1FAIL

Three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEHEDIATYFCQQGSTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of two crystal forms of FabR19.9 from a monoclonal anti-arsonate antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA R19.9 FAB (LIGHT CHAIN)
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiL01
3FKUS 2CLVA 3KPLA 3VDCA 1YQVH 4K23L 3B2VL 4UUJB 2Q6WA 4PP1C 4X6DB 3S9DB 2YWYA 3TBYB 1YQVL 5C2UB 4P2RA 5C0IA 2O61B 2VLKA 2EXYD 3L6FA 3QG7H 2NY2B 2X9YA 3CX2A 4JG0L 4Y19A 4ZUSA 4ZFZB 5C08E 3SGDI 4P23C 1M6OA 1ZA3B 4WNQA 3T65A 3LMJL 5JTWA 3MYJB 1I1FA 2BSRB 2OL3H 1N8ZA 1FVEA 2NY3D 4HEPG 4HJ0C 1JZ7A 3PHQA 5E00B 3QDAA 1WCQA 3QEQA 5DRXB 2GJZB 4ZFGH 5HGBB 3WUZA 5EZLB 1EBAA 1XH3A 4DEPB 1UENA 3O2VH 5BO1L 3D39E 1CDIA 4NNYB 3MCKB 3F5WB 1CDYA 1W72H 4HD9A 1AQDA 3FB7B 1J1XL 3GMMB 5ISZA 2B0SL 2X6MA 4CGTA 2MCPL 3ZE0E 1QZ1A 2QEJA 2HP4A 3L5HA 4FQCL 1T7XA 4JFEE 4HWZA 2NX5D 4MXVE 1QA9B 4EEEA 2VQTA 2KBGA 3SE8L 4WFGE 3G04A 4ZXBC 3CFJB 1C16A 4K2UL 2P48B 3QFDA 3MUY1 4AM0B 1A7NH 5T33L 4XWOD 5I74B 5SWZB 3S35H 2GY7B 1JZ4A 5J89A 2PYED 5JHDA 2PXYC 4P4KD 5E9DB 1ORSB 2EDQA 4JFZL 4ZDHB 1XF5B 1L4IA 4LLMA 4CDHA 1MF2H 4LVNB 4UIKH 4K3EL 4LSQL 3HC4H 1TTUA 1A6VH 2G75A 2HRPL 5DD1L 3ET9F 3O6FD 4ZPVA 2J2ZA 4XP5H 1NMCC 2DYPB 2EYRB 2Z8VC 2VDPL 1FAIH 2X4OB 5ADOL 3RIAF 3R8BB 4N0UE 5K9JH 4RIRB 1P6AB 3IDUA 4RAUB 1D6EB 1T1ZA 4YPJA 1HINH 4WGWB 1BIIB 1BZQK 2O5YL 5GRUL 4PTUB 3K2MC 2HVKA 3TF7C 2VAJA 1A3RH 3F6IA 4HSQA 2GJJA 4OIBA 4OCMC 3QIBA 3FL7A 2ERJC 1BX2A 2DQEH 1ZT7A 5DRZA 1K5NA 1GL4B 4RMWA 4FABH 3SDXA 3VG0H 4D0BB 3BGMB 3NMEA 3TO4A 1NEZA 1EDQA 5GGVH 3W9DA 2BXYA 2O5ZH 3F7PC 1AGFA 1N0LA 5MEOA 3TYFA 5LQBL 1FNEA 3FONB 2DICA 1MIMH 3TO4D 5JW4N 1IEHA 5GS0H 2Y23A 3EKCA 1QTYT 1OY3B 5K33A 1KIRB 1WZKA 3BGAA 5IHZB 3TYGH 4WEMB 2X2YA 2XRAL 3OG4B 3AS1A 5GGUB 5D1QB 4LP4A 4Y19B 4YGAB 1PLGH 4ZUSB 4XXDA 4L4VE 3DX6B 2JJSC 4BZ2H 3AU1A 3LKNA 4Y88A 1IC1A 1MQKL 1X5IA 3BRDA 1YNKH 5A2JH 1V5JA 2V6HA 3WNNA 5I71C 5CCKH 4X6CF 1H5BB 3P73A 4J1UB 5IESL 1ZGLP 3VD7A 5A2KH 1JMZA 3SCMD 3O11A 1IGTB 1ERNA 3WNPA 3IDYC 5EBLA 2M1KA 3BN9D 3D2UB 4GO6B 3MLXH 4LGPB 3GMMA 5ISZB 1N2RB 1YY9C 3DUSA 3OXRB 1IQDB 4MB5A 4XMKH 4JM2F 4A2LA 4ETYA 1J0ZA 3GO1H 4YO0B 1GC1C 3GSWB 3KPRD 5CD3B 5TE7H 1SHMA 4DK3A 4R2GB 4MMXC 1DQJB 1RZKH 5D7JA 1IEBA 2WBJC 5J8OA 4L3CA 1QG3A 1X5AA 2NY0C 4EZMA 2I26N 2D0GA 1C5DB 5IBLC 1SEQH 1FNSH 3MRHA 3BKJH 1WWAX 2C9AA 3U2SA 1CFQB 1MLBA 5K9OA 4O5LH 1AGDB 2J8UF 5TQ0L 5L2KE 4WU5A 4Z7VE 1LGVA 2I9TB 4JGUA 1RUKL 4JFED 5DJAB 1NDGB 5BRZD 1JGVL 2QHRL 2WIIA 4NO0D 4R96B 2QKIB 1RUMH 2BSTA 3WUWB 4AT6A 1CDGA 3R0MA 4XPTH 1A1NB 5EUOA 3JTTA 4V1DE 3L3IB 2FSEA 3W0WB 5GSVB 1B2WH 3QNYA 3QZWG 5CILL 3J7HA 1OW0A 1H15A 3H9YA 3IS1X 1NLDH 1L7IH 3O45B 5BJTB 4Y19E 3QUZB 1U2HA 4K7FA 1OAYL 3CC5A 5IFJB 4OFIA 3T0EB 3SDDB 5DRZB 3P0VH 1IAIH 1IJ9A 5GHWH 4UBDD 5CJXC 3Q1SH 2AKRB 3PE9A 4IRSD 1WISA 1WT5C 1RUAH 3HC3L 3OJDA 1JN6B 5JXAH 3Q1SL 2ORBH 1DQLL 2OCFD 4GKNA 1RSFA 3NIDE 1AP2A 5IIEB 4MNHB 1H8SA 2A6KB 4P5MB 4U1KA 4U7KA 4YAQA 4AEHH 1NC2A 5FK9A 1MVFA 4PJ7E 4UIMA 3MCLH 2EDLA 3QEGH 4QHNA 5D7KD 3KR3H 4PGBB 5FF6A 2APFA 2Z35A 4Z8FL 1IZKA 3JV0A 5HDBF 5L88L 1G0XA 2QADD 2YC1A 4M00A 5KSVB 1NFIB 1DEEA 2Y07H 3BPNC 15C8L 1KB5L 4FZ8H 5D70H 3IDJA 3MGAA 1I7TB 3TA3B 3VXQA 2A77H 5EBMB 3SPVA 1IAIL 2ERJB 3L3OB 5BMFH 5HYFA 4M6NL 1OQOA 4TQEH 3T04D 1ZTXL 4HG4J 4NO2A 1MCPH 3LHPL 2Z92B 4G80B 5GS1C 4HQQL 4X6EA 4HJJL 3ULUF 4HC1A 1RHHB 1GIGH 1L7TH 4YUEL 2AEPL 3DHJA 1OGAB 1CT8A 3ZTNH 2AJXH 2X9XA 3L5XL 1F8TH 1BVZA 3GSOA 3HE7A 4GW4B 1J05B 2AK1H 4WV1C 2FCBA 4ZAKD 4ZFZA 4X4YB 3QPXL 1LILA 5DJYB 4XB8A 1HQ4A 4L9LB 3DX7A 1UWEH 1BF8A 1QRND 3BFOA 3KLDA 2FX8H 1RK1B 4OF6A 4KUCD 5IGXL 4N0UA 3WFCL 1QHOA 2E7HA 1RIUH 2CPCA 2OI9C 1KXTB 3PABA 2PYEB 1KEMH 2VLKD 9CGTA 4U1SA 4X98A 4Z7QE 2OS7A 3MV9E 4DGIH 1GYAA 4I2XA 2AAVA 1LWRA 3D0VB 2ICEA 1WCBB 2VH5H 4GT7A 4XPHH 2GSGB 1CDHA 2RCSH 2BSTB 5T3XH 4UQ2A 1J0YA 4WCYL 2V7NA 4JVPA 5DQ9B 4JHAL 4N8CH 2WWMC 5DZLA 1GGCL 1EMTL 4Q58C 3T4AA 3GIVA 3RP1A 4HBQA 2DLFL 4ODWA 1OTSD 1INDL 1A4JA 1J5OH 1LO4H 1LEIA 5EUOF 4N5UA 3ZDYE 5EFIA 4F7EB 1RV6X 4O2FB 5FKAA 2OTPA 1IC7H 5CINH 4DWHA 4O51A 3S4SA 1UXWA 2BVOB 2WZPD 5IOPB 2BFVL 5CINL 4AIXA 1DLHB 1KN4H 1MJJB 3RA7H 2B20A 3REWA 5DJZA 4CKVX 1OAQL 5KAQG 3WYRA 4MQXC 3FQNA 4GKNB 4G42A 1EAPB 3PP3K 1VGEL 1KN4L 2J8UA 4CW1B 1CICC 3KS0J 2CXKA 4Z7QF 2ARWA 3E6FA 1ZA6B 3MXVL 3VMPA 1KGCE 1FNFA 3HG1D 3VI3F 1NPUA 1SJHB 4LCCB 3GUTA 1ORQB 1EPFA 4XWGH 3QHZL 1MREL 2K7QA 4UOW0 2VDKH 5IW6A 3HR5A 1JTTA 1VADB 3FHAA 5I1AB 4RMRA 2EDKA 3RAJH 4WDIA 1NFIA 3V4VL 2ZP0T 4K07A 4NKMA 2FATL 5D7IF 5CUSL 2GSIB 2YPVL 3QDGD 3QDMD 1N7ML 5IV2A 2ZPKH 1P2CA 1RJYA 2ITDA 2ZUYA 3CMOH 1TNMA 1T1YA 3RBGA 4MQ7A 5CSZB 1NL0H 2UZYB 2DOCA 3JWOC 4NN7C 4YR6A 1CFSB 1QSFA 3LQZA 2FB4H 3UO1H 1SYVA 1E0OB 1F4WH 1H0DB 5T1LD 2YUVA 4RWHA 4GW1B 1XF2B 2RHEA 3HE7B 3BH9B 1QSFD 2AXJA 1KGCD 5EOCH 4I8DA 4L9LA 1IVLA 3PDDA 4M9PA 2V5TA 1X5JA 2IALB 5ILTH 2CMRL 4PRPB 3B9VA 4Q97A 3HRZA 1NCAL 4PJGA 2EH7L 4QTHB 3CXHK 1I8IB 4GRLC 5I9QB 3O81A 