1FAPA

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP.
pubmed rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fapA00
2LGOA 4DH0A 3CGNA 3KCEA 4QT2A 1R9HA 1B6CA 1KT0A 1U79A 1C9HA 1Y0OA 2ZQSA 1FKJA 4DROA 3O5LA 1D7JA 2PPNA 3NI6A 4G50A 5GPGA 3IHZA 2ZR5A 1QPLA 2PPPA 2XPAA 3GPKA 4ODPA 4J4OA 1FKIA 1M5YA 2RUCA 2RQSA 3PRDA 4DZ3A 2RURA 2M2AA 2KGJA 2FKEA 3B7XA 4TX0A 1PBKA 4O2TA 4ODLA 4DRKA 4LAWA 3TC5A 5HWBA 2LJ4A 2F21A 2XP6A 2MLYA 3RGCA 4LAYA 4N19A 1W26A 1ROUA 2KE0A 2VN1A 3H9RB 4JFJA 4TW8A 3JYMA 3O5DA 1KT1A 4J4NA 4JFMA 2MPHA 2KI3A 4MGVA 4ODQA 4W9QA 1PINA 4DRPA 2FAPA 1FKTA 4DRHA 1JNSA 3UQIA 4ODRA 1FKGA 4W9PA 1FAPA 5B8IC 3O5GA 4TNSA 2XP7A 4ODKA 4LAVA 2XP4A 2Q5AA 4IQCA 4C02B 3IKGA 2M08A 3O5KA 2DG9A 2PV1A 4IPXA 1EYMA 2PBCA 3I6CA 4MSPA 2N87A 2PPOA 5D75A 5HW6A 4QT3A 4FN2A 1N1AA 1T11A 1ROTA 1JVWA 3VAWA 1NMVA 3PRBA 2D9FA 4DT4A 1JNTA 3JYJA 1EQ3A 5DITA 2MF9A 2LKNA 4DRMA 4GIVA 2RUQA 5HUAA 5HW7A 1J4RA 1FKKA 2ZQUA 3UI5A 1NSGA 1FKLA 2AWGA 4ODNA 3O5IA 3RFWA 3O5FA 2IF4A 1J4HA 2KFWA 1HXVA 3WH0A 1TCOC 2XP9A 4FAPA 1D6OA 1FKSA 2Y78A 1J6YA 4ITZA 5DIVA 1FKRA 4JFKA 3MDYB 2MNTA 1F40A 4ODOA 1L1PA 3JXVA 3EY6A 1BKFA 4TW7A 2JZVA 2XP8A 3O5PA 2MLZA 3IK8A 3TDBA 2VCDA 2RSEA 1FJDA 3O5RA 3UQAA 3O5JA 4QIBA 3O5EA 2ZR4A 1FKDA 4W9OA 4DIPA 1QPFA 1BL4A 1D7HA 5HKGA 2DG3A 3IKDA 5J6EA 1A7XA 2ZR6A 3UQBA 3LUOA 3NTPA 1YATA 2KR7A 2PV2A 2XPBA 5HWCA 1FKHA 2ZQTA 2MLXA 2ITKA 3KACA 1NMWA 2KO7A 3NRKA 3PA7A 1FKFA 1Q6IA 4DRIA 3FAPA 4DRNA 4TW6A 2M1IA 4NNRA 3KAFA 4U84A 3UI6A 3KADA 1ZCNA 1YW5A 3O5MA 4JFIA 2F4EA 3KAGA 1FKBA 4TYOA 2UZ5A 2XP3A 1D7IA 2ZQVA 3UI4A 2PV3A 5I98A 4GGQA 4DZ2A 5BXJA 2K8IA 4ODMA 1FD9A 3KABA 3KZ7A 4R0XA 4DRQA 3UF8A 1P5QA 4U86A 4U85A 3CGMA 5HW8A 4BF8A 2XP5A 1J4IA 2F2DA 4JYSA 4DRJA 1Q6HA 3ODKA 2LPVA 3KAIA 1F8AB 4G2PA 2L2SA 3KAHA 4JFLA 5DIUA 2DG4A 5HTGA 1Q6UA 1ZK6A 2OFNA 1QZ2A 3O5OA 3O5QA 4IQ2A 4LAXA 3TCZA 2RUDA 1Q1CA 5HT1A 3OOBA
chains in the Genus database with same CATH superfamily
4QT2A 1U79A 1ZBCA 2ZQSA 1FKJA 4DROA 1D7JA 2PPNA 4WJXA 3GPKA 1M5YA 2EULA 4TX0A 4ODLA 4LAWA 2F21A 1ZBWA 3RGCA 4LAYA 4N19A 3H9RB 4DZ3A 1IX5A 4XAKA 1KT1A 4J4NA 1ITXA 4ODQA 4W9QA 1E6NA 2FAPA 4URIA 4TNSA 1HKIA 2G8ZA 3IKGA 5DF0A 3O5KA 4QZVB 3WIJA 5D75A 2N87A 2PPOA 3ARWA 1JVWA 2A3EA 3PRAA 2YBUA 1EQ3A 1GUVA 4GIVA 3GTYX 5HW7A 2A3AA 2ZQUA 3UI5A 2AWGA 1EDQA 4W5UA 1LJYA 1TCOC 4HARA 3CH9A 1J6YA 1FKRA 3B8SA 1HJVA 3CHCA 4Z2JA 1EHNA 3O5RA 4Z2GA 3ARXA 2ZR4A 1FKDA 4W9OA 2A3BA 1WB0A 2ZR6A 3CHDA 2KR7A 1ZBKA 2DT2A 2MLXA 1GOIA 3PA7A 3AQUA 1FKFA 2AOSA 4DRNA 1CTNA 2M1IA 3KAFA 4JFIA 3EIPA 4WK9A 2ZQVA 1ZU8A 4DZ2A 5BXJA 1JNEA 2FDMA 3UF8A 4DWSD 