1FAKT

Human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
205
structure length
183
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGEPLYENSPEFTPYLETNLGQPTIQSFEQKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWGKKTAKTNTNEFLIDVYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of extracellular tissue factor complexed with factor VIIa inhibited with a BPTI mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords PROTEIN (BLOOD COAGULATION FACTOR VIIA)
total genus 38
structure length 183
sequence length 205
ec nomenclature
pdb deposition date 1998-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fakT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fakT02
2HKHH 2PO6B 5DUMH 1R5VB 1AC6A 5MI0B 1CFVL 3FQXB 3GBML 5E7FA 2AJZB 4ALAL 3WNLA 4MXQC 3E2HB 1NGWB 3MRDA 3ARWA 4OCLC 1IGCL 3VFGH 1JN6A 3QDGE 5D7LA 3MRQB 4L1DA 4JHWH 4PJBE 5F6HJ 1Q0YL 5IMMB 4DKEL 1GC1C 3O4LD 5F9AC 2A1WL 4KPHL 5A2JH 4D94A 4PV9A 3IDIA 2G5BB 4JQXC 4OZFG 4H20H 4UTBH 2H1PH 1MCJA 5IKCB 4X4YB 2FX7H 4PJFE 5KG9B 4GAJH 4U1LB 1YNLH 2VLKD 1W72L 2DQHL 4LSDA 3ARDB 5K93A 4PUBL 3OAYK 2HMID 4M62H 5GS1C 3RA7H 4N5EC 4ZAKB 5GSVA 1SVCP 3W11D 4G8IB 4UT9L 4OLVH 4L3EE 2P24B 4FG6D 1MFNA 1YNLL 1N6VA 2NZ9C 1AGEA 1RZGA 2R4RL 4ODSL 4WFHE 3PP4H 2XRAL 4PRBA 4AJ0A 4LLUB 4HCRH 5F7EL 5IWLC 1V7NL 4UQ2A 2V5RA 1J0IA 1IC1A 3VXOB 2QQQA 2CXGA 2ZUXA 1YPZA 4MA3A 1JPFA 4S0TD 5I1LB 3MXVL 4EDWL 1HILB 4L4JA 5SWQA 1B88A 2MMXA 4P23D 3DHJA 1CG9A 4ZPVB 4PYHA 1V7NH 3SDCD 3U9UA 4P46A 4RAUA 1QFPA 3H3KA 1XGPB 5D4QA 3ARBA 3CVIH 3OJDB 1D6EB 5EUOE 3HAEA 1QRNB 4MJID 2WIIB 4LLQA 1FNEA 4WDIA 3AFLA 4LPTA 1RUQH 4Q74A 4OZHB 3VFSA 1EGJH 4E5XB 1AD0B 1ZTXL 3I9GL 5IMKB 2YPLA 4AL8L 1ZANL 5C0RL 1HHHB 3TV3L 5KANI 4LLMB 4BM7A 3A67L 4UOW1 3TT1L 4PJ9A 3UXFA 4KKCC 1YEIL 1QA9B 1MREH 5DR5L 3QIUB 2LVCA 2W0LA 3PHSA 4JN2A 3WN5A 4WI4A 4L3AA 1CFNA 2R2EB 1HOCB 5EA0H 5DHVB 3QCUH 3BH9B 3L3OB 3TT1H 3NAAH 4RISH 4YHKH 2AK1H 3IDXL 1DBBL 4LSRH 1ZVSB 3U4BL 5C92A 3KHOA 1HINL 2OK0H 5DQJA 1IAKB 3DTXB 3RWIA 1FYTD 2VDQH 2VDKL 5HI5D 2WP3O 3HCVA 5DEFA 1QSEE 5IP4A 3B83A 4TNWF 2R9HC 3NN8A 4UIMB 4ZUWB 5EU3B 2PXYA 4PYGA 2ICWJ 4WY7H 5HHOE 1U8KA 3TBTB 3AREA 3D0VB 3ZZ1A 1B90A 4XCCL 5FYJH 5KSBA 2H8PA 2ZNWA 4OLZH 5ERWA 1DQTA 3VWJD 3AMKA 5D70L 5BOPA 5ICXA 4D9RE 4NQED 1MLCB 1HCFX 1M4KA 5KVGH 3F7YB 4EI5A 4PREA 3O8XB 2HJKA 4JHZA 4AT6B 5IT2H 4I5BA 2XFXA 1TITA 2J8UA 5BMFH 1CLYH 1VFMA 5D70H 3U9UB 1U8PA 5B4MC 2ITDA 3B5HA 2BVOB 3FT4B 5I1LA 1GC1H 1I9IL 1NCDL 1QNZH 5GGRB 5FGSA 3W39A 4C83B 4ETYA 3VFSB 4EIZC 1MFCL 2VUOA 2EO1A 5D7JC 4AMKL 4YLQT 5I66A 4FQ1H 1AXSA 4EDWH 2A6DA 5SX4I 1A1NB 2VQ1A 1G0XA 1S7UA 1L4IA 3DJ9A 4YE4L 4O2EA 3O6LH 4PJDE 5CKGA 5T1DL 4ODBD 2VLKB 5DMKB 2IQ9H 3GHEL 5KVFH 5JA9A 1XT5A 1A3LH 3LPWA 3JBG7 3PV7A 4D0DA 3I02B 4LCUA 4L9LA 1IM3B 3MR9B 3DGGA 4LL9A 4RMVA 3HS0A 4PV9B 3AB0C 2WW8A 5H37G 3PGCA 1CFVH 4XP6H 4BFEA 1A3LL 2H2SD 4WHCA 2CLRA 1QP1A 4GFTB 2V17H 3LH2L 1KFAH 5INCB 3HUJF 4H8WH 1FAKT 3NN8B 5ALBH 5GGVH 4CADB 4XTRD 3C6LC 1VKXB 2HT3C 2OSLB 4R90L 4Y89A 3CAFA 3MFGB 3DXAD 3AM8C 1HSBB 1BX2A 1R24A 4NSKB 5HD8D 4F7TB 3MBEA 1XR9B 2LU7A 3GSUA 1KFAL 1FZJB 3FCTA 4D8PA 3D0VA 3UYRL 4FQQB 4JM4L 4F2MB 2VIRA 2BXYA 3QUMB 5MEOA 4LK4A 1N5AB 2K7QA 4M7ZB 4TUJB 5D1ZA 4U7SA 3UTSB 5C08A 2EEDA 1NGWA 3MRDB 1X5ZA 3QISA 2NW2B 2IF7A 1NEZB 1U8OA 3GZKA 4FS0A 1PZUB 2BSRB 3T4AA 1MCPH 2IPKB 5MERA 2EYTA 2E6PA 3FOMB 4WU5B 2ILLA 4LKXB 4HBCH 1BIHA 3U7WH 4U4BA 4MMXC 2KQNA 4XP1H 1G7PB 2R1XA 3X13A 2IAMD 3V5KB 1AR1D 2DQIH 3FQTB 4XI5D 4Z76A 5TDNB 1T04B 3TPUB 3T2PA 5DQ9A 3QUZC 1JI2A 1R3KB 3MUJA 4GKSB 3QUXB 2M8XA 5C6WH 1EX0A 2XG4A 2EXYD 4M61A 3DUUB 4RQQB 1ZEAH 1J1OH 2NPLX 4WHTA 2JIXA 3ARED 5I1KL 1W72B 3EAKA 3B3IA 1GGIL 5I66B 3REWB 4DKDC 1TNMA 1E4XH 3EO0B 4ZXBB 1NGPL 4MQSB 3RUGF 5JMRA 2XIDA 5ID1B 4AMKH 4NO3B 3WKML 1ETZB 3HZVA 3WO4B 4RWYH 1G9NC 2ITCA 3AS3A 4JPVH 1BZ7A 4V1DB 1CK0L 1T04A 3KPMB 4D3CH 2F74B 1FNSL 1EVUA 2MQ0A 5SWZE 5B3JE 3OWEA 1R3LA 4JAMB 5FUOH 2AV7A 1UYWH 4TYUA 4F9PA 1MFEH 2N56A 3VFPA 2IH1B 3N9GL 3G5VA 1JZ3A 1E6OH 5E8DH 5FEBA 4OFYA 4PJFA 1G1YA 1FFPA 2VLRE 3V79C 4L8SC 1OAZH 4GW5B 2Q6WB 1FNSH 3EYFB 3S36H 3T65A 3PDOA 1EO8L 3HAEH 4JN1L 4OIIH 5DK0B 3OB8A 4ZAKA 3WSQH 4NHUB 2X1XR 1C12A 4PS4H 3OGOE 4I8DA 1GZQB 4TVSa 3PWJA 3AXLA 1RUKH 5KAQF 3QQ3B 2ZJSL 5JOFA 4M8VA 1ZXQA 1VGEL 3KXFE 4Z7WF 3QUMA 5FHBH 2VDRH 5C6TH 1ODAA 4JFZH 4KTEL 3GIZL 1TZIB 4D9LH 4MA1C 2DQJH 2XZQH 5ICYA 1Y0LA 4YNYA 1ZA3A 2O5XL 4HWBA 1BZ9B 4Z7VF 1LNUB 4KV5F 4GRLD 4P2RB 3ZKSD 4DGIL 2AV1A 3MLYH 4POYA 2XACC 3DX8B 1VERA 3LQAH 4HS3B 1DQDH 2YOCA 4I18A 5HHNB 5LWYH 2P7TB 3BZEB 1Z0MA 1N6UA 2HT3D 5CJQH 1DCLA 5F7NC 4LSUL 4QYOA 5D96C 4FQXD 1I75A 4KQ4H 4I2XE 2F9BT 4NRYA 3ZYJA 1UH3A 2DQHH 5DJAB 2AJUH 1QR1B 3NTCH 3PWLA 1VFAA 4GSDH 1TCRA 5DD3L 4IIQA 4G9DB 3U30C 5CBAB 1KPRB 2E7HA 3REWA 2DKSA 3U36B 2ZOKA 5D7SH 3V6FB 2EZ0C 3B43A 3FB8A 4D2NA 4BELD 4Z0BH 2HFEB 4YXLL 2BNRB 1RD6A 4B7LA 4Z7UA 4FQXB 2DJSA 1NANH 3ZHLA 2DQCH 2WBJB 1OVZA 2BVPA 2FIRT 3U9PL 3KYKL 1VFUA 3KYOA 5EOCH 2R2CA 5EORL 1X4XA 2Y36L 4P2RD 5DK3A 5GGRA 3FHQA 3L3DB 1ND0B 3CIQA 4RX4D 3QO0A 