1FAPA

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP.
pubmed rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fapA00
1TCOC 1J4IA 3PA7A 3PRBA 1N1AA 3KACA 1NMVA 1ROTA 2KFWA 1FKLA 1D6OA 1PINA 2Y78A 3GPKA 4LAWA 1U79A 2LJ4A 1NSGA 3IKDA 3JXVA 3H9RB 1W26A 2KE0A 4TW6A 3RFWA 4FAPA 5HKGA 2PV2A 4DRIA 1F40A 1C9HA 1J4HA 3WH0A 1FKBA 1F8AB 2KO7A 3NTPA 1FKTA 1QZ2A 2XP7A 4DZ3A 5BXJA 2RUQA 4W9PA 1QPLA 4TW7A 1FKRA 4LAXA 2ZQUA 4GIVA 2FKEA 4GGQA 3KADA 2MNTA 4DRHA 5I98A 1FKFA 2DG4A 2XP5A 2XP4A 2LGOA 2XPBA 1YW5A 3CGMA 4DT4A 4JFJA 2M08A 5HW7A 3UI5A 5DITA 2MF9A 2JZVA 3O5LA 2RQSA 5B8IC 1EQ3A 4DH0A 1YATA 3KAGA 3KAFA 2RUDA 1J4RA 2RURA 2F4EA 2KR7A 1Q6HA 2MLYA 4W9QA 5HTGA 2K8IA 4BF8A 3IHZA 3TCZA 4TYOA 4JFLA 3KAHA 5GPGA 3O5DA 4LAYA 3O5EA 4DIPA 3UQAA 3KAIA 4DRQA 4JYSA 3RGCA 3O5IA 3B7XA 1Q6UA 5HWCA 2XP3A 3UI4A 1Q1CA 2ZQVA 4ODMA 1D7IA 4DRPA 4DZ2A 4TX0A 4ODRA 4QT3A 4ODLA 2XP6A 2MLXA 4ITZA 2D9FA 1JVWA 3O5QA 1FKKA 3MDYB 3TDBA 2PPNA 1FD9A 1BL4A 4QT2A 4R0XA 3JYMA 4N19A 2XPAA 1D7JA 1FKIA 2MPHA 1P5QA 4ODNA 4TNSA 3UQBA 2IF4A 2M2AA 2ZQSA 4JFMA 5HT1A 4DRMA 3LUOA 3PRDA 2M1IA 2PV3A 4ODPA 1JNTA 1J6YA 4G2PA 4O2TA 5D75A 3NI6A 1JNSA 4G50A 4QIBA 4ODQA 3O5JA 5HW8A 4JFIA 3TC5A 2PPOA 3O5PA 1FKJA 1R9HA 3JYJA 2KI3A 1ZCNA 3ODKA 2VCDA 1Y0OA 2DG3A 3O5FA 1M5YA 3KCEA 3O5MA 1EYMA 4FN2A 4J4OA 4MSPA 4U86A 2LKNA 3UI6A 4DRKA 1L1PA 1HXVA 2RSEA 2ZR5A 4DROA 2LPVA 4ODKA 2PPPA 4MGVA 1KT0A 1ZK6A 4W9OA 2PV1A 3IKGA 2KGJA 1D7HA 1T11A 4TW8A 3IK8A 2ITKA 1PBKA 2PBCA 2ZR6A 4JFKA 3O5KA 2VN1A 2MLZA 2XP9A 3KABA 1BKFA 4IQ2A 4U84A 4IPXA 1A7XA 1ROUA 2DG9A 1QPFA 4U85A 4J4NA 1KT1A 1FKSA 2RUCA 3OOBA 4IQCA 3NRKA 5DIVA 3CGNA 5J6EA 4C02B 1FAPA 2AWGA 3EY6A 3O5RA 4DRNA 2Q5AA 3KZ7A 1FKGA 2FAPA 2UZ5A 2L2SA 4LAVA 5HUAA 3I6CA 2N87A 3FAPA 5DIUA 3VAWA 5HW6A 4ODOA 2ZQTA 4NNRA 3UQIA 2XP8A 5HWBA 1FJDA 2F21A 1FKDA 1NMWA 1B6CA 1Q6IA 3UF8A 2OFNA 3O5GA 2F2DA 4DRJA 3O5OA 1FKHA 2ZR4A
