1FAPA

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
publication title Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP.
pubmed rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fapA00
3KABA 1C9HA 1D7HA 2PPNA 1JNSA 1FKRA 2LJ4A 2RURA 1TCOC 1D7JA 2RUQA 3PRBA 4MGVA 4QT3A 1KT1A 3PA7A 4DRQA 3GPKA 3TCZA 3O5KA 2XP6A 4DRJA 1D6OA 2RUDA 5HTGA 1ROTA 4DZ2A 4U86A 4QIBA 2XP8A 4DRIA 3O5FA 4W9OA 4JFMA 4TYOA 2M1IA 1QZ2A 4IQ2A 1FKSA 2XP3A 2M08A 1FKIA 2ZQSA 1QPFA 2F4EA 2PV1A 4ODMA 3IKDA 4N19A 5DIUA 1B6CA 1FKKA 2MNTA 1BL4A 5HT1A 3FAPA 2OFNA 1NMVA 2N87A 4ODKA 4U85A 1J4RA 1FKTA 4TNSA 4LAYA 1YW5A 3IK8A 1NSGA 4ODOA 1FKJA 4JFIA 1KT0A 3O5MA 4DRNA 4ODQA 1FKBA 2XPAA 2XP9A 2VN1A 3JYJA 3EY6A 4FN2A 1Q6HA 4GGQA 2PV3A 3KAFA 1R9HA 1YATA 1J4HA 2Y78A 1T11A 1PBKA 2ZQTA 3NI6A 2PBCA 2Q5AA 2MPHA 3MDYB 3O5PA 1EYMA 1QPLA 2XP4A 2ZQUA 2IF4A 1Q1CA 2F21A 4IQCA 5GPGA 3H9RB 3B7XA 3KCEA 3RFWA 3TC5A 5J6EA 4NNRA 1BKFA 3NRKA 1JNTA 3ODKA 4O2TA 5DIVA 2L2SA 3UF8A 3NTPA 3UQIA 1Y0OA 4TW6A 2D9FA 2MLYA 3O5JA 4LAWA 2FAPA 5B8IC 4W9PA 4MSPA 2DG3A 3CGNA 3O5QA 1W26A 2VCDA 4LAVA 1M5YA 5I98A 2KFWA 4C02B 1A7XA 2PV2A 1FD9A 1ZK6A 2K8IA 4W9QA 2DG9A 3PRDA 2F2DA 3O5OA 2RSEA 4TX0A 1J6YA 5DITA 2XP7A 3KAIA 2KO7A 2ZR5A 4IPXA 3IKGA 1F8AB 2UZ5A 5HWBA 2RUCA 5HW8A 1J4IA 4DROA 2KGJA 4G50A 4JFKA 3I6CA 1P5QA 1F40A 3IHZA 4DT4A 5BXJA 4ITZA 1EQ3A 1ROUA 4DH0A 3WH0A 5HWCA 2MLXA 4LAXA 4ODRA 3UQBA 1ZCNA 2XPBA 4TW7A 5HUAA 1Q6IA 2PPOA 2ZQVA 2KI3A 4JFJA 2ITKA 3O5LA 3O5IA 3JXVA 1HXVA 3UQAA 4FAPA 2ZR4A 2LPVA 4J4NA 4U84A 2LKNA 3O5RA 1FAPA 4J4OA 4R0XA 4DRKA 3O5EA 3O5DA 3RGCA 1PINA 3KAHA 4DRPA 2FKEA 2KR7A 1FKFA 5HKGA 1NMWA 3O5GA 2KE0A 2ZR6A 3JYMA 3KADA 4GIVA 2M2AA 4ODPA 1FKDA 1FKLA 4QT2A 1FKGA 4DZ3A 2MF9A 4BF8A 5HW6A 3KZ7A 1JVWA 2DG4A 2AWGA 4DIPA 1FKHA 4G2PA 4JYSA 4ODLA 2MLZA 4DRMA 2RQSA 1Q6UA 3VAWA 2PPPA 3LUOA 4DRHA 5HW7A 4ODNA 1FJDA 3KAGA 4JFLA 3UI4A 5D75A 1N1AA 3UI5A 1U79A 2JZVA 3OOBA 3KACA 4TW8A 3TDBA 2LGOA 1D7IA 3CGMA 1L1PA 3UI6A 2XP5A
chains in the Genus database with same CATH superfamily
1C9HA 2PPNA 1NWRA 1EIBA 4MNMA 3PRBA 1NWSA 4MGVA 1CTNA 3WKZA 5HTGA 1ZBKA 2DPEA 1ROTA 4DZ2A 4P8UA 4DRIA 1W1TA 1ZB5A 4FAPA 4N19A 5DIUA 1FKKA 1BL4A 3OA5A 1H0IA 1NMVA 1YW5A 3ALGA 3ARQA 1FKJA 3O5MA 1FKBA 2PV3A 3ARTA 4NSBA 1J4HA 2Y78A 1PBKA 4W5UA 2PBCA 4TNSA 4DIPA 5GPGA 3UQIA 2IF4A 3RFWA 3CHCA 4NNRA 3BMBA 4O2TA 2IUZA 1JNTA 3FXYA 3NRKA 2DT2A 1Y0OA 4TW6A 2A3EA 2MLYA 3O5JA 1ITXA 4HBEA 4W9PA 3G6LA 2O9OA 2PN0A 4LAVA 5I98A 2KFWA 2B5UB 1ZBVA 2K8IA 3EIPA 2F2DA 2RSEA 3ARUA 3KAIA 2KO7A 3IKGA 4ZPVR 5HWBA 5HW8A 3AS2A 1FFQA 4ITZA 1GPFA 2MLXA 2XPBA 3WIJA 1Q6IA 3B8SA 1X6NA 