2EIZA 3BKYL 2R0LL 4ZOAA 2VN7A 3ULSB 1B3JA 2EYSB 4R90L 4X83A 1FLTX 1ZHLB 5DK2A 4QGYA 2IPUG 1FLRL 4LVHB 4NM4H 4WW2B 2EC8A 4XXDB 3S7GA 4X6DF 2VXSH 3NABH 3ARWA 2EIDA 4AG4H 1TPXB 1ZT4A 3ZYOA 3NAAL 4H8WC 4G8GA 2IEPA 3TIEB 1U8LA 3RY4A 4ETQA 2OR7A 3VFSB 3IFLH 4OSUH 3J8F7 5C0CB 2FGWH 3OHXA 4FTVA 3SDCA 1YEDA 4UTAH 5HI5C 1CL7H 2OTWB 3VG9C 1TZHA 4GMTH 5F7YC 4Y1AE 4R7NB 1ETZB 3SKOA 5KVFL 3K8LA 1XIWC 1BM3H 5C0BD 4LPCA 2XZZA 3E1F1 4Z76A 4KY1L 2DQTH 1F13A 4N0YL 4WWKD 1MJJA 3MRMA 2R0KL 2JJTA 4P2OA 4PB0H 2YXFA 5DC4B 4MHHI 4YC2C 3KXFD 3QHFH 1WBXA 1BOGA 4WUKH 2F19L 2Q7YA 3WUWA 3BD5A 2E6QA 5EULV 1RZJC 2DM7A 3HMXH 1NMAH 5DRWA 4GQ9L 1AGDA 4IOFD 2EIEA 1SJHA 1CWVA 5J9PA 3CPLA 4ZTPL 3K4AA 4OCYL 5D1XD 1H15B 4H8WH 4IEFB 2F5BH 4I0PC 2AJZB 4NUJB 5I30L 4LLYA 4AEIL 2R2EB 3EHBD 3QJHA 1QRNA 2W65B 1NKOA 4DVRL 3L5WB 2IGFH 4AT6B 5ACZB 4BQ6A 3EYSH 2APVA 1EFXB 3HB3C 4TPRL 3D85A 2BY1A 3IETA 4Q6YA 4PJBA 4YHKH 1IBGH 4L29A 3D69A 3UPRB 3ZZ1A 3DV6A 5J06A 3WHE1 4TUKL 1H0DA 4PGDB 3MLWL 2NLJB 1DDHA 4V2BA 4HCRH 3OWEA 1IEAA 4HS3B 1OQXA 2Y06L 1MI5D 3MR9B 1ACYH 2CDFA 3OBAA 1AHWB 1FIGL 4W4OA 5EC1B 5IFAL 2Q3ZA 3F65A 4IOSD 5J1AA 4UT6L 2MFNA 4G9DB 1FO0H 3FO1B 3N9GL 1MWAH 1NANH 4HC1L 1WBZA 1FG2A 2BZDA 1X6LA 4MA1C 1U3ZA 3BDYL 1FL3A 1AP2B 1YDPB 1ZS8B 1G7PB 3O9WD 4TVPH 5DVOA 3VE0B 3ZLQC 1B88A 1S7TB 5KTEL 4XPAH 1ZGLM 1FZKB 2QQNL 4UNUA 3WSQH 2OTUB 2ID5A 1KEGL 1NFDA 5FF6B 3CFIC 2AV7A 5FYKU 1F00I 5HHOD 1EGJA 5BZDA 1CZ8H 4S10A 1ZANL 5E6IA 4HEME 1C12A 5JOPD 2VN4A 4LLUA 5FAAA 4X4ZA 2JKXA 3PUCA 4UDUB 3BMWA 5ID0B 4HCRL 5TE4H 1FV1A 4FTVB 5SWSE 3HZKB 4AIOA 3TIDA 3QUMH 3EFFA 5IFAH 4XCYA 1N0XH 3S3JA 4NP4L 2ED8A 4ESKA 3QA3A 1TZIA 1NAKH 2KQMA 3RL2A 1JHTB 3FRPG 1B0GB 1MHPH 1F42A 2A74A 4XNXL 2R4SH 5BCAA 1WTLA 4HS8H 5JZ7D 2A1WH 2VZSA 1R5WA 3BP4B 1NGWB 4O58H 2D0FA 1T22A 4GKZB 1WBXB 2GYSA 4ZQKB 2BNRB 3UPCA 3GHBH 4WU7A 3QPQD 3LIZL 3SGKA 2IG2H 4PJ7A 5D71L 4R0LA 4R2GD 3TVMD 5ITBL 4ORZC 3BH8A 1YEEH 5FGBA 2HA1A 5HHOE 2ITCA 3OAZK 2XA8L 1PBYA 3E0GA 3OR7B 4OCNC 4QKXB 1Z2KA 4NC0B 4PYHA 2FEEL 3SO3B 2FJFA 1I1RA 3DSFH 4KTDL 5I1EL 1P9MA 1U8QA 2HJLB 3FB8A 3VRJA 4QHKJ 2PR4H 4GAFB 4TNVF 5JR1L 1OAUL 1OTSC 5IGXH 1UYWL 1DBMH 4RFEB 4BFEA 2DQFA 5ENWB 3VXNA 1BBJB 4ZTOH 5BV7B 5J11B 4JDZA 3QDMA 3D85B 2H45A 1QSEA 1U2CA 2G60H 1LO3H 1GJIA 4RMUA 5E6IC 2HFGL 4BUGA 4GJTB 1FFPB 4OB5H 5C0DA 2ED9A 4CW1A 4DZ8B 3HHRB 2BMKA 3C5SB 3W2DH 3OSKA 4HAGA 3MRRB 5BQ7B 1LP9E 5ANME 4X0KA 3MJ9H 1AHWA 4OGAD 4U0QB 4YE4H 3QIBD 1UXWB 4YXKH 5A40E 5JPMA 4KRPC 3RWFA 2X4RB 2DQHH 1F4YH 5D7LB 3ILQD 5DJZB 5DLML 1JNHA 3U4EB 5ICZA 4M7LT 4H25A 1TZGH 4HIEA 3JVGC 5KZCB 3DRQB 3EOAB 1IT9L 2QHRH 4DZBB 3FTGA 2J6EL 4U0RB 1H3VA 3BAEL 5CJQH 5IM7B 3T3ME 3KXFE 5GJTL 1MRCL 2CUMA 3MROA 1URLA 4CBPA 3MREA 1IQWL 5ESVB 1GZPA 3QO1B 4XNQA 5L9DH 1QR1B 3DMMD 4OJFH 4Y5YB 2AI0H 2QV2A 4FHBD 4KUZH 1R5VA 2GT9B 4LCYA 2J8HA 2I9LB 3TIDB 4M7ZC 4KUZL 3WKML 3T65B 3MLVH 4EKXA 3VXSA 3T77B 1S5IL 5C0JB 2FX9L 3D3VA 2ITDB 5DD6A 4CMMB 3ZYIA 3K81A 2XI9A 3KYNB 1JHLH 1CD1B 4QY8B 3TCLA 4GRMB 5F1IA 3MODH 3ZT7A 5SWZE 4RMVA 4Z7WB 2A0LC 3HC3H 2Q86B 2WBJA 3QXTA 3NTCL 2IQ9H 2VJXA 2NY4B 1HEZA 2PYEE 1T0NA 1RUKH 5C0BA 2DQUH 1DQDH 4F7TB 1NUGA 1FNSL 3VFOB 1BBDL 5E6ZA 5SWSD 1XF1A 2HH0L 2NY0B 4MQTB 3DGGA 4OGZA 5E9DD 4L9LC 3V9FA 1OW0C 2DQDL 4JY5H 2MKLC 3FB6A 3IS0X 3U7WH 4H26B 1HSBA 2DMKA 4QTHA 4OQTA 5DVLA 3MV9A 3BHBA 4IDJL 1HH6A 5JW4M 2VOTA 1XIWA 2ZCHH 3NZ8A 3V0WH 5E99H 3GMPB 1JPFA 4JAMB 4X6BB 3I50H 4GOSA 2VQ1B 4N0CC 2CKBL 4ONFL 4QRPD 5CP3H 1WFOA 1BFSA 4G8GB 2GAZA 5E4IA 2G9HB 5KSBF 5ICXA 3CSBA 5KG9B 5C0CD 4ZOCA 5HJ3B 4LBEA 2VQUA 3UX9B 3FN0L 4GMSL 4L8SC 4QRRD 5HGDB 1LD9A 4ZD3L 1I1AD 2MHAB 5J6HB 3QFDB 2A83A 3N1GC 3Q0HA 1FGVL 1FVDB 4OLXH 1WAAE 1TQBB 1N6VA 2IFGA 4KKBD 1F58L 3F12A 4R7NA 2HH0H 2IADB 1ETZA 1FFOB 4HKBA 4PJCA 2X4OA 5DSCB 1DQTA 2Q3AA 3NIFE 2LVEA 4M93B 5ERWA 1EZVY 3WFCH 4O02L 1QSVA 1S9XA 5SWSA 4OKVA 3CVIL 3WJJC 4DGIL 1FRGH 3UBXI 4UDTB 1TDQA 3H9SA 3V6FA 4WI3A 4YWGH 4OD1L 1D6VH 1TVDA 3IETB 4NJAL 5IEKB 3IJHA 2X4UB 3SDDC 3TWCH 2MQ0A 3GRWH 5I8KL 1Q9KB 1SY6H 3LH2L 4EOWH 3BPCA 4RGNE 3G6JF 4BA8A 3HNSL 3L1OH 3K1KC 4K94L 4L1DA 5L2KB 4U4BA 2NLJA 3OAUH 3HMWH 4P9HH 1GOFA 3G5ZA 3FFDA 4YUEH 4C57C 2DWDA 1WFNA 3WXVH 2A77L 4ERSH 5IW1B 3UTZA 4MJIE 1UM5L 2ATPB 1UADC 5HYQB 5D1XB 4HHAA 2YA1A 4LEOB 3ZT6A 3VXMA 2XY2A 4G9DA 4NZUL 2H1PL 3WE6B 5AD0B 3SKMB 4PJHE 3DV6B 4H88L 4R4BA 1IGTA 1T2QH 2CJUL 3HCVA 4LF3B 2ZCLH 2P44B 1MHHB 5D1QA 2VISA 3Q2CA 4HUMB 4UTBL 1MHEB 4U6YA 4NQXB 4G6JH 5BZDB 1ZT1B 1CXHA 4K9EC 5IQ9A 1TJGH 4NT6B 1FL3B 5E4EC 1ACYL 3QWRA 2VL5B 4CADB 1DFBH 2NYYD 1CQYA 1WWWX 3FOLB 1F4XL 5JOFA 4M8QB 5FYKE 5FM8A 4G8GE 5T5NF 3GHEL 4PJEB 1CXIA 4XH2A 3MLTA 4LSUH 4NUGL 4PJBE 4CJ0A 1FFNB 1BVLB 1CICD 4XI5C 3QQ3B 4HV8A 5FA4B 1H5BC 4KH2A 5HGAA 4ELKA 4YXHL 3IF1B 1T22B 4WEUD 3ARFD 3NH7L 5JDSA 2D4DA 1P7KB 2QKIA 5DEGA 3QCUL 5FFLA 4XVUC 4LSQH 2UWEA 4YNYB 4PJ7B 5DC9B 4R0LB 3DYOA 5CAYB 3IGAB 4Q6IA 1CFQA 1FFQA 5K9OB 5FGSA 1A9EB 3ARFA 5JOEA 1OWRM 3SDYL 2UWEF 4WTZA 3H6JA 5JMRA 4ZO7A 4JQVC 5E56A 2YUZA 4XT1C 5A2LH 2V2WB 4FS0A 4K3DL 