1FAKT

Human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
205
structure length
183
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGEPLYENSPEFTPYLETNLGQPTIQSFEQKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWGKKTAKTNTNEFLIDVYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BLOOD COAGULATION FACTOR VIIA)
publication title Structure of extracellular tissue factor complexed with factor VIIa inhibited with a BPTI mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 38
structure length 183
sequence length 205
ec nomenclature
pdb deposition date 1998-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fakT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fakT02
5D7IE 2OP4H 3F5WB 3MBXH 4TSCH 2I5YH 2EDTA 4WV1C 1N5YH 4WV1A 3QEQA 4JPKH 4HKJA 4LSUL 4FMKA 1G9NC 5BOZG 5FCUL 3VRLF 3HHRB 3LV3B 4DQOH 4MXQC 3HN3A 3E6FA 3L3JA 3OJ2C 4P5TD 2R1XA 4RWHA 3G5VA 3WIHA 3QG7L 4OZHA 4MDIA 2NTSP 5CWSA 2H32A 2PW2A 1CXEA 1HHHB 1NBVL 4ODSH 1N4XH 2YOCA 4N0CD 3O3BA 4YGVB 1Q9LB 4Y2DB 5DJXA 5I71B 3E6HB 5FV2A 2A6JA 5DJ6A 4H20L 5DQ9B 3WFZA 8CGTA 1AGFB 2OSLB 3RWDB 2ICCA 3TNNA 3L7EA 3FB8A 4R0LC 3LN4A 4R0LA 3BQUB 5JA8B 4QRPA 4BZYA 1I85C 2KL6A 4NT6B 1I85A 1RZJL 2R23B 4F8QA 2CR3A 4BQ9A 1UWGH 4LAJH 1NAKH 1T0PB 1U3YA 3ZZ1A 1GAFL 3STZB 3M45A 1UEYA 2E7CA 4E5XA 2Q86B 2AJVL 5C09D 1MIEL 3L95A 4QO1A 4BJLA 4GS7C 4S2SB 3JWNC 3K8KA 2MWCA 5IMLA 1T5XB 4YHML 2FEDD 1L7TL 3RQ3A 1OW0C 2WBJD 5K59E 1OW0A 1NFDF 2FJGB 3QHFH 1I8KA 3GMQA 1U8KB 3D9AH 5DDHA 3MRGA 4UINL 1HXMA 1FO0A 2VLME 4EBQH 5EOCH 2AXFA 4L1HA 1VFAA 4WW1A 1JYNA 2BRRL 1N0XH 3BH8B 1FIGH 3OKNA 3W39B 1SMOA 3U79A 3V0VA 1TCRA 1IL1B 5T5NF 2X89A 2GJ6B 3FOMB 1WFNA 3WE6B 1BFOA 4LLDB 1N59B 4JDVB 3W9EA 3WUZA 4X6FB 2ZCLH 4DVBB 3VMNA 4PJGE 5KSBE 2AK4A 5F6HI 3HA0A 4WWKB 4NN6C 2F54A 3MLXH 1A2YA 1AIFB 2CLRA 2G5RA 5JHDA 1V3KA 2QSVA 4FQPA 4NQTA 1S7QA 4L5FH 4HF5H 4XP1H 3TBTB 3TO4C 1RD6A 2B20A 3TO4A 3UTZA 2PKDA 1Z2KA 3WSQL 4EI6A 4XX1G 5IBTL 4DKDC 4Z5RB 5JDSA 1FL3B 3BZEB 1T03H 1HIML 2NY2D 1VKXA 3IETB 1RUPL 5IKCB 5IW6B 4HXAH 1K8IB 2WUBL 2H3NA 1SJHB 5J0BA 5FA4A 4BH8A 2AXJA 2Y1VA 5DUPL 2VXTH 3QPXH 4NYLA 4JFPA 4XB8A 5EORH 1KCKA 1A6WH 1S7RA 4JFFB 2OTUA 1JRHI 3GSNA 3RVVD 1AQKH 2C4FT 1MWAH 5JOPE 5JQ6H 3QG6B 5DJAB 1IARB 4ZSOE 1ITBB 4D8PB 1XR9A 3OF6D 1KPRA 4K8RD 4RA0C 5IESH 1S7WA 3K4AA 5C71A 4HWBA 1PSKL 2R56H 4L4TD 1UH4A 4LSTH 3SDDB 4XAWH 3TESA 3NFNB 5JZ7C 4YZFF 1GZQA 1HEZA 1U3HB 3GIVA 4UB0H 5DXWA 3RVXD 2OTWB 3HAEG 3BYTA 1AC0A 3FT2A 1INQB 1TZGL 2NY0D 3RIFK 4MNQD 2EH8H 3OR7B 4U6XB 2EEDA 5I73B 5D7KD 2P8PA 1HOCB 2NY4C 4QRTA 4EDWL 3ZKXB 5BS0B 1HSBA 3C09C 4Y4KB 2JIXB 3TO2B 1SJXA 1KGCE 1AR1D 1B4RA 2YSSA 2ZZUT 1NUFA 1EPFA 3IGAB 1ZHNA 2DM3A 4BQBA 5D7LB 4I9WD 4J3OC 2BHYA 2W9LA 3C8DA 4XVTL 2E8ZA 2PXYD 1MCFA 1QBLL 1YEDB 1E4WL 4C55A 1QFUH 1KG0B 4LF3B 4YBLB 3PHQB 4PJDB 3QDHA 4ZQKA 3MRDB 3SKMA 1UWXH 4QT5A 5D1QD 5BMFH 2CK0L 2ZCKL 4JHAL 3C5SB 3WS3B 5AD0A 5IM7A 1QEWB 3NA9L 4V1DA 3CJJA 4P2RA 2J5LC 5D96C 3EOTH 3T3ME 3RWJB 4JFOB 3IAQA 4NNYA 5E8DL 1GGBH 5I9QC 2Y25A 4OCYL 2J8HA 1OSPH 3ZKQD 5C6TH 5FO8B 4X5WB 3VWJC 1IT9H 3VWJA 1G7JB 5JO5B 4CADA 3Q6FB 3EAKA 3IDGA 3L3HA 4YPGA 3MV7E 4Z0BL 4U49A 1QSEB 4P23C 4RMTA 4CN6A 4K8RH 4P23A 2ED7A 2JCCA 3WS6C 1OWRM 2VDQL 4QOKA 3WS6A 2O93L 3I75B 1AXIB 4APQC 4IOIB 4APQA 5CFHA 3FO2A 1ZGLB 1ADQH 2R0LH 4JZOB 4JN2A 4JN1H 4TNVK 3ESUF 1H0DA 4YK4B 3W2DH 4P48A 1RZFH 2NY6B 3GI9L 3D18B 3ARBB 3EYFA 3F7PC 3C60B 3VFNB 3RI5K 2PO6C 3B83A 5ECJE 3VXSA 2PO6A 2R2BA 2AV7B 4UV4H 3PIQB 3P0GB 3PQYA 3GMRB 3VFWA 2DN7A 3O45A 1YPZB 4FQ1L 4RMWA 3BIKB 3ARFB 3D69A 2UWEE 2AXGA 1CU4L 5AZEL 3VGDA 4WO4D 2VLRD 2C7UA 1LE5A 4DN3H 4GSDL 3RX7A 4OB5H 4ETQB 3ALXA 4IRJC 4IRJA 3C5JA 2BSRB 2JJTA 3JV6B 4G8EA 2CQVA 3KYNB 3B8YA 3B5TA 4LU5L 1OF2B 4E41E 2VDNL 4KKAC 4M7ZC 4OLXH 3IFNH 1MF2H 3O6FB 4FQLH 2N4IA 3MMEB 5EZLA 5IBUG 4P5MB 4JHZA 4LVOC 2AEIT 5I17A 4PJFB 4ZYKA 5EZJB 3U46B 3RTQC 3EYUH 3RTQA 3OWEA 1XEDA 3BWAB 4G42A 1K3IA 2Q20A 5CSZA 1ZANL 1RUQL 3T4AA 3SGEH 3V9FA 2NTFA 2AGJH 4AZ8A 2ARJB 1XR8A 4H1LH 3MRPA 3JSSA 5EIIA 2BHUA 4H26A 3EJYC 5SWQB 1KEMH 3GNML 2NX5E 1HILB 1ZVSA 5I8CA 4DGYH 4XP5L 1NFDA 3T1WA 2NY7H 5TFSH 1KPVB 1PG7W 4RFNC 2YPKB 4EUPB 1BHGA 2LE9A 4GFTB 4GLRH 3IS1X 4GRMB 1LE9A 3QDGE 4LSRL 1C5BL 2FSEB 2V2WB 2VZTA 3QEQD 3EOYG 4P59H 1E28A 1J7VR 4EVNB 3H7LA 3WNOA 2WINA 4PJ7A 3ZDYE 4M1DL 2IQ9L 3H3BC 1CTOA 4ELKB 3DVGA 3RWIA 3BUYB 1F00I 2WWKT 1MFBL 5L0QB 4YFLI 4N5EC 4NRZA 5D1XC 5D1XA 3I2CH 2DQIL 4WFHD 4FFVD 1MHEB 4HX1B 4DKEH 1PDKA 5DC0A 3RX8A 4JO4H 4R26L 4XNMA 4P49A 2EE2A 2P49B 3E3QC 4NQDE 4P2OB 1A1OA 5D93C 4LRNL 2B2XH 5ADPH 4UU9A 1HN1A 2CUMA 1JGVL 5TF1L 4LLMB 1ZLWH 4QY8B 1MJJB 1WFTA 1DN0A 3L7FB 4OTXL 2I5YL 4TSCL 5GJTH 1OTUC 3UP1A 4LDEB 1XF2A 3V5HB 4M3KB 2EH7H 4G8FA 4OZGE 4J3VA 2C3WA 4DQOL 1SYSA 2FYYB 3TZVC 4QRPD 1L9MA 3TZVA 5MHSD 3MRBB 1XCQA 4R96B 3DXAD 1VB9A 3ABZA 4JRWA 4NO3B 1VHPA 4I0KA 4KVNL 4CGTA 2PYFB 4ODSL 4K7PY 3X17A 5DEFB 1P5VA 4ZPVA 2YZ8A 4EN3C 4OGZA 1QFPA 4EN3A 4Z8FH 1T21B 4HMEA 1GGUA 1W72A 3UJJH 3TCXA 5IW1B 4X6BB 3DX7A 1KIRB 1QLEH 5KJRL 1GZPB 4Y88A 2VLJA 1MY7A 2BNQB 5FHAL 