1LJYA 2ITKA 2PI6A 3O5LA 1HXVA 2LPVA 4J4NA 1HKMA 4R0XA 1HKJA 4WKFA 1LG1A 1KFWA 1RD6A 3O5GA 2KE0A 2ZR6A 4GIVA 1WNOA 4TX0A 4URIA 4BF8A 2DG4A 1NWUA 2AWGA 2WLYA 3WD2A 4DRMA 3LUOA 4JFLA 2QF8A 3CGMA 2XP5A 1O6IA 3KABA 3RMEA 2RURA 1D2KA 1W1YA 1KT1A 4DRQA 4P8VA 4S3JA 4WK9A 1D6OA 1HKIA 4U86A 2O92A 1K9TA 4W9OA 3WD1A 1H0GA 4PTMA 4LGXA 1QZ2A 1FKSA 2M08A 1FKIA 2ZQSA 1QPFA 2PV1A 3ARYA 4ODMA 5HT1A 4Z2IA 1B6CA 2MNTA 2OLHA 3AS3A 4DWSB 3WL0A 4U85A 1FKTA 4LAYA 5GQBA 1HJWA 4DRNA 4ODQA 2XPAA 2XP9A 3QOKA 2VN1A 4GGQA 1T11A 3NI6A 3O5PA 2Q5AA 2ZQUA 1W1PA 1Q1CA 3H9RB 3TC5A 1ZBWA 1BKFA 2A3BA 4MAVA 4DWSA 2DT0A 2D9FA 3ARPA 3GU0A 5B8IC 3CHFA 1W1VA 1FFRA 4C02B 3ALFA 1ZL1A 5GPRA 3RM9A 2DG9A 3BXWA 3PRDA 3O5OA 1J6YA 1SYTA 2ZR5A 2WM0A 3FY1A 4JFKA 1WB0A 5BXJA 4IT4A 2P4VA 3CHDA 4DH0A 3WH0A 5HWCA 1GUVA 4ODRA 5HUAA 4ZPTR 3AS1A 4L3NA 3JXVA 3UQAA 3ARRA 4MPKA 3O5RA 1W9UA 4R5EA 3RM8A 4Z2GA 4ODPA 3JYMA 1NH6A 1UR8A 1FKDA 4QT2A 1JNDA 2DSVA 1E44A 3KZ7A 2EULA 2DSWA 4G2PA 2A3CA 1HJXA 2MLZA 4HBOA 5HW7A 1FJDA 1UR9A 4XAKA 3KACA 1D7IA 4DT4A 3WD3A 3WL1A 4Z2LA 1LL4A 4MTVA 1JNSA 2LJ4A 1TCOC 1D7JA 2RUQA 1OWQA 1LL6A 3PA7A 3WQWA 4WKAA 3GPKA 3TCZA 2XP6A 1ZU8A 2RUDA 1W9VA 4QIBA 2XP8A 3O5FA 2M1IA 1VF8A 2XP3A 4DWSC 3PRAA 2F4EA 1IX5A 3FAPA 2OFNA 2N87A 1J4RA 3IK8A 1NSGA 3ARXA 1Q6HA 3KAFA 1R9HA 1YATA 4DRPA 4FN2A 2MPHA 1EQ3A 2DSZA 2XP4A 4P8XA 2F21A 4IQCA 3B7XA 3KCEA 3CHEA 5J6EA 4NZCA 4DWSD 3WQVA 1E6ZA 3ARWA 5DIVA 2L2SA 3B9DA 1EHNA 1XHGA 4Z2JA 3CGNA 1NWTA 1W26A 3RM4A 2VCDA 2ESCA 1A7XA 4QZVB 1FD9A 4W9QA 4WKHA 2XP7A 1F8AB 2G41A 2UZ5A 2ETNA 1J4IA 2WLZA 4DROA 4G50A 3I6CA 1P5QA 2F23A 1F40A 3IHZA 4HARA 1ROUA 1ZCNA 2DSUA 4TW7A 2ZQVA 4KQZA 3PR9A 3O5IA 3B9EA 1TFVA 2ZR4A 2LKNA 4MNJA 1ZBCA 4Q22A 1FAPA 4J4OA 4DRKA 3O5EA 3O5DA 3RGCA 1LQ0A 1FKFA 3KADA 3ARZA 4Q7NA 5HW6A 4ZS6A 1FKHA 2RQSA 2PPPA 4DRHA 4MNKA 4ODNA 5DF0A 3KAGA 5D75A 1N1AA 3UI5A 1U79A 2JZVA 3OOBA 2LGOA 3G6MA 1L1PA 1D7HA 2DT3A 1FKRA 4QT3A 1HKKA 1JCHB 1HJVA 3W4RA 3ARVA 3O5KA 1GRJA 1W9PA 4L72B 2AOSA 4JFMA 4TYOA 2G8ZA 4IQ2A 3IKDA 2YBUA 2B31A 1LL7A 1OGBA 4ODKA 1E15A 3AQUA 4ODOA 4JFIA 1GOIA 1KT0A 5DEZA 3CZ8A 3JYJA 2WK2A 3EY6A 4ODLA 2ZQTA 2DT1A 4DRJA 3MDYB 1EYMA 1QPLA 5HBFA 2FDMA 4Z2KA 3ODKA 3UF8A 3NTPA 4AY1A 1E9LA 3CH9A 4LAWA 2FAPA 4MNLA 4MSPA 1XRVA 2DG3A 3O5QA 1EDQA 1M5YA 2PV2A 3WD4A 1ZK6A 1E6NA 5DITA 4WIWA 4IPXA 4ML4A 4UDMA 2RUCA 2KGJA 2A3AA 1WAWA 4IT6A 1SR0A 4LAXA 3UQBA 2PPOA 3B9AA 4S3KA 1E6PA 4WJXA 2KI3A 3AS0A 4JFJA 3GTYX 4U84A 4P8WA 1LG2A 1PINA 4ZPWR 3KAHA 2FKEA 2KR7A 1E6RA 1OGGA 5HKGA 5JH8A 1NMWA 2M2AA 4DZ3A 1FKLA 1FKGA 2MF9A 2YBTA 1JVWA 4JYSA 1Q6UA 3VAWA 4Z2HA 3WD0A 4KR0B 1JNEA 3ARSA 3UI4A 1X6LA 4TW8A 3TDBA 5DO2A 3UI6A 3AROA