3T0ED 5ANME 3LEXA 5LCVH 1BPVA 4Y7MA 5KVMC 4OF3A 4QRUB 1ZLSH 1CGYA 1NUDA 3VXSD 3WLBB 1JWSA 2GY7B 2EE9A 4PIRF 1CR9H 4E41B 1WV7T 3N9GH 4N8CL 2P45B 4Z0XB 4DAGH 4LU5L 4PJ8D 3RZCA 3ES6A 4M6OH 1OT1A 4N0UA 3LIZH 3QDMD 1OAXL 4YEFA 2EKJA 1CICD 5FK9B 4HUVB 3R0MA 4HS8H 4H0GA 4PJEB 3G6JA 5TH2A 2X4NB 2AK4B 4HCRA 2UVFA 4NNYA 1G6RL 4LU5H 4DEPB 1QTYT 1JPSH 3ZYIA 1I7ZA 2MCPL 3RU8L 1P7KA 4NQTA 2HP4A 1GGCL 2UZYB 2KZ1B 1KIQA 4KUZH 2V9TA 1NUFA 1RURL 4W4OC 4MS8C 2NZ9D 1FVCA 4NUGL 3BP5A 1R3LB 4ZUVA 2GJ6B 1LDPH 2XNAA 2QBWA 1XZ0B 3MUY1 1NFDA 3GMMB 4PY8J 2ERJB 1BVKB 4PGBA 1S7VA 1K8IA 1BVLA 1I7TB 2VERN 4Q0XH 4HG4K 3UTTA 3TA3C 4QOKE 4XGZB 1ETZA 3HZVB 5GGQL 3NIGF 4Z6AT 4RMSA 2AXFA 3RPIA 2VC2L 2HFGL 1MRCH 4WEMB 2ICEB 4KQ4L 1IC5L 4RFOL 4XWOD 4E9LA 5K9KB 4M48L 3SN6N 3ZTJG 4M43H 3F12B 2Z35A 1YN7A 3QXAB 2I9LB 3FFCB 3L5HA 5FUZH 3LHPL 3U46A 2XN9A 5CSGA 1RSFA 2PXYD 4PJCA 3HMXL 3KYOB 4ODHL 4BFBD 4KKAC 4LCWE 4P2QB 3DUSB 4Y1AA 2PCPB 2AERT 4MX7B 5INDA 2JB6B 1WWWX 1YPZF 2EYSA 1FGVH 3GMMA 4LCIL 5B4MD 2EDHA 4KKCD 1ZHKA 2Z8VC 4HFUH 5DHYA 3BMVA 3TNMB 4K8RL 3INUL 1QBMH 3VFRB 1KPRA 5SX5K 1A7QL 3SDAA 5E6YA 1Y18A 4EQ3A 5IMOB 5JW3H 1A7PH 3QIBD 1Y0LB 1RZJH 2H2PC 3PWLB 4TTGA 5B3JF 5E56A 25C8L 5DEGA 2ZUTA 1KB5L 4KKLC 3S7GA 1RAMA 4I2XA 1ACYH 2FB4L 3MLVL 1A7QH 2IEPA 3LPGA 2XQYG 1VFOA 3B5TA 1ZLSL 2Z31C 3CPLB 1A7PL 1KCSL 4YAQA 2ESVA 2CO6B 3DYPA 5E9DD 1KTDA 4APQB 1S7SA 4MD0B 3BFOA 3WIHL 4OD3L 4JM2D 4LPUA 1WIPA 3T0EC 1MCEA 3F6IA 1FVDA 4J3OC 1MJ7L 1J0JA 2OI9C 2VITB 3MLTA 3QEUA 3LZFH 2BSSB 5T1LA 3Q6GL 4X7TB 1MCOH 2X44D 2W60B 3FRPG 4HV8B 4PP2A 1S7SB 2FJGA 3D39A 3L1OL 1LP9E 2HLAB 3MA7B 4OCWH 3PQYB 1NGZA 5HVHC 4AQOA 4HUVA 3AS0A 1F4XL 5HY9A 5D2NA 3QUXC 1C1EH 1X5LA 1A4JA 1ZOXA 2BC4B 5BJTB 1DE4A 2QKIA 1I4FB 5FO9A 1VFBA 3O6ML 4XPFL 2FEDD 1EJOH 1W8NA 4M6NH 1U3HC 5EO0B 4XVTH 5HYIA 3MRJB 3RNQA 1XIWB 4XNMA 1FNHA 1EFXD 3RVVD 2EXWD 5JA8B 4MX7A 1BFOB 5INDB 5SWQB 2Q7YB 3FO1A 1T03H 3GUTB 3BIAX 5F7LB 3BGMB 1PEZA 4RFOH 3TPUA 5DEZA 3SCMB 5ITBH 3FQTA 4C56B 1MCNA 1G7PA 5IWLA 3WD5L 4POUB 3QEQB 2Z92A 2X70A 4NP4H 3QNYA 4KHXH 4MAYB 1RHHA 4MCZB 5I1KH 4KI5D 3GMNB 3GB7A 4X6CE 5C09D 4I18B 5F6IB 2WWKT 5F93C 4NFCA 2C3HA 5GSVB 4XVSH 3CVHB 5IOPA 2ZG2A 4MMZC 5J1AB 4MYWB 5CUSL 1CT8B 3JWDC 1CI5A 1MCQA 4K8RH 3BIKB 4GH7B 4ETQB 3MGOA 3LD8B 4K7PX 3AB0B 3QUKA 3HMWL 3RWFB 2GJJA 1J87A 4TNWK 5IW3A 1INDH 1U8JB 2X4UA 4JE4B 4ZYKB 4PRID 1EEQA 5HPMB 3VW3H 1NCBL 4JY5H 3GMPB 3MLVH 3VI4F 4HBQA 1IQDA 2YZ8A 4JRXD 1F97A 3MZGB 3ZTNL 5BV7B 1V05A 3MV11 2XQYK 4HT1H 1G7MB 4K3GA 3EGSB 4PS4L 5HGHB 3AY4A 3E3QE 5C0EB 3O11B 2ED9A 4MDIA 1HIML 3CX5K 1WITA 3WS3B 4JFYB 4YBLC 5L8LB 4U1SA 4WI5A 4X9HA 5LAXA 4ZD3H 2BK8A 2IG2H 3OAUL 3QZWA 5IBUG 5IFJB 4HXAH 2CMRH 2H26A 1CXFA 1EIBA 3WLBA 4XNZB 3SDCB 3PL6C 5K9QI 4FNLH 3GB7B 4PGDA 4Y16C 5JO5A 1A8JH 2RIKA 4JFEE 3T08A 3OGCB 1RJYB 3RKDD 3F7VB 4JQIL 1DQDL 1YECH 3BGAA 3VFRA 2AV7B 4KHTH 3MO1A 2B1HH 3D1MC 4WO4B 4L4TD 4F7EA 3NIFE 1AKJD 3W0WB 3O2VL 2QHLA 1DQJB 3UTSE 3MRHA 5DD3H 5I8KH 3HR5A 1QBLH 4BKLA 1LE5B 3IU3B 1QZ1A 5IQ9A 4QRRE 5FA3A 3L7EB 4R7DA 4WO4A 4XNUH 1ZAGA 2YUVA 1YN6B 2R29L 4JDTL 4XBGA 5A40E 3O3UN 1AHWA 3DWTA 3TFKC 3MRBB 5EUKB 1JGEB 4YFLI 2I9LA 5F96H 3VG9C 5JORB 1R0AH 3RP1A 1N3NB 2EYTB 2YPKA 3SPVA 2W9LA 4ODUB 4XNUL 3KYKH 5C6PB 1YNTB 5FOJA 4EBQL 1NAMH 3KS0J 2G5RA 3O4OB 4U6YA 2WAHA 1CE1L 4JCMA 2IPUK 2QQNL 4I5BB 4PV8B 2HJKB 1PLGL 2E8ZA 4AT6A 5DJ8A 1S9XA 1NC4A 1EV2E 3V7MA 4JHBA 4QRQB 4NT6B 2OJZL 1D5BB 2IALA 3DMMB 2G5BA 1B0RB 1SY6H 3R4DA 2UWEB 1QSVA 3EGSA 4M9PA 2ORBH 3U30B 3VFTB 1IAKA 3DTXA 1N6QL 2C1PA 3E6HA 4Z95L 4F7TA 2ARWA 4NQCA 3JTSA 4LKCA 5I1JL 5J06A 1IQDB 4CU6A 4DUVA 4LDOB 1B0RA 3ZL4L 1INDL 4WFGD 4P9HH 1KJ2B 3LMJL 3TCLB 3DETD 3O3EA 1C5BH 4JPKL 3V8CA 5C0AD 3LIZL 5F8QC 2AJ3A 1CYGA 1PEWA 1WBYB 4XCEA 2MQ3A 1XEDA 5IG7B 2DJUA 3GSNB 3FMGH 2FJHA 3QI9A 2VISA 4PG2C 1GYAA 1EEYA 4L3EB 2XZAH 2VDML 1I85C 1RZ7H 1DVFB 3LCYA 4M1DH 1OTTC 4LLQB 1B6UA 5KVEH 5INCA 2P44B 1IJ9A 4I0PD 4P5MA 2DMBA 5CEZE 3SDDC 5F88B 1RZ7L 3ZT7A 5D9SB 3RWHA 5ITBL 3ZKNC 3BDBA 4Y5YA 4K23L 4I3RL 3W39B 2H3NB 3C2AL 3BD4A 1WCBA 5IHBA 2GK0A 3IKCB 4YWGL 3RUGB 5JORA 4F33B 4D9RD 4PJBF 1UB6B 3HE6D 5SWSB 3VGHA 2YD5A 5ADPL 2WANA 1AGFB 2VLJB 2W65A 1O7VA 4L8SA 5CSZB 4HJGA 4JJ5B 5I8KL 2AXFB 3C8HA 1NDGA 4U6XA 4XB7A 3I3DA 5LQBL 4MNGA 5DRZB 2CK0H 3OBAA 5HHVL 4RGNB 5IVNA 1ZSDA 1JPFB 1DE4B 2VDNL 3MV7E 4LEXL 3LEYH 2H32A 3EW3B 1H3PL 1JBJA 4N0CC 1OT2A 3HMWH 5B38B 2F5AL 5J13C 1MRDH 3DVGB 2EC9T 3ARZA 2BNUA 2VXVH 3OXSB 5I1IL 5EU3A 1I7RA 4KJPC 4HF5H 1CICC 3LKRB 1CE1H 4LFHG 4LDLB 2GTWA 5MHSD 5FCUL 4WFGE 1J05A 2V2TA 2EYRA 3QPQD 2AABH 4KQ3H 3AC0A 3K74B 4KK5C 5AZEH 2C3VA 12E8H 3AY4C 5KSBB 1OGAB 2VXTH 4KJQD 1UB5A 4ZFFB 4BQ9A 4L8CB 1VACB 4F2MA 1WBYA 1DZBA 2PYFB 2BDNH 4MAUL 2G2RB 3K7UA 5ECJE 1IEBA 1MAKA 4AK1A 3BKYL 4OD3H 4TRPH 4JZNA 4NO2A 1NBZA 1U3ZA 3N06B 3RWEA 2UY7A 2CQVA 1I1AC 5AYQA 3HFMH 5E5RB 5L2KD 1PGRB 3QAZC 4HWEH 1KCVH 1T1WA 3QULB 5EIIA 2V5YA 3G6JF 4DFHA 3VFTA 4KK6D 1QLEH 5E8OA 4PJFB 4H25A 4OF6A 5C0AA 2CLVA 5J1SC 1D5ZA 3WN5B 5HDQH 3HAEB 4Y88A 1XAUA 5BVPH 5IJVA 2YPVH 3HE6A 1QVOB 5HGAB 5IOPB 3P0YL 1DBJH 