3I6GB 3O4LB 5DZOA 3S5LA 1UWGL 1NAKL 3SQBA 1OAKL 5TJWK 4Z7UF 5GRJH 2JJVA 1JPFA 2P48B 3LOWA 4AH2A 4TSAL 1G9NH 3BPLB 4LNRB 1T20B 4DVRL 2X89D 3C8KB 1X5LA 4TPRH 1K9TA 2EYTA 1MFAH 3NN8B 3RWFA 4WI8A 2V9RA 4R4FH 1EHLH 4BH7A 3S3JA 3MRNA 5EO9B 5F8QC 2X09A 2K7PA 5F97E 1NCWL 4ZUVA 3WO4B 4PJXE 3QHFL 4DGIH 3D9AL 3PGFH 4PJAF 4OZIB 5JHDD 4OIAA 5EOCL 4NC1E 4KK8C 2JKXA 3VJ6B 1N0XL 4OGYL 3TNMB 4X99A 1J10A 1FIGL 1T1WA 3MNZA 4K94H 3TJHC 1R5IA 3DYOA 1M71A 1MNUH 1HHJA 3DI2B 3PWLB 4N5UA 4WHTB 3GZKA 3NZHH 4MGXA 4HXBH 4PS4H 5FXCH 1DUYB 5JHLL 4HEPG 4FA8A 1DEEA 4ZO7A 1A5FH 3QFJE 2ZCLL 4R3SB 4GAGH 4HK0B 3L5HA 2H45A 4WUUB 2ZUSA 3SPVB 1LILA 2FD6L 3JZ7A 1Z0MA 3Q1SH 3HCVB 1X3DA 4CDGC 4PLNC 1XAUA 1IAOA 5CJ5A 4L5FL 5JW5A 3ULSB 3MREA 4HF5L 4XP1L 3OTTA 2HG5B 3W81A 4NUJB 1TTUA 2AABH 1KIQB 4GQ9H 4X9BA 1Q1JH 9CGTA 2W0KA 2FHCA 3HI6H 3MV8A 5EZIH 5T3ZD 3GMOA 4KDWA 4JFDA 3SDXE 5DJ0B 4HXAL 4Z0XA 1R3JB 3O9WC 4X7TA 3O9WA 4ELMF 1RZ8A 1JIBA 5J9PB 1NLDH 1SQ2N 3QPXL 5I8OH 4KXZH 2YR3A 1QSVA 4FHBD 5FB8B 1BVZA 3MRRB 4OFIA 4E42B 4Q74A 4RWYH 2XQYG 3VG9B 5JQ6L 2C3HA 5B38A 2OQJB 5EU5B 1RJLA 4M61A 1SBSH 5LAXB 3CFJA 4CKVX 3V7MA 5IESL 2R56L 5JW3H 1P7KB 4PB0H 4RGOL 1OTSC 4JQVC 1P4IH 4JQVA 1TJIL 3OXRB 3H7BA 1G7LA 3V7AG 1EEUA 5D7IF 1LEGA 5HHNB 2NY5H 4ODUB 1AKJA 3HUJA 1QLFA 4Z7NE 4UB0L 1JGDB 4QEGA 2PW1B 5E6YA 2H6PB 3FRUB 3MNWA 4AT6A 2W9EH 2VJXA 4HKBA 4ZO8A 2G75B 3B9DA 1UVQA 4JQIH 5ELIA 1A9BB 5M95B 3I85A 4TULL 5ICYB 1MLBA 4NNXA 4HH9B 3KPTA 3GB7A 2DQJL 3IDIB 3F7QA 4N68A 4MD0B 4ZFZA 4V1DD 5CSGA 4P2RD 1MCBA 2XT1B 4ODXA 3CFBB 5CCKL 1MRCH 3KPPA 1N64H 2COQA 3BGAA 1TQBC 3REWA 4A2LA 4Y16D 2FIRT 4UAOB 4BFGA 3O3EA 1DZBA 1J1PH 4XPFL 4R4BA 4Y2OA 1DBKH 1T2QH 3IF1B 3NMEA 3W9DB 3DURB 3T2QA 3WHXA 4CVZB 2X4NA 4FQJH 1EGJA 4D94A 4MVBC 5EUKA 3U7WL 2RCSL 3I02B 4QOKD 5T3ZH 4S1QL 3X3FH 1JL8A 2MKLC 4KK6C 4KJQC 2V2XB 3GSOB 5JPNB 5KVEL 3EOTL 4GH7B 5D7JC 5D7JA 4U1NA 4XRCB 4D3CL 1QYGH 1KLUB 4U3CA 1GGBL 4PTUB 4B0MM 4NPYA 1FNAA 1IZJA 1I7UB 3TF7C 1IT9L 1D5IH 4Y1AA 4UIKL 1WWWX 1F3DJ 1F4XH 3M1BA 1DUZB 1AFVH 1ORQB 2WQRA 3GI8H 1J1XH 2QLVB 2VR9A 1IGML 3FQNA 4MXVF 2B5IB 5I0DA 4JG0H 2J7LA 3C9NA 2ITDA 5DJDA 4CW1B 3S97C 1Y6NR 1ADQL 2R0LL 5FA3A 4H0GA 4IM8A 1LMKA 1MLCB 4IRJD 3F7RA 4L8CA 1TITA 1NUDA 2CXKA 4X9HA 5GRXG 4OLWL 4MNQB 5KW9H 5DRZA 1RZFL 2I60L 4XVJH 1EHXA 4DK3A 1EVTC 1P7QA 4MCYB 4KKAD 1PGRB 2Q6WB 4YUEH 5TQ2L 4N0RA 1FZMA 1HSAA 1K4DA 2P8LA 1X7QB 4Z18A 5SWSE 5T33H 4MNHA 2XY1A 4Z7QF 1SY6H 5KSBF 4XWGL 2XZCH 2NY3B 2R9HC 1UCTA 3G5YA 4KROC 4WI3A 3RTQD 7FABH 2WUCL 4M03A 3SGDI 4FN0A 4JVWA 3LSOB 5FAAA 3QUYC 3QUYA 4YHOL 3U36B 4C4KT 3DRQB 4OB5L 1M6OA 1MRDH 3T4YB 3CZJA 4JAMB 3VFPB 5FGCB 4ODBD 5MENE 3FFCD 3MUGA 3FFDB 5I1KH 3KPRE 3MROB 4JFED 3VXUD 2ITCB 5DRXB 4LEOB 5D1QB 4LPUA 5TE6H 4AL8H 4D0BA 4LVHC 3IFNL 4HPYL 3TBYB 4CJ1A 4FQLL 3TYGL 1MCLA 3LD8B 1NGWA 3HG1A 3MRLB 5ETUA 3AS2A 1BGXH 4MCZA 3DMMA 3B2VL 3HPJA 2EYSB 1EZVY 1OGAA 3UPRB 1JWSB 1PKQA 3PL6C 5D5MB 3QUMA 3PL6A 1YMMD 4H1LB 4J3XA 1HI6B 1LO4L 3NFSH 2LTQB 3RUGB 5HGAB 5C0EB 1YECL 5HPMA 1K8DA 1JPST 5HJ3B 4N5ED 3LKSB 2YBRB 1YEFH 1QNZH 4Y8AA 4DGYL 2R8SL 5DD3H 2NY7L 4NN5C 1XCTA 4U6VH 1Z0NA 1DLHB 1UM5H 2CKBB 2DQUH 4O58H 2X5PA 4UT7H 4Y19B 4OCSH 2CKBL 4LCWE 2ESVB 2OXHA 4MSWA 2UY6A 1OTUD 2NQCA 5F3BB 5HGBA 4CL7A 3HI5L 2EKSB 1RQ5A 1U58B 4LPYA 5IFHH 4HUVB 5L2JA 2W1NA 3AREC 3LIZH 5DK2A 3AREA 2VL5A 4OSUH 4OV6F 5H35A 1QPXA 1JZ8A 1VADA 3C08H 2AJSL 4BSWB 3TZVD 3UMTA 3I2CL 1A3RL 2LABA 2VLRB 2XWTB 4DKEL 2VQ1B 4JO4L 4Z7VF 1N5AB 5BV7C 5EU6A 1WC7B 3QQ4B 5MEQA 2XN9E 2O5ZH 3HS0A 4G3YH 3KR3H 4GKZB 3IU4H 3K4DA 5GJTL 4ZOCA 1MCQA 1NDGB 1H3XA 2OYPA 3TBSB 2F8VA 2A0LC 2ZNXA 2QQKH 2A9NL 2VNCA 3PHOA 4MXWL 1YY9D 2C4XA 2EH7L 3CPLA 4F9LC 1FDLH 4F9LA 1I1YB 1UM6H 2F53E 1G7MA 1NQBA 2CDEA 4PGEA 3CFCH 4G6JL 3EJJX 4YE4H 2VXSH 4XCEA 1T7YA 3D2UD 1B0GB 1OQOA 3ARDD 4YX2H 4F7CA 1OSZA 3FQUA 4XH2B 7CGTA 3TEUA 4JY6B 5GGVY 2F5BL 2YC1A 2DWDB 3BP7B 2OK0H 4AYFA 3MJ9H 2Z4QB 5GISL 4WTZG 4FOMA 4CMHB 4Z8FL 2VIRB 2BXZA 4NQCA 3D6GA 3UJJL 2ZOKB 5C0RH 1DEDA 1AXSB 1NCTA 4G7VH 4C56E 1E4XH 4GUPA 2LU7A 1QLEL 2V5MA 3BESR 4KKBC 1U8PB 5D7IA 1IEAB 4MB5A 1KENH 4MJ6A 3OKKA 4WV1B 3QEQB 3CH8A 4YDVB 4UIMA 4HKJB 5HYEA 3QPQC 5F1KC 5I19L 2BZDA 2QJDA 1T1XA 1BF8A 4V2CB 2AVGA 5GRJL 3VFOB 1VACA 1QKZH 3B2UD 5DQDH 1G9NL 3P0VL 3K46A 3E6FB 4WWID 3N0PB 3O6MH 2R1XB 2AI0H 1FBIH 3G5VB 3MR9A 4L29B 4OKVA 3F62A 1MFAL 3L5JA 2Y5TA 4H88L 4OZHB 1MIML 5CWSB 4R4FL 4OQTH 1EHLL 2PW2B 3QO1A 4UT6H 3PWUA 3WIHL 2MHAA 4JKKA 4DGIL 2WWMD 3D0VA 3PGFL 3DGGA 3O3BB 1L0XA 5DJXB 2A6JB 2PCPA 5DJ6B 1U8OB 4GJTB 4XAKD 5F9AC 2CLVA 2YMXH 3WNNA 2BVPB 2E9IA 2VUOA 3MV8D 4PBWD 5KSAC 1W72H 5KSAA 5LCVH 2GY5A 3L7EB 4ZUUA 3FB8B 3IS0X 3EOBA 1HNFA 3LN4B 3MV9E 4R0LB 4F7EA 2VSDA 4QRPB 3RBGA 3GIZL 4C54A 1FC1A 3O9WD 5D4QA 2D0GA 1QO3A 4L3EE 1JPTH 3O2VL 1PKOA 4E5XB 1OP5K 3N9GL 1TJHH 4KDTC 3U7YH 4KDTA 4OJFL 1R6VA 3L95B 3N06B 4GS7B 4PGBA 3GSXA 5TGBB 1BJ1J 1YNTB 3S35X 1FZJA 5E0QA 3ZYZA 2AABL 4GQ9L 4OGAD 1Q1JL 2ZUTA 4DOHB 3MLYH 1I7RA 1A4JA 1I8KB 1MHCA 2XACC 3GMQB 5EZIL 5DDHB 4BUHA 3MRGB 4ZTPH 2VZ1A 1HXMB 1FO0B 3UO1L 2AXFB 2MCPH 1VFAB 4WW1B 5FUZH 