chains in the Genus database with same CATH topology
1C9HA 2PPNA 1NWRA 1EIBA 4MNMA 3PRBA 1NWSA 4MGVA 1CTNA 3WKZA 5HTGA 1ZBKA 2DPEA 1ROTA 4DZ2A 4P8UA 4DRIA 1W1TA 1ZB5A 4FAPA 4N19A 5DIUA 1FKKA 1BL4A 3OA5A 1H0IA 1NMVA 1YW5A 3ALGA 3ARQA 1FKJA 3O5MA 1FKBA 2PV3A 3ARTA 4NSBA 1J4HA 2Y78A 1PBKA 4W5UA 2PBCA 4TNSA 4DIPA 5GPGA 3UQIA 2IF4A 3RFWA 3CHCA 4NNRA 4O2TA 2IUZA 1JNTA 3FXYA 3NRKA 2DT2A 1Y0OA 4TW6A 2A3EA 2MLYA 3O5JA 1ITXA 4HBEA 4W9PA 3G6LA 2O9OA 5I98A 4LAVA 2KFWA 1ZBVA 2K8IA 2F2DA 2RSEA 3ARUA 3KAIA 2KO7A 3IKGA 4ZPVR 5HWBA 5HW8A 3AS2A 1FFQA 4ITZA 1GPFA 2MLXA 2XPBA 3WIJA 1Q6IA 3B8SA 1X6NA 1LJYA 2ITKA 2PI6A 3O5LA 1HXVA 2LPVA 4J4NA 1HKMA 4R0XA 1HKJA 4WKFA 1LG1A 1KFWA 1RD6A 3O5GA 2KE0A 2ZR6A 4GIVA 1WNOA 4TX0A 4URIA 4BF8A 2DG4A 1NWUA 2AWGA 2WLYA 3WD2A 4DRMA 3LUOA 4JFLA 2QF8A 3CGMA 2XP5A 1O6IA 3KABA 3RMEA 2RURA 1D2KA 1W1YA 1KT1A 4DRQA 4P8VA 4S3JA 4WK9A 1D6OA 1HKIA 4U86A 2O92A 1K9TA 4W9OA 3WD1A 1H0GA 4PTMA 4LGXA 1QZ2A 1FKSA 2M08A 1FKIA 2ZQSA 1QPFA 2PV1A 3ARYA 4ODMA 5HT1A 4Z2IA 1B6CA 2MNTA 2OLHA 3AS3A 4DWSB 3WL0A 4U85A 1FKTA 4LAYA 5GQBA 1HJWA 4DRNA 4ODQA 2XPAA 2XP9A 3QOKA 2VN1A 4GGQA 1T11A 3NI6A 3O5PA 2Q5AA 2ZQUA 1W1PA 1Q1CA 3H9RB 3TC5A 1ZBWA 1BKFA 2A3BA 4MAVA 4DWSA 2DT0A 2D9FA 3ARPA 5B8IC 3CHFA 1W1VA 1FFRA 4C02B 3ALFA 1ZL1A 5GPRA 3RM9A 2DG9A 3BXWA 3PRDA 3O5OA 1J6YA 1SYTA 2ZR5A 2WM0A 3FY1A 4JFKA 1WB0A 5BXJA 4IT4A 3CHDA 4DH0A 3WH0A 5HWCA 1GUVA 4ODRA 5HUAA 4ZPTR 3AS1A 4L3NA 3JXVA 3UQAA 3ARRA 4MPKA 3O5RA 1W9UA 4R5EA 3RM8A 4Z2GA 4ODPA 3JYMA 1NH6A 1UR8A 1FKDA 4QT2A 1JNDA 2DSVA 3KZ7A 2DSWA 4G2PA 2A3CA 1HJXA 2MLZA 4HBOA 5HW7A 1FJDA 1UR9A 4XAKA 3KACA 1D7IA 4DT4A 3WD3A 3WL1A 4Z2LA 1LL4A 4MTVA 1JNSA 2LJ4A 1TCOC 1D7JA 2RUQA 1OWQA 1LL6A 3PA7A 3WQWA 4WKAA 3GPKA 3TCZA 2XP6A 1ZU8A 2RUDA 1W9VA 4QIBA 2XP8A 3O5FA 2M1IA 1VF8A 2XP3A 4DWSC 3PRAA 2F4EA 1IX5A 3FAPA 2OFNA 2N87A 1J4RA 3IK8A 1NSGA 3ARXA 1Q6HA 3KAFA 1R9HA 1YATA 4DRPA 4FN2A 2MPHA 1EQ3A 2DSZA 2XP4A 4P8XA 2F21A 4IQCA 3B7XA 3KCEA 3CHEA 5J6EA 4NZCA 4DWSD 3WQVA 1E6ZA 3ARWA 5DIVA 2L2SA 3B9DA 1EHNA 1XHGA 4Z2JA 3CGNA 1NWTA 1W26A 3RM4A 2VCDA 2ESCA 1A7XA 4QZVB 1FD9A 4W9QA 4WKHA 2XP7A 1F8AB 2G41A 2UZ5A 1J4IA 2WLZA 4DROA 4G50A 3I6CA 1P5QA 1F40A 3IHZA 4HARA 1ROUA 1ZCNA 2DSUA 4TW7A 2ZQVA 4KQZA 3PR9A 3O5IA 3B9EA 1TFVA 2ZR4A 2LKNA 4MNJA 1ZBCA 4Q22A 1FAPA 4J4OA 4DRKA 3O5EA 3O5DA 3RGCA 1LQ0A 1FKFA 3KADA 3ARZA 4Q7NA 5HW6A 4ZS6A 1FKHA 2RQSA 2PPPA 4DRHA 4MNKA 4ODNA 5DF0A 3KAGA 5D75A 1N1AA 3UI5A 1U79A 2JZVA 3OOBA 2LGOA 3G6MA 1L1PA 1D7HA 2DT3A 1FKRA 4QT3A 1HKKA 1HJVA 3W4RA 3ARVA 3O5KA 1W9PA 4L72B 2AOSA 4JFMA 4TYOA 2G8ZA 4IQ2A 