chains in the Genus database with same CATH superfamily
1JCHB 2DT0A 3KACA 4W5UA 1FKLA 1D6OA 4LAWA 1NSGA 2KE0A 3RFWA 1JNDA 4MAVA 2PV2A 3WD0A 1LQ0A 3CHFA 3WQVA 1QPLA 4MNLA 4ZPTR 1ZU8A 3RM4A 4GGQA 2MNTA 3RM8A 1E6NA 2LGOA 1YW5A 4DT4A 3UI5A 3O5LA 4NSBA 1LL6A 4DH0A 1YATA 3CHCA 3FY1A 4XAKA 3ARUA 2F4EA 2MLYA 3EIPA 5HTGA 4TYOA 1FFQA 3FXYA 4JYSA 3O5IA 2PI6A 5HWCA 4ODMA 4QT3A 3ARTA 4ODLA 5JH8A 2XP6A 2MLXA 3ARQA 3MDYB 2PPNA 2WLYA 1LG1A 4QT2A 4N19A 4DWSC 2MPHA 4ODNA 1ZL1A 3ARVA 2IF4A 3UQBA 1NWTA 5HT1A 1NWRA 1EIBA 3PRAA 1JNTA 1J6YA 5D75A 1E6RA 2IUZA 4URIA 3O5PA 1FKJA 1JNEA 2G8ZA 2KI3A 3AS3A 4J4OA 3WIJA 1L1PA 2LKNA 4DRKA 2DSWA 1IX5A 1TFVA 2LPVA 1XHGA 4MGVA 3CHEA 3AQUA 4W9OA 1D7HA 1W9PA 1W9VA 3ARWA 1GPFA 1WNOA 3WD1A 4IQCA 2RUCA 3NRKA 4C02B 1FKGA 2FAPA 2UZ5A 2L2SA 2WLZA 3ARZA 4LAVA 3FAPA 4HARA 2ZQTA 5HWBA 4P8VA 1NMWA 2F2DA 1ITXA 2WK2A 1ROTA 2Y78A 4IT4A 2LJ4A 3IKDA 2O9OA 4DRIA 1J4HA 1F8AB 2KO7A 4ZPWR 2RUQA 1FKRA 1FFRA 2ZQUA 2DT1A 2P4VA 3B8SA 4DRHA 3ALGA 1FKFA 1ZBVA 5DF0A 4Z2HA 1OWQA 4WKHA 2DPEA 2DSUA 3QOKA 3ARSA 4Q7NA 1E6ZA 3O5DA 4Z2KA 3O5EA 4KQZA 3RGCA 3B7XA 4MNJA 3B9EA 1Q1CA 1D7IA 4DZ2A 3WD2A 4TX0A 4Z2LA 4ITZA 1JVWA 3ARYA 3CHDA 5GQBA 2XPAA 1LL7A 2M2AA 4IT6A 4JFMA 2M1IA 2PV3A 4Q22A 4ODPA 3ARRA 2A3CA 3ARXA 4P8WA 4JFIA 3JYJA 1EDQA 3CZ8A 3ALFA 3ODKA 2VCDA 5DITA 4FN2A 3UI6A 4Z2IA 2DSVA 1HXVA 4LGXA 2ZR5A 3RMEA 4ODKA 3WD4A 1H0IA 2YBUA 3AS0A 4MNKA 1NH6A 4HBEA 3RM9A 1PBKA 4ML4A 4JFKA 1LG2A 2XP9A 1E15A 4IQ2A 4U84A 2AOSA 2DG9A 4U85A 3B9DA 1EHNA 3OOBA 4DWSB 5DO2A 5DIVA 3CGNA 5J6EA 4S3JA 3O5RA 4DRNA 5HUAA 2N87A 5DIUA 3VAWA 3PR9A 3GTYX 2EULA 3G6MA 1FJDA 1OGBA 3O5OA 1TCOC 3PA7A 3PRBA 1N1AA 