3LQZB 3O41B 1J8HD 4OCXH 4F7CA 4NHCL 1R6VA 3BWAA 4O51A 1DUYA 4HIJB 3QUML 3WFHB 3EOTL 3QJFB 4WWID 3Q1SH 1AHWC 1R0AL 1LGVA 2CJUL 1XF4A 3I6KB 4W81A 4R97C 5TPWL 3DGCR 2P8PB 3IGAA 3O81A 2VDLL 4YGVA 2FO4A 3X3FL 4JJHA 3FO1B 1CIUA 3OKEB 4LVEA 6CGTA 2VABA 6FABL 4OFPA 5FM8A 4BFIB 1PLGH 3MUGB 4N8PA 5FECA 2O26U 2VZ3A 4WTZA 1IVLA 5I8CA 5TGBA 4ZFOA 4XVUC 5GS1A 1KUMA 1KEGL 1T0NA 2KQMA 3IXTB 1K4CB 3H7BB 3QB7C 5GISL 3UJIL 4ZS7H 1KJ2L 1KTKE 5CUSH 3IAPA 3BKCH 5E2JA 3MV7B 1IBGH 1CXIA 2Y4SA 5C0CE 3GSRB 2XY2A 2C4FU 3KPSB 1NH6A 3G6JB 3MV8A 5TH2B 3OTTA 3MRGA 1A3RH 4P59H 3V5DA 1WICA 3TJHD 4UOW0 5MEOB 4X5LA 1IGIL 3RWFA 3G5XA 3P77B 1CDJA 2YD3A 2ATKB 4A6YL 3L3HB 3FO9A 4F58L 3BIKA 1KLUB 2VXTL 3SKOB 2AKRA 3D2UD 4WUUE 3B2VH 4X7CC 5KJRH 4P4RB 1J0HA 3P73B 3LKQB 4QXTA 3EYQD 4IDLA 5B8CB 3V7AE 1YC8A 3GKWH 4OCMC 4BSVA 4JREC 5KZCB 4JRYA 4HD9A 3WHXB 4HSQA 5I18H 3QP3A 4F7MB 1OAUL 5C09E 1KT2B 4DZ8A 3BYTA 4LLYA 3RTQA 3L7FA 1FFRA 1INQB 4NO3A 5BRZD 2Z91A 3RVVC 2IPTL 3SJVE 4BUHA 4W4NA 3S98A 1OGTB 4XHQA 3FFCA 3CFCH 4NC1E 1BIIB 3QXAA 3MXWH 1CFSB 3H9SB 1UACL 4PJXE 3EDDA 3DX7B 4QTIH 1ERNA 5A1AA 4OGXL 4POZC 3OKNA 3SGEH 5BQ7A 3MJ8B 1XGUB 5I1CH 3BRDA 2Q87A 3ARBB 1DBJL 4L8DA 1KCUL 4K7PH 2DICA 3DUSA 4Y1AB 3OAZK 5LQBH 2GITB 4YO0A 1GGYA 1NMAL 2OTWA 4HC1A 1KJ3L 3LDBB 5FHAL 2VB5A 3VXUD 2CLVB 1G7QA 2EDFA 1K4DB 1VPOL 1Y6NR 5SWZB 1J1XH 4LEOB 2N4IA 3GSQA 1NSNL 5IEKA 4KDTC 2AJYL 5EZJB 3VD4A 4YHPA 3FT3A 4S1RH 3QT2A 2IFFH 4R2GB 1OSZB 4JRWA 2HKFL 3RPIB 3KPLB 5MP6L 4IRSB 1U3YA 1T89C 2OR8A 4XGZA 1EAJA 1JPGA 3ZKQD 5EO0A 1H3TA 4U2ZA 1MVUA 3FFDB 4MJ5A 4WW1A 3QNZB 1N5AA 4TUJA 5KSUA 4BZ1L 1NMBH 3CDCA 3DX9B 2UZIL 1WFNA 5MENE 4KWUA 5IFAH 5D2NC 2FIKB 4WU7A 3M45A 1J10A 3VFUA 3S96A 1PKQB 4LGRB 4X0KB 5IMLA 4MS8D 4LOUC 4ISVB 1OWWA 4HFWA 3DPBA 4JEGB 3A6BL 1IGTA 1YA5A 4FHBD 4QEGA 1WTGT 2YN3A 1QSFD 5LGKA 4PJAA 4ELKB 5HVHB 4G8EB 2BZDA 3BH8A 1G7IA 1P4IH 3DRTB 2Q8BL 5J13B 1I8LC 3H7BA 5J0BA 5DVLA 5IW6B 4P2OD 4EZMA 1FP5A 2I27N 5ALCH 1F3DJ 1BBDH 3MLRL 1YYLH 1K9TA 3KJ4B 4XXDA 3TNNA 3VXUA 4RMQA 4MA8L 4HMDA 1RIHH 2FX7L 1XR8B 4N0FB 5IHLB 3QHTC 4C55A 1HSAB 3S4SA 2B0SL 3MNVB 1NMCB 1BBDL 3IDYB 3MBXL 3MLRH 3D69B 2YN5A 1S78C 2XZAL 5IUSA 5I16A 4ORGA 1JPTL 4ZSOB 4MSWA 3VI3E 2BY2A 2IMNA 1TJGL 4PJDA 4WV1B 4OD2B 3SEPA 3LEXB 3LQMA 3DX7A 2VZUA 5DTFB 5C0ND 1AD0A 4TOYL 1ND0A 2WNGA 3QEGL 3OKDB 3VXTB 4WW2B 2ATKA 4RGNC 5MENB 4K94H 1BGXH 3LVEA 2OTWB 1SY6A 3VWJA 3IVKB 1M7DA 4FZEH 3D18A 3MGTB 4CKVX 3B2UC 4X6DE 1JTOA 3KGRA 4XMLH 4ZPVA 2DOCA 3VGDA 1T80A 2J3SA 1RIVL 2R39A 4LSPH 5DGQA 3X14B 3O8XA 1MWAL 4LQFH 1KCUH 4K7PL 3STLA 1AP2B 3OG6B 3RGVB 2H9GA 1QFWL 5L0QC 2P49B 1R3JB 1JRHL 4P9MH 3VXOA 4PJXF 2A83A 1D5XB 2ZPKH 5CIPB 2Z31B 2BVYA 3GSOB 4TPRH 4YHOH 1ZS8B 1AO7A 4P2CG 2H8PB 1ZTXH 4RGMC 1VFBB 1I4FA 3T77B 1GXEA 5T5NF 5I15L 1DBAL 1NSNH 1JMXA 4X4ZA 3UYOD 4NNPH 3BP4A 3GMLA 1FFNA 1MAJA 2WWKO 4M7JL 1S7VB 5FGBA 2IFFL 3G5YB 2EICA 5FYKE 4U1LA 5FYKU 2AV1B 3MRNA 3PWPD 4AEHL 1T22A 4PG9B 4M1CD 1YEKH 2XXCB 4XP9H 2YBRA 1V7MH 4RA0C 1FGNL 3NIDF 3QEUB 4GLRI 2AW2A 2R2BA 4AM0B 5E2WL 1GIGL 3KLAA 5JHDE 2OR7A 3BDXA 1GCFA 1L9MA 1J05B 5C8JB 2VXQH 3VXSA 3EJYD 4AEHH 3FT2B 5DJCB 1CL7H 4JN2B 4KJPD 3I6GA 2W92A 5IK3B 3MRGB 4G7YL 5C0FA 1GIGH 5DHXB 5C2BH 2ZKHL 4OD1L 3OQ3B 3CXHJ 3FO0L 2D7QA 5D1XB 4BSWB 4KROC 1P4IL 1U95A 2XTJE 1JV5B 1KG0A 3ARYA 1F00I 2KBGA 2XKNB 3RVTC 4YGVB 3KVQA 2C1OA 3VFMA 2MOVA 2FGWH 1VADB 2DBLH 3MXWL 3UAJC 5JW4R 2L0DA 3FRUA 4G42A 2ERJC 1QRNA 1T1WB 3QULA 4YHLH 2BFVH 5FAAA 1AD9B 4OIAA 1WWCA 4JKPL 5EC2B 1ZLUH 4K8RD 3QDJA 4P46B 3MCLH 2PW2A 2P5WB 3ZMRA 3OHXB 1URLA 3LKSB 4YZFF 4Z78B 3HR5B 3TT3L 2FGWL 1Z5LB 3MRHB 1CDBA 3FZUD 3T0WA 1ZLWH 4N68A 4URTB 1KSRA 5GGSA 1MUJB 2FH8A 1I8LA 3ZLQC 4I77H 3JUYA 4MWFA 2ICWB 1L7TH 3VG9B 2P8MB 2WBWB 1D5ZB 3UO1H 2HVJB 3T0AA 1CVRA 3AS2A 1JFQH 4PRBB 3AU1B 1CGUA 3O9WB 1ZT4A 3OJMB 2R0WH 5MEPB 1DUYB 4DW2L 1IGML 4M00A 5H35A 2BVUA 3K4AA 1SJHB 4JFFD 1C5DB 2J5LC 3LSOA 4HQQL 2H26B 5JXAL 2LQRA 3SGKA 2NTFA 1LEGA 5MEPA 1G6RA 3QXDB 3U0WH 3EYOA 2IQAB 3A6CL 3IAQA 3ULVD 1NBVL 3V7AG 1IL1B 4QYOB 3SKNB 4GS7B 2Y07H 2IBZY 4P48A 3DV4A 3BPCB 3JV6A 5GS0H 1I1CA 4IRJB 4UTAH 5E2UH 5GXBB 4NN7C 4CVXA 2NXYD 2B1AL 2CIIA 2Y07L 2KDGA 3MLUL 1HWHB 3VD9A 4U1HB 5I30H 4YBHA 1V3KA 2LABA 2W59A 3IFNH 4JG0L 4OFYD 2VLRD 2ESVE 3MRCB 1HHGA 3QHZH 1J0ZA 1IFHL 1FL3A 4MQ7A 4M8QA 4GAFB 3MRMA 4JHWL 4Y5VB 5GRZA 2Y72A 3C9NA 5T1KA 4PB9L 5E1AB 4ZNEE 4UT6L 2I9TA 4U6YB 1T6WA 1HKFA 2MFNA 2Z4QA 4R26L 5HI3D 3U7YH 2RCSL 4X7DC 3D39E 5TQ2H 4DN3L 4LLAA 1CLOL 5FYLE 1BEYL 1T1XB 5CGYC 2HTKD 3QCTH 3SE4A 1T66C 4XCNA 4QKXB 1L9NA 4TULH 1OTSC 2XZCH 5EDXA 4Y4KD 4BSWA 4DUWA 3UC0H 4OZIE 3NCFB 5D2LF 2AAVA 5JNYB 3MRIA 1CF8H 2MCG1 4EN3B 2ITCB 3WCYA 5T3XH 2NY2C 4NWTL 2X4QA 5EFIA 1QFWM 3TCLA 4OLZL 4O5LL 4L8SB 1JGDB 5HYEA 1UWEH 4EI5B 2DLHA 2BNRA 2HAZA 4ONHB 4ZODA 2NY6B 2D03H 2YWZA 1MRFL 2BNQB 5D1QA 1EFXA 5T3XL 1KEMH 3OGCA 3TYGL 4TTDC 3CXDL 5E00B 2W91A 5CZVL 4NM4H 1A6UL 1U95B 1DBMH 4BQCA 32C2B 4HS6B 5HYJE 3TO4A 3TZVB 3C5ZD 4YX2H 3O3DB 4P5TD 3ECBB 4HX1B 5DJ8B 2HLFD 1I1AB 3G08A 2R0ZL 4M5ZL 2BX5A 4N1CA 1RK1B 4XNXH 7FABH 3BZEA 1N59A 4TVPE 