3U9UA 1G1YA 2VYRE 1VFUA 2IPKA 3K3QA 4QHUA 12E8H 4L8BB 3QNZA 3GI8H 3P9MB 2EE6A 4DAGL 3CDFA 1FE8H 1G7JB 12E8L 3RTQA 2J88L 3BMVA 2Z93B 5ENWA 4KKAD 3VXNB 4FXGB 3V6FB 4QOKD 1E28A 3JTTB 5DURD 4OIIL 1C1EH 5JLZB 3GJFK 5DJ2A 1ZEAL 3H3PH 4KHTL 4EUPA 3GIZH 3SY0A 4F7CB 1RZJH 4Q9QL 3OV6A 5T1LB 1SJXA 1P4IL 2VERN 3RVWD 5C0DB 5E08L 4J7RA 1BOYA 3JUYA 5DJ0A 1D7FA 1U95B 3FO9A 4LARH 5TE6H 3QDGB 2QSCH 5T5FL 3KWWA 5K9QI 5DUPL 4DGVL 3SDDA 5HHXH 3ARRA 2VXVL 5HYJE 2YK1H 1NSNL 1FYTB 5HYQA 3N1PC 3VMNA 4BZ1L 1HHIA 5KVFH 3ARGC 3EDDA 4ODHH 4GG6A 3SKMA 3U6RA 3X13A 1YEKL 1T3FA 3CH1A 4OI8A 4E9LA 4DCQB 2PR4L 1QO3B 4I9WD 5GRXG 2EH7H 1JGVH 4PD4K 3HE6C 3LEYL 1KNOA 1Q94B 2W91A 1KPUB 4M1GL 1ZLUH 1LEGA 4U1HB 3B9EA 1QFUH 4QRPA 2DWEA 2R39A 5EC2A 3PQYB 1FZJB 1X7QB 1KYOJ 2R9HD 4YX2L 1JYNA 4PGZA 3TN0B 2Z35B 1S7WA 4HH9A 5I74C 5IB4B 2P5EE 4L5FL 2ZKHL 4U1JB 5D7LA 4FFYL 1KLGA 4MDIB 3RWHA 3A67L 3G6JA 4L5FH 3DRQA 1PGRB 3LRHA 1Q0XH 1T0MA 1T66C 5D2NB 4CN4A 1NGYB 3V4PL 2FYYA 1R3JA 4MX7B 6FABL 1N5AB 35C8H 3T77A 3VI3E 1DL7H 4PJHB 4WFFE 1T2JA 3LKQA 3GGWA 4M8QA 1QEWB 5HHNA 4NO2B 1KBGL 1EO7A 1KYOK 4W4NA 3IXTA 2DD8L 4X9IA 4BKLA 3MLSL 2IANE 2C7UA 4GW5A 4ZS6D 5BRZA 3GI9L 1UEMA 2OL3A 3VU2A 3SHSA 1EVTC 1OCWL 4QWWC 3MACL 1QFUL 2PUQT 4L3ED 2AABL 1RZKC 1OCWH 5C09E 3VW3L 3DMMB 5C0JA 4JVWA 3IGAA 3HLAA 4XPGH 4HGWB 2V5MA 4PJAF 4ZXBB 4WO4C 3GSVB 1WVZA 4U1MA 5C08D 3PXHA 4MHHG 4BQCA 4DQOH 3MRCB 2YXMA 2CUIA 3WFEL 3MRGB 4BQ9A 4NN7B 2DDQL 5T3ZH 3DO7A 4HH8A 4O4YH 4JY6B 1V7MH 4Z78A 1EEQA 2ZWLT 2W9DL 5MENA 1CS6A 4AH2B 4NPYA 3T4YA 2OX5A 5GIRA 2H9GB 4DFHA 1WWBX 4LSTH 4ZPTA 3RTQB 4FQ2L 4F7PA 1OM3L 1LP9F 4Y4KA 5BS0E 5F9DC 1RZ8B 1UG9A 3WD5L 1MCPL 1CD0A 2P24B 4ZAKA 5ALBL 1RPQA 3QB7C 4NQSA 1FNLA 2DIBA 3LOWA 2IGFL 5CP7A 5C8JA 5HHMD 5INDA 1IARB 2C1PB 4JRXE 3FO9B 3OGCA 2P47B 1PG7L 1T20A 3CLEH 3K46A 4KJYB 5DD0L 1WF5A 4X80L 4P5TB 1YMMD 4F33B 2DMCA 2G5BA 4KZDL 3P2TA 1ZHKB 4M61B 2ZUQB 3ZHDA 5ID1B 1FNGA 2OZ4L 5HJ3A 1S9YB 4Y19D 5F88A 5LXGL 1LDPH 2VXQL 5FYJH 4H1LH 3U6RB 1KEML 2VLLB 1KC5H 5E99L 1J1PL 2D7NA 2VNCA 3QEUA 2EDBA 3GSQB 4MGXA 5DWUL 3HG1A 2CLZA 3ZKNC 2CLVB 3KPLB 3WIIL 1K4CA 3AM8A 4LOUC 1NH6A 3LHPH 2YD8A 1PEWA 4X5WA 3MRDB 1PSKH 4E5XA 5L2KA 3SDDD 5FYLH 3HA0A 3PDGA 4MJIA 1P7QB 5FYJU 4KROD 4J2XA 3T0BA 1LK2A 5BO1H 3VGAC 5L0QB 1M71B 3I2CH 1U3HB 4Y4KC 5D1ZD 3UYRL 3MLZH 3FRUB 1DP0A 5JR1H 2CIKA 2HLAA 3BO8A 1I1FB 4PJGB 3QI9C 3FRPA 5ADPL 5GRJL 2G5RA 5HI3D 4XC3L 3TBTB 4E41D 4HWEH 1NAKL 3FQTB 1K8IA 1HHJA 3EBAA 4RAVB 1GGBH 4RDQF 5FKPA 3QUYD 1HE7A 2AXHA 3S88L 3PIQA 3DROB 2LTQC 4YGVB 3NIFF 3O6KH 4LSVH 2ARJA 3OAZH 1KULA 1IKNC 1X5XA 1OAKL 2BSRA 2B4CL 3I3EA 3GJFB 3LIZH 2VDQL 4MAYC 1KJVB 1RU9L 1PSKL 5DRXA 4XNXH 2NTSP 4IIQB 1CIDA 4LEXH 3CFBB 2EIZB 4OLWH 4POYA 3JUZA 4MNQE 3VGDA 2HG5B 3MFGB 4ODUB 1A6PA 4X8JB 2VL5A 3K2UL 4JRYE 5D6DC 4Z9KB 2FATH 1TZHB 1C5BL 1EA9C 3N85H 2OJEB 4P46A 4Y2OA 3BN3B 4JB9H 2O5XH 4HPOH 5EZOH 2EIBA 4XC1H 1D5BB 3SJVB 2IQAA 2VXUL 2H1PH 5MP6H 3EGSA 2GW5A 2F54D 4EVNB 4J3WA 1DBBL 4HWZB 4ZDHA 4G5ZH 5DF0A 3BPNB 3O6FC 5GJTH 3VFSA 3TVMA 3KPSE 3FT3A 5F7HA 1HI6B 4YHML 3MXWL 3CVHB 3MV01 5EU6D 4HIXL 1NMBH 4OQTL 1B4RA 4Y0GA 1AD0B 1FC2D 1UGNA 1XGTB 3GSXB 5IBUG 3WKNA 2EDRA 5ELIA 2WQRA 4ORGB 1KPVB 4XXCA 4NC2B 4RIRA 2MQ3A 5KJRH 1KB9J 2GY5A 2XTLA 3UTQB 3QNZB 1UWXH 1QRKA 1S5HA 2Z31C 5SWQB 1OARH 2EKSB 4JRWA 3CJJA 5CZVH 4YDKH 1C08B 1Q0YL 2XZAH 2VZTA 3WHXB 3GM8A 1A9EA 3ARFB 3OL2A 2D3VA 3I6GA 5L6YH 2H6PA 4DKEL 1OAQH 3MRLA 5C09D 5C71A 5I17B 3QP3A 5EO1A 4X6CE 3EUUA 3UTTD 2HVKB 2EECA 2JCCE 3P9MA 3LQAH 3HUJA 4NHCL 3O3UN 1VFBA 3MRFB 3STLA 5GRZA 4ZSOB 5J4MA 3WN5C 4XNMA 3LEVH 4WTXA 2ZOKA 2DBJA 3LB6C 5KJRL 5BVPH 3UPRA 3MJ8A 4RAHA 1F11B 5DXWA 1K8DA 1QBML 3B6SB 4Y16B 1V3MA 3KPNB 4QGTA 4RA3A 3CSYB 3VE0A 4U7MA 4JQVA 4HMEA 4G6AC 1KJMA 4F57L 4XCNA 1FZOA 2PCPA 2FX7L 4MWFB 1PYWA 5H94A 4YFLF 3H3PL 3T1FA 4JPIA 3RX7A 2ARJB 2J8OA 2JJVA 1HHIB 1UC6A 1TVHA 5D93C 1BBDH 3UTTE 2Q8BL 5GS2D 4QO1A 1X5YA 4NWTL 3WJLC 2YPLA 3D18B 2BJML 1T3FB 4UB0L 3CFBA 3IDNB 2DLEA 1YN7B 1X5ZA 1PQZA 4O2CB 1HYRC 5SV3A 4PIRF 3U9PL 1KPUA 4FFZL 4G3YL 5I18H 1CL7L 1Q9LB 4UUJA 3PQYA 5I1LB 5MEND 2YD1A 3CX5K 3VXUA 2DJSA 4BUHA 1BEYL 4G6ML 1KXQE 4PJ5E 1FP5A 3V52H 2R1YA 1CYGA 1HHGB 3WIFB 1M6OB 1ZA3A 4LLAA 3GEWB 4NM4L 4NN5C 1R3JB 4YBLC 1CXEA 1P53A 1S7XB 3ARVA 3FQUB 1G0DA 1N8ZB 4XZUB 2DKMA 3L3IA 5J12C 4J6RL 4JFHD 3VWKA 3OR7A 3CDGB 4I4WA 3MBEB 1N4XL 1YUHA 2F8OA 3MCKA 4XBEH 3L3KB 4ZFGL 4PLNC 4NPYB 3T4YB 2DTML 3BIAX 2DQJL 3GNML 4MA3B 4KHXH 4AMKL 2R2CA 4Y2DC 2BOBB 1UZ6F 1T04B 1BBJA 2DQJH 3ARUA 4YQXH 4FQXC 3RWIB 4D9LL 1LO2H 1AO7A 4UTBH 3X3FH 2FSEB 3W0WA 1T4KA 4PJ5D 3CXHJ 3SOBL 2BCKA 1CK0H 3KDMB 4TPRH 1RZ7H 1HOCA 3LZFH 1C16B 3INUH 4PRID 2C26A 3Q6GL 1H3PH 2OJZH 4XRCA 3TWCL 4ZNEA 4BFIB 1U8JA 2BMKB 2D9CA 3PJSB 2AV1A 3GSNA 3DPBA 3SJVD 4OZ4A 5CJ8A 1L9NA 4EN3B 3MBXL 4PBWD 4KDVA 1IQWH 3WD5H 3MRIB 4MD0B 1F4XH 4YBLB 1DUYB 4J6RH 5E1AB 3QDMB 5GSRB 5GGTA 5CLWA 2AJ3A 5EBGA 1EIBA 1FAKT 4N8VB 3V5HA 5EU6B 3R8QA 3AS3A 5ANMA 1WZ1H 3BKCH 3QEUB 1I1AC 3O4LD 5DRNB 1TETH 3TBWB 5HYIA 4F37K 3WEXB 3HPJB 