1P5QA 1O6IA 3WKZA 2QF8A 3ODKA 1XHGA 3KAHA 2DG4A 3O5QA 3O5OA 4LAXA 3TCZA 1H0IA 2WLZA 2LGOA 3CGNA 1H0GA 4HBEA 4MNMA 4P8UA 3RM4A 1W1VA 4MNKA 5GPGA 4G50A 3IHZA 2XPAA 4J4OA 1FFQA 1LL7A 3OA5A 2RQSA 2B31A 4MTVA 3PRDA 2KGJA 2FKEA 1SR0A 3B7XA 2XP6A 1E9LA 2MLYA 3TC5A 3ARUA 4JFJA 3AS0A 1KFWA 2WLYA 4S3JA 3O5GA 4IT4A 4PTMA 2XP4A 4C02B 4MPKA 3ARZA 4IPXA 4MSPA 1UR8A 5HW6A 4ZPWR 1N1AA 1NWSA 1T11A 5HBFA 2D9FA 1E6RA 3ALFA 2ETNA 2RUQA 5HUAA 1J4RA 4ODNA 1ZB5A 3O5IA 1HJXA 4R5EA 3RFWA 3WH0A 3B9AA 3ARTA 2XP9A 5DEZA 1E6ZA 2Y78A 3AS1A 4Z2HA 3JXVA 1BKFA 3O5PA 1X6NA 3IK8A 3TDBA 2RSEA 4WKHA 1W1PA 4DIPA 1LL6A 5J6EA 1A7XA 4HBOA 1WNOA 3WD3A 3UQBA 1LG1A 3ARPA 1VF8A 2PV2A 5HWCA 1HKKA 1TFVA 2WK2A 3NRKA 3AS2A 3CHFA 3WD1A 3FAPA 4KQZA 4TW6A 4NNRA 4U84A 3UI6A 1W1YA 4TYOA 1YW5A 1D7IA 1FD9A 3KABA 4R0XA 1NH6A 4P8VA 4U86A 2F2DA 4UDMA 4DRJA 1Q6HA 2LPVA 2L2SA 1Q6UA 2OFNA 2RUDA 1Q1CA 5HT1A 3OOBA 4Q7NA 4DH0A 3ARSA 3KCEA 1R9HA 1B6CA 1Y0OA 3O5LA 1OGBA 3ALGA 1QPLA 4DWSC 1FKIA 2DT3A 2RURA 2M2AA 1HKMA 4O2TA 5HWBA 1D2KA 3RM9A 1W26A 1ROUA 1XRVA 2VN1A 1FJDA 3O5DA 4JFMA 5HW8A 1PINA 1HJWA 1FKTA 4DRHA 4W9PA 1FKGA 1JCHB 4ODKA 4LAVA 2Q5AA 4IQCA 4S3KA 3G6MA 1E15A 4NZCA 1EYMA 2OLHA 2PBCA 4DWSB 1X6LA 1K9TA 4FN2A 4ML4A 1ROTA 1LQ0A 3WL1A 4DT4A 3PRBA 2ESCA 4Z2LA 3JYJA 2MF9A 4DRMA 1LL4A 3BMBA 1NSGA 2IF4A 2KFWA 1HXVA 4NSBA 1D6OA 1EIBA 1GPFA 2YBTA 4JFKA 3MDYB 2IUZA 2MNTA 4MNLA 1L1PA 3EY6A 4TW7A 2JZVA 2XP8A 2MLZA 2VCDA 2PI6A 3UQAA 3O5JA 4QIBA 3FXYA 3ARYA 4KR0B 1D7HA 3WD0A 1RD6A 3LUOA 3NTPA 2P4VA 1ZL1A 1YATA 2G41A 5GQBA 2XPBA 2ZQTA 1WAWA 1ZBVA 3KACA 4Z2IA 3KADA 3O5MA 4P8WA 3KAGA 1FKBA 2UZ5A 2XP3A 5DO2A 2PV3A 5I98A 1NWUA 4GGQA 3KZ7A 3W4RA 3WL0A 1NWRA 4U85A 4ZS6A 2XP5A 4LGXA 4DWSA 2DT1A 3KAIA 4G2PA 5HTGA 4WKFA 1F40A 1QZ2A 4P8XA 5GPRA 1HKJA 2DT0A 3AS3A 1KT0A 1C9HA 3NI6A 2ZR5A 2PPPA 3ARRA 4ODPA 2RUCA 4Q22A 3RMEA 1PBKA 4DRKA 1W9UA 4WKAA 2LJ4A 4IT6A 4TW8A 2KE0A 3JYMA 4MGVA 2MPHA 2KI3A 4DRPA 1JNSA 1OWQA 3UQIA 4ODRA 1FAPA 5B8IC 2XP7A 3ARQA 2M08A 2DG9A 2PV1A 3WD4A 3I6CA 1E44A 4QT3A 3WQWA 3AROA 3VAWA 1NMVA 3BXWA 1JNTA 1SYTA 5DITA 2LKNA 4L3NA 1FKKA 1JNDA 1W1TA 1FKLA 3O5FA 2PN0A 1J4HA 5JH8A 3WD2A 4FAPA 1FKSA 3B9EA 4MNJA 4ITZA 5DIVA 3ARVA 4ODOA 2F23A 2O92A 4ZPTR 3B9DA 3GU0A 3WQVA 4ZPVR 1NWTA 3O5EA 4WIWA 1OGGA 2O9OA 1E6PA 3PR9A 3FY1A 1QPFA 1BL4A 3QOKA 5HKGA 1UR9A 2DSZA 2DG3A 3IKDA 2B5UB 1LG2A 3G6LA 4L72B 1FKHA 3RM8A 2ITKA 1NMWA 2KO7A 1Q6IA 4DRIA 1W9PA 1ZCNA 2F4EA 3CZ8A 3UI4A 1FFRA 2K8IA 4ODMA 4MAVA 4DRQA 3CGMA 4Z2KA 4BF8A 2A3CA 1J4IA 4JYSA 1W9VA 3CHEA 1F8AB 2DSWA 2DSUA 2WM0A 4AY1A 4JFLA 2DSVA 2DPEA 5DIUA 1ZK6A 4IQ2A 1GRJA