2KFWA 4AY1A 3H9RB 4FAPA 3WL1A 1C9HA 1W9UA 3WH0A 3OA5A 4S3KA 3NTPA 1FKTA 4DZ3A 5BXJA 4QZVB 4W9PA 4LAXA 2B31A 1WAWA 4GIVA 2FDMA 4DWSA 3KADA 1HJXA 5I98A 2XP4A 3CGMA 5HW7A 4ZS6A 2JZVA 2DSZA 3KAGA 2ESCA 1OGGA 3KAFA 4WJXA 1J4RA 4W9QA 1LL4A 2QF8A 3IHZA 4BF8A 1E44A 4JFLA 5GPGA 4LAYA 4DIPA 1O6IA 3KAIA 1LJYA 2PN0A 4DRQA 4HBOA 1KFWA 1X6NA 2XP3A 3UI4A 4KR0B 1K9TA 4ODRA 3WL0A 3G6LA 3WKZA 2D9FA 1FD9A 3AROA 4PTMA 2OLHA 1P5QA 3WQWA 3PRDA 4G2PA 3NI6A 4ODQA 3O5JA 4NZCA 1UR8A 5HW8A 3TC5A 3O5FA 3O5MA 1XRVA 3KCEA 1EYMA 4U86A 5HBFA 1HJVA 4DROA 3WD3A 2PV1A 4Z2GA 1W1YA 2KGJA 4TW8A 3IK8A 3O5KA 2MLZA 3KABA 1BKFA 4IPXA 1ROUA 2A3AA 2ZR4A 1FKSA 1FAPA 1H0GA 4WKAA 2Q5AA 1NWSA 4WK9A 4NNRA 1GOIA 1FKDA 2F21A 1B6CA 2OFNA 1J4IA 3UQIA 1NMVA 3GPKA 1PINA 1U79A 4TW6A 3JXVA 1W26A 4WKFA 3W4RA 5HKGA 4DWSD 1F40A 2F23A 1D2KA 1FKBA 1E9LA 1QZ2A 2XP7A 4Z2JA 1GUVA 4MPKA 4TW7A 1WB0A 2FKEA 2A3EA 4P8UA 1ZB5A 2XP5A 2DG4A 2G41A 3B9AA 1ZBCA 2XPBA 4JFJA 2M08A 2MF9A 2DT3A 2RQSA 5B8IC 1EQ3A 2YBTA 2RUDA 2RURA 2KR7A 1Q6HA 2K8IA 3TCZA 1UR9A 3KAHA 1X6LA 1HKMA 3UQAA 1Q6UA 2ZQVA 4DRPA 3ARPA 1HJWA 3CH9A 3O5QA 5GPRA 1FKKA 3TDBA 1W1TA 1BL4A 2O92A 4R0XA 1HKKA 3JYMA 1W1VA 1D7JA 1FKIA 2WM0A 3BXWA 1NWUA 4TNSA 2ZQSA 3AS1A 4DRMA 3LUOA 2ETNA 1GRJA 1ZBKA 3AS2A 4O2TA 1JNSA 4G50A 4QIBA 2PPOA 1R9HA 1ZCNA 1Y0OA 2DG3A 1M5YA 4MSPA 2DT2A 2RSEA 2PPPA 1KT0A 1ZK6A 1HKJA 3IKGA 4UDMA 4R5EA 1T11A 2A3BA 2ITKA 3BMBA 4P8XA 2PBCA 2ZR6A 4ZPVR 2VN1A 1HKIA 1A7XA 1ZBWA 1QPFA 4L3NA 4J4NA 1KT1A 1SR0A 1RD6A 2B5UB 3EY6A 1E6PA 2AWGA 3GU0A 3KZ7A 1CTNA 5DEZA 3I6CA 1W1PA 1VF8A 5HW6A 4MNMA 4L72B 4ODOA 1SYTA 2XP8A 1Q6IA 3UF8A 4DRJA 4WIWA 4MTVA 1FKHA 3O5GA
chains in the Genus database with same CATH topology