1GC1L 4JM2C 1F2QA 3LN4A 4RFOL 3T0VA 1L0YA 4OBSA 4Z7VB 4K9EL 1UM5H 2R2BA 1R3IL 4ONHA 1GVIA 5KVDH 1S7UB 3DRTA 1RUQH 2NY4D 4N90E 4X6EB 5IP4A 4PJXB 5FOBA 3C8DA 1MELA 3P0YL 4M7JH 1VDGA 4FQIH 4MAYB 4LNRB 1S9VA 5LKNA 5JW4R 2PF6A 2NR6C 1Z0NA 4D3CL 2JTDA 2DM2A 5CBEA 4MCZA 2J6EA 5EDXA 2B1AH 3G5XB 1KIPA 3I85A 1J05A 3D85D 3MLYH 1R3LB 2WIMA 3VFTB 4APQD 4D2NA 3ECBA 1ZWIB 4LSPL 3DYMA 4HX1A 1TJGL 4HG4K 1MFDL 2Y7QA 3U83A 3UJTL 5MEOB 3N50A 2DL2A 3QDME 5GGSB 5GISH 3BIKA 7FABL 4KXZI 3G6JE 3P4MA 2VLKE 1OGAA 3FJTA 1GGCH 2PW1B 5EORL 5C3LD 3X3GH 4YHYB 5IHZA 4QYOB 4JFDE 1M7DB 3MLPA 3D0VA 1LK2B 3RZCC 3X3GL 2QQNH 4QXWA 1HHHA 1GPOH 3RPIB 3EO0B 1PLGL 2GJ6D 3QISA 3TP4A 4WHCA 5FXCH 4LHUG 4PRHE 3BEWB 1QBLH 5GJSH 2BSSB 4I4WB 4MA8H 1GZQB 1ZVSB 4I48A 4D94A 1AFVL 4ODUA 4X8JA 2IWGA 5DJ8B 1Q9WA 5DJCB 5B22A 1OT2A 3OGOE 2C4XA 3QG6B 3VRLE 5IESH 4O9HL 3SDAC 3C60B 2O5YH 4GS7C 4MA3A 2FWOB 4YH6A 5GRUH 4JKPH 5GRVL 3V6OC 4Z5RB 4HUVB 2Q8AH 3B5GA 2DQEL 3RWIA 4GG6F 4IDLA 3HZYB 5HYEA 5ICXB 5ADOH 2WLZA 4LCWB 4JY4B 3ZDYF 1MY7A 1KLFA 1DLFH 4GRLD 2XG5A 5HGDA 3KPRB 4LGSB 3QI9A 2YPLE 4Z7UF 1I9JL 3MV8A 1F90L 2CRMA 4JCLA 2FHBA 3NZHH 1JPSH 3UTSD 3U2SB 5E08H 5GS0L 3E6FB 4ODSL 5EO0A 2E9IA 2VDMH 1DBKH 4GRWE 3GBNH 3MV8D 3P11L 3O41A 3K8MA 3U79A 4DFIA 3OB0K 1XF4A 2NW3A 1C1EL 1DUYA 1YY8A 1F6LL 4MA8L 1MCRA 3LS4H 3KPPB 3LSOB 4WW1A 1A5FL 3BGFC 1YEJH 5EU6A 2CDEA 4OKVB 5J13C 1U93B 5AYUH 4R96A 4YHLH 3ARFC 3AAZB 4KMLB 5E95B 1E4JA 1A3LH 3VXMD 1OSZA 2VLJB 1A6TA 3ZTJG 5T5FH 2YBRA 4GBXD 2EDNA 1A6UH 3T09A 1K9TA 4MJ6A 2X1QA 1BZ9B 1RFDL 3DX9A 5CJQL 4LCCA 3H7LA 1NGZA 5B4MC 4U6HB 1INQB 4YJZL 5KANI 1VACB 2F53A 3C6LB 1DBAL 2VDOL 2VLME 1WUNT 3FFDB 4QXGL 4OLUL 3LB6D 5TDOA 1T7YA 4JFOA 2OXGA 4ZUTA 1B9ZA 5ACMA 3WLWC 1I8KB 4YC2B 4KVCH 2Q6WB 5IEKA 2LE9A 2APWA 3DIFB 4OKDA 2W1NA 4S0SD 1IGCH 3MGTA 5JA8B 43CAB 1I9EA 3I75A 2BC4B 4P2RB 1D9KD 4ZODA 2V2XB 5I9QC 2X9WA 3BISA 2YD7A 4HLJA 1IE5A 4UILL 3WFBH 3UBXB 5KVEH 1EXUA 2AEPH 1CFNA 2LU3A 4JFFE 5E8EB 3UZQA 1H8OA 2IALA 3O6MH 4UAOB 5D1ZC 4H0IA 2NY5C 3S96A 4YEEA 4MQXD 3VJ6A 2WQ8A 1U8OA 1FL5A 5BZWB 3MJ8B 4RGOH 1UXSA 1JK8B 4Y4HB 1ZK9A 5KAQF 4YIQB 1I7TA 1PQZB 3TA3A 1CD8A 1FJ1A 2OK0L 3DVGB 1LK3L 4POZC 5KSUB 2E7MA 4HZLB 3QG6A 3QIUA 4JRXB 4QEGA 3O2WL 2QBWA 5H94B 3RFZC 2FJHB 5SWZD 2HJKB 5E8OA 5CEXB 1MJ7L 2XN9B 4K23H 1HHKA 2BSED 3TIEA 4JFDB 1O7SA 4XB7A 3CK0L 3B3IA 2CO7B 2F8VA 3ARGB 4TRPH 2WWMD 3QI9B 3O9WC 5D7JC 3RGHA 1H3TA 4X4YA 5DURB 1T2XA 4O2CA 3WIFA 2NY6C 1W8NA 4PJFB 1MUJA 1F4AA 3B9KB 4P23B 3RVTC 5I76B 3SKOB 1ZHNB 4OFDA 5MEQB 1ONQA 4U1NB 4XH2B 5JORA 1K85A 1HK6A 3UCRA 2M26A 3SGDH 3MNVA 3VMOA 5EZJB 3QUXA 3WFHA 3E3QE 3L3KA 3MLUH 3DGCR 3BDXA 4LFHG 3GMLB 1J8HD 1G7JA 2G75B 4QWWD 1YYML 1KACB 3FQRB 4PBVC 1UACL 1IFHL 4XCEB 2Q7YB 1N59A 2YPLD 5DT1L 4XBGA 4FG6C 2ZUUA 3MCG1 1FRGL 3VWKD 4JEGB 3UZVB 4XVSH 1MI5B 1NC4A 3HC0A 2NCMA 1U6AH 4M48H 3SY0B 1NBYA 4F7CA 1NAML 1LQSR 3T4AB 4QTIH 2X09A 4NQDB 5CFHA 3FO2B 4M6ML 5DVKA 2UYLA 2VLRA 3BDYH 5CWSA 2I27N 3FO0L 5DHXB 1L7IL 3WXWH 4U6VH 4I5BA 3CMGA 4OTXL 1V3JA 4HIIB 4A2MA 4XPBL 1AXSA 5I1DB 5GPRA 5JQ6H 4YHOL 5ANMB 3RA7L 2A6DA 4JFXA 2X1XR 2PO6B 2LAAA 4JQXC 1S7TA 3VFNA 4YHMH 3BZ4B 2NNAA 2DWEB 1ZA6A 3BUYA 3P0GB 4XP5L 4HIXH 1RAMA 1D6VL 4GG6E 2Z91B 1CFNB 2UY6A 1KUMA 2JIXA 1U6AL 1YPZF 3R4DA 2R0WL 3F58H 3A6BL 3QO0B 4JN2B 4U1LB 3MXVH 1AH1A 3O6KL 3QEHB 2F58L 1CFTB 4XGZA 4OV5A 3JVGA 5MEPB 4Z7NF 3KPQA 4UDUA 4ZFOB 5FYLD 1JK8A 3UTSA 1AJ7L 2VDKL 1QBAA 5FO8B 2ZSVB 5F7KC 3ZKXB 4HS6B 4U6VL 4HZLA 3FT2B 1N2RA 4FABL 3RRQA 2X42A 4C56E 3OJMB 1SMAA 4V1DB 4MJ4A 3VXTA 4JDTL 5CEYB 1NCNA 4OLZL 2JK5B 5DHYA 4JFFD 4Y5XC 1E6JL 2NZ9C 1DBBH 4HXAL 3BZFA 1M7DA 5ID0A 4F9PC 5BS0D 3FT4B 2AJXL 1MFBL 4PJ9A 1NCCL 4HIHB 4Z7VF 5CEZD 1HHHB 4GKSB 4LHUB 1TLKA 4IS6B 5D2NC 3MYJA 2B1HH 3B9KA 3MXWH 3BPOB 1IC5H 3H7BB 1JP5A 3GGWB 4RNRB 3QCTH 4Z0XB 1KCLA 5E2VL 4RGNC 1FGNH 4ELMB 3T0DA 4U1GB 5D5MA 2B8OT 2WANA 1KCSL 3DURA 2YMXL 1QVOA 2VMFA 3BWAB 1WICA 4FQXB 4X5XA 4U05A 4MZ2A 4OQTH 4F7PB 3IKCA 2O26U 3AMKA 43C9B 4J3SA 1AC6A 3SGJA 4YDJB 3S34L 4PB0L 2J88H 2B2XH 3GBML 2P24A 1JI1A 1SBBA 5K9KA 1MJUH 4LCWA 2ITCB 5DO2D 4A6YH 2A9MH 2B2XL 3FAXA 1IAMA 3DVFA 3GJEA 1JMXA 5FUCC 2FJFB 4YXHH 5C6PB 3H3BC 3TT1H 4I48B 4AM0A 3VXRA 4Z7OE 1RZJL 4Q9QH 1DVFA 4PG9A 4Z78B 1T20B 3VWJC 1DANT 2AGJL 4M43L 2YPKB 5BQ7A 4RMTA 2FGWL 4ZPTB 4LRNL 2G5BB 3LDBB 3EAKA 3ZDZE 3KPOB 1FIEA 1T80A 2HTKC 1ZLVK 3RZCA 1IC4H 2I07B 3O0RL 4MQSB 4JY4A 2XG4A 4FQHA 4JFPB 5EU7C 3KPTA 4FQ1L 3VFVA 1WWCA 1JI2A 3QRGL 4WEBL 2YRZA 4GG8A 2C3XA 3VFWA 1NGQL 3GSQA 4P5MA 4U1KB 4U3CA 3QRGH 2YBRB 4RWYH 1AE6H 2FH6A 4MSWB 3ZKMD 1X5FA 2VE6A 1E27B 1TCMA 1JPTH 2AXFB 5E2UL 3EYFB 4G6KH 2ESVE 4WW1B 3QNXA 4Y16D 3H0TA 4UNVA 5D93B 3B9DA 4MJIB 2EE3A 3G9VA 4HMCA 3BKYH 4MXQC 4PLOB 5KSBE 3SE3A 3GRWA 3U30C 3FFCD 4PJ5A 3ZSSA 2BJMH 1CFVL 5CUSH 1FLRH 1G6RB 3W9DB 3GNMH 4LCIL 4PJIB 4MVBC 3LAFA 2IBGA 1YEJL 2YR3A 3VXTB 3VDBA 4CN6A 1YEHL 4PRAA 4UV4H 4MA7L 4YHLL 3NACH 2V2XA 3BSZL 2XTJD 3WMSA 2V9QA 1XCTB 4X9GA 4NN6C 5D1ZA 1XGUB 4R8WL 4LK4A 4PG2A 1S9WB 4WW2F 1ND0A 5LVEA 4ONOA 