chains in the Genus database with same CATH topology
4QT2A 1U79A 1ZBCA 2ZQSA 1FKJA 4DROA 1D7JA 2PPNA 4WJXA 3GPKA 1M5YA 4TX0A 4ODLA 4LAWA 2F21A 1ZBWA 3RGCA 4LAYA 4N19A 3H9RB 4DZ3A 1IX5A 4XAKA 1KT1A 4J4NA 1ITXA 4ODQA 4W9QA 1E6NA 2FAPA 4URIA 4TNSA 1HKIA 2G8ZA 3IKGA 5DF0A 3O5KA 4QZVB 3WIJA 5D75A 2N87A 2PPOA 3ARWA 1JVWA 2A3EA 3PRAA 2YBUA 1EQ3A 1GUVA 4GIVA 5HW7A 2A3AA 2ZQUA 3UI5A 2AWGA 1EDQA 4W5UA 1LJYA 1TCOC 4HARA 3CH9A 1J6YA 1FKRA 3B8SA 1HJVA 3CHCA 4Z2JA 1EHNA 3O5RA 4Z2GA 3ARXA 2ZR4A 1FKDA 4W9OA 2A3BA 1WB0A 2ZR6A 3CHDA 2KR7A 1ZBKA 2DT2A 2MLXA 1GOIA 3PA7A 3AQUA 1FKFA 2AOSA 4DRNA 1CTNA 2M1IA 3KAFA 4JFIA 4WK9A 2ZQVA 1ZU8A 4DZ2A 5BXJA 1JNEA 2FDMA 3UF8A 4DWSD 1P5QA 1O6IA 3WKZA 2QF8A 3ODKA 1XHGA 3KAHA 2DG4A 3O5QA 3O5OA 4LAXA 3TCZA 1H0IA 2WLZA 2LGOA 3CGNA 1H0GA 4HBEA 4MNMA 4P8UA 3RM4A 1W1VA 4MNKA 5GPGA 4G50A 3IHZA 2XPAA 4J4OA 1FFQA 1LL7A 3OA5A 2RQSA 2B31A 4MTVA 3PRDA 2KGJA 2FKEA 1SR0A 3B7XA 2XP6A 1E9LA 2MLYA 3TC5A 3ARUA 4JFJA 3AS0A 1KFWA 2WLYA 4S3JA 3O5GA 4IT4A 4PTMA 2XP4A 4C02B 4MPKA 3ARZA 4IPXA 4MSPA 1UR8A 5HW6A 4ZPWR 1N1AA 1NWSA 1T11A 5HBFA 2D9FA 1E6RA 3ALFA 2RUQA 5HUAA 1J4RA 4ODNA 1ZB5A 3O5IA 1HJXA 4R5EA 3RFWA 3WH0A 3B9AA 3ARTA 2XP9A 5DEZA 1E6ZA 2Y78A 3AS1A 4Z2HA 3JXVA 1BKFA 3O5PA 1X6NA 3IK8A 3TDBA 2RSEA 4WKHA 1W1PA 4DIPA 1LL6A 5J6EA 1A7XA 4HBOA 1WNOA 3WD3A 3UQBA 1LG1A 3ARPA 1VF8A 2PV2A 5HWCA 1HKKA 1TFVA 2WK2A 3NRKA 3AS2A 3CHFA 3WD1A 3FAPA 4KQZA 4TW6A 4NNRA 4U84A 3UI6A 1W1YA 4TYOA 1YW5A 1D7IA 1FD9A 3KABA 4R0XA 1NH6A 4P8VA 4U86A 2F2DA 4DRJA 1Q6HA 2LPVA 2L2SA 1Q6UA 2OFNA 2RUDA 1Q1CA 5HT1A 3OOBA 4Q7NA 4DH0A 3ARSA 3KCEA 1R9HA 1B6CA 1Y0OA 3O5LA 1OGBA 3ALGA 1QPLA 4DWSC 1FKIA 2DT3A 2RURA 2M2AA 1HKMA 4O2TA 5HWBA 1D2KA 3RM9A 1W26A 1ROUA 1XRVA 2VN1A 1FJDA 3O5DA 4JFMA 5HW8A 1PINA 1HJWA 1FKTA 4DRHA 4W9PA 1FKGA 4ODKA 4LAVA 2Q5AA 4IQCA 4S3KA 3G6MA 1E15A 4NZCA 1EYMA 2OLHA 2PBCA 4DWSB 1X6LA 1K9TA 4FN2A 4ML4A 1ROTA 1LQ0A 3WL1A 4DT4A 3PRBA 2ESCA 4Z2LA 3JYJA 2MF9A 4DRMA 1LL4A 1NSGA 2IF4A 2KFWA 1HXVA 4NSBA 1D6OA 1EIBA 1GPFA 2YBTA 4JFKA 3MDYB 2IUZA 2MNTA 4MNLA 1L1PA 3EY6A 4TW7A 2JZVA 2XP8A 2MLZA 2VCDA 2PI6A 3UQAA 3O5JA 4QIBA 3FXYA 3ARYA 4KR0B 1D7HA 3WD0A 1RD6A 3LUOA 3NTPA 1ZL1A 1YATA 2G41A 5GQBA 2XPBA 2ZQTA 1WAWA 1ZBVA 3KACA 4Z2IA 3KADA 3O5MA 4P8WA 3KAGA 1FKBA 2UZ5A 2XP3A 5DO2A 2PV3A 5I98A 1NWUA 4GGQA 3KZ7A 3W4RA 3WL0A 1NWRA 4U85A 4ZS6A 2XP5A 4LGXA 4DWSA 2DT1A 3KAIA 4G2PA 5HTGA 4WKFA 1F40A 1QZ2A 4P8XA 5GPRA 1HKJA 2DT0A 3AS3A 1KT0A 1C9HA 3NI6A 2ZR5A 2PPPA 3ARRA 4ODPA 2RUCA 4Q22A 3RMEA 1PBKA 4DRKA 1W9UA 4WKAA 2LJ4A 4IT6A 4TW8A 2KE0A 3JYMA 4MGVA 2MPHA 2KI3A 4DRPA 1JNSA 1OWQA 3UQIA 4ODRA 1FAPA 5B8IC 