2DT0A 3KACA 4W5UA 1FKLA 1D6OA 4LAWA 1NSGA 2KE0A 3RFWA 1JNDA 4MAVA 2PV2A 3WD0A 1LQ0A 3CHFA 3WQVA 1QPLA 4MNLA 4ZPTR 1ZU8A 3RM4A 4GGQA 2MNTA 3RM8A 1E6NA 2LGOA 1YW5A 4DT4A 3UI5A 3O5LA 4NSBA 1LL6A 4DH0A 1YATA 3CHCA 3FY1A 4XAKA 3ARUA 2F4EA 2MLYA 5HTGA 4TYOA 1FFQA 3FXYA 4JYSA 3O5IA 2PI6A 5HWCA 4ODMA 4QT3A 3ARTA 4ODLA 5JH8A 2XP6A 2MLXA 3ARQA 3MDYB 2PPNA 2WLYA 1LG1A 4QT2A 4N19A 4DWSC 2MPHA 4ODNA 1ZL1A 3ARVA 2IF4A 3UQBA 1NWTA 5HT1A 1NWRA 1EIBA 3PRAA 1JNTA 1J6YA 5D75A 1E6RA 2IUZA 4URIA 3O5PA 1FKJA 1JNEA 2G8ZA 2KI3A 3AS3A 4J4OA 3WIJA 1L1PA 2LKNA 4DRKA 2DSWA 1IX5A 1TFVA 2LPVA 1XHGA 4MGVA 3CHEA 3AQUA 4W9OA 1D7HA 1W9PA 1W9VA 3ARWA 1GPFA 1WNOA 3WD1A 4IQCA 2RUCA 3NRKA 4C02B 1FKGA 2FAPA 2UZ5A 2L2SA 2WLZA 3ARZA 4LAVA 3FAPA 4HARA 2ZQTA 5HWBA 4P8VA 1NMWA 2F2DA 1ITXA 2WK2A 1ROTA 2Y78A 4IT4A 2LJ4A 3IKDA 2O9OA 4DRIA 1J4HA 1F8AB 2KO7A 4ZPWR 2RUQA 1FKRA 1FFRA 2ZQUA 2DT1A 3B8SA 4DRHA 3ALGA 1FKFA 1ZBVA 5DF0A 4Z2HA 1OWQA 4WKHA 2DPEA 2DSUA 3QOKA 3ARSA 4Q7NA 1E6ZA 3O5DA 4Z2KA 3O5EA 4KQZA 3RGCA 3B7XA 4MNJA 3B9EA 1Q1CA 1D7IA 4DZ2A 3WD2A 4TX0A 4Z2LA 4ITZA 1JVWA 3ARYA 3CHDA 5GQBA 2XPAA 1LL7A 2M2AA 4IT6A 4JFMA 2M1IA 2PV3A 4Q22A 4ODPA 3ARRA 2A3CA 3ARXA 4P8WA 4JFIA 3JYJA 1EDQA 3CZ8A 3ALFA 3ODKA 2VCDA 5DITA 4FN2A 3UI6A 4Z2IA 2DSVA 1HXVA 4LGXA 2ZR5A 3RMEA 4ODKA 3WD4A 1H0IA 2YBUA 3AS0A 4MNKA 1NH6A 4HBEA 3RM9A 1PBKA 4ML4A 4JFKA 1LG2A 2XP9A 1E15A 4IQ2A 4U84A 2AOSA 2DG9A 4U85A 3B9DA 1EHNA 3OOBA 4DWSB 5DO2A 5DIVA 3CGNA 5J6EA 4S3JA 3O5RA 4DRNA 5HUAA 2N87A 5DIUA 3VAWA 3PR9A 3G6MA 1FJDA 1OGBA 3O5OA 1TCOC 3PA7A 3PRBA 1N1AA 2KFWA 4AY1A 3H9RB 4FAPA 3WL1A 1C9HA 1W9UA 3WH0A 3OA5A 4S3KA 3NTPA 1FKTA 4DZ3A 5BXJA 4QZVB 4W9PA 4LAXA 2B31A 1WAWA 4GIVA 2FDMA 4DWSA 3KADA 1HJXA 5I98A 2XP4A 3CGMA 5HW7A 4ZS6A 2JZVA 2DSZA 3KAGA 2ESCA 1OGGA 3KAFA 4WJXA 1J4RA 4W9QA 1LL4A 2QF8A 3IHZA 4BF8A 4JFLA 5GPGA 4LAYA 4DIPA 