4RAHA 4OQTH 4X7SH 4CVZB 1ORQB 3L6FB 3WS6A 2W60A 4OCNC 3S88L 1SJHA 1AXTL 3CU1A 2IWGA 3MNZB 1BOGB 4OZFB 1MFEL 3QO1A 4X80L 3B5GA 3HNTL 1FGNH 2ZCHL 2Z31A 4X4ME 3HE7D 1OP3K 4R4FL 1LNUA 5EOTA 3OR6B 1JWUB 1PX3A 1DUZA 2BSRA 1T5WA 1CD1A 4WWKA 1XGTA 4G8FB 2EDRA 2G75A 3RAJH 4X80H 5C08B 2P8LB 4HIEA 1YQ2A 3HZMB 3OSKA 4QOKA 5IFAL 1B4JH 1FZKA 3QBTB 3VE0B 5CEXB 3T3PF 1T21B 1VB9A 5HHQB 3TLRA 3VWKB 2QV2A 1OP3H 3RKDC 1BJMA 4PJIF 1R3HA 3D25B 3TC9A 1G7JA 1DL7H 3SDDD 3TO2A 3MO1B 1JF6A 4IJ3B 3V4PH 1MCSA 2J88H 1SM3L 2FNBA 4YUEL 4PJ7F 3NCCB 3HPLA 2X9YA 3V0VB 4CMHB 2H2PD 4GAJL 3ARVA 5DHYB 4G8EA 4OGYH 3CFIC 4JZJA 4YDJB 1YEDA 2BP3A 1S9KC 1E6JL 4PJ5D 5HYSB 1J12A 3MV9E 1B3JA 4R26H 4GRMA 2X1OA 3QNYB 4PP1D 4U0RB 4IRSC 4UINL 2DF3A 3ZKXB 1FDLL 4JFHE 4JFDE 4K71C 5ESQA 2RBLA 1BM3H 5EWIH 2CUHA 3WFCH 5C71A 2OS7A 5ID1A 1N3NA 4P2OC 1JHLH 4KRPD 5FV2A 1R5IA 4LHQB 3DROB 3HLAA 1FL5B 5IVZB 2VSDA 2V5TA 2HT4C 3BEWA 4GOSA 4A6YA 2EH7H 4P5KB 3SE9H 4TOYH 3IRZA 4YXLH 4HQQH 4KK9C 2A77L 2FECL 4M4PA 5E8PA 1H5BB 4FA8A 4YXKH 2P1YA 4DWHA 4I4WB 4IRZH 3UDWA 2JJVA 3EYSL 4F7EB 2R1WB 3WIFB 5JMOC 1EMTL 4IS6B 3ULSB 1AFVL 1AR1C 2XWJB 3QDGA 4MJ2A 5D7LE 5EU5A 1KEML 5B8CC 4NM8L 4PRDA 5F21B 4WJ5B 2X9WA 3BDYH 1QFWH 3MRLB 5IIEB 1IAOA 2JJSA 5HHOD 2BNQE 1V3MA 5LCVL 4TSBH 1J0YA 3DO3A 2QR0B 4M9OA 3ARGA 1AP2A 1QSED 4MLSA 1KC5L 3PV6B 5J1TC 3T04D 2EDDA 4Q9BA 4S1SL 5I19H 2GT9A 5DFTA 2AVGA 1KCKA 1HZHL 1HI6A 3FHAA 1Q1JL 1AQKL 4J3XA 3THMH 4BK4A 4FTVE 1QPXA 2IADB 3FN0L 3WDJA 3V0AC 3LOWA 4P5TC 4R90H 1OY3B 4GXVL 4HS8L 3MMEB 1RMFH 4ZUWA 3V52H 2APWA 4YK4C 5A3ID 4X9FA 3VGAB 1DQQA 1T83C 4JZJB 5E2WH 3WHXA 3O0RL 5FYJD 4JRYB 1U8IB 2J8OA 3PHQA 1FC2D 5F1SA 2E7LC 2E5EA 4FQLH 4M6MH 5F7YC 2QQKH 3UYPA 3OKOB 4YDLC 2X40A 3QRGL 3DGGB 3HR6A 4ODTL 1NLBH 3ZDZF 3QIUA 5HHXH 1FRGL 4QOKB 2NY1B 5FF6A 2J6EL 5DUBB 4F8QA 1AR2A 4JFZL 4X6CA 1MH5A 4NZUH 3RY6A 3CFKA 3U82B 5BMFL 2QHRL 3WNMA 2IANA 5FA4B 4KZEL 4R96A 3RTQC 4NN5B 1Z9OA 5E7BA 1XF3B 2OL3L 2HG5A 2P43B 1TVHB 1BM3L 3CH1A 5EWIL 3WFCL 3TYGH 4XAKD 4LBEB 1I9JH 1I9IH 3C60A 4Y5XA 3JV5A 3QUYD 3HC3H 3TT3H 2DI8A 4C4KO 2CRMA 2NY4D 4O58H 4QT5A 3RWDA 5EO1A 5CGTA 3K1KC 5SV4A 1A1MB 2Q86B 2DDQL 3LS4H 4PLOB 4IJ3C 5FECB 4KI5F 1C08A 4Y16B 5E8EB 5DJ6A 1QPPA 4FQIL 3HC3L 4NQXB 5IB4B 4OV5B 1NGZB 3FZUC 3T0BA 4OM1L 2W9EL 4N0RA 2F8VA 3SO3B 4AIZB 4R9HA 5TQ0L 2DYPA 1Y18B 5IMOA 4WFEE 5AZ2L 5ICXB 1KB9K 2VITA 3MLTB 3TBWA 3IDMA 1EEZB 3PJSB 4D3CL 3B9AA 4MD4B 3VDBA 5TDPB 1KB5B 2NY6C 4GXUM 4PRHE 5ABDE 3U4EB 1NGQL 4NNYB 5K59F 1F8TL 2VRAA 2ZCLL 2VABB 4WHDA 3W2DL 1SVZA 3ROOB 3V6ZA 1T7ZA 1JZ8A 5E70A 2ZUVA 3O6LL 2WUBL 5T1DH 1E4KA 1EO8H 4AIOA 4KMLB 1Z3GH 3DSFH 2XN9B 3HZYA 1H0DA 3SE3A 3VFOB 5ILTH 3QQ9C 3QYCA 4UIKH 3V4PL 1QACA 3CDGB 1A64A 3PXJA 1K4CA 1A7NL 1HYSD 1IKNC 2JJUA 1CIDA 2WUBH 2IH1A 3K8LA 3MA9H 1M6OA 3VG0H 1FAIL 1UM5H 2R4SL 3CFJB 3M8OH 4GBXD 1F4WL 4F9LA 3P4NA 4KUCD 4Y4HB 4M4RA 1CLCA 4BFIA 1T21A 4YBQD 4DAGL 3ZO0A 1ZA6B 2GAZA 3T0VA 3BWUC 3MA9L 3SDXF 4QHKJ 4PJ9B 5ADOH 5KSBF 1HNFA 1FH5L 3U7WL 5HYQA 1HXYB 4D0BA 3PIQA 2I25N 1WGOA 4UDTB 3RU8H 3QCVH 4OLUH 5DD1H 1ACZA 3ULVL 3RWEB 2MKWA 2R69L 3IDGB 5IVXA 1P7KB 5EH1A 3UMTA 1X5AA 3TZVC 3RIAF 2CUIA 1JWMB 5DMYA 2NLJB 3UTTB 2BNUB 1T03L 1MFAL 1YEHL 3HMXA 3B8YA 2NQCA 3IDYC 4UT7L 1JRHI 1YEGL 1UWXK 3OR7A 4UILL 3WNKA 1NMCC 1XZ0A 3ILPB 5IB1A 4L29B 1HI6B 3EYVA 5HDBF 2QSVA 4UU9B 3ZDXE 4H1LA 5EIIB 1RULL 1MFAH 1U92A 1YEHH 2IBGA 5BV7L 4ZNCD 3HPJB 1OTTD 3T4AB 3WKMH 2N1KA 5EORH 5EBGA 4WVRA 5TFSL 1NEZA 1U8OB 3QUZA 4TVPD 5BOZG 4OTXH 2Q8AH 3L3KB 2WZPD 1UM6H 4FP8H 3U7AA 2DQFB 4WHYH 5ANMA 4DQOH 2G2RA 2OMBA 4ZFZB 5C0BE 3L5WB 32C2A 4M1GH 3SDDA 1DVFC 1E6OL 1KJVB 4OGZA 5J7CC 4OIBA 4LGPB 3V0WL 1NC2A 4RMUA 4OLXL 5GRYA 3MTRA 5FB8A 4HKJA 4LCIH 1EZVY 2D9CA 3MLXL 4H26B 1VKXA 3VH8A 2ZUQC 4G6FB 3KNBB 1QBML 4EIGB 3I3BA 3QDJD 4LRNL 4U6TA 2HFEA 2VDKH 3QWRA 1T0MB 1TJIH 4U1GC 1FPTH 4RFNC 3QFJA 3SDAD 3MLXH 4MNHB 2DIBA 1OW0C 5IVZA 4EOWL 2H3NA 5T1MA 1ACYL 3PWPA 5D5MF 1Z2KA 3HI6H 1G9MC 1U36A 1LD9B 2HKHL 1F3JA 1T66D 1H3XA 3VWKA 4OIIL 4ZD3L 5HHQA 1H9VA 5I75B 4P5MB 4XI5C 1FL6A 2GKIA 2V2WA 4WFED 4OI9A 1NANI 4HAFA 2EDWA 4JR9H 5D2LA 5FKAB 3BXNB 5EU6D 2CLZB 3WFDH 3HG1A 4JZNB 3BIBX 5IROA 1ZT7B 4Z7VE 5IB5A 5F9WB 5EC1B 4OUOA 5I74C 2VLLA 2YBRB 3BX7C 2VDOH 4LMQE 3NH7H 4KHTL 3QO1B 2PYFA 4AYFA 3MCKA 2A0LC 4W68A 4ZSOE 4TTDD 1F4XH 1JHTA 4M62L 4MJ6B 1IGJA 4FQIH 2F54D 4XAKE 2FX8L 2FATL 3S5LG 5CJQL 5F9WC 2DLFL 4KKBD 4ZUTA 4HH9B 4H1LG 2P42B 4LCWA 4NJAH 3ARPA 4TSAL 1OP5H 4CJ0A 3RVWD 4IIQC 3GSNA 4R7NA 4L4VE 2ATPB 5EB9A 1FFOA 1P84J 5FA3B 1GGIH 4KK9D 2ZCLH 5E0QA 5DJ6B 1NEZG 1F13A 3MGTA 5L88L 4PJBB 4GXUN 4Z18A 3GMRB 4PB0H 5AAMA 1H8OA 4FQPA 1DTUA 4Z78A 1D9KB 1E4XL 4HUUA 4KH2A 1WFOA 4U6XB 2NXZD 4XP6L 5C07D 4I48B 3U6RB 5D8JL 3IS1X 4JY4B 5FYJE 3JWNC 1CGWA 4ZO7A 5ELIA 2Y36H 5IHZA 1WJ3A 1MHEB 3I6KA 5IB5B 1UZ8B 3DXAA 4J6RL 1BD2A 4UDUA 3V9FA 4R4ND 4X6DA 3JVGC 1NC4B 2IANB 4GRWF 2I07A 1JYWA 4E42B 2NY0B 1JPST 2NNAA 3DUUA 3UYRH 1YEJH 1MJ7H 2I9TB 1A6VL 5GSRA 3ULUD 5K9OB 4LCYB 1XMWA 1PY4A 3VRLF 1HHKB 1LDSA 3F6LA 2CPCA 3W9DA 1J88A 1MCCA 4X5XB 2H6PA 4PTUB 3KPRE 3KJ4C 3BKML 