2XP7A 3ARQA 2M08A 2DG9A 2PV1A 3WD4A 3I6CA 4QT3A 3WQWA 3AROA 3VAWA 1NMVA 3BXWA 1JNTA 1SYTA 5DITA 2LKNA 4L3NA 1FKKA 1JNDA 1W1TA 1FKLA 3O5FA 1J4HA 5JH8A 3WD2A 4FAPA 1FKSA 3B9EA 4MNJA 4ITZA 5DIVA 3ARVA 4ODOA 2O92A 4ZPTR 3B9DA 3WQVA 4ZPVR 1NWTA 3O5EA 4WIWA 1OGGA 2O9OA 1E6PA 3PR9A 3FY1A 1QPFA 1BL4A 3QOKA 5HKGA 1UR9A 2DSZA 2DG3A 3IKDA 1LG2A 3G6LA 4L72B 1FKHA 3RM8A 2ITKA 1NMWA 2KO7A 1Q6IA 4DRIA 1W9PA 1ZCNA 2F4EA 3CZ8A 3UI4A 1FFRA 2K8IA 4ODMA 4MAVA 4DRQA 3CGMA 4Z2KA 4BF8A 2A3CA 1J4IA 4JYSA 1W9VA 3CHEA 1F8AB 2DSWA 2DSUA 2WM0A 4AY1A 4JFLA 2DSVA 2DPEA 5DIUA 1ZK6A 4IQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGO A;  4DH0 A;  3CGN A;  3KCE A;  4QT2 A;  1R9H A;  1B6C A;  1KT0 A;  1U79 A;  1C9H A;  1Y0O A;  2ZQS A;  1FKJ A;  4DRO A;  3O5L A;  1D7J A;  2PPN A;  3NI6 A;  4G50 A;  5GPG A;  3IHZ A;  2ZR5 A;  1QPL A;  2PPP A;  2XPA A;  3GPK A;  4ODP A;  4J4O A;  1FKI A;  1M5Y A;  2RUC A;  2RQS A;  3PRD A;  4DZ3 A;  2RUR A;  2M2A A;  2KGJ A;  2FKE A;  3B7X A;  4TX0 A;  1PBK A;  4O2T A;  4ODL A;  4DRK A;  4LAW A;  3TC5 A;  5HWB A;  2LJ4 A;  2F21 A;  2XP6 A;  2MLY A;  3RGC A;  4LAY A;  4N19 A;  1W26 A;  1ROU A;  2KE0 A;  2VN1 A;  3H9R B;  4JFJ A;  4TW8 A;  3JYM A;  3O5D A;  1KT1 A;  4J4N A;  4JFM A;  2MPH A;  2KI3 A;  4MGV A;  4ODQ A;  4W9Q A;  1PIN A;  4DRP A;  2FAP A;  1FKT A;  4DRH A;  1JNS A;  3UQI A;  4ODR A;  1FKG A;  4W9P A;  1FAP A;  5B8I C;  3O5G A;  4TNS A;  2XP7 A;  4ODK A;  4LAV A;  2XP4 A;  2Q5A A;  4IQC A;  4C02 B;  3IKG A;  2M08 A;  3O5K A;  2DG9 A;  2PV1 A;  4IPX A;  1EYM A;  2PBC A;  3I6C A;  4MSP A;  2N87 A;  2PPO A;  5D75 A;  5HW6 A;  4QT3 A;  4FN2 A;  1N1A A;  1T11 A;  1ROT A;  1JVW A;  3VAW A;  1NMV A;  3PRB A;  2D9F A;  4DT4 A;  1JNT A;  3JYJ A;  1EQ3 A;  5DIT A;  2MF9 A;  2LKN A;  4DRM A;  4GIV A;  2RUQ A;  5HUA A;  5HW7 A;  1J4R A;  1FKK A;  2ZQU A;  3UI5 A;  1NSG A;  1FKL A;  2AWG A;  4ODN A;  3O5I A;  3RFW A;  3O5F A;  2IF4 A;  1J4H A;  2KFW A;  1HXV A;  3WH0 A;  1TCO C;  2XP9 A;  4FAP A;  1D6O A;  1FKS A;  2Y78 A;  1J6Y A;  4ITZ A;  5DIV A;  1FKR A;  4JFK A;  3MDY B;  2MNT A;  1F40 A;  4ODO A;  1L1P A;  3JXV A;  3EY6 A;  1BKF A;  4TW7 A;  2JZV A;  2XP8 A;  3O5P A;  2MLZ A;  3IK8 A;  3TDB A;  2VCD A;  2RSE A;  1FJD A;  3O5R A;  3UQA A;  3O5J A;  4QIB A;  3O5E A;  2ZR4 A;  1FKD A;  4W9O A;  4DIP A;  1QPF A;  1BL4 A;  1D7H A;  5HKG A;  2DG3 A;  3IKD A;  5J6E A;  1A7X A;  2ZR6 A;  3UQB A;  3LUO A;  3NTP A;  1YAT A;  2KR7 A;  2PV2 A;  2XPB A;  5HWC A;  1FKH A;  2ZQT A;  2MLX A;  2ITK A;  3KAC A;  1NMW A;  2KO7 A;  3NRK A;  3PA7 A;  1FKF A;  1Q6I A;  