1O6IA 3KAIA 1LJYA 4DRQA 4HBOA 1KFWA 1X6NA 2XP3A 3UI4A 4KR0B 1K9TA 4ODRA 3WL0A 3G6LA 3WKZA 2D9FA 1FD9A 3AROA 4PTMA 2OLHA 1P5QA 3WQWA 3PRDA 4G2PA 3NI6A 4ODQA 3O5JA 4NZCA 1UR8A 5HW8A 3TC5A 3O5FA 3O5MA 1XRVA 3KCEA 1EYMA 4U86A 5HBFA 1HJVA 4DROA 3WD3A 2PV1A 4Z2GA 1W1YA 2KGJA 4TW8A 3IK8A 3O5KA 2MLZA 3KABA 1BKFA 4IPXA 1ROUA 2A3AA 2ZR4A 1FKSA 1FAPA 1H0GA 4WKAA 2Q5AA 1NWSA 4WK9A 4NNRA 1GOIA 1FKDA 2F21A 1B6CA 2OFNA 1J4IA 3UQIA 1NMVA 3GPKA 1PINA 1U79A 4TW6A 3JXVA 1W26A 4WKFA 3W4RA 5HKGA 4DWSD 1F40A 1D2KA 1FKBA 1E9LA 1QZ2A 2XP7A 4Z2JA 1GUVA 4MPKA 4TW7A 1WB0A 2FKEA 2A3EA 4P8UA 1ZB5A 2XP5A 2DG4A 2G41A 3B9AA 1ZBCA 2XPBA 4JFJA 2M08A 2MF9A 2DT3A 2RQSA 5B8IC 1EQ3A 2YBTA 2RUDA 2RURA 2KR7A 1Q6HA 2K8IA 3TCZA 1UR9A 3KAHA 1X6LA 1HKMA 3UQAA 1Q6UA 2ZQVA 4DRPA 3ARPA 1HJWA 3CH9A 3O5QA 5GPRA 1FKKA 3TDBA 1W1TA 1BL4A 2O92A 4R0XA 1HKKA 3JYMA 1W1VA 1D7JA 1FKIA 2WM0A 3BXWA 1NWUA 4TNSA 2ZQSA 3AS1A 4DRMA 3LUOA 1ZBKA 3AS2A 4O2TA 1JNSA 4G50A 4QIBA 2PPOA 1R9HA 1ZCNA 1Y0OA 2DG3A 1M5YA 4MSPA 2DT2A 2RSEA 2PPPA 1KT0A 1ZK6A 1HKJA 3IKGA 4R5EA 1T11A 2A3BA 2ITKA 4P8XA 2PBCA 2ZR6A 4ZPVR 2VN1A 1HKIA 1A7XA 1ZBWA 1QPFA 4L3NA 4J4NA 1KT1A 1SR0A 1RD6A 3EY6A 1E6PA 2AWGA 3KZ7A 1CTNA 5DEZA 3I6CA 1W1PA 1VF8A 5HW6A 4MNMA 4L72B 4ODOA 1SYTA 2XP8A 1Q6IA 3UF8A 4DRJA 4WIWA 4MTVA 1FKHA 3O5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCO C;  1J4I A;  3PA7 A;  3PRB A;  1N1A A;  3KAC A;  1NMV A;  1ROT A;  2KFW A;  1FKL A;  1D6O A;  1PIN A;  2Y78 A;  3GPK A;  4LAW A;  1U79 A;  2LJ4 A;  1NSG A;  3IKD A;  3JXV A;  3H9R B;  1W26 A;  2KE0 A;  4TW6 A;  3RFW A;  4FAP A;  5HKG A;  2PV2 A;  4DRI A;  1F40 A;  1C9H A;  1J4H A;  3WH0 A;  1FKB A;  1F8A B;  2KO7 A;  3NTP A;  1FKT A;  1QZ2 A;  2XP7 A;  4DZ3 A;  5BXJ A;  2RUQ A;  4W9P A;  1QPL A;  4TW7 