1EAJA 4RGND 3ZHLA 5ABDE 1G9NC 1S9KC 1B0RB 3EYVB 4HULB 5DQDL 4KZDH 3GJFA 2W38A 2MMXA 2YHGA 4U31A 3VW3H 3S36H 5F1NB 3CX5J 5KW9L 3O3BA 4PJGE 3HZVB 2PYEA 5JHDD 1OPGH 4YDIH 1G7PA 4XAKE 2ZJSL 4X7EC 1P7QD 3DURB 1IAKB 3VFPB 4RAVA 4GAYB 1JPFB 3VXUD 2XQBL 4CVXA 2VRAA 1WIOA 1D5BA 3SJVA 3UMTA 5KTEH 3U4AA 1AIFB 3S37X 2QADB 3ILQC 4PV8B 1RJLB 2MWCA 1I1AB 1RIHH 1NCDH 2BOCB 3ROOB 3MRQB 3TGXA 1IEBB 3MX0A 1L6ZA 5F9WB 2VDNH 4W81A 1A21A 5LAXB 2XA8H 3O8XB 2W60B 4QCIA 3U0TA 5CGTA 4JHWH 2XZQL 1BPVA 1P69B 2YZ8A 5FB8B 4X80H 3CFKA 4PRPE 5JHDE 1FPTH 2XN9A 3X14B 3RPKA 1M4KA 4TN9A 2FRGP 1KCUH 2XWJA 1IGJA 5K9QG 1UJ3A 2B39A 1UQSB 3ARGA 3WFHB 5IVXA 3F8UB 1OL0A 5D7LD 4M6AA 3DUUA 2GJ6A 3NA4A 5D7IB 2XY1A 3EDJA 3I6LE 4JO4L 4TVPE 4LCWD 1EO5A 4M1CD 4KI5C 1GC1H 3U4BH 4UOJA 2F54B 3Q6FB 2UVFA 1A14L 4ZMAT 4FG6D 5IR1B 3KG5A 1YC7A 4IMLA 3T0AA 1YEIH 4UT7H 1FNAA 1VKXA 3FQWA 1JNJA 3FO2A 3F7VA 1JBJA 1TENA 1NCUA 3W9EA 3QYCA 1U0QA 3NCBB 2FD6H 2ESVA 2JIXD 3BQUB 4PJDB 2XTJB 1HCFX 3QIWB 3MJ6A 4JANB 1CLCA 5DDHB 3L5XH 1RD6A 1TQBC 3QEQE 2I5YL 1MFAH 2B1AL 3E2HC 4HPOL 5D96C 2Z31A 2FIRT 5JZ7C 3KJ6H 4HT1H 2KQNA 2GTZA 1Z9MA 4R3SA 5BVJA 4OAWA 4XMLH 3UJTH 1U91B 3HI5L 4PGCB 1CDBA 3IDXH 2DS4A 3M17B 3HCVB 4KVNL 2HN7A 4APQB 5TPWL 1MNUH 2PO6A 4BH8B 3VH8B 4UT9L 1XCTA 4PJ8D 4JN1L 3BH9A 1DTUA 4NHUA 1NCBL 4X0KB 3BUYB 4Z77A 2AP2A 4M48L 4N8PA 3L3HB 1ZHBA 3VXMB 3ILPB 4PJ8A 5MERB 1HYSC 5CBAA 4F15B 4FFWD 3TZVB 5CZXD 3RVXC 3V7AE 2K7PA 4FXLA 4L8CB 3HZVA 3LPWA 2ZUXA 3QXVA 2R1WA 1B4JH 2OP4L 3RX8A 2VZ1A 5ISZD 2DLHA 4UIKL 2XWTB 4OLWL 1ZHLA 3HZMA 2JJSA 2WBKA 3PGFH 2DQGL 2Z92A 1C5BH 1ZMYA 2EDHA 4DJMA 3WJJA 4OUUB 3P4OB 1B90A 2JK5A 5DHYB 4PV8A 4ZFFA 3WUWG 2ARJQ 4TYUA 1TVHB 4ZS7L 3SDAD 2BNQB 4CRPA 1HSAB 4BH7A 1AGCB 1GGBL 1QSEE 4DVBA 5JIKA 3BRGC 1AGBA 25C8H 2XACC 2XIDA 3ZTJH 2AVGA 3V6BR 2DM3A 4TSCL 2ED7A 4Q0XL 4TSAL 1XR9B 4NQDE 5LBSL 2QTEA 4Z7WA 2YZ1A 5ESQB 4ELMA 1DQMH 1WIPA 3P11H 4X7FC 1EUUA 1K6QH 4KK8D 1YEFL 4JPWH 1IGCL 1QPPA 5HGAB 1MH5B 4Y5XA 1VENA 3LS4L 4LASL 1SM3H 5J6GA 3D39A 1D5ZA 4F7TA 5JA9A 2FBJH 3ZE1E 2F5AH 3PHSA 4QHKI 2XKNA 1IT9H 4Z0XA 1P1ZB 3HR6A 4QOKB 5D71H 3PGCB 3O2DA 3ETBF 2HAZA 4Y4FB 2FIKB 4IBLT 1A6UL 3NFPA 4E42B 4L3EE 4LRIC 2DKUA 5T1LA 3HB3D 4POUB 3H42L 3DECA 1IM3A 2ICES 2Z9TA 3QFJA 5D72L 4MYWB 3HAEB 5AYUL 1A6WH 3IJSA 1F4WL 3TT3H 3TC9A 2R2EA 3QJHB 2OLDA 1AO7E 5C0FB 5E2WL 3U9PH 3MUHL 1Q8MA 2BVQA 2R0ZL 3ARED 3OKEB 4PRDB 2BOBA 4XVJH 3I6LD 2H3NA 2GITB 5HVGB 3C5JA 5DJ2B 2FJGB 5B39G 4HF5H 4XMPH 1DLHA 5AUMA 4KPHL 3EOBA 4NQEA 3VXUE 4LBEB 2XPGA 3CH1B 1U91A 4FQJL 5C70A 4JZJA 1OARL 1A2YB 3HUJE 4G8IB 1GGYA 1REIA 1QOKA 3HTLX 4NHUB 4YPGA 5I1KH 1K2DA 2ZCKL 4JJ5B 5L7XL 2NY7L 4F57H 4B0MM 4PS4L 3DX8B 5CHNB 5B8CB 1SJEB 3HNSH 4Y4HC 4MD0A 4PJXA 1T7VA 5I2IA 4PS4H 1TCRA 2I07A 1KBGH 5F8QC 3KXFB 2YD9A 3L7EA 1T6VN 1V3KA 1WBZB 4NSKA 1S9XB 4RQQB 3VFGH 1U58A 1BGXL 3TESA 1ODAA 5INCB 2J8UB 2R1WB 4LP5A 1MCCA 1Q94A 4MX7A 5IHUH 1P2CB 1RJYB 1T1XA 1WLHA 2Y7QB 3UYOD 4OGAC 2FL5B 1VFAB 4GXVH 5DI8B 5MI0B 1H3UA 2DJ4A 1LVEA 5BXFB 5GGSA 4QRSB 3DLQR 4LCWE 3STZB 2WSKA 5IW6B 1Z0MA 1YECH 3OPZH 2IPTL 4DQOL 1JRHH 1IMHC 2O61A 5I8KH 2VAAA 3BGFB 3G6JB 3PNWA 4KK9D 2KPNA 1HXYA 1JYWA 1FL6A 3UTZB 1X5HA 4AENB 3SE3C 2BHUA 3SBWC 3D25A 2ICWI 3VFUB 1KSRA 1BD2D 4ISVA 3N1FC 2NY1B 1ZVHA 5C0AE 3U0WH 3P4LA 1MRFH 3MRNB 2I60L 4ZXBA 5AG9A 2AK4B 4M3JA 1WAAA 3ZYZA 3BIKB 1LO4L 5DYOB 5IF0A 4PRAB 1PVHA 4TULL 3U36A 4X7DC 1J8HB 5EA0H 2KUTA 5LGHH 3U1SL 3C2SA 2XZCH 1KJ3H 3N1QC 1QLEH 1HZHL 4OLXL 2APBA 4ZQKA 1CN4A 1LEKA 3T1WA 3TEUA 1J10A 4G7VH 2FO1A 3EO0A 3QCVH 5ALCH 4NQXA 1RK0A 1HXMA 1DVFD 2VXTH 3KYOA 7CGTA 3MBEC 3PF2A 4Y4FA 4QHLA 4HXBH 4NT6A 1W72L 5HY9A 4KJPC 4KK6D 5HGBA 5INDB 3MRGA 1DUZA 3ULSA 3VGFA 2A6IB 3MUGA 3X11B 1LO0H 5MENB 4PUBL 1U8PA 4LSPH 4JG1L 2DRUA 1RZIB 3U7YL 1A4KA 3QAZC 3KHOA 4WENB 4Y8AA 4M1DL 3T2NH 1UJTA 3RWCA 1FFNA 1SYSB 5GGRB 1RIVH 1IGJB 2EEDA 4L4VB 5IQ7H 4XNUL 2R29L 1N4XH 4NM8H 1YJDH 3RIFK 4FNLH 1AKJD 3L3GA 5EO9A 1OSZB 1UZ8B 2AJYH 4F8QA 5SWZA 1NQBA 1VPOH 3HG1B 1RUPL 1K2DB 5JPNA 5EO0B 4PR5A 1YJDC 2XN9D 3SQOH 1LO2L 5EUOE 3X3FL 4AJ0A 2B0SH 1I7UA 2FHFA 1HILA 3RWFB 3A6OA 4BSWB 4YHNB 3BD3A 4MDJA 1XF5A 3INUL 5LJYH 1UQSA 3PQYE 5GRJH 1I9IH 2AJZA 5ICZB 4FQLL 3QXDA 2HKHL 2F53B 1UJ3C 5EOTA 5IUSA 1D5XA 2KZ1B 3BQUA 3FHQA 1N26A 3KLHD 2A0LD 4ZUTB 4DZBA 1A1OB 3DMMC 3BGMA 1U3JA 3HI6H 1KB5H 2CLZB 1TPXC 1R0AH 2BP3A 3QH3B 3NCCB 3WL9B 3TYFB 1DFBL 4EUPB 5C0EB 4M6NH 5IB1A 4JM2B 5F72S 5J9PB 2GQHA 4M5ZH 1OGAD 5IFHH 3I75B 1EH9A 5FECA 3QUYB 3M17A 1OTTD 4JFQB 2E27H 4LSUL 5DA0B 5C0GA 4FNLL 1QKZL 4KKCC 4FFWC 4U3HA 2X4SA 1H3XA 1PEZA 1E6JH 3CXDH 1U42A 5FDYA 1FYTA 5KVGH 1A14H 4G9FA 1EFXA 1PKOA 4WHYH 4EI5D 3GHEH 5HI4C 3S96B 2ADGA 3BUTA 1IC5L 3QFJD 3PL6C 4BJLA 4QXUL 5DLMH 4I3RL 4S1QH 3CFEB 4O5LL 3M07A 4PGDA 1JF1B 3K74B 4EXPX 2MPAH 2L0DA 3D2UA 1AFVH 4U1HA 3CAFA 4IJ3B 2FJHA 1X7QA 1F02I 3OG6B 3QCTL 3V5DA 1GGUA 1UYWH 2J8UE 4HJ0D 5CMAB 5EUKB 4NO5B 3IDXL 1I9RL 1KJVA 3O3EB 2VZ3A 1U8IB 1G9MH 2NXZC 3V6OE 1MREH 3RL1B 1H5BA 3P73B 4KTYA 4MCYA 2Y36H 1KOAA 3MUGB 1DBAH 2VDOH 5AWNL 