4DRI A;  3FAP A;  4DRN A;  4TW6 A;  2M1I A;  4NNR A;  3KAF A;  4U84 A;  3UI6 A;  3KAD A;  1ZCN A;  1YW5 A;  3O5M A;  4JFI A;  2F4E A;  3KAG A;  1FKB A;  4TYO A;  2UZ5 A;  2XP3 A;  1D7I A;  2ZQV A;  3UI4 A;  2PV3 A;  5I98 A;  4GGQ A;  4DZ2 A;  5BXJ A;  2K8I A;  4ODM A;  1FD9 A;  3KAB A;  3KZ7 A;  4R0X A;  4DRQ A;  3UF8 A;  1P5Q A;  4U86 A;  4U85 A;  3CGM A;  5HW8 A;  4BF8 A;  2XP5 A;  1J4I A;  2F2D A;  4JYS A;  4DRJ A;  1Q6H A;  3ODK A;  2LPV A;  3KAI A;  1F8A B;  4G2P A;  2L2S A;  3KAH A;  4JFL A;  5DIU A;  2DG4 A;  5HTG A;  1Q6U A;  1ZK6 A;  2OFN A;  1QZ2 A;  3O5O A;  3O5Q A;  4IQ2 A;  4LAX A;  3TCZ A;  2RUD A;  1Q1C A;  5HT1 A;  3OOB A; 
#chains in the Genus database with same CATH topology
 4QT2 A;  1U79 A;  1ZBC A;  2ZQS A;  1FKJ A;  4DRO A;  1D7J A;  2PPN A;  4WJX A;  3GPK A;  1M5Y A;  2EUL A;  4TX0 A;  4ODL A;  4LAW A;  2F21 A;  1ZBW A;  3RGC A;  4LAY A;  4N19 A;  3H9R B;  4DZ3 A;  1IX5 A;  4XAK A;  1KT1 A;  4J4N A;  1ITX A;  4ODQ A;  4W9Q A;  1E6N A;  2FAP A;  4URI A;  4TNS A;  1HKI A;  2G8Z A;  3IKG A;  5DF0 A;  3O5K A;  4QZV B;  3WIJ A;  5D75 A;  2N87 A;  2PPO A;  3ARW A;  1JVW A;  2A3E A;  3PRA A;  2YBU A;  1EQ3 A;  1GUV A;  4GIV A;  3GTY X;  5HW7 A;  2A3A A;  2ZQU A;  3UI5 A;  2AWG A;  1EDQ A;  4W5U A;  1LJY A;  1TCO C;  4HAR A;  3CH9 A;  1J6Y A;  1FKR A;  3B8S A;  1HJV A;  3CHC A;  4Z2J A;  1EHN A;  3O5R A;  4Z2G A;  3ARX A;  2ZR4 A;  1FKD A;  4W9O A;  2A3B A;  1WB0 A;  2ZR6 A;  3CHD A;  2KR7 A;  1ZBK A;  2DT2 A;  2MLX A;  1GOI A;  3PA7 A;  3AQU A;  1FKF A;  2AOS A;  4DRN A;  1CTN A;  2M1I A;  3KAF A;  4JFI A;  3EIP A;  4WK9 A;  2ZQV A;  1ZU8 A;  4DZ2 A;  5BXJ A;  1JNE A;  2FDM A;  3UF8 A;  4DWS D;  1P5Q A;  1O6I A;  3WKZ A;  2QF8 A;  3ODK A;  1XHG A;  3KAH A;  2DG4 A;  3O5Q A;  3O5O A;  4LAX A;  3TCZ A;  1H0I A;  2WLZ A;  2LGO A;  3CGN A;  1H0G A;  4HBE A;  4MNM A;  4P8U A;  3RM4 A;  1W1V A;  4MNK A;  5GPG A;  4G50 A;  3IHZ A;  2XPA A;  4J4O A;  1FFQ A;  1LL7 A;  3OA5 A;  2RQS A;  2B31 A;  4MTV A;  3PRD A;  2KGJ A;  2FKE A;  1SR0 A;  3B7X A;  2XP6 A;  1E9L A;  2MLY A;  3TC5 A;  3ARU A;  4JFJ A;  3AS0 A;  1KFW A;  2WLY A;  4S3J A;  3O5G A;  4IT4 A;  4PTM A;  2XP4 A;  4C02 B;  4MPK A;  3ARZ A;  4IPX A;  4MSP A;  1UR8 A;  5HW6 A;  4ZPW R;  1N1A A;  1NWS A;  1T11 A;  5HBF A;  2D9F A;  1E6R A;  3ALF A;  2ETN A;  2RUQ A;  5HUA A;  1J4R A;  4ODN A;  1ZB5 A;  3O5I A;  1HJX A;  4R5E A;  3RFW A;  3WH0 A;  3B9A A;  3ART A;  2XP9 A;  5DEZ A;  1E6Z A;  2Y78 A;  3AS1 A;  4Z2H A;  3JXV A;  1BKF A;  3O5P A;  1X6N A;  3IK8 A;  3TDB A;  2RSE A;  4WKH A;  1W1P A;  