BC4A 2DLFL 5E94B 3WNPA 5I8KH 2GTZB 4HJGA 2VXUL 2WWKO 5C08E 5C0DA 3QJHA 4WO4B 2E6JA 1NBZA 4RGNB 3TZVB 4HJ0D 1I75A 5DI8A 2Q7YB 5CIPA 3JV5A 1RU9L 2B8OT 3QFJE 4GKOA 1RZ8B 2CKBA 5K9JH 3CDGB 2CUIA 2GW5A 1I8MB 4OZHB 5E9DA 1MFNA 3EGSB 3LKNA 4PJAE 2QQLH 2Y5TA 4YXKH 3MGTB 3UYPA 1RULL 1Z0MA 1G6RH 3BDXA 3MRIA 3DO7B 3GK8L 3B2UC 3EHBD 3MRBA 2VISB 3LKOB 4NN5C 4YFDB 3ULVD 2F74A 2ITDA 2QLVB 4WW1B 1BECA 2ADJA 4HUWA 1OSPH 4M5ZL 4B50A 4WI9A 3DVIA 4WI4A 3RWGA 4DEPB 3C60C 2HP4A 5CIPH 3QI9A 1S8DA 1D6VL 4TTDC 1CG9A 3OZ9H 5T1MB 3UTPD 1GGCL 3VG0L 4XI5C 1XIWD 3S96B 2I9TA 1IJ9A 1ACYH 5IMKB 2BY2A 4E41E 4F15B 5BS0B 4OKVB 5HD8D 2XQYG 3FFCD 4GMSL 1ACZA 1NCNA 4BKLA 2HLFD 5JHDA 1EDQA 4M9OA 5IMLB 1A9EB 2V17H 5F8RC 1AC6A 2VB5A 1BOGA 4JO1L 5D2NE 4I2XA 3FTGB 1ES0A 4RGMC 4S0TD 5SWQA 1U2CA 5DMGC 1YY9C 4JRXB 4MZ3A 4F33B 2IFFL 2XPGB 1AD9B 1FYHB 1P53A 4G6MH 2C4FU 4TQEL 2X10A 1IEAA 5H8DA 2HWZL 1TQCB 5DJCA 2F53D 1UJTA 4X4ME 3MC0A 3NACH 1YECL 5B4MD 1ZA3B 4RAUA 5DD3L 4GQ9L 3MUGB 3WFHA 2W65A 5EIQA 1N0LA 4OFDA 3C5ZB 3SO5A 3BKJH 1A7NH 4MNQE 2IWGA 5D7JD 4QY8A 2CLZB 1JPSL 5SX4I 5D7IE 5EC1B 5GGQL 1PJ9A 1TZGH 1G7QA 5KVGL 3OKOB 3QPXL 1D5MB 2YBRB 3O9WA 2X4PA 2I24N 4JPKH 3IXTB 2D3VA 4NNPL 5HYSG 4UU9A 3R06B 4HIEA 3QDHA 3CDCA 1S9VB 1WBZA 4RMUA 2EDTA 5DMIH 1T22B 2LTQC 3BGFB 4TNWF 2LE9A 1CE6A 5ESQA 5C8JA 4I4WB 2EDBA 1CXHA 3B9DA 4Q9CA 3BRFA 4NQDB 1YEEH 1IQWH 5E99L 2OTWB 4MQTB 2FLRT 2ZG3A 5I75B 5IEHA 5TE4H 4PB9H 4X83A 1BP3B 3Q6FB 5K9KB 4P23B 1ND0A 2BSTB 1UM5L 3EOBA 3UXFA 5BV7L 1JCKA 2GITB 4WUUD 2V7NA 3L7EB 3UYRH 4XWGL 1QKZL 4YDVB 4EI6B 1FVDA 1KNOA 1F4YL 4WJ5A 4YFEA 1YNKL 4F2MB 1R3KB 3ZYJA 4ZYKB 1AGEB 5C09B 1GC1H 1KFAH 1Z3GH 1WC7A 4NUGH 3GMOB 4Y0GA 1IGCL 1DL7H 3Q5OA 3KPLA 4XMLH 3HFMH 2EO1A 1MWAA 1X9QA 2DQDH 2FJHA 4CMHB 4Z7WA 1T83A 2KZ1B 1HOCA 4KTEL 5H35A 1E27B 5DJ6A 2AABL 5E8PB 1K4DA 4HH8A 3QFJD 3HAEB 3QDGD 3LB6C 4OUUA 2PW1B 3BSZL 3GHBH 3V6FA 4GS7C 4ZOCA 5IB3A 1A3RH 4HXBH 5CD5C 2JCCA 3ZYZA 4P59H 3VXQB 4QTHB 4APQC 4DWHA 1HCVA 1JHLH 2YPVL 1RUAH 1MWAH 3HC3L 3WKMH 3DXAA 1W0VB 2EYSB 1U8PA 2XN9B 5D6DA 3SY0B 5JW4R 5K59E 2ZP0T 4H0HB 1YNLL 3GMNA 5GS1C 4GW5B 4HEME 3MZTA 3W2DL 1P7QA 4QHMB 4P3CL 2V5RA 2VERN 3LZFH 2FDBP 1A14L 3NZ8A 5IR1B 5EOCH 4Q7DA 2ENYA 3SPVB 3U4EB 5HVHC 5F88A 5DDHB 5I8CB 3QUYA 2VN4A 4PBXA 5M94B 1GZPB 3HE7A 3ARUA 1ZSDA 4IS6A 4BZ1H 1KCVH 4Y2DA 4E41D 1RK0B 5TDNA 3BJLA 4U1HB 4ZFOL 3FB5A 4PJDA 2VWEE 4FABL 3ARTA 5IWLA 3CD4A 5IVXA 1SEBB 1G0DA 1TZHA 3LS5H 1AFVL 12E8H 1YN6A 2Y06H 1IFHH 5HY9B 1TPXB 5F7EL 5AZ2L 1T3FB 2AK1L 3W9EA 2B4CL 5SWZE 4EXKA 4YBQC 5GRXG 4LQ1A 4ZUWA 1U3JA 2QQKH 1P4IH 1F6AB 3O3DB 1S7VB 3FB7B 3TYFA 1QRNE 3KPOA 1Z9SA 2BDNL 4MXVE 4PLJD 2IPKA 1DVFB 2YK1L 5BO1L 3MGAA 5C9JA 1FDLL 4YXKL 1S5IL 1J0JA 3WXVL 2E6PA 1JK8B 2HG5B 3KLSA 1FL5B 1ZA6B 3ARPA 3VGAC 2E7HA 1JF1A 3WIHA 1BFVH 2R0LH 5JR1L 5TH2B 2NYYD 2VDNL 4OUOA 1OSPL 2P47B 3VWJA 3SN6N 1EMTH 3QDJA 3EYFB 4P5MA 1REIA 2CKBL 1XGTA 3OZ9L 4K7PX 4M1GH 3BAEL 1EAPA 4W6XB 4XNZB 5IJKC 4R4FH 4OLYH 3LDBB 4CVZA 4D9QE 2VKWA 5EU4B 4W68A 1IAII 1NJ9B 1CFVH 4UB0L 1LO5A 3BT2H 1EA9C 3P3YA 4G7VH 4LLYA 2WNGA 5C0AA 2V17L 4RAVB 1N5AB 4JQVC 3FONA 3EYOB 4MCYB 5EU6E 1K2DB 4Y1AB 5ID1B 3O4LB 2OTPA 4GAFB 3U9UB 5ERWA 3IETA 4JB9L 2LVEA 4I1NB 5F6HI 3HS0A 3VH8A 4PS4L 3OF6A 3FQWA 2ITCB 3DX7A 2OX5A 2MKLC 4Z77B 1LE5A 4U1IB 2ARJQ 3IDJB 1UWEH 4IIQC 3NACL 2UV3A 5IFJB 1NCBL 4UBDD 3EYSH 3BJ91 3ROOA 3MJGX 3WLBB 3GJFB 