3V0VB 2EZ0C 4PB9H 2X10A 5KSUA 1IGIL 5T3XD 1NGXA 5DEZA 5F93C 3RVVC 1G9MC 4XTRC 4PRHD 5AWNH 1IL1B 3OF6D 2DDQH 5T3ZL 3ULVE 3RJQB 3KYKL 2O5ZL 3OJ2C 2JELL 2G9HA 2X7LB 4P4RA 5D7IE 1ES0B 5DEFA 5TQ0H 4LU5L 3UTQA 1MIML 2H32A 1ZLWH 1CTOA 3S6CA 5C3TA 3W0WD 5TDPB 5B39B 3AM8C 1T7ZA 2NTFA 4XP1L 1T89A 1AGBB 2HT4C 2QSCL 4KI1A 4DN3H 3GK8L 3GMOA 4L1HA 4P2YA 3MACH 5T5NG 3BJLA 3GK8H 4EIGB 3LEYH 4IRSB 1LDSA 4DOHE 3GSVA 1OF2B 1I7UB 4BSWA 3HAEG 2UY7A 3DO7B 2LFGA 1JGEA 3KPRE 2MJWA 3DVIA 4JFDD 4MJ2A 1JNLH 1T5WB 2ZKHH 4L8DB 5TE7L 3HPLB 4LGRB 2YKLL 2BRRH 2GUOA 4LIQH 1WTGT 1OSPH 5JHLL 4IOIB 4IRZH 1AD9B 1J11A 1UH4A 4OF5A 1PZ5A 4XNYL 2XKNB 1Q1JL 2ZOKB 3NPZB 5F1KC 1RI8A 2AEQL 2NY0D 4H5SB 3IJHB 2JB5L 4XNYH 4JPWL 2VLRE 2XPGB 5T1MB 5IMMB 4OZIA 5LQBH 3BPCB 1WT5A 2GHWB 3GIZL 5MHSD 4Z95L 5IIEA 3PWNA 5FYJE 4MNHA 3LY6A 5EU5A 3HMXA 1KJMB 4NFBA 3MRRA 3PQYD 4HPYH 4Q6IC 4U1IB 4P5TA 3FB5B 3P9WB 1HQRA 3QDGE 1G9NL 1VSCA 3D2UD 3QULA 3ULVL 5HYSA 3WFBL 1DQDL 1T03H 5I2IB 5J0BA 1TCRB 3PWVB 1MCNA 1QSEB 3G5YA 5I8CA 1U92B 3QIWC 2Y6SD 4JM4L 3VXRD 3KLSA 4RQQA 4ELME 3D18A 4KY1H 4BZ1H 2R2HB 2X4QB 4UZGA 2Y4SA 4P2CG 4Q9RH 5LWYL 4XXCC 3S36L 4KKBC 5EU3B 2XQYK 5KN5A 3QXAA 4NGHL 3FT2A 3VFNB 4NQTA 3K7UA 1LNUB 3EO9L 1CGSH 2ZJSH 5EWIL 4JJ5A 3LD8B 4WUKL 1VFAA 3MV8E 2AJUL 3V95A 4E0RB 2Q7NA 4P3CL 3O4LE 5J56B 4U6YB 4DW2H 2JIXB 4TSBH 5GZOD 4K8RD 3ZDXE 2RB8A 3GSUA 3C6LD 5CMAA 5EUKA 1Q38A 4HCRA 4X4ME 1ED3A 2VXSL 3NABL 2Z8RA 3QEHA 1TJHL 2Q76B 5TF0A 1BP3B 4BFBD 2VAAB 4NJ9H 4X4XA 4P2RE 3N1MC 4IHOA 4MD4B 1BLNA 4LSSL 4OZHB 3QFJE 2B4CH 2V5RA 4Q2ZB 1KN2H 4HQQH 1B6UA 4F37F 3IDIA 3FOLA 1NAMA 2DTMH 1MWAA 2LAGB 1RK1A 4ISVB 1FZMA 5D2NE 3TCLB 5BW7A 1A9BA 3EYOB 1BVKB 3RUGE 3O8XC 4P99A 2W0KA 1AI1H 1FORL 2EZ0D 4QRSA 4D9LH 2HVJB 1DANU 3F62A 1PD6A 1MCHA 2DB8A 3OKMA 1K8IB 2WUCL 1CU4L 3UC0H 1J8HA 1R5IB 4OLEA 2DBLL 5DO2C 4JGJA 1INEH 3DROA 1CGSL 5EWIH 1U36A 4DKAA 2WV3A 2V7NB 5I16B 1MJ7H 3FQUA 4XZUA 3JTSA 4G9FE 1HXMB 1JWMB 3QT2A 4O2EB 4XP6L 5F3BB 2C3HA 2DTSA 4J23A 4EI5B 1A7BA 5ESAB 4I18A 1TJHH 1N5YL 5L88H 2VUOA 3G08A 2IPKB 2BNUB 4QXTB 1EJOH 4R4FH 5CJOL 3PG2A 1J1PH 4OCYH 4DKFH 1UT9A 3CUPA 3RBSA 3BWAA 4X5XB 4OGXH 4LDLB 4P2OD 3X12B 3SKJL 5TF1H 4LOUD 3EYUL 4FFVD 3JWOL 4EVNA 4JM2D 1SYSA 5DUBA 2I5YH 3UXFA 1TNNA 1A22B 4JZOA 1JRHI 3O6FB 2ZPKL 1A7OH 2D03H 3FQNB 3UC0L 4FP8H 5LGHL 5HY9B 2E7BA 2CRZA 3VXRB 8FABA 3THMH 3HI1B 3OKLA 3P30L 5ETUA 3KWWB 2FEDC 4O2FA 5DD3H 3L95B 2DLIA 5GQBA 5GGTL 1WFTA 2R56L 2YA2A 1U8MB 5HVFB 2UVEA 3LCYA 4RZCA 4J3UA 2E8YA 3ARZA 5GGRA 5KG9A 2IANB 5T3XL 1EHXA 1U92A 4FQHB 4JFPA 4G6FB 4G43B 2EEAA 4KK9C 3QZWB 5E2JA 1E4XL 1NLBL 5CBEB 4ONGL 1D5XB 1G84A 3ARTA 4Y4FC 4FOMA 1UCTA 2C3GA 3RNKA 2X89D 2COQA 3WXWL 3LN4B 2HT2C 1PY4A 4XVUD 3UAJD 2P5WA 4MSWA 4MQ7B 1QSZA 4KKCD 1RIVL 3GKZA 3EYFA 4I18C 4HW6A 4MDJB 3HN3A 4IRJA 4XAWH 5TGBB 3QUYA 5C0IB 1D5IH 3MJ9A 4KV5E 4MCZB 4XCFH 2VITA 4HUWA 3VXRE 4NWUL 5DS8A 4OZHA 3P30H 4HIJB 3UTTB 1EHLL 4U3XA 4NWTH 5D1XA 3VGGA 1NAMB 4R7DA 3EYQC 2A6JB 5TE4L 3TV3L 5CSZA 1UB5B 5ECJE 2DQCL 3EJJX 2Q8AL 5C6TL 2ADJA 4MJ5A 5JXED 2BFVH 1CFSA 2ZG3A 4CUCA 3RUGA 1FCGA 4QYOA 4X7CC 2HT3C 2VDRL 1Z9LA 4GFTB 3CLFH 4KTEH 3LQMA 3MA7B 2D7OA 1MFCL 1A3RL 5DMKA 4O58L 5EH1A 4LASH 1AY1H 3HLAB 5H37G 4GMSH 3HRZB 5C08A 4D0DB 1QYGL 2P42B 3WE6A 4PRIA 4Y5VB 5IKCB 4JHAH 2EDXA 4P9HC 3C5ZA 3MLRH 1IAII 2CXGA 2P46B 5B38A 1MCFA 2BNUA 3ARBA 5D4QA 1QFOA 4WO4B 1CIUA 1NGXB 2NXZD 5EU7E 2VISB 4LARL 5D6DA 1DN0B 1JZ6A 4WY7H 1XF4B 2NW3B 1MRDL 1ORSA 4F9LC 4PLKD 3MV7E 1NSNH 4NKOA 4QXUH 4KRNA 4JZJC 5KS9E 4G9FD 3O9WA 5DVNA 3H42H 4EIZC 5HDQL 4HAFA 1U93A 2NTFB 3BD4A 4OM0L 3O4OB 5DZNA 2P43B 4OJFL 1A6ZA 1N64L 5MI0C 2AERT 4C4KT 4LHUD 4N0YH 3PWUB 1A7PH 2RIKA 3RI5F 3MJ9L 1MJ8H 1I8MB 4P4RB 3MUZ1 1ADQH 1JGEB 3QQ3A 4HV8B 2Q87A 3CFCH 3M8OH 2VLLA 4NKIH 4ZO9A 4MNGB 4G8EB 1T5WA 2M8XA 3SKNB 1BX2B 4PD4J 3HMXL 1BZ7B 2F5BL 3U46A 5JDSB 2NY6D 1D9KB 4TOYL 5I6XC 3BZEB 4Y89A 1GGIL 4LLVA 2GI7A 3GMOB 4D0CB 4JLRA 4NQCD 3MV7D 1IC4L 2PTVA 1EZVX 5EOQH 4EDXB 3D69B 3NAAH 1BZ9A 3DX9B 1PZUB 1FNEB 4YQXL 4IMLB 1TITA 3QDGA 2MOVA 4E41B 4LLYB 4L8DA 1HIMH 2Z93A 4JANA 2PTUA 3B2VH 3L5WA 5ACZA 1BF2A 1L0QA 4IOIA 5HYSB 3RHWK 1BM3L 4K2UH 1MJ8L 3CDYA 2EDOA 2CLRA 4HUXB 2J3SA 4ODTL 4WUUE 1YDPA 2B5IC 2VSCA 4GRWH 5EOCJ 5DVMA 4Y5VC 1KC5L 5EBLB 3H9ZA 5KZCD 5FKPB 3ULVF 3CCHB 1M05A 3B2UC 5I1GL 1MHPL 3SBWA 4Z77B 1CDJA 4WWKA 3U1SH 5E8EA 3CU1A 2ENYA 5E8DH 5AZ2H 5FM4A 3JWDC 1CLOL 4KJPD 1G7HA 4KK6C 4NNPL 1S7WB 5FIEA 3WFDH 5CBAB 3TZVA 4OZGE 4OCLC 1F3JA 2V5SA 3L5IA 1KEGH 3VWJD 3OKKB 4G7YH 2Q76A 2HRLA 4M7LH 1KLGB 4MDIA 2WNGA 5ALBH 4BH7B 4U6XA 4I13B 2VXTL 1ZS8A 5EA0L 1C5DA 4FMKA 4P46D 4N9OB 5J57B 3V5KA 4XCYB 5CJXA 5IROC 4NQVA 2PETA 5L2JB 3DUSB 1XR9A 1BVKA 1CDCA 4HH9B 4HT1L 4KXZH 3LKPB 2VC2L 1UM6L 3P4MB 2Z4QB 1I3GL 2UZIH 1GCFA 5D7JB 3RWHB 4XVTH 3IAGC 4RSVA 1AGCA 1T7WA 1CXLA 1FH5H 3LD8C 4OCXH 4K94H 3MLWH 4PY7B 3TNMA 4UMGA 1A6ZB 1QUNA 1KPRA 3P40A 4OCXL 4JPVL 3RWEB 5HHNB 4WFGD 1XIWD 3MSPA 3CVHH 4P9ML 5CEZE 3B5TA 3ZE1F 1S7SB 5C2BL 2X5PA 3N06B 3KLHC 4ODSH 3JWDH 4OCWH 1AR2A 2W9EL 2WIIB 