3IKDA 2YBUA 2B31A 1LL7A 1OGBA 4ODKA 1E15A 3AQUA 4ODOA 4JFIA 1GOIA 1KT0A 5DEZA 3CZ8A 3JYJA 2WK2A 3EY6A 4ODLA 2ZQTA 2DT1A 4DRJA 3MDYB 1EYMA 1QPLA 5HBFA 2FDMA 4Z2KA 3ODKA 3UF8A 3NTPA 4AY1A 1E9LA 3CH9A 4LAWA 2FAPA 4MNLA 4MSPA 1XRVA 2DG3A 3O5QA 1EDQA 1M5YA 2PV2A 3WD4A 1ZK6A 1E6NA 5DITA 4WIWA 4IPXA 4ML4A 2RUCA 2KGJA 2A3AA 1WAWA 4IT6A 1SR0A 4LAXA 3UQBA 2PPOA 3B9AA 4S3KA 1E6PA 4WJXA 2KI3A 3AS0A 4JFJA 4U84A 4P8WA 1LG2A 1PINA 4ZPWR 3KAHA 2FKEA 2KR7A 1E6RA 1OGGA 5HKGA 5JH8A 1NMWA 2M2AA 4DZ3A 1FKLA 1FKGA 2MF9A 2YBTA 1JVWA 4JYSA 1Q6UA 3VAWA 4Z2HA 3WD0A 4KR0B 1JNEA 3ARSA 3UI4A 1X6LA 4TW8A 3TDBA 5DO2A 3UI6A 3AROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAB A;  1C9H A;  1D7H A;  2PPN A;  1JNS A;  1FKR A;  2LJ4 A;  2RUR A;  1TCO C;  1D7J A;  2RUQ A;  3PRB A;  4MGV A;  4QT3 A;  1KT1 A;  3PA7 A;  4DRQ A;  3GPK A;  3TCZ A;  3O5K A;  2XP6 A;  4DRJ A;  1D6O A;  2RUD A;  5HTG A;  1ROT A;  4DZ2 A;  4U86 A;  4QIB A;  2XP8 A;  4DRI A;  3O5F A;  4W9O A;  4JFM A;  4TYO A;  2M1I A;  1QZ2 A;  4IQ2 A;  1FKS A;  2XP3 A;  2M08 A;  1FKI A;  2ZQS A;  1QPF A;  2F4E A;  2PV1 A;  4ODM A;  3IKD A;  4N19 A;  5DIU A;  1B6C A;  1FKK A;  2MNT A;  1BL4 A;  5HT1 A;  3FAP A;  2OFN A;  1NMV A;  2N87 A;  4ODK A;  4U85 A;  1J4R A;  1FKT A;  4TNS A;  4LAY A;  1YW5 A;  3IK8 A;  1NSG A;  4ODO A;  1FKJ A;  4JFI A;  1KT0 A;  3O5M A;  4DRN A;  4ODQ A;  1FKB A;  2XPA A;  2XP9 A;  2VN1 A;  3JYJ A;  3EY6 A;  4FN2 A;  1Q6H A;  4GGQ A;  2PV3 A;  3KAF A;  1R9H A;  1YAT A;  1J4H A;  2Y78 A;  1T11 A;  1PBK A;  2ZQT A;  3NI6 A;  2PBC A;  2Q5A A;  2MPH A;  3MDY B;  3O5P A;  1EYM A;  1QPL A;  2XP4 A;  2ZQU A;  2IF4 A;  1Q1C A;  2F21 A;  4IQC A;  5GPG A;  3H9R B;  3B7X A;  3KCE A;  3RFW A;  3TC5 A;  5J6E A;  4NNR A;  1BKF A;  3NRK A;  1JNT A;  3ODK A;  4O2T A;  5DIV A;  2L2S A;  3UF8 A;  3NTP A;  3UQI A;  1Y0O A;  4TW6 A;  2D9F A;  2MLY A;  3O5J A;  4LAW A;  2FAP A;  5B8I C;  4W9P A;  4MSP A;  2DG3 A;  3CGN A;  3O5Q A;  1W26 A;  2VCD A;  4LAV A;  1M5Y A;  5I98 A;  2KFW A;  4C02 B;  1A7X A;  2PV2 A;  1FD9 A;  1ZK6 A;  2K8I A;  4W9Q A;  2DG9 A;  3PRD A;  2F2D A;  3O5O A;  2RSE A;  4TX0 A;  1J6Y A;  5DIT A;  2XP7 A;  3KAI A;  2KO7 A;  2ZR5 A;  4IPX A;  3IKG A;  1F8A B;  2UZ5 A;  5HWB A;  2RUC A;  5HW8 A;  1J4I A;  4DRO A;  2KGJ A;  4G50 A;  4JFK A;  3I6C A;  1P5Q A;  1F40 A;  3IHZ A;  4DT4 A;  5BXJ A;  4ITZ A;  1EQ3 A;  1ROU A;  4DH0 A;  3WH0 A;  5HWC A;  2MLX A;  4LAX A;  4ODR A;  3UQB A;  1ZCN A;  2XPB A;  4TW7 A;  5HUA A;  1Q6I A;  2PPO A;  2ZQV A;  2KI3 A;  4JFJ A;  2ITK A;  3O5L A;  3O5I A;  3JXV A;  1HXV A;  3UQA A;  