4DIP A;  1LL6 A;  5J6E A;  1A7X A;  4HBO A;  1WNO A;  3WD3 A;  3UQB A;  1LG1 A;  3ARP A;  1VF8 A;  2PV2 A;  5HWC A;  1HKK A;  1TFV A;  2WK2 A;  3NRK A;  3AS2 A;  3CHF A;  3WD1 A;  3FAP A;  4KQZ A;  4TW6 A;  4NNR A;  4U84 A;  3UI6 A;  1W1Y A;  4TYO A;  1YW5 A;  1D7I A;  1FD9 A;  3KAB A;  4R0X A;  1NH6 A;  4P8V A;  4U86 A;  2F2D A;  4UDM A;  4DRJ A;  1Q6H A;  2LPV A;  2L2S A;  1Q6U A;  2OFN A;  2RUD A;  1Q1C A;  5HT1 A;  3OOB A;  4Q7N A;  4DH0 A;  3ARS A;  3KCE A;  1R9H A;  1B6C A;  1Y0O A;  3O5L A;  1OGB A;  3ALG A;  1QPL A;  4DWS C;  1FKI A;  2DT3 A;  2RUR A;  2M2A A;  1HKM A;  4O2T A;  5HWB A;  1D2K A;  3RM9 A;  1W26 A;  1ROU A;  1XRV A;  2VN1 A;  1FJD A;  3O5D A;  4JFM A;  5HW8 A;  1PIN A;  1HJW A;  1FKT A;  4DRH A;  4W9P A;  1FKG A;  1JCH B;  4ODK A;  4LAV A;  2Q5A A;  4IQC A;  4S3K A;  3G6M A;  1E15 A;  4NZC A;  1EYM A;  2OLH A;  2PBC A;  4DWS B;  1X6L A;  1K9T A;  4FN2 A;  4ML4 A;  1ROT A;  1LQ0 A;  3WL1 A;  4DT4 A;  3PRB A;  2ESC A;  4Z2L A;  3JYJ A;  2MF9 A;  4DRM A;  1LL4 A;  3BMB A;  1NSG A;  2IF4 A;  2KFW A;  1HXV A;  4NSB A;  1D6O A;  1EIB A;  1GPF A;  2YBT A;  4JFK A;  3MDY B;  2IUZ A;  2MNT A;  4MNL A;  1L1P A;  3EY6 A;  4TW7 A;  2JZV A;  2XP8 A;  2MLZ A;  2VCD A;  2PI6 A;  3UQA A;  3O5J A;  4QIB A;  3FXY A;  3ARY A;  4KR0 B;  1D7H A;  3WD0 A;  1RD6 A;  3LUO A;  3NTP A;  2P4V A;  1ZL1 A;  1YAT A;  2G41 A;  5GQB A;  2XPB A;  2ZQT A;  1WAW A;  1ZBV A;  3KAC A;  4Z2I A;  3KAD A;  3O5M A;  4P8W A;  3KAG A;  1FKB A;  2UZ5 A;  2XP3 A;  5DO2 A;  2PV3 A;  5I98 A;  1NWU A;  4GGQ A;  3KZ7 A;  3W4R A;  3WL0 A;  1NWR A;  4U85 A;  4ZS6 A;  2XP5 A;  4LGX A;  4DWS A;  2DT1 A;  3KAI A;  4G2P A;  5HTG A;  4WKF A;  1F40 A;  1QZ2 A;  4P8X A;  5GPR A;  1HKJ A;  2DT0 A;  3AS3 A;  1KT0 A;  1C9H A;  3NI6 A;  2ZR5 A;  2PPP A;  3ARR A;  4ODP A;  2RUC A;  4Q22 A;  3RME A;  1PBK A;  4DRK A;  1W9U A;  4WKA A;  2LJ4 A;  4IT6 A;  4TW8 A;  2KE0 A;  3JYM A;  4MGV A;  2MPH A;  2KI3 A;  4DRP A;  1JNS A;  1OWQ A;  3UQI A;  4ODR A;  1FAP A;  5B8I C;  2XP7 A;  3ARQ A;  2M08 A;  2DG9 A;  2PV1 A;  3WD4 A;  3I6C A;  1E44 A;  4QT3 A;  3WQW A;  3ARO A;  3VAW A;  1NMV A;  3BXW A;  1JNT A;  1SYT A;  5DIT A;  2LKN A;  4L3N A;  1FKK A;  1JND A;  1W1T A;  1FKL A;  3O5F A;  2PN0 A;  1J4H A;  5JH8 A;  3WD2 A;  4FAP A;  1FKS A;  3B9E A;  4MNJ A;  4ITZ A;  5DIV A;  3ARV A;  4ODO A;  2F23 A;  2O92 A;  4ZPT R;  3B9D A;  3GU0 A;  3WQV A;  4ZPV R;  1NWT A;  3O5E A;  4WIW A;  1OGG A;  2O9O A;  1E6P A;  3PR9 A;  3FY1 A;  1QPF A;  1BL4 A;  3QOK A;  5HKG A;  1UR9 A;  2DSZ A;  2DG3 A;  3IKD A;  2B5U B;  1LG2 A;  3G6L A;  4L72 B;  1FKH A;  3RM8 A;  2ITK A;  1NMW A;  2KO7 A;  1Q6I A;  4DRI A;  1W9P A;  1ZCN A;  2F4E A;  3CZ8 A;  3UI4 A;  1FFR A;  2K8I A;  4ODM A;  4MAV A;  4DRQ A;  3CGM A;  4Z2K A;  4BF8 A;  2A3C A;  1J4I A;  4JYS A;  1W9V A;  3CHE A;  1F8A B;  2DSW A;  2DSU A;  2WM0 A;  4AY1 A;  4JFL A;  2DSV A;  2DPE A;  5DIU A;  1ZK6 A;  4IQ2 A;  1GRJ A; 