2ICWA 4X6FB 3BN9C 1BIHA 1V7NL 1CZ8L 2P5EA 5BV7L 2BY0A 3ARDA 1IGFH 1IAOA 5DMJB 1C8PA 1Q9OA 3PP3H 5KS9B 1KELH 4LLQB 1R3HB 3VDAA 5DMYA 4LVOC 5CCKL 3MRJB 1CF8H 1SBSL 1MFDH 3LEXA 5ESAA 4PTTA 2BNRD 2RJMA 4I18B 5A3ID 2NW2A 3UJIL 5HYJD 4PJBF 2OI9B 1YN6A 2VSDA 4TVPD 1NC2B 2DQIH 1CFBA 3PWPB 4JPVH 3VA6A 4QHNB 1ZHKA 3U7AA 4P9HL 3OAYK 4GUPB 4WV1B 1GXEA 1AXSB 4N0CD 3QDJB 3HAEH 5ID1A 1TIUA 1JN6A 5AUMB 1ZGLB 5HGHA 5E5RB 4JHZA 4XGZB 4OV5B 3QZWA 1OT1A 1DEEB 3MLVL 4I2XE 5FM5M 4OM1L 1T5XB 5EORH 4P49A 1X4YA 3F7YA 5E70A 2LU7A 3NIGE 3IAPA 2PCPB 2A2QT 4BZ2L 5F6IB 5DD1H 3AS2A 3L95A 1KTDA 4GRWB 1FBIH 4ALAH 4KK8C 1KG0B 2VXUH 3OZ9H 5MP6L 5HHMB 5I73C 4U1GC 1IILE 1JNHB 3U4EA 4UV7H 4PTUA 1CLZH 2OM5A 5C86A 1EFXD 1S8DB 2LVCA 4WWKC 3RNKB 4HIHA 3TT3L 3HS0A 1I8KA 4OZFH 5IM7A 2PYFA 2R4RH 5T33H 1UB5A 3IFOB 4G80A 3VD4A 1VESA 3BEVB 3DUHA 4P46C 5F7UA 1JFQL 1MCDA 3LKPA 3TBTA 4UINL 4L4TB 5I75B 4PRNA 1AXTH 2IMNA 2DQHL 2YN3A 4YK4C 3NTCH 4DUVA 3VFOA 3IKCB 3DNKA 4BYHA 3DX6A 5K59E 2FNBA 3NN8B 5GZND 3T2OA 4ALAL 3EOYG 5E94B 3T3PF 3SO3C 3C60C 2AK4A 4IIQC 1YMMA 3ULUH 2ZUTA 5JNYA 1UXSB 5DD5L 5T3ZD 1NEZG 2XICA 2DQDH 4OGYH 1S3KH 2BNQD 1YUHB 2EE9A 1KCVH 3MRBA 3SDCD 2LTQB 4FTVE 4OZIE 4OFPA 5L9DL 1WAAF 43C9A 3BAEH 4NGHH 2X4NB 1B2WL 3ZO0A 1GRWA 1SEBA 3REVA 4JRXD 1A3QA 3HRPA 1MRCH 3E3QC 3OKDB 4EDWL 15C8H 2EH8L 4FN0A 1KCRH 3WKMH 5EB9A 4KUCF 1UA6H 3KDMA 4ZTOL 4L3CB 2WUBH 2WM0A 3PP4L 4W6YB 1XR8A 4XRCB 4ZXBD 1FVDA 3JBG7 1SVZA 1X3DA 4S11A 4X99B 5AZEH 1U8PB 3BKMH 3L3JB 5DTFB 2VE6B 3KJ4C 4XNZB 2HFFA 1OGAE 1RUAL 4DKDC 4HPYL 3BKML 3EGSB 1OB1B 1Y0LA 4GRLA 1G7LA 1KB5B 3HR5B 2AJ3B 5E9DE 4OGYL 3WV0A 1D5MB 3PWLA 3RWDB 5I19H 4P5KA 1E6OL 1HI6A 1T5XA 4H1LG 4OLVL 2OBGA 1X4ZA 5E5MA 3MCLL 2CK2A 4Z0BL 4XCEA 1CVSC 1C08A 1DCLA 4HFUH 4PJFE 4WFFD 2IADA 4H88H 4S2SA 1FFOA 4HKBB 5BOZG 4EDXA 2C4FU 2D0HA 3IDGA 4F7MB 3H9SE 4URTB 2WP3T 3UBXG 2DI9A 1Q9KA 3GKWL 4XMKL 4HWBL 4KJWC 3VA2C 2NY2D 3EHBC 2C5DC 3FFCA 1S7VB 5SX5H 3CC5B 3HUJB 4NKMB 5IFJA 5EZIH 4O4YL 4Z7UA 3SGKC 5JO5B 4GSDH 4FZEH 2WLYA 4XNMB 1G7MA 3LKRA 4JO1L 2H41A 3WS3B 5IBTL 3GSNL 3O2DL 2VR5A 1SYVB 4LFHD 3KPMA 4NRZA 3WLBA 3CZFB 4B41A 3CFEA 4M9OA 1AO7D 1T2QL 4IMKC 5F7EL 5FYKL 2VL4A 3QWOB 1CGYA 1XGQA 2V17L 4NRYB 4WGVB 4F80A 4PRHB 4Y2DB 5D6CA 4M6OL 3O8XD 1UACH 2E8ZA 3C08H 4JRYD 1I1AA 1HNFA 4K3JL 4PGJA 1MAJA 5FO9A 4I3GA 1YECL 3OPZL 5DQJB 2A73A 4JKMA 3EZ8A 4O02H 3CSYA 5DJ8A 1QRNE 3IDMB 4XPHL 3F5WA 4UAOC 4MXWL 2QQLL 1GAFL 4FZ8L 1YYMH 5D70L 1GOGA 2FO4A 2GCYB 4NYLA 2AS5M 1MHEA 3F7RA 4P57B 2D2OA 4WWKB 1MCSA 4OZGB 3FO0H 5IBTH 2QSTA 4K8RC 1BVLA 2R9HC 3SDCC 4J8RB 2BOCA 5FUZL 7FABH 3QUXC 1GIGL 3VG0L 5IVOA 3IF1A 3BZFB 3JWNC 2PTTA 1FO0L 4P4KC 4WCYH 1CXFA 4TRPL 5HTSA 3W81A 1TQCB 5T3ZE 4W4OC 3S3PA 5AG8A 4GKSA 5HYJA 1O5DT 1XGPA 2VKWA 2YD5A 2DLFH 2YSSB 1IL1A 5TF1L 5IEHA 4RFOH 5HDLA 1OAXL 2BVYA 1UWEL 4X6CB 5FB8A 5HHOA 5TE6L 3NA9H 1F5WA 3GSRB 1YY8B 3TJHD 3NFNA 1A6VL 1J87A 3HNVL 1BAFH 1QLRB 5ADPH 2Z4QA 1A7OL 2D03L 5HHXL 3IVKA 2K1MA 1D5MA 4FQCH 4GKOA 2GIYA 1I7RB 3MRPB 4K3DH 1I3UA 4WI5A 1WCBA 3DUUB 4TUJB 1W0YT 1QRNB 2W65A 5CP3A 4ZUUB 4ZUVA 1HKFA 1H8NA 4ODHL 5H2BA 1JF6A 2HLFC 2RGSA 3RWEA 1QNZL 4WO4D 3T0EE 3QUYC 4R3SB 4KZEH 3LEXB 3CPLB 4J4PA 2VDLH 4EBQL 4XVTL 5IMMA 4U6HA 2BVPB 2F53D 1LO5B 5M7QA 3OKNB 1VKXB 5D8JH 2Q20A 1G9ML 3B2UD 5SX4H 1VACA 1EX0A 3C6LA 5DJXB 1P4IH 4HLZG 4F7EA 1FVCB 4KK5D 4EN3A 1MF2L 4Z7UB 2IH3B 3TO4C 3D3VD 2GUOB 5FHBL 4FXGA 3L3HA 3DVNB 5E1AA 4G8FB 3CXDL 4MNQA 2WBWB 4GG6B 1JL8A 5BVJB 3MMEA 4YXLH 1HDMA 43CAA 32C2A 3O0RH 1MFEH 1FAIL 4HMDA 1YN6B 1VEOA 3HPJA 4KTDH 3T2QA 3HZMB 2NY5L 1CVRA 5C0RL 4JQXA 3IFNL 2FB4L 3HE6A 3G6AB 5EBWA 3BZDA 4NO3A 1ZHBB 1ORQA 1XF3A 5J1AB 5F70A 2VDLL 1G7QB 1G6RH 4JE4B 1JZ8A 4LLUB 2R2HA 5HHVL 5FGCB 3DSNA 4J1UA 4XPTL 2BY3A 5MENE 5IVXF 3W39B 3F7YB 5J1TC 1GHFH 3ECBB 2H2PC 5EU3A 3MLRL 1LEGB 3BX7C 1A1MB 4HKJB 4C56A 5KVGL 3MOQA 3ARGD 1FZJA 3IXTB 3P4OA 3IFLL 1CL7I 2AV7B 4LRNH 4LSTL 5CD3A 1AC0A 3FOMB 3RTQD 3WDJA 1R5WB 1Z9SA 1R5IA 3L6FB 4OF7A 5EN2A 5GS3A 1J0HA 3HZKA 1ZWIA 4HX1B 1FSKC 3BVNB 4ZAKC 2J1KA 4YBQD 3JV6B 3PV7A 3DWTA 5I8EB 1T03L 1ZSDB 2EEBA 5JNYB 3LEVL 1I8IA 3QUXD 3CLEL 1JZ5A 1B0GA 5EZJA 1XH3B 3V7MA 3GO1L 2OMNA 3I02A 1C5CL 3VXSD 2P5ED 4Z7UE 4NNXA 1YMHB 3WIHA 2V7HB 1BD2A 1YY9D 2FWOA 1NBVL 4ZUVB 4Z5RA 1BWWA 4JFYA 1J1OH 5LXGH 1AIFA 1V05A 3LRSA 3R0NA 2H3NB 3RVXD 3REVB 2YPVH 3ARBC 4HK0A 1QA9A 3HC0B 1HYSD 3MRQA 3NFPB 3W0WE 1FFPA 5JQHC 1GZQA 3KPRA 3G08B 3KVQA 2JCCB 2X4PA 3SDCB 4KI5E 1OTUC 5GGSY 1T1WA 3GMNA 1Q9WB 5DJCA 3MO1A 1AQDB 3CUPB 3FB7A 4MS8D 4XHQA 5DTFA 2D7TH 5E9DA 3BP6A 1W0WA 3WNMA 1OB1A 1Y0LB 3HZYA 3UZEA 4D3CH 2KL6A 3KPPA 3LSOA 5J1SC 2BDNH 3MC0A 3MLYL 3QPQC 3VRIB 1KXVC 1EVUA 3D5OF 4RDQG 2CK0H 2H26A 2MNUA 3G9AB 4RX4A 2QADC 3BZ4A 1BJMA 3G6DL 3TNNA 1Y18A 3HE6B 1KCRL 3NBNA 1MWAL 4LAJH 5FV1L 1JHKH 4GRLB 5HHPA 1OM3H 4PJAB 1TFHA 4DEPC 3NFSH 4D9QD 4YX2H 3FQWB 3V8CA 2YC1B 3F7VB 4QTIL 4P9MH 3UTOA 3UJJL 1P5UA 5BMFL 2Y6SC 3UTSB 4HFWA 3I84A 1OAKH 3A67H 4AENA 5IJKC 2WINA 4LCUB 4AEIH 3OKOA 2ATKA 2XFXA 1IGFL 2EC9T 3C8KB 3IRZA 4KJQC 