4GAFB 4CRPA 1MI5D 3I50L 2GJZA 2J3SA 1FO0L 2Z31D 3GHBH 4QXTA 2DKSA 1AKJD 1NLDL 5J4MA 3ESVF 5I8OL 4ODVL 5HY9A 4PY7A 1B2WH 4JREB 3EYSL 1TCRB 4WJ5A 5FFLA 5CSBA 5E8PB 4WU5A 2AJ3A 1I9IL 5KOMC 3GM0A 1BFOB 1QLRA 1UXSA 3ULVE 4BK4A 3W9EB 4S10A 5KSBA 4FFYL 1SBSL 2AK4B 4IHOB 1OP3K 1UKTA 3MA7A 3RGVC 3RGVA 4NM4L 2F54B 4NN6B 5B39A 1ZVYA 5JW3L 1LK3L 4PB0L 1A2YB 1P4IL 5JHDB 2CLRB 5HYJE 2IC2A 2C5DC 1S7QB 2BVUA 4M8VA 5H8DA 2RQ8A 3VXRD 2NY5L 3PG2A 1SEQL 1X5AA 3TO4B 2P43B 1G84A 5EH1A 1CBVL 5KS9B 1I3GH 4NFDA 1E6OL 2W9EL 5GXBB 1VKXB 2F5AL 1ES0A 4JQIL 3M8OH 4MVBD 3RKDC 3RWGA 4I8DA 5DHYA 1A64A 2VN4A 1J8HD 2H3NB 4LIQH 1U6AH 3HE7C 5ICZA 5FA4B 4MQTB 1IKFH 4NYLB 5D6DC 4KK6D 5D6DA 4JFPB 3S9DB 4KJQD 1MRCL 1S7RB 5D7JD 5I1EL 2OTUB 3W0WD 3GSNB 3DECA 5JNYA 2YD2A 4ZSOA 1J1PL 3GSNL 3WL9A 1FGNH 1DBKL 1T2QL 1XR9B 1BQHA 1BREA 4WDIA 2X4OA 1KPRB 5FYJD 5EO1A 1S7WB 1BFVH 4JHBA 4WIQA 1OVZA 5EUOF 4FQJL 4L9LC 4PYGA 4L9LA 2RFXA 2AW2A 4LPVA 4JY5H 5T3ZL 1QBAA 3MOBH 3UTPD 1TDQA 1GZQB 2IPUG 1IE5A 5DC9B 3WDJA 1HEZB 2EDRA 3GIVB 5JW4M 1HQ4A 5GGSY 3FT2B 5ILTH 5I1JH 5DF0A 1AQDA 2VLKD 2M8XA 4N8CL 3V95A 1QYGL 2P8PB 4BYHA 4MD4A 2NY4B 3X12A 4QRTB 1YEKL 4GW1A 4ZS7L 1HSBB 2FJFA 1B0RA 4HWNA 3C09B 1D5IL 1LDPH 4MHHI 4U31A 3ILQC 2YSSB 1AFVL 3GI8L 3MCLH 2R9HD 1J1XL 4X6CE 4PJHE 4Z78A 4KROD 2LVCA 4JG0L 4Z7VA 3QUYD 1X4YA 1AXTH 1MFEL 3W82A 1PZ5A 1I75A 2NZIA 1OAUL 1A7NH 3FN9A 3T0XA 2R1WA 2J8UF 1TPXC 4ZQKB 2VAJA 2A6IA 3SKMB 1AJ7L 2I26N 4XVJL 3BVNA 4QT5B 3UROR 1ZA6A 3AMKA 4YUEL 1P1ZA 5AD0B 4OCMC 5IM7B 4HCRA 2K7QA 4V1DB 3QNYA 4P2RB 5D96B 1V7ML 2J5LB 4W81A 3ZDZF 2XZCL 1NGYA 3D3VE 5KAQG 4NNYB 7FABL 4JPWH 1OT2A 5I9QB 4JKLA 1DFBL 4LKCA 3IFOA 2BDNH 4KQ4H 5I6XC 5HBBA 4OBRA 3VWJB 1JP5A 3HZMA 4CADB 1MRDL 5I2IB 4L1DA 3ZTNH 3MV7A 3L3HB 4S1RL 4RMRA 4YPGB 4PR5B 5T1LA 5I1KL 5FYJH 1VGEL 4P23B 1CICC 4LSQL 1CICA 2JCCB 3VFGL 4QOKB 3RVWC 4OD2A 4TUJA 3ZE2E 1OAYH 4APQB 3FO2B 1ZXQA 2X1PA 2AKRA 4JN2B 1EXUA 2X9YA 3H9YA 1BGXL 1H0DB 3GHEH 5IMKA 4HKZB 4N0UE 3IDXL 3JWDH 3ZT6A 3EYFB 3TFKC 4J6RL 4P46A 1F97A 2PO6B 2R2BB 3VXSB 5IBLC 1EO7A 4YR6A 3NFSL 1KCUH 2GCYA 3ARED 3PQYB 4X0KB 3O6LH 3VFWB 5FO7A 1UCBH 3O45B 2KZ1B 4QWWC 1WFOA 2IANE 2W38A 3MC0A 2UWEA 1WBXA 4F8TA 5A2KH 3D69B 2AXGB 5DVKA 3V4PH 4WUKL 1IVLA 1QNZL 2X4RA 2C7UB 1LE5B 3MXWH 3U0PB 1QRNE 4U6VL 4K71C 5E5UB 1UM5L 3BXNA 1YN7A 4H1LG 4IRJB 2DQUL 1EAPA 3C5JB 4G8EB 1NFIA 1KTRL 2DQEL 2A38A 5FIEA 3LCYA 4OCSL 2BVTA 1RIHL 4FQHA 2QQLL 4E41A 1QR4A 4Z95H 3X14A 4M7ZB 1GGIL 2DQCL 2A0LD 3PJSA 2VDOL 1LQSR 5IFHL 3RDTC 3IAGC 5EZLB 5T1KD 1HYRC 3LIZL 4LVOB 3QXUA 5F7YC 4M5YL 5I17B 4ZYKB 3MGAA 3WIIH 1KJ3H 1DQDH 4OSUL 2X42A 1CFQA 4CU7A 3C08L 2YD8A 3RTQB 3GRWH 4G8IA 1NGXA 1KBGL 2DMCA 2QBWA 1BOGB 4NZTH 4G5ZL 5CSZB 4U6HA 3T4AB 1RSFA 4GW4A 1XR8B 4LSSH 3UTSE 4ZS6D 5BQ7A 2O5ZL 4JY4A 3MRPB 3FFCB 3BEVA 5EIIB 2FLRT 2QHRL 4XMLL 5IB3A 4H26B 4G3YL 5TE4H 2NX5A 5J3HD 2LV4A 1DQQB 1ZVSB 3P0YL 2EZ0C 3D39E 1NFDB 4PRNA 2K9UA 3PABA 2QQKL 3VD5A 4W6XB 4RFNB 2BRQA 2RBLA 1LE9B 4IBLT 4IMLA 2Y36L 4FXKA 3TN0C 3CFCL 3TN0A 4YE4L 1YEHH 2VXSL 6FABH 1E28B 3QPQD 3EYQC 4PLKC 1J88A 1N7ML 2XZQH 4YX2L 1BWMA 2WINB 4OM0H 4PJ7B 4K55A 5LQBL 3SY0A 4TVPE 3SE4A 3G04A 5CUSH 3DVGB 3RWIB 4O00A 4NRZB 2OK0L 5D1XB 4XPAH 2EC9U 3G5ZB 1CE6A 4XHJC 3MLUH 4XNMB 2ZPKH 5ACZA 3DUUB 4NQDA 3HZYA 4NZDA 4G7VL 4I5BA 1E4XL 4PJIE 1A1OB 1A7OH 5D93B 1QVOA 4UU9B 1A0QH 3JVGC 3JVGA 4Z7OE 1H9VA 3BRDA 1KENL 4EZMA 1DN0B 5C92A 1CGSH 3ZE0F 2VDKL 4I13B 3ARTA 4WI5A 5AAMA 1QKZL 3OG4B 4OZGA 1CD8A 3HRZA 3N85H 5DQDL 1SYSB 3A6CH 3RVUC 3TZVB 5LVEA 1FE8H 3D0LA 1ZGLM 1XCQB 1FORL 1AO7D 4OQTL 5IEKA 3VMOA 3W11C 2IQAB 3QDME 5E2WL 3LEYH 1RURH 1S8DA 2A1WL 4S1DC 5IVNA 3O0RL 3V8OA 5K9JH 1OD7A 3CXHK 4ZPVB 4YHIA 4EN3B 1N0LA 2YMXL 1W72B 3I9GH 1QSFE 3DX7B 2VO5A 1LHZA 4KJPC 1W72L 2BVOA 2DDQL 2VLMD 2X7LA 5LCVL 4N90E 4UDUA 2VLJB 1CG9A 1JJUA 2Y07H 4XBGA 1A8JH 1V3MA 5INCA 4F2MA 4MB4A 4F9PC 4F9PA 3C6SA 3BZFA 3VXTA 1A1MA 3BAEL 4JRYE 3NVQA 4AH2B 1G7HA 2FLBT 1BJ8A 3F7YA 5EBWA 2DTSA 5EZOH 5AG9A 3V5DA 2EYTB 5IHLB 3RWFB 4M93C 2Y4SA 3LN5A 4IOSD 4CAGA 1U2HA 4BH7B 5C0AA 4ZUVB 2DQGH 1MEXH 4PJXA 4UNUA 5SX4I 3ZLQC 1PVHA 3MLYL 1IGCH 4M5ZH 2C9AA 5C7XL 4JM2C 3LB6C 4JM2A 4NC1C 3KLHC 1RY7B 3VRJB 3GHBL 4X99B 3MNZB 4P2YA 1T1WB 3TT1H 1YZZA 3QEGH 5JXAH 2APTA 5DJ2A 1B2WL 1M71B 2P5EE 3SO5A 3QCUL 3RKDD 2R29L 5E6ID 5F3HA 5EBGA 3MO1A 5GGRY 4U7SA 1DEEB 3HE7D 3QFJA 1WAAE 4NZRH 5ADOH 1LEIA 4I77H 1UT9A 4HIEA 1H8SA 3UJIH 2DL9A 2DRUA 2H2PC 3O81A 5FEBA 5JOPD 1IAOB 5JMRA 4P4KC 4P4KA 1P2CA 5JW5B 5EA0H 3MREB 3ARUA 1L4IA 3TVMC 3TVMA 1F6LL 4K3JL 4UI2A 5F7EH 1I4FA 3NCFB 3MV8B 3GMOB 3M8OL 3SDXA 4UOJA 2XRAL 1OCWH 2PTTA 4LIQL 4Z0XB 1NBZB 3O9WB 4X7TB 3GBML 1RZ8B 1DBMH 4HSQA 3ULUF 1G6VK 2FJHB 3BMVA 2WBWB 3K3QA 1BP3B 3NCMA 2CKNA 5C2BL 4M6MH 2B4CC 3BMWA 3RY4A 1RJLB 4M61B 4R90L 2RGSA 1KGCD 1YEJH 2CGRH 3CFJB 1Q0XL 1EHNA 2PETA 1BFVL 1LO2H 3QB7C 2FR4A 1YEGH 4WI4A 4HGWA 3H7BB 1G7LB 1LEGB 2ATPA 2C1OA 4CN1A 1QSZA 5I8EA 2DTML 1AKJB 3HUJB 3VFRA 4GG8A 1QLFB 1Z5LA 3G6JF 1IAII 4CU8A 4AT6B 2QSCH 5ILTL 4I3RH 3U2SA 5I1JL 4Z6AT 1UVQB 4JJ5A 2YD5A 1X5HA 1H15B 5DQJA 4NNXB 1I9EA 