3LKPB 5L2JB 4DZBB 4HK3J 5DLML 3VXUA 3MROB 1V7NL 1UEYA 3MBEC 4ZPVB 1MI5B 1UH2A 4DK6A 4EDXB 1CFNA 2XNAB 1A7NL 1MCCA 1LO3H 4FQPA 2H41A 4BSVB 3QWQB 1TZGL 1AQKH 1ZHNB 3V0VB 1QUNA 3BZ4B 4CU8A 5IW1A 4JPKL 4PRBA 4Z7VB 3OJDB 2F53B 6FABL 1I1RA 3G5ZB 1GGBH 3TC9A 3JVGA 1JVKA 2BFVH 4WWKA 1UJ3A 5D71L 5DMIL 5EO1B 1XF5A 1BJ1J 5D2LB 4GO6B 2VITB 4G8EA 1N6VA 4P46C 2CQVA 5D7JB 2HTLD 4EIZC 5JORA 1U42A 2VLKB 1BMGA 1DUYA 5T3XD 4XNXL 1B0GA 3KPRB 4IOFC 4IRJD 1T1WB 4Y5VB 3JV4B 1TJIH 4NM4L 5M7QA 3SCMC 5EIIA 1T03L 4Z7UE 1OGAE 1UWXK 1WWAX 2EIZA 2CD0A 3TO4D 2X89A 4LARH 2WBKA 2BSRB 3BEWA 3UTSD 5IOPB 3FFDB 2GUOA 1ZK9A 1KFAL 1LEIA 5DUBB 1AGDB 1NCCH 4Z0XA 3IJSB 3LD8B 4NUGL 1Q1JH 1OQXA 1IM9A 3UTZB 4MD4B 3WHE1 1YJDC 1XFPA 1I9IL 1JUFB 1I1CA 2DQDL 4WEUD 1QRND 4KI1A 2H45A 1O7VA 4Q74A 2A73B 1A6ZA 2NY6C 2PYEE 3PHSA 1RJZA 5I1DB 1FFPB 2HJLB 4HPYL 1U8HA 5D1QA 3GHBL 2WZPD 1W0YT 3U79A 1MSPA 5FYJU 1AGCB 1RK1B 3DMMB 3HTLX 4MAUH 4HZAA 5C08B 3KPPA 3HPJA 4JLRB 1A21A 2OR9L 3NN8A 1JHLL 4ONFH 4TUJB 5JXEC 1RUAL 1MWAL 4XX1G 5EOQH 3CLFL 4S2SB 3CFBB 1WZKA 3MLPA 1T0MB 1A6PA 4OLUH 1N26A 2R0WH 3QFJB 4OCYH 3LZFL 4G3YH 4JFPA 4U1GB 1K4CB 2FHFA 1H8SA 1UH4A 1J11A 4X7SH 4PJAB 4X99A 3LKRA 2FHBA 5EIVA 2IPTH 5C0CA 4G6AD 4DK3A 5BMFL 3PWJB 4JGUA 4MD0B 5FGSA 4QTIH 1DDHA 3AVEA 2GIYA 1XGPB 4JFDE 12E8L 2Y06L 1AR1D 4MB3A 5DQ9A 3VD7A 3DVNB 1FZMA 4F9PC 3NIDE 4ZS6D 3ES6A 5EU6D 4OGZA 1NFDF 2HH0H 2GJ6A 1QEWA 3QDME 3RU8H 4QT5A 2GJJA 3ZLQC 4HUUB 3ZE2F 3C2AH 3LH2H 1NGYB 4E41B 4EKXA 3VI4E 3VFOB 1D9KD 1G7LA 2IGFL 2N56A 3GMLB 1U8IA 2J7LA 1T89A 5TDOB 3IFNL 3F7VA 1QLRB 2EYTB 5ETUA 1NMBL 4F37F 2IBZX 5TQ0L 1QFWM 4F3FB 5D2NB 3M45A 4LSUH 4NO0A 5TPWH 1KULA 3BW9B 2P45B 2Q6WB 5L8KB 5E8EB 2C1PA 1BFVL 5JOPE 2H1PH 4LLDA 1X5GA 4U1NB 3TBSB 3LAFA 3CU1A 3ARGB 1J05A 2NR6C 2D7OA 4LVOC 3QHFH 2GY7B 1BD2E 2VDLH 4YQXL 4DUVA 3B9EA 3PL6A 5F9OH 1J0HA 1I1YB 4M1GL 1KC5H 1FAIH 1L7TH 3GI9H 4KAQL 4OLYL 4E5XA 3D25A 3D0LB 2BOCB 5FYKD 4MZ2A 1F11B 3QUMA 3O6MH 3WIHL 5KAQF 1TETH 4QRUB 4PJHE 1F4WL 1CFVL 3BO8B 4MNQB 5HHMD 5BQ7B 1J1OL 1FC2D 1EERB 2Z31D 4PP2A 4Q6IA 5D7IB 1A2YB 2X1PA 3L3GA 1LP9E 5HVWA 1PYWB 1WICA 3BWAA 2BVPB 3NZHH 3IDXH 1J9CT 4YPJA 4HKZB 4OF5A 4OM1H 1B2WL 3CUPB 1OGAD 3BH9A 5IFAH 3RWHB 1GAFL 3S35L 3QUMH 1T7ZA 2ZUVA 3MRJA 5GGRY 2Q86B 4RNRA 1RZJH 2GSIA 5ACZA 2J8HA 1K3IA 2BNQA 1DBBH 4TNWK 3KXFD 3CFJA 3GI8H 1YEJH 3O6KL 4JM4L 1DEDA 5IKCA 3SOBH 1DQJB 1G7IB 1U8JA 4A2LA 2AERT 4MHHG 5E5MB 3RVXD 2NXYB 5AAMA 1BBDL 3QXDA 1RI8A 3RDTC 4EOWL 3ZHLA 5D9SB 4FQ1L 4TVPL 2PXYC 4R96A 3V5KA 1AXIB 4PRPA 5INDB 3TBVB 4JVUA 2HFGH 2QHLA 4OGXL 4JQVA 4BFIA 4BA8A 4Z7OE 4WRLA 5FGRA 5FK9B 8CGTA 3DUSB 4XPTL 1GGBL 2BY3A 1TTUA 3KJ4C 1CD1A 4Y5XA 2ZSVA 4P4KC 2ZUTA 4R2GD 4LNRB 4BQBA 1I9EA 3QIBC 1KJ2B 2NY3C 4HS6A 5JTWA 2RIKA 1KLGA 5DJZB 5D93C 4XB7A 3VFWB 2VLME 4AENB 3MLXL 2B1AL 5EORH 3ULUC 4OZFA 5T3ZE 4G8FB 3TH4T 3QNZA 4GUPA 5E2VL 4N8VA 4ZOAA 3BP6B 3RTQD 1KLFA 4JFXB 4JFDD 5CSZA 4F9LA 3IVKA 2AGJL 2X70B 5E8DH 2E27H 5T1KA 4CW1B 4PJIA 2UZXB 3SJVE 4HUVA 1TCMA 5GS0H 4JPWH 3L3IB 4LARL 4AYFA 5MEQB 4R0LA 1TTGA 1ZT7A 3BXNA 5GJSL 1NCCL 5IVZA 5CINH 4YAQA 3QDMD 1KTLB 1Q1JL 1KXQE 1LEKA 3G6DH 4FHBD 1U41A 4MNHB 2DIBA 1AQDA 3KYKL 2Z35A 5E2WL 3WN5C 5E03A 3CU7A 3U36A 3HZKA 3EO0A 5IT2L 2JELL 1WBYA 4GT7A 2JE8A 4E0RA 3MNZB 3TO4B 2NY0D 2P8PB 2CK2A 4JCLA 2WBWB 4H5SA 4NKMB 1GJIA 2JF1A 3K1KC 3NIGE 4NDMA 5SWZB 8FABA 3TEUA 1YEIH 4MAUL 2QSTA 3KG5A 4XTRD 