#chains in the Genus database with same CATH homology
 4QT2 A;  1U79 A;  1ZBC A;  2ZQS A;  1FKJ A;  4DRO A;  1D7J A;  2PPN A;  4WJX A;  3GPK A;  1M5Y A;  4TX0 A;  4ODL A;  4LAW A;  2F21 A;  1ZBW A;  3RGC A;  4LAY A;  4N19 A;  3H9R B;  4DZ3 A;  1IX5 A;  4XAK A;  1KT1 A;  4J4N A;  1ITX A;  4ODQ A;  4W9Q A;  1E6N A;  2FAP A;  4URI A;  4TNS A;  1HKI A;  2G8Z A;  3IKG A;  5DF0 A;  3O5K A;  4QZV B;  3WIJ A;  5D75 A;  2N87 A;  2PPO A;  3ARW A;  1JVW A;  2A3E A;  3PRA A;  2YBU A;  1EQ3 A;  1GUV A;  4GIV A;  5HW7 A;  2A3A A;  2ZQU A;  3UI5 A;  2AWG A;  1EDQ A;  4W5U A;  1LJY A;  1TCO C;  4HAR A;  3CH9 A;  1J6Y A;  1FKR A;  3B8S A;  1HJV A;  3CHC A;  4Z2J A;  1EHN A;  3O5R A;  4Z2G A;  3ARX A;  2ZR4 A;  1FKD A;  4W9O A;  2A3B A;  1WB0 A;  2ZR6 A;  3CHD A;  2KR7 A;  1ZBK A;  2DT2 A;  2MLX A;  1GOI A;  3PA7 A;  3AQU A;  1FKF A;  2AOS A;  4DRN A;  1CTN A;  2M1I A;  3KAF A;  4JFI A;  4WK9 A;  2ZQV A;  1ZU8 A;  4DZ2 A;  5BXJ A;  1JNE A;  2FDM A;  3UF8 A;  4DWS D;  1P5Q A;  1O6I A;  3WKZ A;  2QF8 A;  3ODK A;  1XHG A;  3KAH A;  2DG4 A;  3O5Q A;  3O5O A;  4LAX A;  3TCZ A;  1H0I A;  2WLZ A;  2LGO A;  3CGN A;  1H0G A;  4HBE A;  4MNM A;  4P8U A;  3RM4 A;  1W1V A;  4MNK A;  5GPG A;  4G50 A;  3IHZ A;  2XPA A;  4J4O A;  1FFQ A;  1LL7 A;  3OA5 A;  2RQS A;  2B31 A;  4MTV A;  3PRD A;  2KGJ A;  2FKE A;  1SR0 A;  3B7X A;  2XP6 A;  1E9L A;  2MLY A;  3TC5 A;  3ARU A;  4JFJ A;  3AS0 A;  1KFW A;  2WLY A;  4S3J A;  3O5G A;  4IT4 A;  4PTM A;  2XP4 A;  4C02 B;  4MPK A;  3ARZ A;  4IPX A;  4MSP A;  1UR8 A;  5HW6 A;  4ZPW R;  1N1A A;  1NWS A;  1T11 A;  5HBF A;  2D9F A;  1E6R A;  3ALF A;  2RUQ A;  5HUA A;  1J4R A;  4ODN A;  1ZB5 A;  3O5I A;  1HJX A;  4R5E A;  3RFW A;  3WH0 A;  3B9A A;  3ART A;  2XP9 A;  5DEZ A;  1E6Z A;  2Y78 A;  3AS1 A;  4Z2H A;  3JXV A;  1BKF A;  3O5P A;  1X6N A;  3IK8 A;  3TDB A;  2RSE A;  4WKH A;  1W1P A;  4DIP A;  1LL6 A;  5J6E A;  1A7X A;  4HBO A;  1WNO A;  3WD3 A;  3UQB A;  1LG1 A;  3ARP A;  1VF8 A;  2PV2 A;  5HWC A;  1HKK A;  1TFV A;  2WK2 A;  3NRK A;  3AS2 A;  3CHF A;  3WD1 A;  3FAP A;  4KQZ A;  4TW6 A;  4NNR A;  4U84 A;  3UI6 A;  1W1Y A;  4TYO A;  1YW5 A;  1D7I A;  1FD9 A;  3KAB A;  4R0X A;  1NH6 A;  4P8V A;  4U86 