4FAP A;  2ZR4 A;  2LPV A;  4J4N A;  4U84 A;  2LKN A;  3O5R A;  1FAP A;  4J4O A;  4R0X A;  4DRK A;  3O5E A;  3O5D A;  3RGC A;  1PIN A;  3KAH A;  4DRP A;  2FKE A;  2KR7 A;  1FKF A;  5HKG A;  1NMW A;  3O5G A;  2KE0 A;  2ZR6 A;  3JYM A;  3KAD A;  4GIV A;  2M2A A;  4ODP A;  1FKD A;  1FKL A;  4QT2 A;  1FKG A;  4DZ3 A;  2MF9 A;  4BF8 A;  5HW6 A;  3KZ7 A;  1JVW A;  2DG4 A;  2AWG A;  4DIP A;  1FKH A;  4G2P A;  4JYS A;  4ODL A;  2MLZ A;  4DRM A;  2RQS A;  1Q6U A;  3VAW A;  2PPP A;  3LUO A;  4DRH A;  5HW7 A;  4ODN A;  1FJD A;  3KAG A;  4JFL A;  3UI4 A;  5D75 A;  1N1A A;  3UI5 A;  1U79 A;  2JZV A;  3OOB A;  3KAC A;  4TW8 A;  3TDB A;  2LGO A;  1D7I A;  3CGM A;  1L1P A;  3UI6 A;  2XP5 A; 
#chains in the Genus database with same CATH topology
 1C9H A;  2PPN A;  1NWR A;  1EIB A;  4MNM A;  3PRB A;  1NWS A;  4MGV A;  1CTN A;  3WKZ A;  5HTG A;  1ZBK A;  2DPE A;  1ROT A;  4DZ2 A;  4P8U A;  4DRI A;  1W1T A;  1ZB5 A;  4FAP A;  4N19 A;  5DIU A;  1FKK A;  1BL4 A;  3OA5 A;  1H0I A;  1NMV A;  1YW5 A;  3ALG A;  3ARQ A;  1FKJ A;  3O5M A;  1FKB A;  2PV3 A;  3ART A;  4NSB A;  1J4H A;  2Y78 A;  1PBK A;  4W5U A;  2PBC A;  4TNS A;  4DIP A;  5GPG A;  3UQI A;  2IF4 A;  3RFW A;  3CHC A;  4NNR A;  3BMB A;  4O2T A;  2IUZ A;  1JNT A;  3FXY A;  3NRK A;  2DT2 A;  1Y0O A;  4TW6 A;  2A3E A;  2MLY A;  3O5J A;  1ITX A;  4HBE A;  4W9P A;  3G6L A;  2O9O A;  2PN0 A;  4LAV A;  5I98 A;  2KFW A;  2B5U B;  1ZBV A;  2K8I A;  3EIP A;  2F2D A;  2RSE A;  3ARU A;  3KAI A;  2KO7 A;  3IKG A;  4ZPV R;  5HWB A;  5HW8 A;  3AS2 A;  1FFQ A;  4ITZ A;  1GPF A;  2MLX A;  2XPB A;  3WIJ A;  1Q6I A;  3B8S A;  1X6N A;  1LJY A;  2ITK A;  2PI6 A;  3O5L A;  1HXV A;  2LPV A;  4J4N A;  1HKM A;  4R0X A;  1HKJ A;  4WKF A;  1LG1 A;  1KFW A;  1RD6 A;  3O5G A;  2KE0 A;  2ZR6 A;  4GIV A;  1WNO A;  4TX0 A;  4URI A;  4BF8 A;  2DG4 A;  1NWU A;  2AWG A;  2WLY A;  3WD2 A;  4DRM A;  3LUO A;  4JFL A;  2QF8 A;  3CGM A;  2XP5 A;  1O6I A;  3KAB A;  3RME A;  2RUR A;  1D2K A;  1W1Y A;  1KT1 A;  4DRQ A;  4P8V A;  4S3J A;  4WK9 A;  1D6O A;  1HKI A;  4U86 A;  2O92 A;  1K9T A;  4W9O A;  3WD1 A;  1H0G A;  4PTM A;  4LGX A;  1QZ2 A;  1FKS A;  2M08 A;  1FKI A;  2ZQS A;  1QPF A;  2PV1 A;  3ARY A;  4ODM A;  5HT1 A;  4Z2I A;  1B6C A;  2MNT A;  2OLH A;  3AS3 A;  4DWS B;  3WL0 A;  4U85 A;  1FKT A;  4LAY A;  5GQB A;  1HJW A;  4DRN A;  4ODQ A;  2XPA A;  2XP9 A;  3QOK A;  2VN1 A;  4GGQ A;  1T11 A;  3NI6 A;  3O5P A;  2Q5A A;  2ZQU A;  1W1P A;  1Q1C A;  3H9R B;  3TC5 A;  1ZBW A;  1BKF A;  2A3B A;  4MAV A;  4DWS A;  2DT0 A;  2D9F A;  3ARP A;  3GU0 A;  5B8I C;  3CHF A;  1W1V A;  