3GB7B 1IZKA 5DSCA 4MNGE 4WUUE 2AJXH 1LDPL 2W0LA 4JR9H 4JDZA 4PRPE 1PY9A 3KPPB 5GGUA 4U1JB 1EO8H 1IILE 3QNZA 3REWB 1TQBB 3KJ6H 4FNLH 3WKNA 5DGRA 3RPKA 3SQOL 3WFCL 2YUXA 3O3EB 3QISA 2ED8A 4OI9A 4KI5E 4R4BB 3VXRB 2APVA 5F1IB 3X11A 3MUJA 1FYTE 3G5XB 3MV7D 2CDFA 1A3LL 3EJZC 5T1LD 1FNLA 2ICWJ 2X4NB 1Q0YH 4MA8L 5EUKB 3BDXA 3FQTA 1CICD 3HE6D 5A40E 1C5DA 4D9LH 2OR9L 1J8HB 2BY2A 3TYFA 3RVWD 2R15A 1EGJL 3EBAA 3R1GH 4MAYC 4MAYA 4JKPH 5JXEC 5JXEA 1GRWA 4L4JA 4GAJH 5D7JB 1KTKE 1MCPL 3GO1L 4U1NB 3W0WB 5IT2H 3BSZL 3OAZK 4NUGH 4PRIE 4PJ8D 4JPWL 4NPYB 2BDNL 4KQ4L 5HSFA 1OT1A 2HT2C 1GYAA 4Y1AB 5IBLD 3FMGH 3M1BB 3ZTNL 4N1HB 4WFFE 4A2MA 1BJ1H 4QWWD 3FQNB 4GRWE 4ESKA 3AROA 1XF1A 1D5MA 5FUOH 4MA3A 1J0YA 4FQXC 3CXDL 3QWRD 4FQXA 2ITDB 3SGDH 3SKNA 3QXWA 2XNAA 4G6FB 2FX9H 1MJ8H 1ITCA 1QP1A 4ZXBD 4L8CB 3TH4T 2FX7H 2VLKB 1RZGA 4OD1H 4K3DL 5DRZB 3FJTA 4YFDB 4E41D 2E7MA 1P7QB 2AAVA 1CWVA 4FQ2H 2OZ4H 2QTEA 1C7TA 2YRPA 1FZMB 4IRSC 1HSAB 1K4DB 4IRSA 2P8LB 3RDTD 3S35L 3L1OL 4MNHB 4Q6IC 4Q6IA 3O6LL 1UCBL 2YPLA 3P30H 3QJHA 5LG1A 3G5YB 3CDCA 4HCRH 1J86A 4EI5C 4KROB 1S5IH 4EI5A 4DTGH 4M9OA 4ALAH 5CINH 3MXWL 3QUYB 3LPWA 2ED9A 4CDHA 1M6OB 3DETD 2E7BA 5CZVH 3ILPA 5MENA 1PQZA 5EIVA 3KPRA 1PG7X 3MRKA 4PY8J 5DA0B 4GQPH 3SDAD 1IKNA 2BY3A 2P5WE 4D0BB 4LVHB 1NGWB 3HG1B 1P4LA 5ETUB 1WZ1L 3QUXC 3QDGD 1KJ3L 1DQDL 1LO0H 3CX5K 5C08D 2GSIA 2HVJA 4RMQA 4I0PD 3GRWL 1OGAB 4HS3B 4NBZB 1SBBA 1YYMH 2R69H 1PKQB 3PL6B 4QNPE 3EYQD 5KZCB 4NZTL 3MLTA 1BD2A 5HDBE 2ENSA 3CU1A 5D70H 5HPMB 1K8DB 1RULL 5TDNA 3OKOA 4W70A 5TE4L 4M7LL 3RWCB 2F9BT 1ZLSL 4XHJD 1XCTB 2VR4A 5JIPA 4NN5B 4NQDD 2XZAL 5DJ8A 5CKAA 1JGUL 1NJ9A 3QZWA 4DN4H 1T6WA 4J4PD 4BSVA 1W0VA 1IM3A 4Q2ZA 3T65A 4LPTA 1YN6A 4MSWB 1YEHL 1H8OA 1WV7T 5HGBB 6FABL 4TNVF 2XZQL 4Q6YA 5L2JB 5DK2B 3AREB 1B9ZA 4MLSA 2VL5B 5CUSL 2GT9A 1KYOK 5H35B 2Z8VC 5HYQA 3IXAB 3P9MA 1EMTL 3VFMA 5FHBL 4XPAL 4D9QD 1EEYA 1FH5H 1KIPA 25C8L 3MLUL 2ZPKL 5BV7B 3NZ8B 3W11D 2XN9A 3MJ8A 5MEQB 1A7OL 4L8SA 5BV7L 1NCAH 1YDPA 3CGTA 3DYPA 3SOBH 1CGSL 1OY3B 3T1FA 4QHMB 3MRFA 4D9RE 3PHOB 5E9DA 3CPLB 2F53A 4U2ZA 3HB3D 1G7MB 1XGYH 1NCDH 2CDEB 4KJPD 2MQ0A 4LEXH 4PGEB 4XVSL 2LU3A 2Y06L 4XCEB 5CZXC 1FE8L 3QFDB 5IF0A 1SM3H 1S5HA 2GK0A 3VXNA 1JTOA 4F7CB 1OSZB 4TOYH 3FQUB 3PWPE 5FYKU 4HIIA 4ODHH 4XX1E 1S9WA 1RURL 2YC1B 3MBEC 2XYCA 2BY1A 1R24A 1YY8A 2ENYA 1CVSC 5K9JL 4OZFA 2KH2B 5E2TH 2CJUH 3UTTE 1IGFH 2QADD 3TJEH 4X7SL 5JPMB 4NM8H 3KYMA 4ZPTA 1T7VA 3I9GL 1DQJA 4GUPB 4AG4L 1JI1A 3JV0A 4KGLA 3AY4C 2MKWA 4UTBL 3VXPA 3AY4A 2E6QA 1NMAL 2DLIA 4NSKA 5D7IB 5CJXC 3LB6D 2Y07L 5CJXA 3KLHD 5DT1H 4MJ6B 3OKKB 4JCMA 3QUKA 1IQDB 2MPAH 2B8OT 2F74A 4GXVH 1T1XB 2B1AH 5AZ2H 1VACB 4NC0B 4LASH 4YHNA 3WCYA 1T3FA 5IFAH 4H8WH 5CEZE 4RQQA 5EZOL 4OKVB 2BSTA 2Y5TB 3WFEH 5C0CD 1RI8A 2MOVA 4NWUL 3QO1B 1BZ9A 2G2RA 3PWUB 1UYWH 1MEXL 2MHAB 1BEYH 4U1IA 4X9IA 4OI7A 4M5ZL 1IGCL 3D0VB 1UZ6E 4L3CA 3DGGB 4MJIA 2H2PD 3GMNA 4P4KD 4GW5A 4YNYA 2PCPB 1CGTA 3TWCH 2CLVB 2DM4A 2W60A 3TVMD 4NRXA 2D7QA 5J1AA 5JXAL 5EU3A 5KSAB 3MV9A 4ZUUB 4F7EB 4UNVA 3QDJE 4Y5VC 3O11A 4Y5VA 3TBVA 1IBGH 3KPLB 3ARPA 3KAAA 2ADFH 1GSMA 4NZRL 3S88L 5E8OA 1QO3B 1GOFA 4NNPL 4Z7WE 4U1MA 2HA1A 2PUQT 3IFLH 4JVPA 4JG1H 1RV6X 3DROB 4B41A 4PGBB 3GSXB 5I1IH 1FZJB 4D0DA 2WP3O 2YXFA 4R7DB 4PD4K 4MWFA 3NCBB 5F7EL 3H3PL 1FGVL 1A4JB 1I7RB 1MHCB 3K2UH 3QH3A 4PJEE 4WRLA 3VD7A 3BKMH 5E8NA 1DSFH 3UX9B 4XCYB 1OCWL 1MPAH 4PJCE 2EXWC 4QXTB 3ROLA 4DCQA 5BJTA 5HY9B 4PY7B 1QFHA 2PN5A 4P3CH 4WJ5B 2W65A 5CP3A 3SGJC 2NY1D 3SGJA 4WU5B 2AJ3B 3QQNA 2EDEA 2LVEA 3C5ZD 3ULVC 3ARXA 4G8GD 1QLRB 1UXSB 4LOUC 2IPKB 3RX5A 3OXSA 1JCKA 4PJGB 5KSBB 1HH6A 1RJZA 1YEJL 2CGRL 5CD5C 3MA7B 2XTJE 1TQCC 1IM9D 1LP9E 3RGVB 1AGCA 3B8SA 5GGTA 5HYJA 3CUPA 3CIQA 3BD5A 3EKCA 4KC3B 4OCXH 2Q3ZA 5IB4A 3QEHA 3QQ9C 5F8RC 1DBAL 1Z9LA 4HKXA 1S78D 3RJDA 2VR5A 1NGZB 4I3RL 1FAKT 3EJZD 4J7RA 4LLVB 1U8HA 5F7DA 1NSNH 1ES0B 3LKPA 3RWGB 5DHYB 3C6LD 4ZMAT 5ICZB 1L6ZA 3HE7B 1Z9MA 2V17L 4MAYD 1EJOH 5JXED 3RIAF 2Z91A 4WU7B 5JUEH 1EO8L 3T0EE 5EO0A 3AVEA 4MZ3A 1NAMA 1NL0H 5JNYB 1JHKH 4ZSOB 3HC3H 3WL9B 2HT2D 4RDQF 4KK9D 5CS7A 5B3NA 4KMQA 4LGPB 1BQHB 4WDIB 2X4OB 3RZCC 5EO1B 4HQQL 2B4CH 2DYPD 1ZAGA 1WEJH 4L9LB 1E4JA 2RFXB 5B8CC 5B8CA 4PJ5E 3O6KH 1EK3A 1CL7I 4LCYA 4JKPL 3FN0H 4JFQB 4LPWA 1HQ4B 3CFEA 4MQ7B 1AQDB 2PYEE 4PGJA 4E0RA 2WLZA 4MD4B 5F44A 3X12B 4GW1B 1AR2A 4KY1H 2AK4E 3SCMA 1B0RB 4IRSD 5SWSD 4Q9CA 3I3DA 2HMIC 2X10A 2IG2L 3FO1A 3C2AH 4OLUL 1CDUA 5JORA 3VI4F 4Z78B 1UXWA 4YQXL 4EI5D 2Y23A 4U0RC 3GJEA 5FUOL 4OKDA 4NCDA 1I1FA 2WSKA 3CX2A 4PYHA 3VCLB 4TNWK 4XCNA 5IHUL 5DVMA 4PP1C 3SO3C 3UYRH 2FATL 5MEND 2R1WB 2XA8H 3AMLA 4KHTH 3HMWH 4KI1A 4XVUC 2FX7L 1YQVH 1TPXB 1TCMA 2A6IB 4OD1L 4W6WB 1BVLA 3BVNB 4RISH 4NQEA 4KDVA 1ZA6B 1A6AA 1EV2E 4FQ2L 1S7SA 1P1ZB 3E2HC 2VZVA 2P8MA 3VD9A 1J05A 3QNYB 4FQCH 3QUXD 3D3VA 1NGYB 4HCRL 1MCOH 4LKCB 4R4NC 4ALAL 3IFOB 5CINL 1INDL 3VGGA 5I6XB 1KTDA 3HZMB 4OFVA 1OP5H 3MV7B 5T1LB 2BOBB 3LMJH 1B6UA 4WW2C 1CICB 4WW2A 2UYLA 3KXFE 4TUJB 2GHWB 5L6YH 1AE6H 1MELA 2L4OA 2AKRB 1EXUB 5INDA 5IMKB 2EDXA 1LO0L 4GBXD 4LCWD 4LSPH 3H42H 4QKXB 4K7PX 