3RWEB 4OZ4A 4RZCA 4ONFL 4N0FB 4M8QA 5AD0B 1I1AC 1JZ7A 5A3IC 3W0WE 3KS0J 5HI4C 1QRNB 5EZIH 1CFSA 43CAB 3GMMA 1FJ1A 1BD2D 4OQ1A 2ZCLL 3FT2B 1P7KA 5I30L 1MNUL 3AROA 4PJEF 4X7SL 3GJEB 2DQTL 4G6JL 3HC4H 2V2XB 4LQFH 5C0JA 4XPFL 3JV0A 5L2KE 4M7ZC 3UCRA 4B5EA 4NQCA 5EWIH 3RL2B 1VKXB 5D96B 4LGPB 4PRIE 2UUDK 4P49A 2PO6D 2XFXB 2AJXL 3U6RA 3IRPX 5CLWA 1PEZA 3DVFA 2G9HB 5DJAB 3O45B 3KHQA 3C2AL 1ZKAA 4IDJH 2R4SL 4PGEA 3RA7H 4PG9B 3X11B 1J12A 5EPMB 1D5ZA 1KJMA 4HZLB 1EEZA 4J4PC 1K85A 4LF3B 3IDUA 4PD4K 1Q9KB 4FQXC 2EC8A 5JNYA 1JTTA 4ODVL 4MCZA 4RDQG 4DTGL 4LAJH 4JANA 3LEYH 5L6YL 1SJVA 3OAZH 5EU6B 2VZ1A 1YN7A 1GXEA 5TPWL 1X5ZA 4KK6C 5B38G 2DKUA 1JTPA 4RDQF 4JQXC 2H1PL 1RZ7H 3NPSB 2DJSA 5KANG 3SGJC 5MI0B 5SWSE 32C2B 3ARBD 1CGUA 4K8RD 3MV7A 4JDZB 4U1SB 1HILA 2FEDC 3QXUA 4KUCD 5IEKA 1L7TL 4KROB 5I1HL 5MHSE 5J57B 3NA9L 1NFIA 3C6LB 2FBOJ 3GMPA 1ERNA 4C4KO 5CMAA 5DRWB 5FCUH 3QAZC 4GKNA 3HB3C 5E2UH 4MJID 1T7WA 2VLMD 1Y18B 4GAJH 2LVCA 3EO9H 3RUGA 2NX5A 3LN5A 4B41A 2I60L 2H32A 2W0FA 3CZFB 3NZHL 3IDXL 5LAXA 3ALXA 3KLDA 3WSQL 1BVZA 2D7PA 3DROB 1T5WB 4PV9A 5LXGH 1ZT4B 4XXDA 1N2RA 1MCDA 2G75A 1WBXB 4U1KA 4YGVA 4OGAC 2Q1EA 3NFPA 4KK9C 5DJ2B 5IFAL 2ZNXA 2Z91B 3TN0A 1JWUB 1OAKH 1T1XB 4JPVL 4Q6YA 2GJZA 2EYRA 4RBPK 1X7QB 2W07A 5CBEA 3SDCD 1OSZB 4HWZB 2E3VA 5CP7A 3TPUA 4LRIC 2KBGA 3KYMA 2F5BH 4TPRH 5JIKA 3V4PH 2GCYB 1UWGH 5KBNC 2WBJA 3R4DA 3U9PL 4ZAKC 1JGEB 3SOBL 2C3VB 4NQSB 1I8KA 4Z7UB 1OGAB 3TNMA 3X14A 4I18B 1JZ4A 4JRYD 1KN2H 2ZSWA 3DHJA 3O6FA 4DZ8B 2DKMA 5B21A 4LLMB 4FRWA 3TBWA 2Z8WC 1MJ7H 1E4XH 4HBCH 4EI5A 2J88L 3PDDA 1GC1C 4FQQA 3P4MB 1L9NA 4R7DB 4TSBH 5FA4A 1MRCL 5CJ5A 2PYEB 1QFWI 5KZCD 2A83A 1J5OL 3FHAA 5GSRB 2IAMC 1SJHB 2ZKHH 3JV6B 4FFWC 1G1CA 2VXQH 2Z93B 2VLLA 5EORL 2XKUA 5TGBA 2BX5A 1ZOXA 2QEJA 3QXAB 3AS3A 1I4FA 2VL5B 4QXTB 4JM2C 3NTCH 3LHPH 3T08A 4PLKC 1HXYA 2BNUA 1OGTB 4YHKH 4PRAB 4PRID 4YX2H 2AK4D 2AJSH 3BN3B 1BOYA 1UQSB 2YD5A 2VR9A 3T2PA 5JIPA 4NJ9L 4XP4H 2H26B 2R69L 5MEPB 5CINL 1BZ9A 4NUJB 5HGAA 5GRYA 3T0EE 4JFQB 5DFVD 3RTQB 4JFDB 4QHLA 3QBTB 3UBXG 4Q0XH 1FSKC 1H3XA 2Z4QA 1EO8H 3QO0A 4X6BB 4ZUTB 1LILA 4OZIF 1Z9LA 5FDYA 2KKQA 1QBMH 1QPXA 1KYOJ 3RZCC 1XR9B 5F1NB 1DEEA 4GW1A 5I71C 4XMPH 1HHKB 4UOW1 3H9SA 4M6OH 4WTWA 5ANME 1JRHI 3G08A 3QDMB 4LAQH 5I18H 3A6CL 1EAJA 1JWSB 2AJUH 5KVFH 5KSAD 3TFKD 4GRMA 2AV7B 3HZVB 4J8RB 1U3ZA 1U8NB 4HULB 1VENA 5EUKB 3RI5F 4LASL 5BZDA 1AE6L 1OL0A 4XPBH 5ISZA 5DJDA 3X13A 4J2XA 2NY0B 3UJJH 2OMNA 3MRKA 1HHJA 1UB5A 3EJZC 2GT9B 3MSPA 4UT6L 3KDMA 1MCIA 3DX8A 3MCLL 4ISVB 4LQFL 5DQDH 2X4OB 1T04B 1GGUA 3CK0L 3QA3B 5EWIL 3MYJB 3QDAA 4P2RD 4F37K 2P7TB 2IALA 4E42B 1OPGH 2NTFB 1NGPL 1J8HE 2XQBL 5D1ZC 1BD2B 5IBLC 4GAGL 4Y7MA 3ZTNH 2GK0B 5EC2B 5DHYA 4PJGF 2FD6L 5CHNA 3IKCA 1YJDL 1LWRA 2VLJD 4PRNB 5CJOL 5GGTH 2UWEF 1LGVA 3IFOB 1RUKH 1SEQH 2ENSA 2ID5A 3BD5A 4NNXB 1ZLUH 5AG8A 5FGBA 1KG0A 4G42B 2P24A 3BPOB 2XA8H 2C3WA 3MRNB 1OP5H 3CMOH 3HMXL 3QEHB 4HX1B 4PJHB 1NC2A 5F1IB 3SBWA 1CZ8L 1KCSH 1RIUH 1U9KA 4K3DH 1LP9B 1WF5A 4ODTH 5GGUB 4OBSA 5LGJA 3IU3A 2X1QA 1F00I 2A6KB 4NHUB 2FEEL 4RQQA 1DBAL 1HINH 2ZOKA 3MV8D 4YDJA 1CLOH 3U2SA 4KVNH 3QHZH 3MNWB 2EIBA 3O8XC 1FG9C 3LRHA 3O2WL 4PJFA 4TN9A 1HEZA 1KCUH 1RVFH 1I8IB 2XG5A 1IT9L 4F7EB 4M93C 4R3SB 4PJCF 4JAMB 5E08L 3VMNA 5F7DA 4BQ8A 1ZLWK 2X4RA 2VLRA 1IL1A 2YA2A 3MOAH 3HNTH 4X0KA 2CJUL 2YD3A 4R7NB 1LEGB 5CWSA 2HTKD 4YIQA 4JFOB 5J6HA 4HGMA 4ZOBA 