1PX3A 1KJ2L 2VLJD 4S2SB 3EIFA 1G7MB 3LKRB 4UQ3B 3AROA 1GH7A 4NNPH 2ADJB 4V1DA 3WFDL 1PY9A 4CL7A 3N85L 2FGZA 4P5TD 1INQA 1CK0L 2JJUA 3T0ED 3QDJD 3GJFH 1DSFL 5KS9F 1TTFA 4Z8FH 3QIBB 5DS8B 3FZUC 2W0PA 1ROWA 1XGQB 3BVNA 2Y07L 4PG2C 3V52L 3QHFL 2GTWB 3ILPA 4PJ8B 4XC3H 4J4PD 3S97C 1MCIA 1WSST 3MBXH 3BP5A 4H20H 2OSLB 4W6WB 3T08A 3Q5OA 3FB6B 4LSVL 5LCVL 3D3VE 1NMBL 2XWBA 3PABB 3BXNA 2BC4A 4Y4HA 2IAMB 1LDPL 2VXQH 5GS1A 1OGTA 1S7QB 4X9BA 1J9CT 5LG1A 4NNXB 3O6LH 3AREA 4YXKL 1CCZA 1DQML 5CJOH 3PIQB 4LQFH 4NN6B 1CICB 1DR9A 1AGEB 1JUFA 1Z5LB 2VQ1A 2VDQH 1F8TL 5CEXA 1PKQE 1KCKA 4XPFL 5DQ9A 1HN1A 2Y5TA 2XA3A 1RK0B 4KHXL 1SM3L 3B3IB 4HKZB 3QHTC 3QDJE 4RBPH 4NDMB 3FT3B 4OLYH 1MLCA 3GIVB 2A73B 5I8OH 2PTTB 3W82A 3P4NA 1HH6B 3ZTNL 5IK3B 1A6AB 3A6CH 4E41E 3MNWA 2N7AA 5HYJB 3GMPA 5F9OH 3QIUB 3HI5H 1OD7A 3SDXF 2D9QB 2J4WL 3EOTH 2OJZL 3LDBC 3BP7B 5FKAB 3T0WA 3RZCD 1A4KB 1TZIB 2XN9E 3DSFL 4P57A 4RMSA 5JORB 5DJDA 1QQDA 2BVOA 1ZLSH 5FDWB 5LBSH 1QR4A 1FGNL 1DQJA 4XMLL 4M5ZL 1B6DA 1S5HB 1I7RA 3MRPA 4GAJL 2R4SL 4HWEL 2MHAA 5J6HA 3AB0C 4GG8B 2RAMA 1P4BL 1NGPL 2AQ1A 4JQIL 1JF5A 1XGYL 1MLBB 3KGRA 1P1ZA 4APQC 3QH3A 5IEHB 2RQ8A 4YEFA 4UOW1 5I71B 5ITFB 4FA8A 3MRLB 3OJVC 3MA9H 3QUXB 3H0TB 1YEGH 4HGKC 5CLTA 4WDIB 2D7QA 5EOTB 3A6CL 3VD9A 5D96B 1U8NA 1HH9A 4HFWB 3SKNA 1BZ7A 3U46B 1R6VA 4HXAH 1F4YL 4PJCF 5H2BB 5CGMA 3VWJB 4HHAB 4LEOA 1P84J 1T1YB 2DIJA 3C6SA 25C8L 4PY8I 3K4ZA 3WL9A 2IBBA 2X4UA 1QD0A 5M94B 1NBYB 4JR9H 4UU9B 3JV5A 1QSFB 2VUYA 5IT2H 2AK4D 1LO5A 1PJ9A 4ZS7H 3HE7D 4NQDA 2YS4A 2CGRH 4M4PA 3O45A 4YAQB 4JO3H 5EOCL 5KANG 1UFUA 1CG9B 4OB5L 4YHPA 2DWDB 1MHHA 2L7UA 1RZGB 1S9WA 4KKLC 1ND0B 4OZGF 4ZSOA 3TA3C 4JPIB 3G6AA 5EBWB 5A16B 1CBVH 2IPTH 4WHYG 3CLFL 3WIHL 1DBKL 1N7MH 4NO5A 5I1DA 1JWUB 1CFTA 2LV4A 3RDTC 3SEPA 1K8DB 5EU4A 5L8JB 2E7CA 4HUNB 2Q8BH 2A6DB 4JFXB 3VXQB 3C2AH 4XCNB 5EIIB 2I60H 5F7MC 4DN3L 5IB2A 5I1LA 1ULVA 5DI8A 3MROB 1MAKA 3MGOA 5GGQH 4KAQH 4NHCH 2ADIB 5C6TH 1G7HB 1NDMA 4L8SB 4GXVL 1YNTB 3LPFA 1GZPB 3FOMA 3QO1A 4XNQB 5FGCE 5JMOC 5KSVA 3HG1E 4U33A 2NXYC 4BZYA 1R5VB 2GT9A 2NX5B 5BVPL 4RFNB 1D9KC 3WS6C 3GDBA 4W70A 1A6WL 5EBMA 2OTWA 4HJGB 4WVRA 3DTXB 3RX5A 2CKBH 5JOFB 2P8PB 3AB0B 2R0ZH 1SY6L 3LH2H 4EOWL 4M1GH 4LMQE 1ZSDA 3K4DA 5DJDB 4XMPL 3HUJF 4FXKA 1ES0A 5DEFB 2WBJB 4N5EC 3TO2B 1FIGH 4LLDB 2IAMC 1ACZA 3AGVA 2GK0A 5DUMH 2VLMD 5CEZL 2DF3A 1TJIH 1TTGA 5DEGB 3QIUC 3N9GH 4QF1B 1E6OH 4NQED 1MAMH 4MD5B 4UILH 4NOFA 5JQ6L 4Q6IB 3H7BA 4RNRA 4KAQL 3MRJA 4JZNB 1N3NB 3BKCL 4Y1AD 1T4KB 2V17H 35C8L 1QSFE 1OF2A 3AC0A 1L9MA 3IFPA 1I7ZB 4HFUL 5IR1A 3ZE2E 3RWGB 4XPAL 1VPOL 4V2CB 2RBLA 4MJID 4YBHA 3PWNB 4OSUL 3CVIH 1DVFB 4L8BA 4PG9B 3IJYB 4PREB 3W9EB 1QBBA 3OR6A 5FOJA 4Q74A 4UTAL 1MPAL 3ELAT 4PRBB 1LK3H 5D7SH 3WN5B 1F3DJ 4JHWL 1AQKL 1AD9A 1MCQA 4OLUH 2DL9A 3OXSA 5D1XC 3GFUA 4C54A 3NCYS 4Y5YC 1WBYB 2DI8A 4XBPA 4L29B 4L4VA 3LKOB 1CQKA 1CE6B 3EO1B 4WTZG 3RY6C 1F3RB 5DQDH 2NW2B 1QFWL 3VCLB 1EAPA 4KVCL 5E7FA 4JFHE 5C0NC 2UZIL 5DRNA 2A83B 3GMRA 5IMOA 1JWSB 3VH8A 4FQQB 3EDFA 3KLAB 1P7HL 4Z7WE 4HS3A 5D5ME 4U1IA 3FB5A 4R90H 5D2LB 1YPZE 3RKPA 4W68A 4C59B 5A1AA 4QRTA 3QBTB 3QDJA 1KG0A 4AG4L 2F8XC 4DVRH 4LNRA 2E7LC 2B5IB 2CJUH 3X13B 3TA3D 3VFVB 5GZOC 3LMJH 1L6XA 4JRYB 4KRPB 1OOAA 1KIPB 2EO9A 4FQIL 3VFWB 4PJ5B 1HIML 3OTTA 2W07A 2D7PA 3C8KA 4R6UA 3T3MF 4PJIA 4S1RL 5EC2B 3TM6A 1FYHB 1KTDB 4XCCL 3PWJB 1UB6A 2EKJA 2MPAL 4JG1H 5H35A 4ZFFB 1JE6A 3TBSB 3SOBH 3DHMA 4N1EA 4P4KA 1OAUH 4DAGH 5E6IB 2OL3B 2X89A 1LE9B 1ZLVH 3FN3A 1ZXQA 4MAUL 2P5WD 2ZNWA 1Y6NR 4GXUN 1MIEL 4PUBH 2N7BA 3IB4A 3OKOB 4NZRL 4ERSL 4NUGH 1QEWA 1VA9A 4GLRH 5D5MF 4RX4D 1I75A 2P8MB 2LU4A 2A1WL 5JW5B 3RL2B 4NZRH 2VIRB 3TBYA 3T2NL 3MRCA 3QUZC 3U4BL 2C7UB 4DUXA 1JZ3A 2PW1A 5DR5H 5C0CE 1S7QA 3VFPA 3GMQB 3QR2A 5FYKD 5HSFA 1CI5A 5DK2B 2MCG1 5JOPE 3HNVH 3AREB 4PGEA 2XNAB 4JFEB 3Q5YA 4OCSH 1QPXA 1YNKL 3V5DB 5I16A 4AMKH 4ZAKB 3VGBA 1N3NA 4JKPL 3NA9L 5C09A 3O3EA 2VR4A 3QCVL 2CR3A 5ALCL 4M62L 2P5WE 3V4UH 1Z6JT 1I3VA 5DGQA 3IYLW 5IK3A 1XCQA 4CADA 2VKXA 2UV3A 1I9JH 4PRBA 4Y4KB 3HMWL 4BQ8A 2HFGH 4I9WE 4RZCB 4OT1H 1P5VA 3GHBL 1FNGB 1W72B 3LV3A 3AVEA 1C7TA 3EOBB 5E8PB 3MRMB 1F90H 3KYKH 4OCWL 3OX8A 5FA4A 4UT6H 4ELKB 4HWBA 4R2GC 3ARSA 5GS0C 1DL7L 3AAZA 3CNKA 4XX1G 4S1DC 5BV7H 1A6AA 4OM1H 3ZE0F 1A64A 4X99A 1ADQA 1OTUD 4NWUH 1UWGL 4N0FA 1U3HD 1MQKH 4CU7A 1OP5K 3BSZH 1II4E 3BT2H 4XP9L 4MNGE 1DBML 4MA1B 1KB5A 4JJHA 3S4SG 2Y72A 1NANI 4HWUA 4LCCC 4ZNCD 3SGEH 2AABH 5K93A 5CKGA 4JRYA 5C6WH 1HINL 3HPLA 5D72H 4CVZB 4XPGL 1H9VA 2HLFD 2YD6A 4O9HH 4BM7A 2FZ3A 3I3BA 5JLZA 3C6SB 4WIQA 5FHAH 1MFCH 4KV5F 4PB9L 5I1HL 4F7MA 4HKXA 1XZ0A 4KKNA 5HVHC 1YQ2A 3NOIA 4NRZB 4DUWA 4RCAA 1KIRA 3FQXA 4R26H 4JQIH 2NZIA 1NC4D 3SDAB 4LU5H 3UBXA 2FR4B 5F7DB 3PWPD 5BV7C 3RTQC 3M1BA 5IJVB 5DD6B 4CMMA 5C08B 2VXVH 3EJZD 2J6EH 4I0PB 1Q0XL 3WS3A 1WC7A 5E4EB 5FO9B 3PHOB 3MGTB 1LMKA 2VDPH 3L9RA 2BX5A 2Y25A 4PGCA 3PL6A 3U36B 3DJ9A 3WLBB 1DQQA 2IC2A 1FJ1B 4PJDE 1KNOB 3RUGB 1GGTA 1EEZA 4MXQD 3O3DB 3MR9A 4S1QL 1FORH 2DQTL 4WUUD 1JGLL 2IAND 4JY5L 3BYTA 5H37H 3SKUD