5KVDL 4KTYA 5ID0A 1XMWA 4YR6B 2AJUH 3CLFH 1C5CL 2IPTL 2IAMD 5FO7B 5D70L 4PLOB 5IEHA 2J6EH 2UWEB 1WBXB 4BUGA 4EXKA 1A6ZA 4LCUA 4P2QA 3MTRA 3VW3H 1FG9C 4XPBL 2X4RB 3IRZA 1X5ZA 3D48R 2Q8AH 3PWJB 4K71B 1A1NB 1OP3H 3BXNB 2XN9D 1YN7B 5E2UL 1EAPB 1HDMA 4DN4L 4XP9H 1NFIB 4X6DF 3NH7L 3SEPA 4NZUH 1UFUA 4FQHB 3MGOA 4E41B 1JI2A 3X14B 5GIRA 3PJSB 2AJYH 4LQ1A 3K8MA 4ZAKD 3RDTB 2F53D 3KPNA 3UTOA 1T66C 5D2LE 1CR9H 1CFQB 5F71A 1T0NA 1II4E 4G8IB 3TM6A 2YPVL 3CX5J 3HR5A 1NGXB 1FH5L 5TQ0H 3BIAX 4HC1H 4U6HB 1UEMA 4KI5F 2VH5H 3KYKH 5GHWH 2H1PH 1AI1H 3UTSA 3WFBL 1RZ7L 1D6VH 1T22A 4JY4B 1F4WL 5JR1H 3BEVB 1NCAL 3MBED 1PW3A 2CLZA 5IB3B 3FOLA 4KV5F 4ORZC 4I3SH 2NX5B 2E7LC 1LK2A 2E7LA 3D39A 3SOBL 1F02I 2EDOA 4PRNB 4IS6A 3PABB 4C56D 2MMXA 4NO2A 1RU9L 1XGYL 1NCDL 3QDGB 3HPLA 2M1KA 2Q7NA 4HBQA 4FXKB 3TN0B 5D72H 1QOKA 4MJ5A 2ATKA 1BZQK 2E7HA 5DD0L 3EO0A 1CDCA 5C8JA 4D0CA 3RAJH 1HCVA 5JDJA 3KNBB 3SY0B 1JE6A 5GGQL 3G04B 3M07A 3QXAA 2FHFA 5HHME 4HK3N 5DR5H 1KFAH 2GTZA 3M17A 1KYOJ 4C59B 5KOVC 3WYRA 3TJEL 1CE6B 4NM8L 5ACZB 4NQDB 3HZYB 4MJ2A 2GSGB 4I5BB 4EQ2A 4KGJA 3WBDA 3B5GA 5ACLA 4MS8C 5DT1L 1CLOH 3PWNA 3U4BH 35C8H 5EB9A 3EOAB 4X7EC 4GG6F 2MPAL 4GXVL 4RGNE 1EFXA 2B1AL 4OZGB 3B9VA 3HRZB 3MV9D 4LASL 4HPOH 4WNQA 3U6RA 3NAAL 2J88L 5IFAL 5EDXA 4K3GA 3D0LB 1YJDH 2J4WH 3QEUA 2R2CA 1JK8A 4CUCA 1PYWB 4OV5A 5IEKB 4L3ED 1UYWL 2C1PA 1BEYL 3QDMA 5SWZA 5MP6H 3AS1A 5CAYB 1BBJA 1X4ZA 1S8DB 2EIZB 3SE3C 5EOCJ 5F9OH 4YHIB 3TWCL 5DFTA 3VMPA 1KC5L 4QRSA 1QSFA 3UZQA 4HUWA 1CDGA 2QL1A 3CC5A 3DHJA 5SX4H 2BVOB 1ZS8A 1RHHA 2X7LB 1I1AC 4UDUB 1CG9B 4XBGB 2APFA 5MEPA 1BM3H 2L7UA 5DRWA 2YUZA 2DQDH 1IBGL 4F2MB 1OPGH 3I6KA 3DV6A 2ADFL 5L2KA 3C6SB 3BZFB 5DMKA 4JRYA 1T7XA 3LS5L 1A1MB 5HVGB 3VXTB 4XNUH 2CR6A 1G7HB 5HDBF 1EO5A 3U1SL 5DJZA 4U1KA 4RSVA 2ZCHH 5EBWB 2QKIA 3F7YB 5J12C 3ULVD 3VWKC 1CE1H 3V5DB 3VWKA 5CBEB 4LOUD 5I1IL 1A6VH 4M93B 3LN5B 3OKLA 4ZFGH 1A7QH 5HVFB 4JO3L 3KPSE 1PX4A 4PJXB 2D31B 1IEHA 4KRMB 3GK8H 3DVFA 4Y2DD 3RZWA 5CD5D 3K2UL 3DX9A 5IB2A 5GSVA 4ZFOB 5HYJD 4JM2B 3VDAA 1DSFL 2HWZL 3D1MC 4ZFOL 4IJ3C 3IJSA 4JDTL 4KJWC 1P53A 3QQ9D 5DJ2B 3BQUD 3RA7H 1EA9C 2P5EA 4CVUA 1IGYA 4DAGH 1FFOA 1VENA 5I1GH 4KJYA 1EIBA 1G7PA 4UTAH 3MO1B 43C9A 1WAAA 3JWOC 1I8LC 3QFJB 1LEIB 3FB5A 5C9JA 2VAAA 3LN9A 3ARVA 3E0GA 1FQ9C 3B9AA 5C0DA 2F19H 2GTWA 1RUAH 4P4KB 1P2CB 3U48A 3KWWA 2QQNL 3TVMB 3RZCD 1I4FB 3LKRA 3UBXG 3HZVA 4RNRA 4YAQA 4YZFE 2J8OA 1NC2A 3SDXB 1C08A 3CSYA 2PTTB 1DTUA 5FCUH 3QWOA 4WHCA 3BPLC 3H9HA 2HRLA 4X5XA 3UAJD 1EJOL 1LO5A 5ANMA 2GJ6D 1ED3A 3QI9A 3QG7H 5JUEL 4M43L 1NL0L 1JHKL 4B53A 3HC3L 3BI9X 1NBVH 2KZWA 2NZ9C 2Y6SC 3ULVH 3EFFA 3U9PL 2B4CL 4UOW1 5J13C 2FR4B 1WEJL 1BZ7A 1MQKH 4HGWB 3QCVL 1T4KA 2C1OB 2ATPB 4U6YA 1EZVX 4BQ8A 2WZPD 4P57A 5FDYA 4GG8B 5D8JH 1Z5LB 4PP1D 3FN0L 5C0ND 3U2SB 1SYVB 3THML 4XVUD 4JJ5B 4N0YL 2EE9A 5CD3A 2PTVA 5DQJB 5KG9A 1DR9A 1CDHA 4MNGA 5DSCB 4KY1L 2X4QA 4W6YB 3WUWG 5D71L 4JVUA 5CHNB 5HYSG 2KKQA 2N56A 1MIEH 4PRPA 3HRPA 1CFSA 4JDZB 4YHMH 3C2AL 5GGUB 1L7TH 1JF1A 4KI5C 4R4ND 2I9TA 1U3ZA 1NAMH 1FYTA 1KNOA 2C4FU 3UYRL 2WANA 5DHXB 4YEFA 5I74C 3SDDD 2CDFB 5E94A 1NBQA 4PB9H 2BRRH 4JFDE 1YQVL 1R3KA 4LVNC 2XKNA 3FQTB 1FG2A 1AHWC 1C5DB 1U0QA 1AHWA 3ES6A 1U3HD 3TYFB 5IG7B 2EDWA 4KAQH 1K2DB 4MMXC 3IT8D 4MAYB 2ZUVA 3V5KA 5E00A 2H2SC 1NGPH 2BNRE 4OBSA 4FQCL 3LRGA 3VG9C 1U93A 4Z7WF 5GGSA 4QHNA 3N1MC 1FNGA 4Y4KD 2WIMA 2NXZC 3S36X 1U2CA 1AGBA 3DBXA 2FL5A 1ZT1A 2XOTA 5IFJA 4JGMA 2IAND 5A16A 1B4JL 4PJEF 4LP4A 4RRPG 1CXFA 4Y4HC 4Y4HA 4KZEL 4J12A 4L4VE 3LMJL 1D5MB 4I3GA 1MJUL 4MA3B 4ONGH 5IVXE 3WSQH 4FQXB 5EC1A 1QRND 3SKNB 4XC3H 2XNAB 1CS6A 5L6YL 1HIMH 3H6JA 4X4YA 1RUPH 3T09A 5K9QG 2WUBH 1RZGB 1RMFL 4LSPL 3H42L 5DUPH 1GC1C 2MCG1 4LHUA 1KXTB 4IRSB 5SWSB 5E03A 1FVEA 3CLFL 1WBYA 5I8KL 4Q6IB 4OLZH 3QJHB 3CNKA 4EI5B 3ZT7A 4M62H 5ITFA 2BFVH 1UJ3C 2GIYA 1UJ3A 3UC0L 2Q8AL 2XWJA 4UT9L 3SN6N 1FVDB 2HJLA 4XP9L 1PQZB 5EOTA 5MENB 4S1SL 1JBJA 3IDUA 3QDAA 1B6DA 3KPRB 2AS5M 1SJEA 3MRKB 2GYSA 2B39A 4RMVA 3N1GC 5E99L 1WIPA 5SX5K 2P5WA 4M7JL 3B4NA 5DFVD 4JPVH 1CZ8H 1GL4B 2AJYL 1KCVH 1P4LB 1F11A 3ORJA 5GJSH 3V6OE 3QUXB 2XWBA 1W0YT 3ARBD 1CR9L 5HHVH 2GSIB 3VG0H 2HVJB 2OI9C 4HBCL 1Z9SA 1BBDH 5TQ0L 3MLTB 4AEHL 2VH5L 5C3LD 3KYKL 4TVPD 1BPVA 4LGRB 1AI1L 4Y0GA 4OFYA 1M7XA 1D6VL 4PGDA 2AQ2A 1QZ1A 5JR1L 3OR6B 3MACL 5TDNB 3OKOB 4HUNB 1BFSA 1J5OH 2Y72A 1QBLH 1E4WH 3S8WA 1KLGA 2VSCA 2UVEA 3CCHA 5DJ8B 1FNEA 3QZWB 1NDMA 1K5NB 1ZV5A 1DDHA 2CK0H 3GSQA 4BSVB 2ZCKH 1W0VB 4LCWB 5A2JH 1I9RH 1IM3B 3O6FD 4Q2ZB 3T65B 4MS8D 1FNFA 1YN6B 5D72L 2YKLH 4BQ6A 2ZOLA 4MD5A 5FK9A 3MCKA 3RAJL 3ZKMD 5ABDE 4QTHA 4OCYH 4Y7MA 1CFBA 1PJ9A 5HYQB 3P9MB 5DR5L 1UC6A 3MLVH 4FS0A 3VFMB 3WNPA 1EEYB 1FFQA 1KIPB 3L6FA 1T5WA 4Z0BH 5IJVB 2XN9B 3MJ8B 4L8SB 2VDQH 4GMTL 3TLRA 1YMHA 1CLOL 3U4BL 35C8L 3T1FB 1CK0H 3MRFB 3U30C 1QSFD 5I76A 1JN6A 2F53B 2GUOA 2NCMA 3AB0C 4KQ3H 4PBXA 4LLWA 1S7VA 5HGDA 4N90D 3QHZH 4HPOL 1I1AD 3KYOA 1HXYA 1J87A 4M9PA 1FLRL 4P3DB 4Z7UE 4I48A 5GRYA 2YD9A 5IF0B 3CH1A 5DFWH 4B50A 4F58H 2IH1A 1S5HB 2GK0B 3VXNB 3OGOE 5C09E 4NHUA 4FQ1H 1MCEA 3PWPA 4JRYD 4HS6A 3GJFA 