4FFVD 3V9FA 4H20L 5FCUL 1OTUD 43C9B 5E2UL 5BRZE 4O58L 3WUWB 4FXGA 1N59B 3VXPA 3QUXD 4X7FC 1YA5A 4LVHB 2PKDA 1AP2A 1KACB 4LKXB 4O2CA 1F3JA 4I5BB 5JMOC 2XWBB 5ALCH 2PW2B 3BN9D 1CDIA 3Q1SH 1MY7A 3THML 1AHWB 4M7KL 1NUNB 5D7LA 4MXQD 4NFBA 2QSQA 5I73B 5HGDB 3DBXA 3QWOA 4G43B 5AUMB 1NGZB 2G5BB 4K3EH 1M7DB 4GAYA 1DQDL 4U1LA 5D1XC 5BJTB 3H9YA 4WFED 5J11C 3JTTB 1KELH 3KLHC 4ETYA 1HE7A 1S78C 3V4PL 1UWGL 3I2CH 2YMXL 2BVTA 2MCG1 3RWCB 5AZEL 2GSGB 1FFOB 4JDTL 4GLRI 1KCKA 2G5RA 3VFRB 3K2MC 3Q3GB 4OCRL 4O2FA 2NY4C 3UPCA 1X5HA 1G7MB 2ESVA 1Q9LA 5LGKA 4XVUD 3SJVB 4HCRA 3OR6B 1K6QH 1TQBC 2CUHA 5HDQH 3OX8B 5AWNL 3B8SA 1JGVH 4K7PH 4LGRB 2X7LB 2APVA 4LCYB 3ARDD 3VXSA 3D39E 1MJ7L 4MS8C 3U1SH 1E4XL 4YFLF 4X4XB 3PP3H 3I6KA 4FXLA 3G6JA 1T66D 3UTTE 4R90L 4CGTA 1IC7L 1PQZB 3G9VA 5KN5B 2QKIA 5D70H 3QIWD 3GBLA 1OWWA 3NABL 1FZOA 4Y4HD 5EU3A 3FO0L 4HCRH 3VFTB 4IRZL 1S7TB 1H15B 3PG2A 3C8KA 3DLQR 3WMSA 3EOAB 4JFYB 3SDAB 5A16A 1AKJA 2IH1B 4OIIH 1DZBA 4Y16A 4XX1E 3BKYH 2YZ1A 3PQYA 4M7JH 3LHPL 1IEBA 1MAML 2V5MA 4YHKL 3V4UL 4YXLH 3FOLA 35C8H 4QCIA 4YHOH 4P2OA 1R24A 4NQEA 3RGVC 2SEBA 1BVKB 1XGQA 4U1MA 4XP4L 2ARWA 3DUUB 3SKMA 4MAYB 4MB5A 4O51A 5CEZL 4GXUN 4ZOEA 3WBDA 3GIVB 4WO4C 1CK0H 5C6TL 3SE3C 4J3WA 1JL8A 3C6SA 3LMJH 2A0LC 3MLVH 1SJXA 4RGNC 3TZVC 3LSOA 4AT6B 5DSCA 3T3PF 4Y8AA 3DX6A 4PRIB 5CSGA 3V6ZB 3OJMB 3ZE2E 1TMCB 2GAZA 2EC9U 1QBML 4C55A 1SBSL 4LLQA 2OXGA 3H7BA 3PWVA 4L9LA 1FHGA 1FYTD 1OAQL 1BFOB 2J1KA 4ODXB 2MHAA 1KOAA 4M6OL 3L95A 1WFNA 1ZVSB 5D5MA 2ATKB 4P2CG 5C6WH 3AU1B 5IK3B 4GRWE 5I18L 1G6VK 5KVFL 2ZWLT 1WIOA 5CBAB 3RHWF 4FZ8L 3MRRB 2X41A 1NDMB 2NNAA 3P4NB 3ZTJH 4DEPC 1BF8A 3ZSSA 4LSRH 3KNBA 2B1HH 3B2UD 3ZYIA 4JFFE 1IQDA 1D5BA 2AI0H 3NAAH 4XPBL 3IDNA 3UJJL 5EO0B 5ITBL 4V1DE 5GRZA 2C4FT 4X8JB 2UVFA 4LVNC 3RX5A 3C60D 1T1YB 4F15C 1UB6B 4M6AA 4TTDD 3WIIL 5FYLL 3SDDA 2CIKA 1FBIL 4EDWH 4XI5D 4YBHA 1HCFX 4R6UA 4EQ2A 1MHCB 1G9MH 2W38A 2C7UA 4PJ8A 5SWSB 3TLRA 5F44A 1VGEH 5FA3B 3ZTNL 2FH6A 2F19H 1R0AH 4JR9L 4NQVB 1VADA 3U4BH 5DR5L 4KRNA 4L4VE 3CH1A 1SYVA 1NEZB 2JLLA 3P40A 5JDSB 4LSSH 1AXSA 2K3TA 1IAIH 5DTFA 1RIUL 1VGKB 2ADGA 2Y6SC 5JLZB 2JIXA 1FFNA 4NO3B 1DQLL 3R1GH 4K3DL 5DMGD 3AM8A 3RNQB 5HHQA 1AC0A 2JCCF 4MSWB 2KL6A 3T1FA 5C07A 1C5DA 1QLFB 4LHJB 4PREB 1M71B 2QHRH 3C5ZC 3E6FB 3TA3A 1FNEA 1CLOL 3QHZL 1MVUB 4XBEL 1I7TB 2Y7QB 1RVFL 1UZ8B 2A38A 2DYPA 1HWGB 4G6KH 3TBYA 3TJHC 5FGCE 4ZUVB 4HIXH 2NW3B 1U58B 4L1DA 1FL6B 3N1PC 3HNTL 3T3MF 1R5IA 3BGFC 1PLGH 1RZJC 4JY6A 1SJEB 1BWWA 3HC0A 4BSWA 2A74B 5IVXF 3DURA 3MV8B 5I75C 1GCFA 3P9MB 1AIFB 2ZJSL 4KPHH 1CXFA 4BH8A 1S5HB 4P23C 5J9PB 4KKCD 1U8KA 4PGZA 1EHLH 1MFBL 5DD1H 1ZGLM 4KDWA 4URTB 2NTSP 3SDXA 5ALCL 4MDIA 3QZWA 3GDBA 3RVUC 2MQ3A 4NPYB 3V6OC 4LLUB 3DYOA 4PG2A 3L5HA 4HWBA 3VGHA 1AO7E 2EDOA 4NCDA 4DUXA 1VFOA 2I07A 1AXTH 4OZGF 2Q20A 1KELL 5DYOA 3U0PA 4GBXA 3NFSL 3KJ6H 2MQCA 3MLRH 1CL7H 1JHKH 3REVB 2CGRL 5J12B 5IJVA 4POYA 4HKBA 4R97B 4CMHC 4UDUB 4HHAA 5IHZB 1ZHKA 3JWOC 2MTPA 2ADFH 2G2RB 3T8XB 1D7FA 1K6QL 2Q76A 2W91A 5GJTH 5HGGS 3LQZA 1JGVL 4M5YL 5HHVL 1YMHB 3PXJA 4EN3A 5I8OH 5I1AA 3JBG7 3LB6D 2ED8A 2VDOH 4K71B 4YC2C 1A7PH 3T0EB 3GSUB 4ZUUB 3QP3A 1IC4L 1YEKL 3IXAA 2UZIL 4YUEH 5HYQA 1CLCA 5CD5D 3OKNA 1IKFL 2DJUA 3ZDZF 4APQD 1ZXQA 3G04B 2ZUSA 4P57A 3TCXA 3FO9A 1OB1A 3T4AA 2IANA 3VH8G 3GUTB 3IRZA 3ARDB 5ANMB 4YZFF 3D0VB 3QNYB 4PJEE 4YDKH 4QEGA 4JFHD 3DVGA 4KRPB 3S3PA 4G8IA 