1FFR A;  4C02 B;  3ALF A;  1ZL1 A;  5GPR A;  3RM9 A;  2DG9 A;  3BXW A;  3PRD A;  3O5O A;  1J6Y A;  1SYT A;  2ZR5 A;  2WM0 A;  3FY1 A;  4JFK A;  1WB0 A;  5BXJ A;  4IT4 A;  2P4V A;  3CHD A;  4DH0 A;  3WH0 A;  5HWC A;  1GUV A;  4ODR A;  5HUA A;  4ZPT R;  3AS1 A;  4L3N A;  3JXV A;  3UQA A;  3ARR A;  4MPK A;  3O5R A;  1W9U A;  4R5E A;  3RM8 A;  4Z2G A;  4ODP A;  3JYM A;  1NH6 A;  1UR8 A;  1FKD A;  4QT2 A;  1JND A;  2DSV A;  1E44 A;  3KZ7 A;  2EUL A;  2DSW A;  4G2P A;  2A3C A;  1HJX A;  2MLZ A;  4HBO A;  5HW7 A;  1FJD A;  1UR9 A;  4XAK A;  3KAC A;  1D7I A;  4DT4 A;  3WD3 A;  3WL1 A;  4Z2L A;  1LL4 A;  4MTV A;  1JNS A;  2LJ4 A;  1TCO C;  1D7J A;  2RUQ A;  1OWQ A;  1LL6 A;  3PA7 A;  3WQW A;  4WKA A;  3GPK A;  3TCZ A;  2XP6 A;  1ZU8 A;  2RUD A;  1W9V A;  4QIB A;  2XP8 A;  3O5F A;  2M1I A;  1VF8 A;  2XP3 A;  4DWS C;  3PRA A;  2F4E A;  1IX5 A;  3FAP A;  2OFN A;  2N87 A;  1J4R A;  3IK8 A;  1NSG A;  3ARX A;  1Q6H A;  3KAF A;  1R9H A;  1YAT A;  4DRP A;  4FN2 A;  2MPH A;  1EQ3 A;  2DSZ A;  2XP4 A;  4P8X A;  2F21 A;  4IQC A;  3B7X A;  3KCE A;  3CHE A;  5J6E A;  4NZC A;  4DWS D;  3WQV A;  1E6Z A;  3ARW A;  5DIV A;  2L2S A;  3B9D A;  1EHN A;  1XHG A;  4Z2J A;  3CGN A;  1NWT A;  1W26 A;  3RM4 A;  2VCD A;  2ESC A;  1A7X A;  4QZV B;  1FD9 A;  4W9Q A;  4WKH A;  2XP7 A;  1F8A B;  2G41 A;  2UZ5 A;  2ETN A;  1J4I A;  2WLZ A;  4DRO A;  4G50 A;  3I6C A;  1P5Q A;  2F23 A;  1F40 A;  3IHZ A;  4HAR A;  1ROU A;  1ZCN A;  2DSU A;  4TW7 A;  2ZQV A;  4KQZ A;  3PR9 A;  3O5I A;  3B9E A;  1TFV A;  2ZR4 A;  2LKN A;  4MNJ A;  1ZBC A;  4Q22 A;  1FAP A;  4J4O A;  4DRK A;  3O5E A;  3O5D A;  3RGC A;  1LQ0 A;  1FKF A;  3KAD A;  3ARZ A;  4Q7N A;  5HW6 A;  4ZS6 A;  1FKH A;  2RQS A;  2PPP A;  4DRH A;  4MNK A;  4ODN A;  5DF0 A;  3KAG A;  5D75 A;  1N1A A;  3UI5 A;  1U79 A;  2JZV A;  3OOB A;  2LGO A;  3G6M A;  1L1P A;  1D7H A;  2DT3 A;  1FKR A;  4QT3 A;  1HKK A;  1JCH B;  1HJV A;  3W4R A;  3ARV A;  3O5K A;  1GRJ A;  1W9P A;  4L72 B;  2AOS A;  4JFM A;  4TYO A;  2G8Z A;  4IQ2 A;  3IKD A;  2YBU A;  2B31 A;  1LL7 A;  1OGB A;  4ODK A;  1E15 A;  3AQU A;  4ODO A;  4JFI A;  1GOI A;  1KT0 A;  5DEZ A;  3CZ8 A;  3JYJ A;  2WK2 A;  3EY6 A;  4ODL A;  2ZQT A;  2DT1 A;  4DRJ A;  3MDY B;  1EYM A;  1QPL A;  5HBF A;  2FDM A;  4Z2K A;  3ODK A;  3UF8 A;  3NTP A;  4AY1 A;  1E9L A;  3CH9 A;  4LAW A;  2FAP A;  4MNL A;  4MSP A;  1XRV A;  2DG3 A;  3O5Q A;  1EDQ A;  1M5Y A;  2PV2 A;  3WD4 A;  1ZK6 A;  1E6N A;  5DIT A;  4WIW A;  4IPX A;  4ML4 A;  4UDM A;  2RUC A;  2KGJ A;  2A3A A;  1WAW A;  4IT6 A;  1SR0 A;  4LAX A;  3UQB A;  2PPO A;  3B9A A;  