1CU4H 5MP6L 5AZEH 2PTUA 4HIIB 3OAZH 4B5EA 1S9WB 2IFGA 4F33B 5FGSA 4HG4J 1R24B 4TVPH 1YY8B 2HFTA 2YUVA 3OZ9H 3TP4A 5F9OL 4OZFB 3UTTA 4XTRC 1WFUA 1HYSC 4PJAE 3S98A 3T0VA 4ZPTB 3KYMB 4X98A 4C56B 2B1HH 1MCSA 5D2NE 1DQJB 4LU5H 5IROC 5IROA 3VXPB 1RK1A 4LBEA 2VDNH 1WCBA 4LLQA 4NSKB 1CI5A 1JGLH 1BM3L 1HZHL 3KPOA 3LQAC 1XGPA 4K2UL 1XGRA 2GJJA 4XI5C 5CIPA 4R7NB 2UZIH 3HMXA 4XNUL 2P5ED 1UA6L 2DKMA 4KWUA 4YHNB 1XF4A 1YQ2A 3VA6A 1DANT 3FRPA 4XB7A 4RQQB 4HHAA 1ZANH 1CE1L 1CLCA 2BSTB 4JPIB 1A6VL 2AQ3A 4G9DB 5EU6E 4ZFGL 4BELD 4NKOA 1BZ9B 2G2RB 4LARH 4CMMB 3GK8L 4U1IB 3HAEA 1CGUA 1MCWW 4MJIB 3MRQA 5FKPA 4GW5B 4S11A 4FFWC 5AEAA 2C26A 2W60B 2XKSA 1RJCA 4DFIA 3MFFA 1ZA3A 5IUSA 1BQLH 3KJ4C 4QHLA 2E6JA 4NRXB 4K7PL 3SE8H 1KJ2A 5K9KA 2DM7A 1OARH 4EUPH 4LSRH 5EU3B 1C5BH 4LSVH 3EDKA 3MV9B 1GHFH 5JIKA 2BX5A 3QDJA 1JTTA 4DAGL 4ELME 5I1GL 3O11B 3O4LD 4Y5VB 3RWHA 4NKMA 3TBVB 2OMNA 4EDXA 5LWYL 2VERN 3MZTA 3DLQR 2IQ9H 2CH8A 4L3EB 5E8OB 1CGYA 4Z7WA 1CXIA 3P9WB 1MFBH 4U1MB 2GFBB 4RMUA 1I8IA 5J57B 5HD8C 4PIRF 2F19L 1FVCA 2A77L 1RUAL 4YDKH 5IMOA 5I1DA 4NQCE 4D0DB 4LRNH 5J6GA 2NZ9D 4L4TE 1SMAA 4GXUN 4MWFB 1U8NA 1JGVH 2I07A 4PJEA 5TF1H 4LQFH 3QH3B 3FAWA 4NRYA 5CP7A 3DHMA 2XY2A 3NCYP 4OTXH 5E8NB 1P84K 1NBYA 2DI8A 2OXGA 1G9EA 4PJCA 3UJTH 2QV2A 3ROLB 4ODWA 4TUKH 3ARQA 4DCQB 5BJTB 4MDJA 5C0BA 2EKJA 4M1CD 1U8IA 1IAIL 2W65B 5DS8B 2GAZA 3O8XC 3K1KC 3O8XA 1CIDA 4YDJA 1KB9J 5MI0C 2EDHA 4WUUD 3OXSB 4KVNH 5GGRA 3ULVL 2W0FA 5IV2A 1HH6B 3CMOH 2XTJC 5T1DL 1LP9A 4I9WE 1SVCP 1TQCB 3RWEA 1AGCB 1KXVC 4YHZL 3ZDXF 3CUPB 5HYJB 1MQKL 5HTSA 1IEBB 5GGTL 4P4RB 5KJRH 1ND0A 5IB4B 3QEHB 5D8JL 4HKXB 3S37L 1OB1A 4QHKJ 5FHAH 1LDSA 1U8HB 5KVMC 1OAXH 3LKPB 1FJ1A 3DWTA 5CZKA 3HTLX 1OAKH 5J7CC 1QBMH 4LLAA 4M6AA 1I7ZA 2MFNA 4TSAH 1TZIA 2H2SD 2Y7QA 1F90H 1IAKB 4DVRH 1TZHA 4OLYH 2Z91B 3T0EC 3L3KA 3T0EA 4PRID 3P2TA 5F89A 4X9FA 3D25B 1NAMB 2ADGA 1NCWH 4M00A 1UWEH 1VFOA 4PRBA 4MXVE 1NAML 1RVFL 3P9LA 4JM4L 3RZCB 3QNXA 4WFFD 2HAZA 3MYZA 4PB9L 2ID5A 2Z93A 4NQXA 1MAML 4OGYH 3QWQB 1KCRH 1S7XA 5B8CB 2R0KL 4PJ5A 4KAQL 3IJHA 4JREC 4LCYB 2X41A 5HPOA 5E70A 1NGPL 4U4BA 3CFEB 2PYEA 5JHLH 5AG8A 4QXUL 4E0RB 2Z8WC 5J6HB 4Z7QE 3S6CA 4LHUD 2P1YA 1Z9OA 5HGHA 2FD6H 3DUHA 3ROOA 2Z92B 3T3PF 2CD0A 3MYJA 1JGEA 1QACA 4X6CB 4PJHB 5JORB 2EO1A 1EHAA 1LGVA 5IVZA 1UXWB 3WD5H 3GSRA 3G9VA 3GJEB 4U0RB 5HDQL 4ONGL 4F37F 2X4UA 1J1OL 1I1FB 4OCLC 5LGJA 4XC3L 1QUNA 4XCNB 4UILH 4PJDF 3SO3B 3OKEA 4LRIC 4LRIA 1VCAA 1BVLB 4NQEB 4O4YH 3V52H 4CNIA 1A6AB 5HI3C 1S7SB 3L3IA 4JKWA 5E24E 3E2HB 1YEEH 2P8MB 5E56A 4UV7L 3FO9A 1J05B 1KPUA 1VFBA 2Q8BH 4OLZL 4ZODA 3D3VB 4UOW0 5ACMA 1EUTA 4M62L 2BFVL 4NJ9H 1AGDA 1KTDB 5TPWH 3VD4A 4TYUA 4RGOH 1TJIH 5MERA 4OCRH 3CSPA 4LLYA 3OV6A 3IYLW 3G08A 3DX8B 4GRWH 3KXFA 4WW2B 2UYLB 2DLEA 4JPVL 1CZ8L 5H94A 2BERA 4ZUWA 5J8OA 3KPMA 1KCVL 4AEFA 3WLBB 1FFNA 2CRIA 4Q0XH 4TULH 5GJSL 4N0UB 3VGFA 3PNWA 3CLEL 3VG0L 1S7UA 3FTGA 5HHVL 2DQJH 2UZXB 3SKOA 3QO0A 5CKGA 1BBDL 5ID0B 5CCKH 1M1SA 1L0QA 4CU6A 1YPZF 2NY3D 5C0FB 2IANB 3QP3A 1IGTA 2AEWA 5IEHB 1MCHA 2FHBA 1P6FA 4Z7VE 4X80H 1A6ZB 4XPFH 4P2QB 3L5XH 3G6AA 1J5OL 1HHHA 4AY0A 4YBQD 2ZSWA 2D03L 3X3GH 4JZJC 1QRNB 4JZJA 4UDTA 4KRPC 3STBA 4YGVA 5E8EA 5SV3A 3DJ9A 4QGYA 1NEZA 3RPIA 1HDMB 3LQZB 3U7WH 2RCSH 1NPUA 5IK3B 4S1QH 3WHE1 1I9RL 3MGOB 4X8XA 3OQ3B 1AGFA 2YKLL 2ORBH 5GIRB 1KJVA 3LEVH 4D9RD 2LAGB 5HVHC 1GGCH 2XPGA 4PJFF 5KVEH 5DJYA 4D3CH 3KPNB 4NT6A 5DK3A 5H2BA 1UJTA 2QR0B 4G6KL 5D2LA 2ARJQ 4N8PA 3DXAE 4HJJL 1XGQA 3BIBX 2X1WL 3FB7B 3MLVL 3UZEA 3GSVB 2YS4A 3HR5B 3PP4L 2HLFC 1C7SA 4X7FC 4DJMA 4UIKH 3P4LA 3IDMA 5BXFB 1FAIL 1T5XA 1IGMH 3UTSB 4A6YA 3NIGF 15C8L 1CDYA 1T22B 4YXKL 1NCBL 1X6LA 2CLZB 3FOLB 1Q38A 1U8KA 1LK2B 4XTRD 3D39B 1CK0L 4IS6B 2OM5A 1ZT4A 2A6KB 4OLWH 4Y19D 4NO2B 2I60H 4KQ3L 3BH8A 2ESVD 3IDYC 3QHZL 1OL0A 2FDBP 3HPLB 4YXLH 5TQ2H 3RL2A 3ARGC 5J1SC 3ARGA 4MJ5B 2ATKB 1JPSH 3EO0B 4M48L 4F58L 1DCLA 5C8JB 4D0CB 2LAAA 4XI5D 4XWGH 5JIIA 4RGMC 4LLDA 2WUCH 3S34H 4HLJA 1JVKA 5CEZD 4TVPL 3OZ9L 3M17B 4YHOH 3EFDH 1NKOA 3UYOD 5IVXF 1MCCA 2JJTC 1AIFA 2VZ3A 2B1HL 4PJIB 3ZTJH 1RIVH 3RJQB 3RFZC 3MUY1 4HPYH 2A74A 1JGLL 2ZUUA 4NDMB 3NCEB 3PWNB 4ISVA 3TYGH 1JF5A 4JFHD 3IETA 4RGNC 2RJMA 1EFXB 1JZ2A 3B2VH 2R0ZL 3P11H 2UZIL 3S36L 3CFDA 3QDJD 4WNQB 1CFTB 3U6RB 2XQBH 5BO1L 4KKCD 1LO4H 3QEUB 3DOSA 1JK8B 4G6AC 4OV5B 1PY4A 1YECH 3HZKA 4PLJC 4LARL 2C1PB 4HJGA 1VEPA 3QDMB 5SWZB 5F6HJ 4X5LA 1BBJB 4XXDB 5HD8D 2R8SH 1JTPA 1NUGA 1CDIA 1D6EB 4KTEH 3W5NA 1Q9KA 5GGVL 2CDGA 1A7BA 4QRSB 1QSFB 1BQLL 4HUWB 3SE8L 1OWWA 1OARL 2CKBH 4LSVL 1X6NA 1F2QA 1ZS8B 1GHFL 1RHHB 2Z0BA 1I1AB 1UKQA 5MEPB 3HI5H 4X9GA 5DRWB 1DLFL 3I6KB 3DV6B 2V5SA 3OR7A 3PDGA 5DMKB 2ZNWA 3CVHA 4JRYB 1CLYH 3LQAH 5F70A 3OB0K 4MXQD 2AJSH 5BS0A 1A3RH 4U1KB 3O8XD 2JIXA 5FYKE 3HMXH 2DBJA 2V7NA 2QKIB 4YDKL 5J12B 1HKLH 3VWKB 3VGAC 5CEZH 3OKLB 5ICXA 3KPSA 1D9KC 1KXQE 1D9KA 3B3IA 4OZIF 5DI8A 4K3EH 4EOWL 4LQFL 2FO1A 5GSVB 1U8QA 1D5BA 1DBBH 2A9NH 1G9MC 4MXWH 1OOAA 5HI4C 3IJSB 4KVCH 1F42A 4IJ3B 2OX5A 3UJTL 4TUKL 2GITA 2P5EB 4G6JH 1IGYB 1FPTL 2OBGA 1X44A 2HT3C 5E95B 4KJYB 3ZHDA 1P69B 