4LIQL 1P4LB 2OSLA 4L3CA 4LHUD 4YXLL 1BGXL 1E4KA 5FYJD 4Y4HB 5I2IB 3M17B 3TPKA 2BNRE 4NKQB 3MV11 4OCXH 1XF1A 4L4VD 4M43L 5JW5B 1CK0L 2EH7H 2CDGA 1W8NA 3VFVB 3A6OA 3MBXH 4Z5RB 1KJ3L 2HLAA 3RZWA 3WFBH 3MLVL 2DTML 3D2UD 5IG7B 4TUKH 3FHQA 2ZCKL 4YBQD 2ED9A 4LOUC 3AREA 3B5HA 1DVFC 3WS3A 1SM3H 1J8HB 3WEXA 3CVHL 4C56D 3L3HB 2H2PC 2J4WH 3LKSB 4MA3A 4UTBH 5DD6A 3MV01 5ENWA 1DSFH 3T1WA 3GB7B 4I0PD 3A67H 3BE1H 3DSFL 5J56B 2FIKA 1MHEB 4W6YB 2Q8AH 5GS3A 5C0BD 5EU7C 3K4AA 4NO2B 3GHEH 1W72A 5H2BB 4LSRL 5ICXA 4S0SD 4ZMAT 3NAAL 1JZ5A 4XNZC 1NCTA 4MWFB 1A6AA 1WAAE 1ZWIB 5EBGA 2JJSA 2FATH 4Y89A 1OHQA 3CFIC 4PTTB 5EU5B 3FO1A 1FLRH 4NC0B 5CJXA 4PRDB 2MJWA 2YWZA 1G9ML 3KYOA 4C4KT 2OL3H 1KPRA 3JTSB 4EUPB 2HRLA 2XZCH 1W72H 5CGTA 1RJYB 3GSNA 4J1UA 5E8OB 3EYUH 5F97E 1XF2B 3PWPA 4GRLA 1G7JB 1U3HB 4KMTH 4PJ9B 3RL1A 5C2BL 1WGOA 3HCVA 4LCUB 3CFKB 4ETQA 1S7QB 1IAIL 5DC9B 4BH7A 3L3JA 5GISH 1NSNH 2VOTA 3DRQB 1FNGA 4JPIA 2ZPKH 3R1GL 4OD3H 5EOCJ 1FGVL 3O3BB 3LOWA 1R5VA 2F54E 3GSNH 1KPVB 2PTTA 5DS8B 4Z8FL 4MD5B 4JG0L 1YMMD 4JREB 1YPZA 2NY5H 5E6IB 1ZT1A 1QTYT 3HRZB 3O3EB 1WT5A 2GTWA 1UG9A 4Y19E 4AIZA 3IFLL 4G6KL 4KJPC 5C6PB 1HDMA 4JZJC 4XH2A 1S7RB 4NC1E 1NAMB 3MBED 3WS6C 4OAWB 4F8QA 4QKXB 4UUJB 5BOPA 4DGIL 1PBYA 2VZTA 3OHXB 4L4TD 1C5CL 4MYWB 3I9GH 5T3ZH 4NN7B 1F6FB 3R8QA 5I1GH 1ZA3A 3LRSB 2EZ0C 3CAFA 3M1BB 4HFUH 4WNQB 5MERB 5TE7L 5E1AA 3D39B 1QNZH 5ID0B 4TYUA 1UACH 4P46D 4X5XA 1HHHA 3HE6B 3H9ZA 3L9RA 3OXSB 2DQFA 5HPMB 1OF2B 5EC1A 5F72S 4LSQH 1D5MA 4UILH 1UFUA 4IOFD 2QBWA 5FHAH 2BNRD 3ROLA 1NGXA 5IMMB 1CD0A 3LD8C 3R06A 4KKBD 3ZDXE 3SCMD 1S9VA 4JFEA 3PHOB 1CT8A 1BJMA 5ESAA 1T22A 1JPTL 2HJFA 2M1KA 2IMNA 1OP3H 1DBML 4IOIA 1RZKC 3OB0K 1P2CB 3MV9E 1FN4A 1GGYA 4HEPG 4JN2A 3VWKA 4I48B 4S1DC 1EFXB 1JMZA 4NNYB 4HXAL 4OCMC 4HWBL 3ARSA 4X7TA 2V5TA 1FZKA 1J88A 4XVJL 4C57C 5I8OL 4UNTA 3DMMC 2E5EA 3REWB 1KEGL 1QQDB 1HSAB 4OZIE 3QXTA 1I3VA 2NY6D 5C0EA 1A6TB 4YDVA 3RX7A 4EI6A 1A7PL 4AIOA 1ZTXL 3KPQA 3MUZ1 3F62A 5DFWH 4ZYKA 2IF7A 2XWJB 1FG2B 1DLHB 4H26B 5CP3A 4L3ED 2V9QA 3LN9A 5JXED 3TVMA 2OJEB 3NCJL 4DGVH 2D0FA 2LU7A 5I1EL 4D9LH 4NGHL 1LNUB 1H5BB 5KSBA 5CJ8A 4PJ5E 1X3DA 4GRWB 3HI6H 1QO3B 4KI5E 2HKFH 4M6MH 4DCQB 2VTFA 2NY7H 4XPGH 5F9DC 2PW1A 2XZQL 4LEOB 1F90L 5BXFB 3KPMB 3CFCH 4LCWA 5F7NC 4PBWD 4FQCH 4O4YH 4GG6A 2WUCL 4KMLB 4JFFB 5GRUL 1UZ6F 5LQBH 3GZKA 2PCPB 1A1OB 4RGOL 4CUCA 1KTDB 4V1DB 5B3JF 1IEHA 3RHWK 1JHTB 2XN9A 2EH7L 1KPUA 5CFHA 4LMQE 3MBXL 4GW5A 2J6EA 3VXME 4ZD3L 3E1F1 2ZNWA 4PJGE 5CUSH 5I16A 5DMKB 1F8TL 1JNNH 2IADB 4TUKL 5DD0L 2DWDA 5IR1A 1QYGL 1HSBB 3AXLA 5IVOA 1CYGA 2YA0A 4AL8L 5DDHA 1SM3L 3ARFA 5I19H 4ZSOA 1OP9A 3P0GB 2VXTH 15C8L 1GZPA 1RQ5A 3L6FB 1IGIH 5GGVY 1N4XH 5D2NC 3N0PB 5AAWA 3WFDL 1U8QA 1U8OB 2HVJA 5HYSA 4MJ6A 4UTBL 4WGVB 1MFEH 1DSFL 4CDGC 1XGUB 4K94L 4L4VB 3T65B 3TT1H 3A67L 2FJGB 3TIDB 4U4BA 3GMQB 2F5AL 2P5EA 4LPYA 4U6VH 2J6EH 4IRSA 4GXUM 1FO0B 4P9HH 3ARGC 4UOJA 5IGXL 4OZFG 3GHEL 4YBLB 3D2UB 2VUOA 4N8VG 4ODWB 2PNDA 4GSDH 5KOMC 3EW3B 4K55A 4TUOA 2YS4A 1HI6A 3PP4L 4XC3L 3TWCH 4AM0B 5C9KA 2HMIC 2B2XH 2NLJB 4C56B 4PJCE 2F15A 3L5WA 3PABA 4NKIH 4PYGA 4DVBB 5DJYB 1VACB 4I13B 4KJQC 3N9GL 5JQHC 1RMFH 4I0PB 2YSSB 4PJIF 4U6XB 1S7UA 2W0PA 1A7RH 1Q72L 2CIIA 4PGCA 4ZPTA 3VFPA 4G9FD 2VSCA 4QRPD 5FGCB 4D0CA 3GSOB 4HWEH 1QR1A 4G8GE 4UV4L 4WUKH 5DWUH 1EEYB 2XZCL 1W72L 3VGAB 4KY1H 1ZA6A 1OM3L 2A77H 3DGGA 1S7WA 4XP1L 3GBML 