4S3K A;  1E6P A;  4WJX A;  2KI3 A;  3AS0 A;  4JFJ A;  3GTY X;  4U84 A;  4P8W A;  1LG2 A;  1PIN A;  4ZPW R;  3KAH A;  2FKE A;  2KR7 A;  1E6R A;  1OGG A;  5HKG A;  5JH8 A;  1NMW A;  2M2A A;  4DZ3 A;  1FKL A;  1FKG A;  2MF9 A;  2YBT A;  1JVW A;  4JYS A;  1Q6U A;  3VAW A;  4Z2H A;  3WD0 A;  4KR0 B;  1JNE A;  3ARS A;  3UI4 A;  1X6L A;  4TW8 A;  3TDB A;  5DO2 A;  3UI6 A;  3ARO A; 
#chains in the Genus database with same CATH homology
 1C9H A;  2PPN A;  1NWR A;  1EIB A;  4MNM A;  3PRB A;  1NWS A;  4MGV A;  1CTN A;  3WKZ A;  5HTG A;  1ZBK A;  2DPE A;  1ROT A;  4DZ2 A;  4P8U A;  4DRI A;  1W1T A;  1ZB5 A;  4FAP A;  4N19 A;  5DIU A;  1FKK A;  1BL4 A;  3OA5 A;  1H0I A;  1NMV A;  1YW5 A;  3ALG A;  3ARQ A;  1FKJ A;  3O5M A;  1FKB A;  2PV3 A;  3ART A;  4NSB A;  1J4H A;  2Y78 A;  1PBK A;  4W5U A;  2PBC A;  4TNS A;  4DIP A;  5GPG A;  3UQI A;  2IF4 A;  3RFW A;  3CHC A;  4NNR A;  4O2T A;  2IUZ A;  1JNT A;  3FXY A;  3NRK A;  2DT2 A;  1Y0O A;  4TW6 A;  2A3E A;  2MLY A;  3O5J A;  1ITX A;  4HBE A;  4W9P A;  3G6L A;  2O9O A;  5I98 A;  4LAV A;  2KFW A;  1ZBV A;  2K8I A;  2F2D A;  2RSE A;  3ARU A;  3KAI A;  2KO7 A;  3IKG A;  4ZPV R;  5HWB A;  5HW8 A;  3AS2 A;  1FFQ A;  4ITZ A;  1GPF A;  2MLX A;  2XPB A;  3WIJ A;  1Q6I A;  3B8S A;  1X6N A;  1LJY A;  2ITK A;  2PI6 A;  3O5L A;  1HXV A;  2LPV A;  4J4N A;  1HKM A;  4R0X A;  1HKJ A;  4WKF A;  1LG1 A;  1KFW A;  1RD6 A;  3O5G A;  2KE0 A;  2ZR6 A;  4GIV A;  1WNO A;  4TX0 A;  4URI A;  4BF8 A;  2DG4 A;  1NWU A;  2AWG A;  2WLY A;  3WD2 A;  4DRM A;  3LUO A;  4JFL A;  2QF8 A;  3CGM A;  2XP5 A;  1O6I A;  3KAB A;  3RME A;  2RUR A;  1D2K A;  1W1Y A;  1KT1 A;  4DRQ A;  4P8V A;  4S3J A;  4WK9 A;  1D6O A;  1HKI A;  4U86 A;  2O92 A;  1K9T A;  4W9O A;  3WD1 A;  1H0G A;  4PTM A;  4LGX A;  1QZ2 A;  1FKS A;  2M08 A;  1FKI A;  2ZQS A;  1QPF A;  2PV1 A;  3ARY A;  4ODM A;  5HT1 A;  4Z2I A;  1B6C A;  2MNT A;  2OLH A;  3AS3 A;  4DWS B;  3WL0 A;  4U85 A;  1FKT A;  4LAY A;  5GQB A;  1HJW A;  4DRN A;  4ODQ A;  2XPA A;  2XP9 A;  3QOK A;  2VN1 A;  4GGQ A;  1T11 A;  3NI6 A;  3O5P A;  2Q5A A;  2ZQU A;  1W1P A;  1Q1C A;  3H9R B;  3TC5 A;  1ZBW A;  1BKF A;  2A3B A;  4MAV A;  4DWS A;  2DT0 A;  2D9F A;  3ARP A;  5B8I C;  3CHF A;  1W1V A;  1FFR A;  4C02 B;  3ALF A;  1ZL1 A;  5GPR A;  3RM9 A;  2DG9 A;  3BXW A;  3PRD A;  3O5O A;  1J6Y A;  1SYT A;  2ZR5 A;  2WM0 A;  3FY1 A;  4JFK A;  1WB0 A;  5BXJ A;  4IT4 A;  3CHD A;  4DH0 A;  3WH0 A;  5HWC A;  1GUV A;  4ODR A;  5HUA A;  4ZPT R;  3AS1 A;  4L3N A;  3JXV A;  3UQA A;  3ARR A;  4MPK A;  3O5R A;  1W9U A;  4R5E A;  3RM8 A;  4Z2G A;  4ODP