4GMTH 3NZHH 3OL2A 3I2CH 3HI6L 1HHJB 1OAXH 2XTJD 2R69H 5IHZB 3H0TA 3B2UD 5LBSL 2BHYA 1TETH 5C08E 1V3LA 4PG9A 2VO5A 4ELMF 2MPAL 3AAZA 2EXWC 5LGHH 1I3GL 2EIEA 5D1ZB 2DQIL 1GGCH 5GGTH 3KPRD 3VGBA 2E6QA 3BP4B 5C8JA 4JO2L 2IG2L 5D1QD 2IAMA 4MD4A 5I6XB 2R8SH 4G80A 1S7TA 5D93B 5FUZL 4NUGH 2YD6A 4GT7A 4WI8A 3B9KD 4FNLL 2D31A 1HH9A 5FM5O 4WU5A 3FN9A 5C9JA 5ADPH 2DN7A 4LCWB 5IJKA 5C0JB 3MRRA 5I1DA 4M3JA 4TUOB 2CLRB 1FSKC 5EZOH 2B1HL 4P3WA 3L9RB 3V2AR 4OCRL 2CK0L 4G8GD 2X42A 1FFOB 4PR5B 4RWYL 4NJAL 4FFWD 1L6ZA 2WM0A 4LEXH 1WC7A 3DRQA 4CBPA 3MCKB 1QBAA 5GRXG 3WDIA 1IAIH 3MRKB 5D71L 3O45B 4PGZA 1TZGL 4JB9H 3GSUB 3L9RA 4OCRH 3U2SB 3BUTA 1WT5A 3HMXH 2VJXA 2J4WH 5DTFA 2R2HB 4QHLA 4POZD 1DQMH 3MJ8A 3M1BB 4KZDH 3WJLC 5T33H 3MRJA 3UPRB 4Y5XC 5DUBA 1BIIA 5CD5C 4A6YB 4UMGA 5JOPD 3VXMD 4MB4A 3MNVA 2NX5D 3S4SB 1HXYA 5HYFA 1MCRA 3WJJA 1UKSA 3U4AA 3LQAC 3KJ6L 5DJZB 2EEBA 3S97C 1PKQE 2H6PB 2OZ4L 2EDTA 4CNIB 4UNUA 3BQUB 2D7NA 3FFCE 1UKTA 3D9AH 5D9SA 1KULA 2P46B 1Z3GL 4D9LL 2YXMA 1ADQH 4U2YA 4NUJA 2OCFD 3PQYA 3HC0A 2O5XH 2NXZC 1MIEH 4XAWL 1YEDB 4RAVB 2DTSA 1M6OB 1HEZA 1HHJA 4X6CF 1YEEL 5EZLB 5IFJA 2JTDA 4KAQH 1UWGH 3V95A 1F4WH 3R06A 4J3UA 1I1FB 4QRPB 1W2KT 3L3HA 3LMJH 5EU6E 3CH8A 1CLZL 3MRPA 1C5BL 4NBXB 4JM4H 4D0DB 5IW6A 4WGVB 3DETC 1A7OL 4XC3H 2BRQA 1ZLUK 2OTUB 2DRUA 3MROB 3PDDA 4O2EB 1CTNA 4XTRC 3KPSA 3LN5A 2K1MA 1C7SA 4UDUB 4N1HB 1P1ZA 4NHCH 1K2DA 4PRPB 2WWMD 1BBJA 3GMPA 4KMTH 4ESKA 4IRJC 2B39A 1PKQA 2C26A 1F11A 3RVXD 5FB8B 5KVEL 5EUOB 2AI0H 4HK0B 2R8SL 3GSQB 4PJCF 3K81A 3QDGB 4JDVA 4PRAA 4YPJA 5FOBA 4IS6A 4JPIA 1S9VB 4NN6C 3UP1A 4N5ED 5IW1B 4MHHI 1VESA 4M48H 4NO0D 1RK1A 4NRXA 4HZAA 5C0GB 3WEXB 3LRGA 3MLZL 3OKKA 3GK8L 5D72L 5KVDL 2OMNA 5J1AA 1HK6A 3BZDA 1CFTB 2GW5A 3CX2A 4OAWB 3D18B 3W82A 1BVZA 5FYLD 5GQBA 1I8KA 2AJSL 5JPNB 4H1LB 2BSTA 4UNVA 5H35B 3EO9L 2X89D 4OTXL 2NY7H 2E9WA 2QQNH 3I50H 4LAQH 4DTGL 1RU9L 1G7QB 2CKBA 2YD4A 5BS0D 1F11B 2NY3C 3U0PB 4ZPTB 3TVMB 1A7RL 5HI4C 5TE6L 1YZZA 3CGTA 1JZ2A 3MBED 2ESVB 3ULVF 3IJHB 4JKWA 5HHVH 2R2EA 1IGJB 3IJSB 4TQEL 2NY7L 4PRNA 4RAUB 5CIPH 4FFVC 4JPVL 5A2LH 3DMMC 2YWYA 5I1JH 3HRZA 2QQLL 1MPAL 4OKDA 3TWCH 1T1YB 1TXKA 3KWWA 1IGIH 1IAIM 5E6IB 1IT9L 4NGHH 4YXHH 4PJGA 3T8XA 1K3ZA 4HPYH 4OT1L 5F7MC 4JPKH 5IMKA 1I1FA 3B2VL 3RJQB 4F3FB 4X6FB 3TN0B 3R06B 2EDXA 4NQVA 1KGCD 5BVJB 1QO3B 3BH9A 1JVKA 1IT9H 4KRPC 4WCYL 2JB5L 5GJTH 5BRZE 3NA9H 2NY2D 3D69A 5I76B 3L3GA 4KK5D 4KXZH 4HXAL 5JR1H 1LK2A 4BH8B 5GS2H 3MFFB 4I13B 1BF8A 4X98B 1CXLA 1ZHLB 1AQDA 1Q9KB 4XAWH 3LZFL 3SDAC 1WK0A 1CCZA 4MAUH 4M8QB 1XGTB 4G8FA 4GKZB 3EFDH 4QXTB 4DOHB 3O4LA 5JDJA 3ETBF 5JR1L 4FXGA 2XZQL 1KTLA 4JFFE 4JR9L 2WINB 1HIMH 4WUUD 1GHFL 1H0DB 2GEEA 3GMQA 3ARUA 3MNZA 3W9EB 1DANT 4QRPE 1QLEL 1W0WB 1NAMA 4BA8A 3ARFD 3VDAA 5EBLB 4WI2A 1INEL 2XWBA 4ONFL 5E4EC 5HPOA 5J11C 4XNZC 1IAMA 3K2MC 4NCC2 2D7TL 35C8L 3VWKC 3M07A 5DEGB 3VGEA 4GRLC 4HKBB 1TZHB 2G60H 4QHNA 3HI1B 2GSIB 4OM0H 4JB9L 5C07B 2AJXH 1XF2B 2ADIA 2NXZB 4HFUL 4MA7H 5B38G 3ESUF 3GHBH 5SX4H 3CFDB 1R3IL 2WK2A 3U0TA 1OGAE 3QIBA 4J3WA 5A2KH 5L0QB 2HWZH 4XZUB 3V6OC 4QXGL 2AK4A 3CFKB 2CR6A 5D7IB 2PCPA 2JCCE 4MAYC 3BP6A 3FN3A 1IC4H 2J12B 1Q9OB 3QXUA 5HXMA 2BMKB 1N5YH 1UEMA 4YEEA 2F58L 4QRPA 5IB2B 1EK3A 1VFAB 3S3PA 4HEME 1J1PH 3BGMA 1Q9LA 2VLLB 2Z91B 2C3XA 3G5ZA 3L7FB 1S7RB 3NGBB 3MV8D 5JHDD 1NAML 2F54B 4PBWD 3W0WE 2B2XL 3IDJA 5ESVA 1XIWC 4G6KH 4M7LT 3TYFA 1V8HA 4ELMB 4HJ0D 1AI1L 4Q6IA 5GS3A 4J1UA 1SJEB 1MCOL 3EJZD 3K1DA 4OZ4A 4HIHA 1VENA 4PJHA 4JM2F 2BRRL 1WZMA 2QTEA 3GJEA 3NFPA 4G43B 3QWOA 1AGCA 5IG7A 3P0VH 4JPWH 1BD2D 4PG2A 1ORSB 3RTQD 5HDBE 2BY3A 2EIZA 4RIRB 4PTTA 1A3RL 4JFDB 4JHAL 4J2XA 3OX8B 5EU6B 1F42A 1E4XI 4Y19D 2BMKA 2GHWB 1PFCA 4DZBA 1EUTA 2XKUA 3S35H 3QUYC 1PBYA 3GRWA 1G6RH 1FJ1B 1FSKB 1DQQB 4X4XB 4YJZL 4LF3A 3ARGB 1UJ3B 3PWNB 4WWKB 2HFTA 3LPFA 4PP2B 3GMOA 3HAEG 5CJOL 3N85L 4LKCB 1UM4L 3DV4B 2X4NA 4EI5C 5ISZD 2C1PB 3EOBB 1UXSA 1FE8L 3P0YH 2VTFA 2BJML 1YEFL 1RQ5A 4HXBH 1BF2A 1VACA 3DYMA 5DO2D 4PJ7B 1UB5B 4Z8FH 5DJ2B 4Z0XA 4Y4HC 1OOAA 5E6ZA 3WIFA 4DUXA 4GG8A 1J0KA 3WL9A 2APBA 4WI6A 5IR1B 2BJMH 5D72H 2CDFB 5D6CA 4IOIA 4MXVE 1A6WH 4LLWB 4NP4L 1MF2L 1LO4L 1HH9B 5CGYD 1KELH 4HK0A 3LRSA 5I1EH 1ZWIB 1XCTB 1U91A 4HWUA 1QLRA 1JGEA 3SDYH 2BOBB 3LS5H 4KJWC 5JHLL 2ICWA 3STZA 4OM0L 3TGXA 5DVKA 1IARB 3LN4A 1A14L 5HGGS 3IF1A 5F6HI 3WXWH 4QRTA 5GGRY 3RWHB 5DMGC 4GKNB 1A1MA 2DQUH 3LKPA 2H2SC 4R4NC 2PW2B 1KJ2H 2V2XB 3TJHC 1TJHL 3DVIA 2N7BA 2WLYA 5K59E 2RFXB 1YEKL 4KRMB 3U46B 4EBQH 4PRHB 3IFOB 1TVHA 1UZ6F 1Z9SA 3CDYA 3U36A 1AGCB 3CZJA 3JWOL 2AS5M 5HD8C 3GJEB 3NFPB 1CGSL 3UTTE 5IROC 3NIDE 4R96B 3WNPA 1MJUH 1PQZA 4N1EA 5JO5B 5ISZB 1J1PL 3H8NA 4OD2A 1KB5H 4N90E 3WNNA 1OQOA 4OKVA 5JXEC 1T7XA 3ARGD 4XCYA 4CRPA 1QFOA 4NO2B 2DQGH 3GIVA 3JWOH 1JGVL 2YS4A 3S3SA 3C9NB 5T1KB 4BZ2L 4LHUG 3FQNB 1ZGLM 4LHUA 3D9AL 4NRZA 3UTZB 5HHPA 1RVFL 4JREB 3OAUH 4Y19B 2MTPA 4JFDD 5EG6C 1LP9B 4JFHD 3TN0A 1NDMA 2O5ZH 1MVFA 2IC2A 5DQDH 5D7JB 1P84K 2VISB 4OZ4B 1OP9A 1JWUA 1L0QA 3FQWA 4EDXB 4X7EC 1FORL 4PRHA 2K9UA 4PJ5E 1BOGA 2CUMA 3HUJE 4JQIH 3S35L 5DS8B 1WVZA 2WUCL 2XXMB 