A;  2F2D A;  4DRJ A;  1Q6H A;  2LPV A;  2L2S A;  1Q6U A;  2OFN A;  2RUD A;  1Q1C A;  5HT1 A;  3OOB A;  4Q7N A;  4DH0 A;  3ARS A;  3KCE A;  1R9H A;  1B6C A;  1Y0O A;  3O5L A;  1OGB A;  3ALG A;  1QPL A;  4DWS C;  1FKI A;  2DT3 A;  2RUR A;  2M2A A;  1HKM A;  4O2T A;  5HWB A;  1D2K A;  3RM9 A;  1W26 A;  1ROU A;  1XRV A;  2VN1 A;  1FJD A;  3O5D A;  4JFM A;  5HW8 A;  1PIN A;  1HJW A;  1FKT A;  4DRH A;  4W9P A;  1FKG A;  4ODK A;  4LAV A;  2Q5A A;  4IQC A;  4S3K A;  3G6M A;  1E15 A;  4NZC A;  1EYM A;  2OLH A;  2PBC A;  4DWS B;  1X6L A;  1K9T A;  4FN2 A;  4ML4 A;  1ROT A;  1LQ0 A;  3WL1 A;  4DT4 A;  3PRB A;  2ESC A;  4Z2L A;  3JYJ A;  2MF9 A;  4DRM A;  1LL4 A;  1NSG A;  2IF4 A;  2KFW A;  1HXV A;  4NSB A;  1D6O A;  1EIB A;  1GPF A;  2YBT A;  4JFK A;  3MDY B;  2IUZ A;  2MNT A;  4MNL A;  1L1P A;  3EY6 A;  4TW7 A;  2JZV A;  2XP8 A;  2MLZ A;  2VCD A;  2PI6 A;  3UQA A;  3O5J A;  4QIB A;  3FXY A;  3ARY A;  4KR0 B;  1D7H A;  3WD0 A;  1RD6 A;  3LUO A;  3NTP A;  1ZL1 A;  1YAT A;  2G41 A;  5GQB A;  2XPB A;  2ZQT A;  1WAW A;  1ZBV A;  3KAC A;  4Z2I A;  3KAD A;  3O5M A;  4P8W A;  3KAG A;  1FKB A;  2UZ5 A;  2XP3 A;  5DO2 A;  2PV3 A;  5I98 A;  1NWU A;  4GGQ A;  3KZ7 A;  3W4R A;  3WL0 A;  1NWR A;  4U85 A;  4ZS6 A;  2XP5 A;  4LGX A;  4DWS A;  2DT1 A;  3KAI A;  4G2P A;  5HTG A;  4WKF A;  1F40 A;  1QZ2 A;  4P8X A;  5GPR A;  1HKJ A;  2DT0 A;  3AS3 A;  1KT0 A;  1C9H A;  3NI6 A;  2ZR5 A;  2PPP A;  3ARR A;  4ODP A;  2RUC A;  4Q22 A;  3RME A;  1PBK A;  4DRK A;  1W9U A;  4WKA A;  2LJ4 A;  4IT6 A;  4TW8 A;  2KE0 A;  3JYM A;  4MGV A;  2MPH A;  2KI3 A;  4DRP A;  1JNS A;  1OWQ A;  3UQI A;  4ODR A;  1FAP A;  5B8I C;  2XP7 A;  3ARQ A;  2M08 A;  2DG9 A;  2PV1 A;  3WD4 A;  3I6C A;  4QT3 A;  3WQW A;  3ARO A;  3VAW A;  1NMV A;  3BXW A;  1JNT A;  1SYT A;  5DIT A;  2LKN A;  4L3N A;  1FKK A;  1JND A;  1W1T A;  1FKL A;  3O5F A;  1J4H A;  5JH8 A;  3WD2 A;  4FAP A;  1FKS A;  3B9E A;  4MNJ A;  4ITZ A;  5DIV A;  3ARV A;  4ODO A;  2O92 A;  4ZPT R;  3B9D A;  3WQV A;  4ZPV R;  1NWT A;  3O5E A;  4WIW A;  1OGG A;  2O9O A;  1E6P A;  3PR9 A;  3FY1 A;  1QPF A;  1BL4 A;  3QOK A;  5HKG A;  1UR9 A;  2DSZ A;  2DG3 A;  3IKD A;  1LG2 A;  3G6L A;  4L72 B;  1FKH A;  3RM8 A;  2ITK A;  1NMW A;  2KO7 A;  1Q6I A;  4DRI A;  1W9P A;  1ZCN A;  2F4E A;  3CZ8 A;  3UI4 A;  1FFR A;  2K8I A;  4ODM A;  4MAV A;  4DRQ A;  3CGM A;  4Z2K A;  4BF8 A;  2A3C A;  1J4I A;  4JYS A;  1W9V A;  3CHE A;  1F8A B;  2DSW A;  2DSU A;  2WM0 A;  4AY1 A;  4JFL A;  2DSV A;  2DPE A;  5DIU A;  1ZK6 A;  4IQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...