2P42B 3DYMA 5CGTA 1G7PB 2MQCA 43C9B 1AH1A 3U7AA 1JV5A 3MJ7A 1HQRA 3FB5B 5C9JB 1ZMYA 2F5BH 2VAAB 2X4SA 3CMOL 3JWOL 4OT1H 5FO8A 5C0DB 5GISH 3T0ED 4JE4B 2GTWB 1U8LA 5DD5L 2GI7A 4JO1L 5EUOE 1DE4A 1FN4A 4PRDA 5F1NA 3LKRB 5EWIL 4YEEA 3HZVB 4GKSA 3OAUL 4RNRB 4YAQB 1R3IL 2VQUA 1OAXL 3BOVA 5I15H 4OGXH 1C08B 5I19H 3Q6GH 3CSYB 3PV7A 1P84J 1AGEA 3UPAA 4XMKH 1QBML 1N6UA 3IDNA 3QWOB 1MSPA 3D18A 3H9HB 3P0VH 4X5XB 1CL7L 1F90L 1LO5B 1MH5A 4M3JA 4OLYL 1ED3B 1IC7H 1UZ8A 2AJZA 4H88H 1MIMH 1CGXA 3GMRA 2FWOA 2AK4D 1YPZA 2D4FA 3WIHH 5C0AE 1UWEL 4NFBA 3ARFA 1Q9WB 3UDWC 5A3IC 3UDWA 2H32H 2F54D 4OCWL 5L8KB 1PEZA 5J13B 4FQIH 3R8BB 1HINL 3TO4D 1KCRL 3F7VA 1JUFA 4HIJA 1HHGA 3KYNA 1KN2H 4U6YB 2J8UE 2ZUXA 4P57B 1KTLA 1GGTA 4X6EA 5IB5A 3FKUS 2P7TB 2H9GA 4UQ2A 1T04B 4I2XE 3GIZH 5EBLA 1RAMA 5KG9B 5CMAB 1M05A 4PJFA 1CXHA 3ZDZE 4MNGB 3O2VH 3N9GH 1VEMA 1U92A 4OJFH 4P9HC 1IFHL 4PRPB 1CFSB 1RK0A 1G6RA 3BW9A 5D9SA 4JB9H 3WD5L 3MFGB 1Y6MR 2ARJA 1JF1B 2EDNA 4R9HA 1KULA 2I9TB 5CGMA 4DZBA 3BH9A 4P9ML 1WCQA 3VFUA 1T0MB 4UILL 3VXUE 1F8TL 4JFEE 1FYTB 1KNOB 3UO1H 1JNNL 4XNQA 5I74B 4M6OL 5E94B 4IOFC 5F7WC 3I50H 1R3KB 5GS0C 1FO0H 4LVNB 2XKNB 5JZ7D 4YHPA 1FG2B 3KXFD 4FG6C 1AHWB 3ES6B 3VDCA 4O4YL 3V52L 4KZDL 4ODVH 3EYSH 2WM0A 2DMBA 1YEEL 2V2WA 2BNRA 3V5KB 3MA9H 4OM1H 4HGMA 1I9IH 2Q8BL 5ESQA 2NY4D 1U93B 5GGSB 4ERSH 3HNSH 4PRIB 1YMME 1FNGB 2YWZA 4F80A 4FFYH 4NJ9L 2NXZB 5DJCA 1AD0A 4J1UA 3OL2A 1CFNB 1BFTA 1TNNA 5TPWL 4GAYA 4NM4H 3DBXB 1LK3H 5AUMB 5IFJB 2MNUA 4X4XA 5A16B 5HVWA 4GRWB 2BC4A 4OCRL 4NOBA 4L4VA 4Y4HB 1G0YR 1SEQH 4P2OA 4GLRI 3JXAA 5IVXA 1HE7A 4IDLA 1CBVH 5EC1B 2YD3A 4KRPD 5KAQF 1E6OH 5E2VH 2F5AH 4X4YB 3L7FA 4Q0XL 1GGYA 2V2TA 5BVJA 1CCZA 4TTDC 1B3JA 5FOJA 2IALA 3OKYA 4ORGA 5EBMB 4LHUB 1SVZA 4F57H 1INEL 2FYYA 4WTZA 2BOCA 1DQLH 5I1EH 3T0DA 4U3XA 1GC1L 1WBYB 4ZG1A 1ZEAH 4BM7A 1U95A 1EEZA 2YA0A 3CZFB 3GSNH 4X80L 3L5XL 4OLEA 5ITFB 3VWJD 4WI9A 3SDCC 3SDCA 5EIQA 1UJ3B 3X3GL 1TIUA 2WV3A 2YA1A 5DEFA 4AEIH 2XWJB 3EW3B 2ZUYA 2HJLB 4P23D 5EOTB 1T21A 4HWBH 3CD4A 1SJEB 2B0SH 3QXTA 2KQNA 3VH8A 1EH9A 4APQD 2P5WB 2ORBL 4FZ8H 2DB8A 4WHYH 1IGJA 1L0YA 5HHXL 3LEVL 2NPLX 1GGCL 5IQ7L 1Q8MA 4TUOA 1F11B 1OM3H 4N8CH 3V6OC 3V6OA 1KCSH 1JF6A 1I9JH 2XWBB 3J8F7 1YEKH 4ZS7H 4O2FA 4G9FE 2OI9B 3ARGD 5D5MF 3VXSD 2PO6D 4IEFB 3RUGF 4ZUTA 2OJEA 3PQYD 1H3TA 4YLQT 5K33A 4PUBL 2F58H 4OZ4B 3R0MA 1MFCL 3NN8A 4U05A 2VDRH 4PGDB 5HHMD 3DPBA 2IMNA 4HAFA 2YRZA 5EO9A 1E6JL 1MFEH 1I8MB 1OAUH 2G5BA 3FL7A 4M1GL 1PAMA 3CCHB 1FNEB 4PREA 1AJ7H 1NDMB 3ZE0E 1DDHB 4HUKB 4HWZA 3TNMA 3I3EA 2X1XR 1P5UA 4ZOBA 4YXLL 5C86A 3BRGC 1JPSL 2ZOLB 1HWGB 3E8UH 1V7MH 4RGND 3KLSA 2UZYB 5FK9B 4P5TC 3ARZA 2EIDA 3AFLA 3DRTA 3MCKB 4P5TA 4RIRA 2YPLE 4Q9RL 4HMDA 1NANI 4W4NA 3S34L 1DFBH 4R3SA 4HK0A 1ERNA 3F8UB 3LQMA 4LSDA 3EFDL 4F7PA 2RAMA 3L6FB 4G6AD 2X4PA 4S1RH 4PLJD 1OAZL 2EYRA 1VGEH 3EJYD 1RIVL 2OTPA 4LSQH 3VFGH 2XIDA 1YMHB 3L3DA 3WIFB 1Z3GH 2ZWLT 1JPGA 2DLTA 4DKAA 3GKZA 3U30B 5I76B 1YNLL 1JN6B 3DMMC 2GUOB 2XXMB 2KPNA 2EDBA 5L7XH 3IDXH 3AB0B 3P11L 1WUNT 2APWA 4LLWB 1S7VB 3VXME 1H3GA 3DVNA 4ZTOL 2XQBL 3KYOB 2PF6A 3MZGB 4Z7UA 4J6RH 2AERT 1MWAA 4KFZC 1E4KA 1SHMA 2E6PA 3NA4A 3CH1B 1BD2E 2IH1B 5C09A 1F4HA 4NKIH 4NHUB 4XGZA 3PWPB 4HS6B 2FEDC 3GJFB 4DGVL 6CGTA 1BQUA 3Q48A 4WUKH 5D1XD 2OQJA 4JGUA 2WBJC 2WBJA 2AV1A 1P7HL 1ZWIA 3UTTB 4KTEL 1FFPA 4PJAA 2CIIA 4X98B 1D9KD 5D2NC 5TDPA 5D2NA 1FV1A 3QQ3A 2DQEH 2BMKA 5B3JF 4NP4L 3PXHA 1RIHH 2QQLH 3DSNA 3A6BH 4LBEB 1WCBB 1GGIH 2DQCH 3KPOB 2VDOH 5CGYC 1XGPB 1XGRB 3D85A 4M5YH 3O4OC 3PP3K 5CIPB 4XPTH 4EUPG 1CLYL 3LQAL 4HWEH 4HH9A 1JZ5A 2P47B 3LAFA 1XF4B 5F93C 2IADA 2HT3D 1KBGH 4OZHF 3HMXL 4NN7C 4G5ZH 4HHAB 1HKLL 3CFBA 2X6MA 5CEZL 4U6TA 4Y5YC 4Y5YA 4NKOB 3EGSA 3PE9A 4K3EL 2QHRH 2KQMA 4XMLH 3HAEB 3MRQB 3P0YH 5FKPB 4EN3D 1DBBL 1U8JA 1J0HA 5L8JB 4KVCL 5E9DE 5LGHL 2NY2C 3LHPH 5GPRA 5T1MA 5KVFL 3MFFB 1ZA3B 4QRRE 4QHLB 3KJ4B 4UBDC 3N1FC 5K9KB 2VLJD 5FF6A 3BKYH 2Y36H 4GMSH 1AP2B 4ELMA 5E08L 1OGTA 3QDJB 5SX5H 3RWHB 4NKMB 1N7MH 1UACH 3ULUE 5LQBH 2HVKB 4XRCA 3RVVC 1TFHA 2DI9A 5CILH 4Z7WB 5DZNA 4OT1L 1I7UA 1I8IB 3AU1A 1FVCB 3OF6A 5I1DB 5IMOB 4K8RC 1S9XA 1LNUA 3BPNC 1ORQA 5FYJE 4L4TA 3OPZH 4BZ2H 2EDDA 3TC9A 5J6GB 5A3ID 4M8QA 1U8NB 2I07B 4PJEB 1ADQA 2A83A 4XPHL 3ARSA 4NRYB 5CP7B 5GSRA 4AJ0A 4H25A 4KK8D 1EUUA 4YC2C 3RVXC 5BVPH 2VDKH 4I18C 5I15L 3HI1A 4I18A 1NBYB 5IP4A 1CF8H 4OGXL 3VXOA 3G6JE 3Q6GL 3TJHD 4AIXA 4PJCB 1RUKL 2BSSA 3ZL4L 4XMKL 4ODWB 1K4CA 1FNSH 1G9MH 4MDJB 2R39A 1WIUA 5C0BB 2I9LA 1U8IB 1X5FA 3L3JB 2GAZB 3O3AA 1IC7L 1FZOA 3O8XB 1FORH 5FO9A 4MDIB 4PGZA 4YDJB 3W5MA 2H32B 5MI0B 5E2WH 1FL5A 2OS7A 2W0FB 5IV2B 4O9HL 2XTJB 1A14H 2A1WH 3CFKA 4MJIE 1LP9B 3NACL 3O0RH 3RWEB 4N9OB 2PXYC 4M4PA 2PXYA 4FQIL 2IBGA 4AMKH 4POYA 5I18H 1KEGH 2GW5A 1KN2L 5KS9F 2R2HA 1P9MC 1ND0B 1P9MA 2DDQH 1OB1B 2DJUA 1QFWI 3VI3F 4MA7L 4JFDD 3TBYA 4IOFD 4QCIA 5A2FA 1FJ1B 1Q94A 4UQ3A 4JCLA 4Q9QL 3BAEH 4JEGB 2D0FA 3BGFC 3MGTA 1I7ZB 2BNRD 1TZIB 2J2ZA 2Y7QB 4P3WA 2YHGA 2Z35A 5IMLB 4U0QB 4H1LA 3T0EB 5F89B 4JB9L 5DWUH 4MLIA 2ADGB 1F5WA 1JZ4A 1BLNA 3GMPA 4TTGA 4PRBB 3RHWF 1KV3A 3KPQA 