3ROOA 3V6ZB 1I3RB 4GUPB 3MV8B 5JIHA 4XB8A 3QUMH 1JF5A 2BVQB 2ZUUA 3DBXA 3KPNB 3TM6A 4OLWL 5TDPA 4Y2DB 1XGYH 1BAFH 3K8MA 1OARH 3H42H 5CP7A 3RY6C 2BOBA 15C8H 2C9AA 3GNMH 3T3MF 5I74B 5DRZA 4NT6A 4XC1H 4LLDB 1HE7A 1Y6KR 1N4XH 1G9NH 4JAMA 4K94C 1N59B 4JGJA 2A73B 4MNGE 5A16B 5L7XH 5E4IA 4OZGB 4PFEA 4ODXB 3SJVD 3G04A 4MAYA 4S1DC 1I8IB 3PL6B 4HG4J 3WL9B 2X7LB 2JCCB 1KTLB 2NTSP 3DI3B 2X6MA 2Z8SA 4KJQC 5DC9B 3P11L 3KLHD 2YSSB 4QO1A 3GO1H 1AHWB 3S9DB 3MOAH 2G9HB 1UWXH 1ZHLA 1UFUA 4X98A 1LQSR 4QRRD 2W07A 3WFHA 4DVBB 1EBPA 3DARA 2A6KB 2F53B 5BV7C 4WV1C 5T1LD 3KR3L 4OZGF 4YBLB 5CZXC 5F8RC 1WFTA 3NBNA 3FB8B 1CDYA 3P4LA 5HGDA 2WINA 1SQ2N 4OV6F 5KS9B 2SEBA 3PIQB 4JG0H 1UA6H 5E5MA 1LHZA 4X5XA 4OGAD 5DVMA 5EBMB 1N2RB 5GJSL 2D0FA 5D5MA 1O7SA 3O2WL 1VEMA 3BD5A 3KWWB 2WSKA 1D6VL 1SEQH 1T3FB 3TBVA 2YHGA 2B4CL 2WLZA 3EOYG 4DZ8B 2A9NH 1X6LA 2OLDA 3WFBL 1FVEB 4OCSL 4E0RA 4UIMA 2OZ4A 1LE9A 5E08L 2D0GA 3X3GL 1NEUA 1TTUA 1D5IH 4NQVB 3QI9D 1GRWA 2XOTA 1MFBL 3WLWD 1PZ5A 3WIHA 2FHFA 4F58H 1G7JB 4HXBL 3TN0D 1ZHNA 4MDIB 4AY0A 5DQDL 3D39D 3TCXA 3DX9A 3VA2C 4JRYD 4NQSA 1RZKC 4M7LL 4QTIL 3WN5C 2MHAB 2DQFA 4R0LB 3EHBC 4X99A 4O2CA 4YWGH 4IMKC 4QRSB 4PREB 3QEGH 2NTFB 4U1JA 3F7RA 3RVUC 1U9KA 4XCFL 2DQEL 5HDQL 2ESVD 2J2ZA 1DEEB 1HQ4A 4ZUSB 1J9CT 3OXSA 2YPLB 2GIYA 3QWQB 4WW2C 5C7XH 1EHXA 5CAYB 1K4DA 1KIPB 2HN7B 2KZWA 1R3JA 3MSPA 1S5HB 3RWJA 2DQEH 4MWFB 1VDGA 1HHIB 3HNVH 4HZLB 1M7IB 3GJFB 1I1AA 5C0IA 2DQUL 3UTQB 5C7XL 1FN4B 4HUWA 4NFBA 4BKLB 1C8PA 5HHOB 4JRYE 3AAZB 3GM0A 1BZQK 4JJ5A 2R29H 3IDGA 5IVXB 5CSZA 2W65B 1CFSA 4L9LC 2YUXA 2P8PA 1HKLL 2DM4A 3KXFB 4R4FH 3HG1B 2VR4A 1D6EA 4HDIA 5HDOA 4Y8DC 2Y6SC 1QHPA 4HAGA 2CGRL 2LFGA 5JDSA 3DURA 1QD0A 2GFBB 4ZS6D 1BOYA 4MNQB 3SE8H 3P4OA 4JFEA 5FGCE 2HKFH 5MP6H 3QUXA 3UPAA 1MH5B 1N5YL 3REVA 4LIQL 2DM3A 2DLEA 2XQBL 3O6FA 4YFEA 2BDNL 2WBKA 5KSAA 4K55A 2DD8L 4MA3B 3I6GB 1A9BA 1NFIA 3MUHL 2GFBA 3AM8A 1S7XB 4F8TA 5MHSE 4HV8A 4FZ8H 3KLHC 4RMWA 3QIBC 5BZWB 4Q6YA 4H1LH 2ZKHH 4EEEA 3DRTA 5FXCH 2VL5B 1UZ6E 2DD8H 5AUMB 1RIHL 2X4TB 1A9BB 1JP5A 5F3BA 2JELL 4K9EC 3U6RA 1UH2A 5J6GA 3PG2A 1U8KB 4DK3A 2B4CH 3FJTA 4X9BA 4O4YH 4M7KH 1BMGA 4YHYB 4YAQB 4X99B 1F58L 3DX6A 3GMRA 4JHAH 5FK9A 4JO4L 3GSRA 4NQSB 3AVEA 5D2LE 4JQVA 3MJ9A 3O11A 2QSQA 1ZKAA 1LO2L 3RDTD 4B50A 4M7KL 4ORZC 5L2JB 3BZ4A 5CWSB 5EZIH 5T1KD 4Z7VA 5I18L 2VQTA 3HRPA 5IHUL 2IH3B 1U8NA 5ESAB 1DEEA 4M7LH 1A5FH 4XMLL 5KAQG 4NN5C 5J4MA 2GJZB 5J11B 4KJYB 1MCIA 2Q86A 4F15B 4GAYB 3H9HA 2MHAA 1NLDL 2X70B 4EJ1C 4PJAE 5D5ME 4DOHE 4K23H 4ZFGL 2C4FT 1JI1A 3PWPE 1AKJA 2X4SA 4BH7A 1AO7B 2AEPH 4FQHB 1U3HD 4LBEA 1X7QA 5TF1L 4XWGL 5F7UA 1PZ5B 3QR2A 4G8GB 1XGRB 2YPLD 1YNKL 4WV1A 4KKLD 4F15C 5EC2A 4YFLF 1QUNA 2AEIT 5F89A 3H9SA 1XGPA 2O93L 4WW2F 4MCZA 2VAAB 4LCWD 4F9PC 4MZ3A 1AE6H 3WXWL 2KKQA 5MENA 2EDOA 4KGJA 4PLJC 5DI8A 3VXNA 3L5XH 5GHWL 3D85A 4G6MH 2RHEA 5GGSB 2FWOA 3V5HB 2R0ZH 4M5ZH 3CMGA 5DXWA 4U7MA 1HHKA 4NKIH 2F5AH 1LK3L 1ZT7A 3KPRB 1A4KA 1GZPA 2J8UE 4NO5B 3SE8L 3BVNA 3JTTA 2I26N 5JPMB 4N90D 5E94B 4GMSL 3MRFA 4X5WA 3PP3H 3OF6D 3HE7A 1MFBH 1MFDH 2OQJB 5CMAB 3IFOA 4U1SB 1TQCB 3QZWG 4AH2B 4WWKD 4OFIA 3CC5A 1OTSD 2PTTB 5L6YL 1CDHA 3D25A 3G5XB 3P77A 2GUOA 3GKZA 1RUPH 1RJLA 4WO4C 3OXRB 2P48B 1VSCA 4CW1B 4M5YH 3WFEL 3WJJC 1BD2B 5T1LB 4WTXA 1HN1A 3F58L 1FCCA 1R5WA 4H26A 5IIEA 4UU9A 3O45A 1EPFA 1I9JL 2WUCH 1TQBB 3O2DA 4HGKC 2V6HA 1CLYL 2GJ6E 1QSFE 1HDMB 2WBJC 3F58H 1HQRA 3HI5H 5IHUH 5JIIA 3ILPA 3SKMB 5IB1B 5JHDB 1I9RL 4L4TE 1VEOA 4V1DA 5DYOA 5E2TL 2BVQA 3C5ZC 1OP5K 3QNZA 4Y16A 3Q48A 1YMMD 4Q9CA 4IMLB 3PL6D 4KRLB 3LEVL 2HJLA 2IGFH 1HH6B 3I75B 3WYRA 4I0KA 3EO0A 1IRAY 5C9JB 1S8DA 3ZSSA 5E8NA 2LTQC 1P5UA 4FXGB 3C8KA 2M26A 4P2RE 3BWAB 3HB3D 2JIXB 3P4MB 1T4KB 4LASH 2J1KA 5JIKA 3QHFL 2E6JA 3I3EA 4OSUL 2BXZA 5DT1H 2DS4A 1ZLWK 3SCMA 1XH3B 3ZKXC 1WBXA 2NYYD 4Q9RL 4ZOCA 3BUYA 1ONQB 3LKNA 4RGMB 4CMMB 2B1AH 3O9WD 1NFDE 2DQDH 5FYJU 1T4KA 3U48A 3N1QC 4N0FA 4JRXE 2PNDA 4XP5L 2DLTA 1NCWL 1QSFA 3JV4B 5C0BB 3VRIB 2ADJA 3NCJH 4PRIE 3L95B 4HUMB 3UJIH 1JJUA 1X4ZA 1KBGH 2XICA 4PJDB 2DQDL 4WUKL 1KLFA 3IFPB 4ZSOA 3OB0K 1TZIA 1LK3H 1U8MA 4K7FA 4FOMA 4QHUB 4GJTB 3A67H 4FXLA 3TO4C 3C5SB 1DFBL 3MV8E 1F58H 1AQKH 3MMEA 3AMLA 3OXRA 4PRNB 2VR9A 2Y06H 4XBEH 4B5EA 2P8LA 3S96B 2F5BH 1H3VA 43C9A 4N8VB 3VFWA 1GPOH 5I1HL 4ZUVB 4LSSL 2GUOB 1BQHB 2VXQL 4QRTB 5EA0L 5EULV 3TVMA 4DKEH 1U93B 3B8SA 4P4KD 1AY1H 1MELA 3GEWB 4YHKL 4KPHH 1KCLA 3JTSB 4JKLA 4DGVH 1DBBH 5L6YH 3EOBA 4OZIB 1T5XA 5JW4N 4KGLA 1QYGH 4IDJL 1W72H 2NY2B 4BQ8A 2GTWB 3WO4C 2VXSL 5I8CB 5GRVL 3JZ7A 2VNCA 2YA1A 4LMQI 3KDMA 3CPLA 3OF6A 3B6SB 2RJMA 3MYJA 1CLOH 1KPUB 3WLWC 4ODSH 3MYZA 5DLMH 3EYVB 1IM3A 4N0UE 4YXKL 2FJFA 2E8YA 1CFQB 1MJ8H 4XCFH 3VFPB 2Y9RT 5FDWB 1I9RH 2NLJA 3Q5OA 4U1IA 1BBJB 3GGWB 4Q2ZA 2E9JA 4JO1H 4MXWH 1C5DA 1EDQA 1UCBH 2X1WL 3MUGA 2JB6A 1NMAH 1AO7D 1IZKA 3HNVL 4S1QL 4C83A 5CHNA 3J8F7 5E2VH 4XNYL 5IB2A 1DR9A 1G6VK 3M17A 1JZ5A 3TIEB 5IBTL 2WBJA 1JWMA 3NCEB 5E8NB 5FUOL 4YHIA 1I7UA 3SKUD 3TEUA 5JQ6L 3BESR 4XNMB 2R15A 2DWDB 3BXNA 5DURD 3VI4E 1GVIA 2YD9A 3JV0A 5IBTH 1V3JA 4GXVH 1MLBB 2ZUWA 5EPMB 5HGBB 