A;  3JYM A;  1NH6 A;  1UR8 A;  1FKD A;  4QT2 A;  1JND A;  2DSV A;  3KZ7 A;  2DSW A;  4G2P A;  2A3C A;  1HJX A;  2MLZ A;  4HBO A;  5HW7 A;  1FJD A;  1UR9 A;  4XAK A;  3KAC A;  1D7I A;  4DT4 A;  3WD3 A;  3WL1 A;  4Z2L A;  1LL4 A;  4MTV A;  1JNS A;  2LJ4 A;  1TCO C;  1D7J A;  2RUQ A;  1OWQ A;  1LL6 A;  3PA7 A;  3WQW A;  4WKA A;  3GPK A;  3TCZ A;  2XP6 A;  1ZU8 A;  2RUD A;  1W9V A;  4QIB A;  2XP8 A;  3O5F A;  2M1I A;  1VF8 A;  2XP3 A;  4DWS C;  3PRA A;  2F4E A;  1IX5 A;  3FAP A;  2OFN A;  2N87 A;  1J4R A;  3IK8 A;  1NSG A;  3ARX A;  1Q6H A;  3KAF A;  1R9H A;  1YAT A;  4DRP A;  4FN2 A;  2MPH A;  1EQ3 A;  2DSZ A;  2XP4 A;  4P8X A;  2F21 A;  4IQC A;  3B7X A;  3KCE A;  3CHE A;  5J6E A;  4NZC A;  4DWS D;  3WQV A;  1E6Z A;  3ARW A;  5DIV A;  2L2S A;  3B9D A;  1EHN A;  1XHG A;  4Z2J A;  3CGN A;  1NWT A;  1W26 A;  3RM4 A;  2VCD A;  2ESC A;  1A7X A;  4QZV B;  1FD9 A;  4W9Q A;  4WKH A;  2XP7 A;  1F8A B;  2G41 A;  2UZ5 A;  1J4I A;  2WLZ A;  4DRO A;  4G50 A;  3I6C A;  1P5Q A;  1F40 A;  3IHZ A;  4HAR A;  1ROU A;  1ZCN A;  2DSU A;  4TW7 A;  2ZQV A;  4KQZ A;  3PR9 A;  3O5I A;  3B9E A;  1TFV A;  2ZR4 A;  2LKN A;  4MNJ A;  1ZBC A;  4Q22 A;  1FAP A;  4J4O A;  4DRK A;  3O5E A;  3O5D A;  3RGC A;  1LQ0 A;  1FKF A;  3KAD A;  3ARZ A;  4Q7N A;  5HW6 A;  4ZS6 A;  1FKH A;  2RQS A;  2PPP A;  4DRH A;  4MNK A;  4ODN A;  5DF0 A;  3KAG A;  5D75 A;  1N1A A;  3UI5 A;  1U79 A;  2JZV A;  3OOB A;  2LGO A;  3G6M A;  1L1P A;  1D7H A;  2DT3 A;  1FKR A;  4QT3 A;  1HKK A;  1HJV A;  3W4R A;  3ARV A;  3O5K A;  1W9P A;  4L72 B;  2AOS A;  4JFM A;  4TYO A;  2G8Z A;  4IQ2 A;  3IKD A;  2YBU A;  2B31 A;  1LL7 A;  1OGB A;  4ODK A;  1E15 A;  3AQU A;  4ODO A;  4JFI A;  1GOI A;  1KT0 A;  5DEZ A;  3CZ8 A;  3JYJ A;  2WK2 A;  3EY6 A;  4ODL A;  2ZQT A;  2DT1 A;  4DRJ A;  3MDY B;  1EYM A;  1QPL A;  5HBF A;  2FDM A;  4Z2K A;  3ODK A;  3UF8 A;  3NTP A;  4AY1 A;  1E9L A;  3CH9 A;  4LAW A;  2FAP A;  4MNL A;  4MSP A;  1XRV A;  2DG3 A;  3O5Q A;  1EDQ A;  1M5Y A;  2PV2 A;  3WD4 A;  1ZK6 A;  1E6N A;  5DIT A;  4WIW A;  4IPX A;  4ML4 A;  2RUC A;  2KGJ A;  2A3A A;  1WAW A;  4IT6 A;  1SR0 A;  4LAX A;  3UQB A;  2PPO A;  3B9A A;  4S3K A;  1E6P A;  4WJX A;  2KI3 A;  3AS0 A;  4JFJ A;  4U84 A;  4P8W A;  1LG2 A;  1PIN A;  4ZPW R;  3KAH A;  2FKE A;  2KR7 A;  1E6R A;  1OGG A;  5HKG A;  5JH8 A;  1NMW A;  2M2A A;  4DZ3 A;  1FKL A;  1FKG A;  2MF9 A;  2YBT A;  1JVW A;  4JYS A;  1Q6U A;  3VAW A;  4Z2H A;  3WD0 A;  4KR0 B;  1JNE A;  3ARS A;  3UI4 A;  1X6L A;  4TW8 A;  3TDB A;  5DO2 A;  3UI6 A;  3ARO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...