1HHKA 2HLAA 4XNYH 5C7XH 2VXVH 3P9LB 1LWRA 2JB6A 1F4YH 3QNXB 1OTSD 1A4KA 2ILLA 5IBUB 3EDEA 1ZSDA 2Z93B 4L4VD 4WEBH 3QCTH 5DRNA 4ZFFA 1S7XB 1WISA 1CD9B 3OKNB 1GPOH 4PJ5B 3U4EA 1CQYA 3IJHB 4LMQI 3V0VB 3ETBF 1PEWA 2KDGA 3MA9L 4OM1L 3QCUH 4BFIA 2R29H 2PYEB 2EKSA 4TTDD 4YPJA 3HNSL 4ERSL 5DMYA 4NWTH 3L5IA 3QIBC 3QIBA 3NGBC 1U8MA 3GBLA 5HGHB 2B7DT 3WXVH 3TPUA 4TRPH 3ROOB 4WO4C 2ARWA 3FO0H 4WO4A 4XP4L 3QUZC 1JRHH 1JGEB 3QUZA 5ITBL 4EKXA 5IVZB 3I6LE 1A6UH 3GSRB 1JZ6A 3SDCD 8FABA 3UTZB 4EI6B 4K3JH 1X4XA 5JDSB 1LEKA 2ERJC 4XBPA 1WQVT 5E2VL 5GS2D 3OKEB 1NDGA 2XRAH 4OF5A 5FYLE 3GEWB 1I1YA 3GBMH 4BH8B 1IMHC 3WKML 4CNIB 2XG4A 2WK2A 4Q9BA 4F57L 4O02L 4HS8H 1EVUA 1DQLL 3FO9B 1KPUB 5GZNC 1VFBB 3PXJA 1ZEAL 5HYFA 3CDYA 5C2BH 1IAIM 4WFED 4R90H 3HC0A 4Y1AD 5F9JA 1AGDB 3DGCR 2M2DA 4ODTL 1Q0XH 3P4MA 3VD3A 4AEIL 4LHUG 4N1CA 1IC5L 1KLFA 1W8OA 3T0WA 5MERB 2JCCF 4HWBL 4LLYB 1Q9OA 1CFVL 2B0SL 2H8PA 2DTMH 3LKOA 3G08B 3P4OA 2QSTA 3KXFB 4G6FD 4NO0A 2JB5H 1YEIL 4FZ8L 1GOHA 1U8PA 3P77A 4UNTA 5H94B 1IEAA 4ZUWB 3KPMB 3RU8H 1OM3L 1FFNB 1HNGA 1KCSL 2PR4H 4YDVA 1I9JL 3MRIA 1P7QD 3IDJA 3KLAA 3PNWB 5C9KA 3MLZH 3JTSA 3QRGH 1S7UB 2P44B 3FTGB 4AEEA 3VFOA 1FRGH 3SKOB 3QO0B 1VGKA 1T83C 1T83A 2K3TA 3LRSA 4L29A 5KTEH 2F58L 3EDDA 4FFVC 2HJFA 1ZHNB 1IGTB 2VDRL 3MODH 3SQOH 3WFCH 2ZUQC 3JUYA 4LDLB 1E4XI 4DZ8A 1JYWA 2WW8A 3G6AB 2KBGA 4WVRA 2DD8H 2ZSWB 4OIIH 3V0AC 3UCRA 4JZJB 4UDTB 5AWNH 3FQXA 2D2OA 2DIBA 4KRPB 5E8EB 1TLKA 1A3LH 4K94C 1NEZB 1U8OA 3RPIB 4MA8H 1JNLL 5I16A 4M02A 2OR9H 4M6NL 3ET9F 5CJOL 4HK3J 4NQEE 1XFPA 1EGJH 2BVPA 5GS2H 3HG1D 5KSUA 1F58H 4YHLH 3NIDF 1BQSA 1KJVB 3E8UL 5BRZE 5HVHB 1O7VA 1YNKL 2XPGB 5DJYB 3WFDH 3GO1H 1MCPH 3DMMD 3BFOA 3BSZH 5H2BB 2IEPA 5EN2A 3TGXA 5C6WH 2HP4A 5JW4N 5D2LB 3V8CA 1OGAD 3DXAA 5JOFA 1AO7E 1XGQB 1QG3A 1CXKA 3PL6D 4BFBD 5KZCD 2JE8A 1YYLL 4U3HA 3IDGB 3IDMB 5BZDA 1JHTA 5TGBA 1YNTA 4G80A 4A6YB 3BEWA 3CXDH 3HLAA 5FM8A 4A6YL 1Z3GL 3BRFA 5DK0A 1ZT4B 3ZTJG 1J12A 1EBAA 4K3DH 5L7XL 2EXYC 1NUNB 3IDYB 1MHHA 3RL2B 2HTLC 1C16A 4P46C 3ARGB 5CGYD 3EYOA 3JUZA 3OJVC 5E8PA 3S35H 4PJ7F 3L1OH 3D85D 4OUUA 4XC1H 4NKIL 4R2GC 3DO7A 1FSKC 1A47A 4RGMB 1NH6A 3VU2A 2FX8H 4P2QE 2G9HA 4B7IA 5HHMB 4IHOA 1WSST 3LY6A 3QJFA 4KTDL 1MCIA 5EU6D 1FL6A 4CN4A 2NY5C 3GFUA 1AY1L 5TDOA 4CVXA 3A6BL 1V8HA 5KS9A 2A74B 5GRZA 4ISVB 4MB3A 3UTQA 1A02N 3SE9H 4YDIL 1WZ1H 4RGNB 4G6ML 4XPTL 4UBDD 4DKFL 5CEXA 3LS4H 4HWEL 2VDPL 4FQQA 3CFDB 1N2RA 3D5OF 3REVA 4G42B 1C12A 2D3VA 1WZLA 1NMBH 5I1LA 2NTFB 1X5XA 3QUMH 1W2KT 2BNUA 3HZKB 4HAGA 2NYYC 4HJGB 3WN5C 3WN5A 1RULH 1KSRA 4M7LH 5I8CB 3NOIA 4NQCD 1ZLSH 3H9SE 3AS0A 1Q9KB 2XZAH 3FRPG 3LHPL 1JGUH 2FNBA 2CDGB 2W59A 4KKBD 5I30L 3BN3B 3BKYL 3O2WH 4GMSL 1JHLH 1LO3H 1JYXA 3PF2A 1UACL 4CBPA 1FIEA 1X5IA 3PUCA 5DLML 5GRUH 3SE4C 2A73A 3CVHB 5HHOE 1U9KA 5CILL 1EMTH 2HKHH 5FHBH 3CVHL 3GSWA 1P4BL 1NKRA 4JFZH 1N3NA 2V7NB 1V3LA 25C8H 4WGVB 4J23A 4C83A 1MCRA 5ICXB 3KPSB 3OPZL 3VGAB 4BZ2L 1D9KB 3B3IB 5BV7H 5DI8B 4WI2A 2GKIA 2VUYA 1DL7H 2BVQA 1U8QB 1D5BB 2X9WA 4XCCL 3LKQA 5BVPL 4L8BA 1CF8L 1XF2B 3GGWA 3TV3H 5KSAD 4XVSH 4G8FB 1KELH 4O5LH 2GITB 1FNSL 1G9ML 2Y06H 4KH2A 3CMGA 3WNKA 1SY6A 2CXGA 1S9YA 2P24A 5KN5A 1U3JA 2IBBA 1JV5B 3MJ7B 1HQRB 2BK8A 3BP6A 5IGXL 5SWZE 4Y16C 4F7TA 2X4SB 4Y16A 4HWUA 4RZCA 1A14L 2CRMA 1U8LB 4X7SH 4AMKL 4F3FA 5I2IA 5I18L 1KEGL 2DMKA 4PR5A 4AG4H 4Z76A 5EUOA 1C8PA 1DE4B 1OD9A 1FN4B 4NIKB 4UTBH 4PRDB 5F1NB 1NMAH 2FGWL 4GKSB 1CD1A 3P40A 4DWHA 3TNNB 5FDWA 2ZP0T 1CGVA 3S5LB 1FFRA 1AGEB 5L2KE 1HWHB 4HKZA 3IDNB 1JPFB 2J12B 4LAQL 1MH5B 3U82B 2GY7B 5C70A 2UUDK 1UZ8B 2AJZB 5DWUL 3SDYH 2UV3A 4X0KA 4NWUH 2FWOB 2C3VA 3MRNB 3QIBD 3NBNA 5IMMA 1FYHB 4TQEH 2WQ8A 3HNTH 4YIQA 4ZDHA 3VI4E 3RGVD 1M7DA 4XNYL 2VXVL 4K3HA 4JO2L 1F4YL 2JLLA 3QUZD 5KSVA 1T2XA 3U0PA 3HKFA 4WEBL 2Z8SA 3QCTL 3VFSA 3F7VB 1JUFB 4HIJB 1HHGB 2VXQH 3HUJF 1QA9A 1GPOL 2J8UA 4K7FA 1R5IB 4RFEA 1KTLB 1HHJB 4X6EB 2R0WL 5IB5B 2H9GB 3L5WA 4I2XA 4UQ2B 2YK1H 3BX7C 5EBLB 5IWLC 5IWLA 1H3WM 2YD7A 4NWTL 4KKLC 4AENA 3S96A 4NBXB 1HKFA 3DX6A 3S88H 1M05B 3B9EA 1P6AB 4N0FA 4NNPH 3WXVL 4TRPL 1U92B 2Q76A 1O7SA 3FO0L 5GZND 1RK0B 4NQVA 1JRHL 1G6RB 1BOGA 2FEEI 3BW9B 5D9SB 4P9HL 1IRAY 4KMTH 1A6UL 4JRXE 1CIUA 1G6RL 1OQXA 1CDJA 3FFCA 5F7LB 3H3PH 1FGVH 3BH9B 4DZBB 3VFUB 3VXUA 4JFEA 4NHCL 4Q97A 5D1ZC 5D1ZA 1DQQA 4XNQB 4JFDB 1JWMA 4YHPB 1RJYA 1TMCB 2XKUA 4NO0D 5T3XE 5GS0L 4HS8L 5C08E 3FT3A 2LQRA 4KPHH 5ANME 2BNRB 2D7NA 5IW3A 1T1YA 5ESQB 1EDQA 3LDBC 1LVEA 4FABL 1EERB 1G0XA 1WITA 1YMMA 3U0TA 3FONA 1KB5A 5B38B 3OAYK 2VABA 4OD3L 3MRHA 3MJ9A 5DJCB 3RRQA 1AD0B 4J1UB 3ZYOA 5KANI 3ILQD 1QRKA 4GAYB 2VWEE 2R4SH 3OB0H 1N6QL 4X4XB 5FV1L 1R3HA 3G5ZA 1RIUL 1XGTA 2BC4B 4L4VB 3DUUA 2FBJL 5IVXB 1JMXA 2EDFA 2X40A 2JB5L 1D5XA 1DBAH 4X6DE 1A9EA 3MNWB 1CTNA 3NPSC 1H8NA 1RZKC 4HKBB 2OP4L 1N5YL 3MBXL 3RU8L 1M4KA 4JPKL 1MLBB 2PR4L 2V2TB 5BVJB 4RA3A 5BCAA 3MLZL 3VXQA 2IALB 2IH3A 3QRGL 3VDBA 2QSQA 2V17H 4ORGB 2O61A 1FRGL 5K9OA 4WHYG 4BSJA 4ZFZB 4HEME 1DQTA 3HR6A 4ODXB 3BKCH 3WJJC 4OQTA 2BOCB 3WJJA 5KTEL 3ZE1F 4D9QE 1NLBH 1U95B 3MODL 1ZT7A 5F88A 1EEZB 3QAZC 2IQAA 2DD8L 1NCCH