4PGBA 4K3JL 4HK0B 5J1SC 2FHCA 4UI2A 1EK3A 3SQOL 2QR0A 25C8L 1OWRM 1NSNL 1UVQA 1Z9MA 1UADC 4WEBH 2AKRA 4TRPL 1CLZH 3LEXB 2IFGA 3MV9D 3MZGB 5T1LD 5TF1H 4A2MA 2VQ1A 3GO1H 5E9DE 3VMOA 1NBQA 2YD9A 1YZZA 2NXYC 5D72L 4EEEA 3ZKXB 3QQ3A 3AAZB 4AEIH 1AO7B 1DQQB 1HXMB 4LPVA 4X6FB 1UCBH 5FXCH 1JBJA 3RVWD 2RBLA 3P73A 4AG4L 1BIIA 1E6JL 1GPOL 4HPOL 1XIWA 4AEHL 1FVCB 5ID1A 3RDTD 4NT6A 3BESR 4NKDB 5IM7A 2PXYD 2AEIT 4A6YA 4X4YA 2CLRB 4UBDC 5C7XH 3KHOA 4PGDA 1YMMB 3FFCA 4FXKB 3PJSA 3GRWL 5HVFB 2RB8A 4Y4FB 3IDJA 4W81A 3BUYB 4XVTH 3A6BL 4P4KD 3SE8L 5GXBB 3ORJA 5I1GL 1E6OH 3QIBD 2NY3D 2LABA 1BZQK 4WI5A 4PJ5D 5JHDE 4CVXA 4X6CF 4DZBA 1VCAA 2YD7A 1ZEAL 5INCA 1UACL 3CDFA 3D69B 2APBA 3UPRB 4I2XE 5B22A 4XXCA 1KCLA 3ULUD 4LSQL 2A2QT 2YKLH 3BQUC 5F9JA 2ADIA 4PB0H 5FHAL 4UT9L 3QEGL 4WV1B 1V7ML 4UT7L 4LVEA 1PKOA 2F53A 1V3KA 4U3XA 3VFUB 1FGNH 5DUPH 3QQ9C 3WUZA 1H8OA 4UIKL 1OY3B 5D2LA 4ZTOL 1F45A 5AEAA 1CR9H 1P5VA 4MNGA 4PJEB 2VWEC 5I1CH 4D0BA 2VITA 5F7YC 2R15A 2BXYA 5D7JA 4HKJB 3MOBH 4DFHA 2V5YA 1A6UH 3VFGL 3HR5B 3TO4C 2Y07L 2HT2C 3FQXB 2BNRB 4P5TC 2VSDA 2X42A 3T3PE 1XCQB 3OJ2C 2A9ML 2RR3A 2IH3A 2LAGB 4Y5VA 5EDXA 2VAJA 1B4JL 3IDIB 3VFMA 5IV2A 5H94A 2DBLL 2Q3AA 2E7LA 2BY0A 4KTYA 5DT1L 1MJ8H 3PDOB 1II4E 1HIML 1QBBA 1AGDA 1DBJH 1C08B 2Z92B 1OARH 4KRLB 4PUBL 1SVZA 3UJTH 1CD8A 1I1AD 5GIRA 3MR9B 5A3ID 2P8MB 1I3GL 4DGVL 3KLAA 1WJ3A 3D9AH 4HGWB 1HQRB 1T0NB 4LCCA 2QQQA 3MLWH 4UV7H 5J7CC 4CMMB 1FV1B 3QHTC 1J1PH 4OFYA 1LDSA 2HJKA 4WUUA 1JRHH 2BRRH 2HKFL 5DHVA 3EO1A 1YNTB 5I1DA 2NY7L 1FFPA 3OPZH 5D96C 4G8GD 2JJWA 1P5UA 4WU5B 3MRPA 5FF6A 4QOKD 3CFCL 1AGCA 3ECBB 5A2IH 4WDIA 1C5BL 1RK1A 5LQBL 4L3EB 4YHMH 1TCRA 2DM7A 4KFZC 4TUJA 3GBNH 3JWDH 4NFDA 3V6BR 1JPST 3JWOL 3MLUH 4OT1H 5CUSL 3QFJA 5DHVH 3QDGA 4F7PB 1VESA 1JNNL 3HI1B 4M48L 4Z7WE 3IF1B 3RY6A 2AV1B 3SGEI 5I19L 4QRTB 1ORSA 1IGIL 2HKHH 3BDYL 4W4OC 1MF2H 4J4PD 1EGJA 5GRJL 4MD0A 5FHBL 5I1IH 3RBGA 4FQXD 1MCWW 1EEUA 2JCCE 3G5XB 2BVYA 3W39B 3NPSC 2J6EL 3I50L 3R0NA 1A7QL 3DTXB 4HT1L 5MI0C 2H6PA 4KK6D 1UM4L 3DXAE 5CJQH 2K1MA 2ATPB 3BISA 1SBBA 1DLFH 4GSDL 3KPNB 5F7MC 1HH6A 3FT4B 4KROC 2F54B 4TNVF 3TWCL 4OI9A 2B2XL 4E41A 1EGJH 3C6LC 4HQQH 2RFXA 2MSPA 3VFOA 1E4WH 3D48R 1PZ5A 2FJFB 3QCTH 4Y19B 4N0YH 1A7RL 3GKWL 4PJDE 4NWUL 5IVXE 2WINA 1T2QH 3BYYA 5DWUL 3FN0H 4W6WB 1Z9OA 3HB3D 4U6YB 4GMTH 1B4RA 3BP4A 4NM8L 4KGLA 4K7FB 5IB1A 3MQIA 2A77L 1QZ1A 4QHUB 4ELMA 5KVEL 3C5SA 4MA7L 1MIMH 2W1NA 1D5IH 1K8DB 5GHWH 2FYYB 2YPLD 5IUSA 1UXSA 3IDGB 3NIFE 2R2HB 4JZOA 5C2UB 3LPGA 4WEBL 3IFPB 4OGAD 4KK9D 4UINH 3BVNB 4ZXBB 2MNUA 3KR3L 3ARQA 3CFDB 3KPSD 4UQ2A 3FMGH 3IAQA 4OZGE 1OAXH 3GSRB 3ZKQD 3N50A 2IG2L 5HDLA 4I18C 4QXGH 4AEFA 4JDVB 4Z6AT 4AEIL 3HZMB 4NRYA 2CDEB 4HAGA 1C12B 2BVPA 3MLZH 2FL5A 4ZAKD 2BVQB 2CPCA 4M6NH 4GW4A 3EDFA 2VXVH 3WL9B 4OD2A 3RNKB 1FE8L 4FOMA 1IAKB 1IGFH 4XCNA 5JQ6H 3WE6A 3QDJE 3RWHA 3S5LB 1JZ2A 2FX9H 3QCVH 4H88H 3MV9B 1JGDA 5T1LB 2YD8A 4GLRH 1B0RA 2N1KA 4JQIL 3RWFA 4WHYG 2NY1B 2XG4A 3ULVL 3FRUB 2XTLA 1VA9A 1SVCP 2YN5A 1L6ZA 1A1MA 2VABB 5D7IF 3U30B 4OQTA 4K2UH 2OBGA 3ZDZE 4OZIB 4YHPB 3QG7H 3WIFB 5DEGA 2UYLA 1N64H 3QQ4B 5C0AE 2IAMD 4FFWD 3RIAF 3UBXB 1MAKA 3VXNB 5D9SA 4A6YL 1TNNA 4BUHA 1B0WA 1ONQA 4YZFE 4BFEA 5INDA 3UP1A 3QB7C 1NLBH 2YKLL 4J3OC 2EDQA 4PB0L 4JM2D 4PLKD 1QFWL 1FVEB 2HRPH 4QF1B 5HTSA 4EBQH 5DUPL 2YR3A 2VZSA 3OAYK 3BGAA 3DIFB 1QSEA 1DFBL 2NY3B 2R56H 4PJ5B 4XRCB 3BP5B 