4XP5H 3IDXH 3K4DA 4LSRL 4RIRA 2FEEL 3IAGC 2X05A 3IU4L 1RUKL 3HZYB 1IM9A 5T3ZE 1IGCH 1J8HE 2N7AA 1FZJA 3IDNB 3BD3A 5J9PA 1HCVA 1OGAA 2CIIB 3QFJB 4CVXB 1CD0A 3O9WC 3M1BA 4H20L 4Y4HD 1A7NH 2DKMA 2ADFL 5KTEH 3ZE2F 1DUZB 1IEBB 4U3XA 5E24E 5AUMA 4FQJL 2Z0BA 3C5JB 1ZV5A 4XCCH 3MCLL 3C8DA 2YD1A 3RQ3A 3MGOB 5DGRA 4DVRH 3QFDB 1OB1B 1QFWI 1XR9A 2RCSH 1WIOA 3FAXA 2H32B 4DN3H 4D0CA 4RFNB 2DM7A 3RHWK 3PGDB 2D3VA 1H15A 1BECA 4MNQD 1LO2H 3A6OA 5IT2L 4HCRL 4WW1B 5F7EH 4U05A 2HRPH 2CXKA 4HHAB 4NBYB 5IV2B 4QHUA 1IGMH 4PJ7E 2ZWLT 4PJGE 2VL4A 5F1NA 1IC7L 5H2BA 3W9EA 3TVMC 1XGQB 3S34L 4RSVA 4BK5A 1KTRL 4G80B 4P9HC 4C56A 3B9KA 3QH3A 4HIJA 1U58B 4QF1B 4Y5YB 4WI9A 1CG9B 4KVNL 3F65A 3IJYB 5AZ2H 2APTA 3CX5J 3TIDA 4XRCA 3CXHK 2B4CC 2FO4B 5AD0A 2VAJA 3D3VD 5JXED 4PJCB 4YHZL 3B9DA 1QEWA 3S37H 4AEEA 2VN4A 3MXVH 5F9JA 1XGRA 1XF4B 2NY4B 1WZKA 4KC3B 4G8GA 3C8KB 5E2VL 3W2DH 5A2FA 5GGUA 5GIRA 2QKIB 5FO9B 2MSPA 1LEIB 4O51B 4WUUB 5FCSH 5T5NG 5JZ7D 4X6BA 3CVIL 2IMMA 1AJ7L 1FHGA 4DQOL 2FYYA 1T20B 2YUWA 3E6FB 5I16B 4HULB 4OCYL 2UYLA 3QPXH 4FABH 4PY7A 1Z0NA 3OKKB 2WMPA 4HWBH 1FZKB 2B5IC 4P49A 3MGAA 3BRGC 2FJGB 3D39B 5CKAA 1DLHA 3VMNA 1WCQA 3V0VA 2UWEE 2GJ6A 4PLJD 3MNWA 4F37K 1T5WB 4YR6A 3U7YL 2FJHB 3QI9B 4GW4A 4NQCB 3I2CL 3RI5F 1ZVSA 1NLBL 4Q6IC 4JY6A 3PF2A 3FB5B 3QCUL 3P9LB 1P69B 4PJIE 2XTJB 5CJBA 2J6EH 4HJJL 4HWZA 3R0NA 5SWSE 2C4XA 2R1YA 1EBAA 4LSVL 4UV7L 2PYED 3MROA 1QA9A 5LGHL 2ZJSH 3PWJB 3QUKB 5KTEL 2P5EA 4HBCL 3TO4B 1E4KC 1NAKH 1EO7A 5KVGL 2QQKL 3FO2B 4R7NB 5FOBB 4MJIA 1B0GB 4N9OB 1T1ZB 1IGYA 3EYQC 3VXRB 5BS0B 1ES0B 1G84A 2JE8A 3BN3B 5CJXA 3SY0B 4AZ8A 3SGEI 3L6FA 1U3HB 4LIQE 4XBGB 1FVEA 4ZFOB 3KG5A 1JHLL 2NY5L 4QRUA 5JW4Q 4F9LC 4MQXD 4NQXA 4OV5A 3CSBA 2HRPL 4M03A 2X4OA 3NH7L 1A4KB 4I3SL 3ET9F 2UYLB 4L4TA 4LEOA 3MOBH 3RNKA 1IC7H 3MR9A 4UAOC 3HLAB 5HVGB 3JUZA 3E2HC 5I0ZA 2YSSA 4WW2A 1D9KD 1B0WA 3TBYB 1L7TL 1WCBB 2YEZA 3QG7L 5GIRB 5GGUB 1UQSA 3HHRB 1RZIB 1YN7B 5ESQB 2BNQA 3KHQA 4HLZG 1BFOA 5AG8A 3NGBC 2P5WA 5E8PB 4WHYG 1S7UB 2ZCHH 4JKKA 4HKXA 1NPUA 2HT2D 1SEBB 1X5IA 3RDTB 1AFVH 1NCDH 1EAPB 1QNZL 3VD7A 3OZ9L 1S3KH 2EH8L 4BUGA 2EXYC 2DQCL 3RAJL 3BDYL 3ZHKA 1CGVA 3DI2B 4NKOA 1H3WM 4Y2DA 1EGJL 3EUUA 5KANG 1UT9A 4XCNB 2AEQH 2HN7A 5HI5C 5DUML 3TBTA 3GI8L 3ARRA 1KN4H 1T89A 4ODXA 4HUKB 3CFEB 3FB6B 1P4LB 1Q1JH 2JJTC 4NQEA 4X83A 4TVPH 1JZ7A 1SM3H 2ADFH 1OSPL 5IMLB 3ULVC 3JV6B 4DFIA 5LJYH 1RK0A 1BZ9A 2VWEC 2W9DH 4YNYB 1DEDA 4X4YA 2JJSC 3SKNA 1BJ8A 2PO6A 2VIRB 2UWEF 1KJVA 3U4BH 3SDDB 2BVEA 43C9B 2CKNA 1A7OH 3RGHA 4GG6B 2NY4C 1J5OL 3N1GC 3G5YA 4OLYL 4K9EH 4X9GA 5DURB 3KPTA 5TDOB 3VXMB 5LWYL 2V2TB 3O3DA 4JDZA 3RX8A 3FB5A 4UT9H 4IRJA 2QLVB 2EH7L 1I7RB 5I8OH 1J5OH 5EO9A 4GW5A 1GAFH 2YMXL 3QDHA 5M7QA 4P4KA 5LBSH 4YR6B 4JQVC 2AQ2A 3K80A 5BZWA 4TULL 4KY1H 3I6LD 4NZUL 3TIEA 4W4OA 1X5JA 2YXFA 2LAGB 1ZEAL 1ZHKB 1MCPL 4ONHA 4HIXL 1GAFL 3ARFA 2I5YH 4JFOB 1BZ7B 4XX1E 4KI1A 3MLZH 2EKSA 3QEHA 3LSOB 1WZLA 1MJ8L 5KVDH 5DK2A 1N8ZA 3ARBC 3ILQD 4O5LH 3WD5H 1NDGB 1HILA 4U31A 2EDEA 5C0JA 4OI7A 3KPPA 3K4ZA 2QADC 4NZJA 1MJJB 4LPWA 1BFVL 2D03L 3ZDYE 3EO9H 1QSZA 5EC1A 5L88H 3RZCC 1YDPB 4RGND 5DD6A 1GOFA 4UZGA 2COQA 5C0RH 1MFCH 5IB3B 1UKQA 4J4PA 1MJJA 1X5GA 5J12B 5BXFB 1UC6A 1L7IH 3O4OC 1EXUA 4FQ1L 1U8LA 2FLRT 1Z5LA 4KI5E 3O41A 3V4VH 3B9VA 4LVOB 2B8OT 3NPSB 3DXAE 2XG5A 5F7DA 3HE6B 4OQTL 4X7SL 4YZFE 4EN3D 4XXDB 5DJ0B 3W5NA 5H94A 2JK5B 1DVFA 4EOWH 1U0QA 1YEJL 1XCTA 5DMIL 4U1KB 4L8BA 4KJWD 4P4KB 5T33L 2X1PA 3E0GA 1F6FB 4K71B 1VGEH 1IILE 1RUAH 2CH8A 2HLFC 4NQCE 3QQ4B 2R0KH 1T7WA 3DSFL 3MUZ1 3RHWF 1PYWB 2ICCA 4X4XA 3OB0H 4U1JB 3QQ3A 5JOFB 2ED8A 3UROR 1RZKL 4X6DF 4V2BA 4F57H 4LSVH 1NJ9B 1NKOA 1RJLB 3VE0A 4MDJA 3O3AB 5CEXA 1D7FA 2HLAA 3MA7A 2I07B 3C87A 1TJIL 1MQKL 3FT2A 3HE7C 1FRGH 4DGIH 4I9WE 1NCCH 5HVWA 5HGHA 2MPAH 5J57B 1S5IH 2EECA 1V5JA 3NFNA 3Q2CA 5C0BD 1AC0A 1YY8A 1R24B 1YQVH 1GHFH 2NMSA 4R97B 1MQKH 1NDMB 2OL3H 4RMTA 5IEHA 3JWOC 5ADOL 3OKMB 3VU2A 1HWGB 3JTTB 1ORQA 5HSFA 3L1OH 4NO5A 5AAWA 5H37H 3WIIH 3IDJB 5B21A 3QIWA 2GSGA 2H1PL 2L7UA 3RL2A 1CLZH 4KMQA 3GMLB 1NBQA 4U33A 2XN9D 3MOBL 1U8MB 2JIXD 5IM7B 3Q5TA 4TSAH 3V6OE 4QTHA 5DD5L 3ZT5A 4DGYL 3QWOB 4XPAL 5E9DE 2EDNA 3QAZB 4X6BB 2G60L 5EZOL 2W9EH 2HG5B 4NQEE 4ZQKB 1XF3A 4EKXA 3WKNA 3BHBA 2VZSA 4MNGB 3SE9L 5AWNH 3OHXA 4ONGL 3IT8D 3QJHA 4QXGH 1PDKA 4JFFB 1ZT4B 2VN7A 4JFOA 4ODWA 1SBSL 1IC4L 5HYQB 1XCQB 2ADIB 4Z0BL 1D5MB 1QR1A 2AEQL 3NZ8B 1OF2A 4OJFL 2DLIA 3S37L 4CL7A 5F88A 1U8PB 1CQYA 1SBSH 2AK4E 2X4PB 1KIUA 3S4SG 4MNHA 1S7QB 1XIWA 2CDGA 4NZRH 5ALBL 5ITFA 3V4VL 5CJ5A 2ZUSA 4PB0L 2OXGA 2ADGA 1ZANH 5E9DA 2X4RB 3SGDH 3C6LA 3BQUC 4AENB 3TFKD 3RDTC 5L2JA 3WIHH 4HKJB 4FQQA 1OAQH 5DDHB 1JHKL 4NSKA 1W8OA 1O0VA 1YEEH 2AXHA 5IVOA 2EEAA 2NY1D 4QOKD 3MJ7A 4UQ3A 3TWCL 4OLYH 4NNXA 2XA8H 5FYLL 5AEAA 4U49A 5D1ZC 1S9YA 4X6EB 5KS9F 4PRHD 5DWUH 1JPGB 4ODVH 4KDWA 4JLRB 1T7VA 3QEQE 5CZXD 3MODH 3BYYA 3VH8B 4JY6B 2CDGB 1C16A 2AJZA 2JB5H 5BVJA 4Y2OA 4Q9QH 1FE8H 3L95A 3MX0A 4P3CL 4ERSH 5C0BA 3VRIA 1LP9A 1DN0B 4M93C 5JUEL 3D6GA 2PTTA 3NZHL 1IEAA 2CIKB 2HFGH 4UV7H 4ZO6A 3ARDC 5CBEB 4RGOL 4FRWA 1TETL 4Q9QL 1NBYA 1ADQA 4PJHB 5FYJL 1Q9WA 1H5BA 3QDME 3IYLW 1RZ8A 3SE4C 4L8DB 4KZEH 1YNTA 1NCUA 4LLMA 1E27A 2OJEA 4NKMB 4HIIA 1KYOJ 4U3HA 1JGUL 4O2FA 2D0HA 4GSDL 2Z92B 1TNNA 1UM6L 1OAYL 4ZDHA 4XPAH 2DAVA 2V7HA 3P30H 1TZGH 3BPLB 3VMOA 2BSTB 4IIQB 2ZNXA 1OD9A 4U1MB 1MUJA 2LAAA 4KTDH 4M1GL 2OTPA 1FBIL 3T1FA 5IJKC 4NO0B 5C09A 4M43L 3C6SA 3LEYL 3OPZL 4N9GA 1RU9H 1YJDL 3QG7H 5HYSG 5GS0D 1FZOB 3MQIA 4DN4L 3QDGD 3QEQD 1PSKL 1UYWL 2IBBA 2BSED 3VFNB 1CN4A 2KPNA 3GHBL 2VLJE 1IQWH 5BCAA 1MPAH 1ZA3B 2EH8H 2AQ1A 4HKZA 4IOFD 1RUAL 5F1NB 3BE1L 3FO9B 5F1IA 1DQLL 2ZG3A 3RTQB 2XTLA 4Q7DA 4NRXB 1NUGA 5I71C 4WEUD 5HHNA 2BERA 3SKMA 4OZFH 2QL1A 4KRPB 4LSQH 1GZQA 3TNNB 4OZIF 3HCVB 3CFJA 4B7IA 2LU4A 4KTEH 2C7UA 4QRPD 5TE7L 1OD7A 3LKQA 2PUQT 1BQHG 4GBXB 4UIKL 1KB9J 2Q6WA 3KJ6H 4C54A 4TVPL 4N0CD 3C5JA 3WFDL 4AENA 5K9JL 1OL0A 1X6NA 4ONOA 1FORH 3ISWA 5F72S 3FFDA 1N7ML 2Y6SD 4Y4KC 2W0KA 4X5WB 1H3UA 2C7UB 5CEZL 3B4NA 2UY6A 4APQA 3LQAL 1MWAA 4F7PA 1KCRH 2DQTH 4HLJA 4MDJB 4YPGA 4JFQA 5CILL 2DM2A 3WXVL 3PGCB 2KUTA 3MJ7B 3QPQC 4UQ3B 2E9BA 3BQUD 4M6NL 1JYVA 4XP4L 1R5VA 4WU7B 1FFNB 1T20A 3E6FA 4MQXC 1UWGL 4ZTOL 1FH5H 3HG1D 5I1GL 3VWKD 5ACLA 4JM2B 3PJSA 4P46C 1KCRL 3KXFD 1OAKH 4FFWC 3CFBA 3CMOL 3CLEH 4J3VA 1AIFB 4IOSD 4X6FA 4I4WA 2DLGA 1A02N 1WWBX 3ZE0F 4WI3A 1EEUA 1ZMYA 1OAKL 3GK8H 3O8XC 2XN9E 1DSFH 5L7XL 4J12A 3X14A 2YKLH 4Z7OE 4JCLA 3O6KH 5F7KC 3ZTJH 3SGJA 1UG9A 3LV3B 3MREB 3CCHB 3IKCA 2AJSH 4RDQG 3ARFB 5DO2C 4UILH 1A2YA 3HTLX 2YA0A 3BPLC 4MVBC 5SWZD 4X7FC 3VXRD 1P6FA 5KOVC 4MGXA 3FL7A 5BS0E 2Y23A 3EFFB 4L3CA 3GO1L 4O2FB 1MF2H 4HLZH 4OFKA 3TZVD 5T3ZH 2FHBA 5DRWB 3TO4D 5IFHL 3W11C 5TFSH 5MERB 1WZ1L 3TA3A 2PYEB 2I60L 3PGFL 1MLCA 1H5BC 4BSVB 4FMFA 1YY9D 5ACZA 4P57B 2X89A 3BW9B 5HDLA 5E95B 2E3VA 1YY8B 3SCMC 1TCRB 4J3TA 4OT1H 5D1XC 2JJWA 1I8MA 4YQXH 1HHGB 4J23A 4NQCD 3BP5B 1INQA 1DLFH 1A6ZB 1YMHB 1MY5A 5IBLC 5IF0B 4Z7OF 1KT2A 4I18C 1OWRM 2FBOJ 1SEQL 2AJVL 3B6SA 3VRJA 5DS8A 4A6YH 3DX6B 4KTYA 3E8UH 1G9MH 1NKRA 3V6OA 3ZE0E 5KJRL 2HFFB 3ORJA 5E6ID 1G7HA 1F4YL 1KJMA 3WUZA 1MHHA 1B2WL 4M6AA 2AJVH 4HPYL 4P3CH 4ERSL 4JY5L 4YH6A 4U1KA 3ALXA 5D96B 2DQGL 1X44A 5D2NE 1CFNB 3MBEB 2F53E 4XPTH 4RGOH 3W9DB 2GT9B 4HC1L 3CC5B 4L9LB 4N8VA 3VFWB 4PJAF 5I8EB 1NCCL 4KAQL 1UEYA 5CSBA 2DIJA 5DJXB 3DO7B 2F53D 2NZIA 5KOMC 3D3VB 3KPOA 3DV6B 1HEZB 4LPVA 1AGDA 2DWDA 4QRRB 5CILH 1MCBA 1EXUB 1J86A 3QDMB 3SO5A 1TIUA 4XP4H 4YHIB 1CDIA 1AXSB 4S0SD 3IXTA 4QNPF 3M17B 4NC2B 5I1CL 2AXJA 1OAYH 1UB6A 4CUCA 2NXYB 1OF2B 3V4UL 4F37F 4LNRA 4PBVC 4LSUH 4XPFH 5CHNB 3AROA 3MREA 4ZUUB 5FFLA 2AJUL 4Z7WE 5HGDB 4F7CB 3REVB 2QSTA 2DWEA 5DMGD 8CGTA 4PJXA 3X12B 1FG2B 2FX8H 2VAAA 3FQUB 5D71H 2GYSA 3IXAA 3BPOB 4FFVD 3RIAK 3RDTA 1DSFL 3RNQB 4NPYB 3T0EB 4ZXBA 1QR4A 2BCKA 1CQKA 4LPYA 4PRPD 3INUH 5JW5A 1HNGA 3KXFA 1DQML 4LLUA 1NFKA 4ZDHB 1FNGA 5E8OB 4Y2DD 2C1OB 3VXRA 1W72A 1T1ZA 2AJXL 1UJTA 5CD3B 2ICWI 4KHXL 4M61B 4RQQA 2ICEA 1A1OA 5HHOA 1SY6L 4XVJL 3NPZB 4NRYB 1CFTA 2HWZL 5DUPH 1H15B 1TMCB 2B2XH 6FABH 1RFDL 5M94B 2XQBH 2I60H 3PGFH 3LY6A 3ELAT 4R3SA 3QFJD 5CEYB 1DN0A 3NABH 5D7JD 2FX9H 3UJJL 1ZT1B 4BZ2H 4Z7WA 2ID5A 5EOTB 2VE6A 4NKDB 3KR3H 3MJ6A 2VH5L 4XCEB 5DVNA 1S7TB 4HEPG 4ENED 4GQ9H 1QLFB 3BOVA 1OTUC 3BKCL 4NGHL 3CDFA 1I7ZB 4O2CB 2DQTL 5I17A 1FO0H 4N8CH 5HHME 2P47B 3VW3L 5DF0A 2HJFB 2NX5B 2HYMA 3GSXB 1KJ2A 5IF0A 2R23A 1RI8A 1J8KA 4WTZG 2GCYB 3ARFC 4XT1C 4RFEA 5IGXH 2RB8A 4HX1A 1P2CA 4OGAC 5CJOH 2VWEE 5FGRA 5GZOD 1C12B 2FLBT 2BRRH 5D1XD 3ULVE 1I8MB 1Q0XH 5C08D 3ZKMC 2DMKA 3NA9L 3PDOB 1M7XA 4LAJH 4NKOB 4ZOAA 3CLEL 3SDAB 1GJIA 5ACZB 4LCCC 4RWHA 4ZFOL 1W0VB 4YDKH 5FO8A 2UUDK 1D5IL 4HC1H 3MRBA 4HWNA 1D9KC 2QJDA 1GSMA 3RI5K 4G6FD 3C60C 3QUYA 3C2AH 1P4LA 2RQ8A 1I1YB 3NOIA 4LCYA 1FYTE 5AD0B 5JUEH 3BUYB 3BKJH 2X4QB 3VFVB 3O6KL 1PVHA 3HNSL 3X12A 1PD6A 2XV6B 3FONB 1ZHBA 3CUPB 1UM4H 2J8HA 3N0PB 1NLDH 4MNQA 4ZUUA 3PWPB 4P5TB 3DURB 3C5ZB 2YEZB 2FWOB 3ZSTA 1JGLH 3I02A 4WNQA 2OR9L 1YEFH 1U8QB 4PJCE 1YECL 2V9QA 3VGAC 2BOCA 3MJGX 2X7LA 2HH0L 1IC5H 1U91B 1LWRA 1E27B 1T1XA 4B53A 3BPNC 2NY6D 4I3RH 1B6DA 1WZ1H 5D2LB 4YDLB 2O61B 3P11H 5KSVB 1AGFA 2VQUA 1TTGA 2KL6A 3O2DL 2HVKA 2Z31D 4RMRA 1A7RH 3JSSA 3CK0L 4DEPC 4PGBB 1VADA 2PYEE 2XPGA 2KH2B 2VLJD 4F33A 3DO7A 1WBZB 5SWSD 5F44A 1KELL 4QHNB 4LQ1A 5I1EL 4MJIE 1HHIA 4HMCA 4LNRB 4TNVF 5CJXC 5GISH 1WC7B 3DRQB 3FO2A 5D1XA 5C70A 3DBXB 1A0QL 5DJAA 4Z9KB 2X4OB 1FIGL 5H2BB 3KYMA 2J8UB 4P23C 1T0MA 5JXEA 1L6XA 3VXPA 4NQDA 1U2HA 4U6HB 4KZDL 5DC4B 5DUPL 4HH9A 4MCYA 4I0PB 3T4YA 2NW2A 3MLSH 1A0QH 3WJLA 3ARQA 5E1AA 3ZTNH 1MRDL 2YUZA 4YBQC 4K7PY 1B0GA 5KG9A 1BQUA 4WFHD 4RRPA 4DZBB 4MD0A 5I1IH 5D7JA 3WFBH 3BZ4B 4Z7VB 5CWSA 4TRPL 5FV1L 4L3ED 4PJ9D 4LIQH 5B22A 2UWEA 4G6KL 1KV3A 5CEYA 4LSQL 1NGXA 5F9OH 1JMZA 3MJ9L 1RUPL 5TE7H 1JWSB 4AIXA 4RRPG 3GSNH 4I0PC 1WAAA 2VLKE 3AXLB 1P9MA 1OW0A 4J1UB 4CADA 3ROLA 2B7DT 1JCKA 4W70A 4AG4H 4NZTL 3TESA 1RVFH 3O4LE 1FL6B 4CDGC 4YFDB 3OX8A 3ULUH 4JFDA 1Q9LB 3FMGL 1HOCA 5EBMA 2VDMH 1KPVB 3JWDL 4PRPE 1QEWB 4MA8H 3HI5L 1DJSA 5EU7C 4QCIB 5DRXA 3OJDA 1L0XA 4KVCL 3EOTH 3GIVB 3BP6B 4FFYH 1QRNE 2J7LA 4LFHD 3VA6A 3BGFC