3P30H 1PEWA 3MRMA 1E28B 4PJFF 3U0TB 5DQJA 2R1WA 1EJOH 2ARJA 3QEQA 4NZRH 4GRWH 4AENA 3MOBL 1HZHH 1RJLA 5F6IC 5GSVA 1NBVL 4XGZB 4QXUL 4LP4A 3VXUE 2H9GB 1IM3B 5LCVL 4R4BA 4G8FA 3ARWA 4N9GB 4ODSH 4M61B 2DMCA 1OAUL 1CXIA 3OGCB 1INEL 5J1AB 3VRJB 3RZCD 2R2BA 1YC8A 3QULA 3QEUB 3VXMB 1U8LA 2W9EL 4PJGB 2XZAL 4LFHD 3EFFB 3RKDC 1DBJL 3AUVA 5ALBL 1X4XA 3WO3B 3L1OH 4YH6A 1H3PH 2NY0C 2DF3A 3UJTL 3WN5B 1N0XH 5JO5B 4JY5L 3TV3H 5CCKH 3RWIB 5BCAA 4IRJA 4PR5A 3MLSH 4YO0B 1G9NH 3S37L 4LP5A 3S35X 3HE7D 1JRHL 3MXWH 4Y2DD 2DLIA 1CICB 3ABZA 1U8MA 1NLDH 4ZDHA 2ZG2A 1A9BA 3OPZL 3EJZD 3TO4A 2R1XA 3LPWA 2J8OA 1AI1L 3UTSA 1XAUA 4G5ZL 4TSAH 5B39B 2MPAL 1F4XH 4CADA 4P4RA 1UXWB 2FWOB 3NCEB 4YHML 3MCKB 4JHWH 4OLVL 1HKFA 5MP6L 4I3SH 5T3XH 4ERSH 4PJCB 4JCMA 4JZNB 1RZKL 5TJWK 3BX7C 3GBNL 3JWDL 5D1ZD 3BPOC 1N3NA 5IBLD 3SEPA 3FOMA 5ECJE 3MRLB 5F93C 2JB6A 3QO1A 3TBTA 1KSRA 4UQ3A 1T21A 4MJ5B 4G8GB 5DO2C 1BWMA 3WJLA 4DKEL 1FZJB 4F7CA 1HQ4A 3I75B 5GRWA 1INQA 2HKHL 2CLVB 5FV1L 2BHUA 3BEVB 4F8TA 3EFDL 3MA7B 5JUEH 1T4KB 4F7TB 5EUOA 1G6RB 2BC4B 1T6VN 4HJGB 1Z5LA 1FFRA 5C0DB 4NBYB 3QJHB 3I85A 2P5WD 2B0SH 1NBZB 4BK4A 4ENEC 1SMOA 5CJQL 5JPMA 3O8XD 5DJAA 5DI8B 1EFQA 5CIPB 1S7SA 3PIQB 2EE6A 1KXVC 2CKBB 1P4BL 4NBXB 5E9DB 3X11A 4KK8C 1NC4D 3LKNB 1RY7B 3K8LA 5IBUB 4YJZL 3OKLA 4HZLA 2Y5TB 1E4WL 4I9WE 1G0YR 2NQCA 3GSQA 3QCTL 5C0CE 5BZWB 1G1YA 3MRIB 4OCLC 5EZOL 3MRFA 1CTNA 2D9QB 3B83A 4WY7L 4DN3L 3MRBB 4LVHC 3UJIH 3LS4H 3BZFA 1T2QL 3V5HB 2NY5C 2F74B 4QWWD 5EU6A 4EXPX 4K8RC 1GHFH 1Q9WA 2ADJB 4HUWB 2E9JA 2L7UA 3CGTA 5J13C 1NGQL 3RWGB 1IGJA 6CGTA 3QI9B 5E5UB 5DURD 1S8DB 1AHWC 9CGTA 4RRPG 5DZOA 5IHBA 1RAMA 3H9HA 5I73C 4MDJA 2GJ6E 2DI7A 2EDKA 1MIML 2E9IA 1D9KA 3P11L 1QA9A 2I9TB 32C2A 5TFSL 3OF6D 2VDQH 3JUZA 1F4AA 4U7KA 1P84J 3Q6GH 2EH8H 1S3KL 1CCZA 1XMWA 5J3HD 2VUYA 3CXHJ 1J87A 5JHDB 5AYUH 2QADD 3DARA 4WU7B 5FM8A 3KYNA 3V2AR 4LRNL 3DJ9A 3FMGL 4NQXA 4POUB 2BCKA 2GFBA 2YUWA 3D85D 2XZZA 4J23A 5D1XD 1OAXL 3KLHD 1BOGB 4I2XB 1S78D 4GKZB 4QXGL 3BHBB 2D9CA 3PGDA 3EJYC 2F8OA 3CXDH 4HIHB 5SWQB 1IGYA 4GOSA 2WUBH 5C0RL 5EULV 2E8ZA 2FCBA 2NY4D 1T5XA 1V5JA 1BQLH 1IEAB 3QIUA 2XV6B 5JQ6L 3O4OB 5DJ2A 1IZJA 1TITA 3IGAA 2FX9L 4L4JA 5DJCB 3DV6A 4Q9RH 4RAUB 4MS8D 5DZNA 2Z31A 3WFHB 5K93A 1LDPH 2W65B 3MACH 1CIUA 1WQVT 3I6GB 3SDAC 4QY8B 2ED7A 3DSNA 3QG7L 2C3VA 3GJFK 1G7QB 2APWA 3MRCB 3H8NA 3O9WB 5CEYA 2EC9T 3TT3L 1B6DA 4CN4A 2X4PB 5FYKH 3PV7A 5I74B 4UU9B 4B0MM 4HIEB 3FQRA 3FCTB 4WFHD 5I1KH 5ESQB 1CE6B 5C8JB 5T5NF 2HRPL 4MAYC 5ABDE 5E5RB 3KXFA 1GH7A 4NCC1 2FX8H 3V6OE 3E3QC 5IEHB 4EBQL 3BOVA 3TYGH 1TVBA 4OQTL 4PTUB 4QGTA 2XOTA 5JOFA 2R56L 2BNQE 3RGVD 2IPUK 3P30L 5B38A 1ND0B 4DJMA 4GFTB 1EX0A 2VC2H 3EOBB 3FRPG 1EJOL 1N6UA 2APFA 2CR6A 4ELKA 1VHPA 4JN1L 1CN4A 4OCSH 3LRGA 3VJ6B 2A0LD 1KNOB 4RGND 1ZANL 2VL5A 3DYMA 1A6VH 2DQJH 2Q3ZA 1OCWH 3QG6A 4PRPE 5IB5B 1TZIA 1RHFA 1ZHLA 2DQCH 4H0GA 1WC7B 2XYCA 3X12A 1RJCA 3C9NB 4X5WA 3VW3H 1KJ2L 2O61A 2P44B 1CVRA 3KPLB 1MWAB 3FQNB 1MREL 2VXUH 2H26A 2FJHB 4ORGA 4Z7WB 4YR6A 1HOCB 4M02A 5DJ6B 3BZEB 1K4DB 5EBWA 3NBNA 5DJ8A 4OUUB 4JFQA 1N0XL 1RZGA 4MX7B 3V6FB 3RTQA 1G9NL 4JFDA 4OI7A 4ZUTA 3TFKC 2JCCB 5F1KC 1NLDL 1I8LC 3OMZA 4J3VA 1N8ZA 1I1FB 4TSAL 5BS0D 3GK8H 1U8PB 3QQNA 1F4XL 3UTQA 2YHGA 4PJIE 3QDMA 1JNHA 1L4IA 1I9JL 4NOBA 4BZYA 1P7QB 4M00A 3HG1A 4ODUA 4I3SL 5T3XL 4M5ZH 3NZ8B 2AV7A 4P9HC 4WWID 1LK2A 1QLEL 1Y6KR 3Q48A 2A6JA 5EUKA 1D6VH 3QUYB 4RMRA 3CFEA 5CS7A 3HE7B 4NRZA 1GGCH 3VG0H 4ONHA 1ZSDB 4IS6B 1JYVA 4Y2DB 5TDNB 3O11A 4H8WC 4XWOD 4PJDB 4KQ3H 2KQNA 1IMHC 5IVXB 4JRXD 1YN6B 3SKOA 4GMSH 2VL4A 1ULVA 3NIDF 4PRHA 4OM0H 5JIIA 5JUEL 5F96L 4NJAL 2X4NA 4P99A 5HXMA 4RFOH 4XVSL 4JO1H 1BD2A 2KDGA 4ZUWB 3VI4F 4PBVC 2GK0A 4WTZA 5EC2A 4UDTA 3C5ZD 4LSTL 4PRNA 3TYFB 3QWRA 3KPOB 4WI7A 5M95B 4NNXA 1M6OB 2IPKB 3SKNB 1MELA 3JXAA 4HF5H 1P84K 3TJHD 4OZGB 2HWZH 5C9JB 4HC1A 3CXHK 1A6WH 3DI2B 1YECH 3QFDA 1XR8A 1JF1B 1NFKA 4NQCE 5DD3H 3I6LE 4Z0BH 2PO6A 3LS4L 4NQDD 1GHFL 4D94A 2ZUQB 1Y6NR 3QDJB 4JHAH 2XY2A 2R8SL 4CU7A 1MVFA 1JPSH 4XZUA 4P5MB 1LO4H 1XGTB 1I8IA 4P23D 5GGQH 5BVJA 1EAPB 3QPXH 2EDJA 5KVGH 4WW2A 4RSVA 2BVUA 3EBAA 4HC1H 4CVZB 2ZZUT 2X4QA 3EIFA 5EA0L 1Q0YL 2W59A 1C16A 1B6UA 4I77L 4XNUL 1KENH 1LO5B 1IKNC 5E99H 5EN2A 3EDEA 5J12C 5JHLL 2P43B 4R97C 5C09D 5FUZL 2CMRH 4Q2ZA 5FKPB 4LLYB 1SMAA 5C0AB 3N1GC 43C9A 2GHWB 5F7HA 3FONB 1EV2E 3Q0HA 1UM5H 5BV7H 1UGNA 3G6AA 3ARBA 2WUBL 4CKVX 3HS0B 3VH8B 5FCSH 3PNWA 3FQWB 2PW2A 1L0XA 4M62H 3DX7B 1BQLL 4JKKA 1F4YH 3CVIL 4QGYA 2QTEA 3T0EC 1LE5B 3FB8A 2QADB 3MV7E 4QHKJ 1FLTX 3ARXA 3CPLA 3D85B 4MJIA 1MJUL 4N0UA 1TVHA 4XVUC 4NFCA 1IGCH 3I02A 3ROOB 1QPPA 5A2KH 2C3GA 2FBJL 1LDPL 5GS0D 3MACL 1CFNB 4KTEH 1NAKL 3VFRA 1JF6A 4N8CL 2AABH 1EO5A 1DBKL 3FZUC 2PR4L 4X9HA 1UWXH 3LQAH 4FQLL 3RUGE 2NX5E 3MO1A 1OD9A 1T66C 4FTVD 4KRPC 5IW1B 2X4UA 3BSZH 4P2QE 5FYKL 4JO3H 4PRBB 1YYLL 2DQHH 4WWKB 2K7PA 1UJ3B 4XHQA 1XF5B 3SDCA 5I1KL 1VFAA 4R8WL 4Y4HC 5T1KD 7FABL 3E6HA 2A6IB 2BOBA 2YPVH 4QRQA 3HC3H 4G8EB 4N9OB 1WV7T 2DDQH 2FX8L 3ZE0F 1P1ZA 1YNLH 4M9PA 4Z7NF 3W2DH 5C0IA 1N7ML 5JORB 1YPZF 1RZIA 4V2CB 1B0GB 3QNXA 5JZ7D 5J6GB 4JRYA 5DF0A 4M7LH 1ZGLA 4BM7A 4LPXA 4JFYA 5EIIB 4XAKD 2IQ9L 2Q8BL 1P6AB 2DQJL 4LOUD 1Y0LA 2GUOB 1DVFD 4UIMA 1MCBA 5F7EH 1LEIB 4EJ1C 2DLTA 3LQMA 3H3KA 5HGHA 4Z0XB 2AK1H 3HPLB 3VW3L 4KVCL 1IM9B 2H2PD 2P8LA 5C86A 3PP3K 1P9MA 3CSBA 3DUUA 4ZTPL 1M1SA 1F6LL 1SYSA 5CLTA 1YDPA 1UEMA 2CDFA 2VDKH 1A6ZB 2J3SA 1WITA 1TLKA 1RJZB 1T1ZA 1M7IA 2BDNH 3NIGF 5F7FA 1U8HB 5CEZE 4G80A 1DQML 4HG4J 4AT6A 2NW2A 3CLEL 2YK1H 5BO1H 1V3MA 2B7DT 3INUL 4X8XA 4NQCD 1FDLH 2AK4A 4IJ3C 5IBTL 3KPPB 1S5IH 3WXVH 3HPJB 3STLA 3NN8B 5GS2D 1BFOA 4N1HB 3HRPA 1ZVSA 5JR1H 2BJMH 4JFPB 3ZKNC 2VDNH 5CBAA 1RIVL 1U3HC 4PJ9C 5FIEA 3VGBA 4X99B 1MQ8A 2IC2A 3LKRB 4X6DA 4WHTB 2CKBH 3BAEH 3TF7C 3RVVD 4RIRA 4DQOH 4Y1AD 5C0CB 3O4LD 3S4SB 1XGYL 5T1DL 1QSFA 2CUMA 4KQ3L 4LVNB 1RUML 5E56A 1T1YA 2G60H 4IMKC 4UB0H 1KF9B 3KWWA 5DQ9B 3O2VL 4JREC 4OM0L 3F5WA 1HH9A 4DAGH 5D7SL 1W0WB 5KSAA 5E6IC 1FZMB 3ES6B 1A4KA 3ZL4L 5IB4A 3H9SE 2J12B 2GJ6B 1QEWB 2FB4L 3R8BB 5L88H 4RFOL 4QT5B 5IIEA 3PUCA 5FA3A 4U31A 4XNYL 4DKAA 4NQVA 4HUMB 1MI5D 5HDBF 1ADQA 3HAEG 2XRAL 4JB9H 4KTDL 1G7LB 1EBAA 1U8IB 4PS4H 2YUXA 3F7VB 1CXKA 4HF5L 5ETUB 5ISZE 4KJPD 3VXRE 4FS0A 4YDLC 1XZ0A 1UA6H 4N1EA 1VGKA 4P2RA 1JFQL 4NN7C 1A6WL 1B88A 4NO0B 1W2KT 1F97A 5E4IA 1NCBH 3TO2B 4GG6F 1MIEL 3UC0L 2C1PB 2RHEA 4Z0BL 4YHIA 5D6CA 4LLDB 1M05A 5DLMH 1V7NH 4FG6C 2NX5D 4PREA 1M71A 3GSWB 1MHHA 2FGWL 2VLJA 3K4ZA 1I3RA 4P2QD 2V2WA 4JHAL 1MVUA 4MJ2A 3HE6C 1BJ1H 5FO8A 3PL6B 3OR7B 1LO4L 1JV5A 2EZ0D 2VLKD 1VFUA 3MTRA 3STZA 4FQ2L 1TJHL 2O5XH 4HC1L 4E5XB 3KPRD 3D25B 6FABH 1KCRL 1UKTA 3QUMB 3H3PL 5D71H 3TN0D 3SE4C 4K9EC 2WK2A 2VYRE 3C09C 3U7YL 4KKCC 1KENL 4WI8A 4PJXF 4PP2B 4Q6IB 2AP2A 3L3GB 4LCIH 5F3HA 5ICZA 2A74A 2CMRL