A;  1FKR A;  4LAX A;  2ZQU A;  4GIV A;  2FKE A;  4GGQ A;  3KAD A;  2MNT A;  4DRH A;  5I98 A;  1FKF A;  2DG4 A;  2XP5 A;  2XP4 A;  2LGO A;  2XPB A;  1YW5 A;  3CGM A;  4DT4 A;  4JFJ A;  2M08 A;  5HW7 A;  3UI5 A;  5DIT A;  2MF9 A;  2JZV A;  3O5L A;  2RQS A;  5B8I C;  1EQ3 A;  4DH0 A;  1YAT A;  3KAG A;  3KAF A;  2RUD A;  1J4R A;  2RUR A;  2F4E A;  2KR7 A;  1Q6H A;  2MLY A;  4W9Q A;  5HTG A;  2K8I A;  4BF8 A;  3IHZ A;  3TCZ A;  4TYO A;  4JFL A;  3KAH A;  5GPG A;  3O5D A;  4LAY A;  3O5E A;  4DIP A;  3UQA A;  3KAI A;  4DRQ A;  4JYS A;  3RGC A;  3O5I A;  3B7X A;  1Q6U A;  5HWC A;  2XP3 A;  3UI4 A;  1Q1C A;  2ZQV A;  4ODM A;  1D7I A;  4DRP A;  4DZ2 A;  4TX0 A;  4ODR A;  4QT3 A;  4ODL A;  2XP6 A;  2MLX A;  4ITZ A;  2D9F A;  1JVW A;  3O5Q A;  1FKK A;  3MDY B;  3TDB A;  2PPN A;  1FD9 A;  1BL4 A;  4QT2 A;  4R0X A;  3JYM A;  4N19 A;  2XPA A;  1D7J A;  1FKI A;  2MPH A;  1P5Q A;  4ODN A;  4TNS A;  3UQB A;  2IF4 A;  2M2A A;  2ZQS A;  4JFM A;  5HT1 A;  4DRM A;  3LUO A;  3PRD A;  2M1I A;  2PV3 A;  4ODP A;  1JNT A;  1J6Y A;  4G2P A;  4O2T A;  5D75 A;  3NI6 A;  1JNS A;  4G50 A;  4QIB A;  4ODQ A;  3O5J A;  5HW8 A;  4JFI A;  3TC5 A;  2PPO A;  3O5P A;  1FKJ A;  1R9H A;  3JYJ A;  2KI3 A;  1ZCN A;  3ODK A;  2VCD A;  1Y0O A;  2DG3 A;  3O5F A;  1M5Y A;  3KCE A;  3O5M A;  1EYM A;  4FN2 A;  4J4O A;  4MSP A;  4U86 A;  2LKN A;  3UI6 A;  4DRK A;  1L1P A;  1HXV A;  2RSE A;  2ZR5 A;  4DRO A;  2LPV A;  4ODK A;  2PPP A;  4MGV A;  1KT0 A;  1ZK6 A;  4W9O A;  2PV1 A;  3IKG A;  2KGJ A;  1D7H A;  1T11 A;  4TW8 A;  3IK8 A;  2ITK A;  1PBK A;  2PBC A;  2ZR6 A;  4JFK A;  3O5K A;  2VN1 A;  2MLZ A;  2XP9 A;  3KAB A;  1BKF A;  4IQ2 A;  4U84 A;  4IPX A;  1A7X A;  1ROU A;  2DG9 A;  1QPF A;  4U85 A;  4J4N A;  1KT1 A;  1FKS A;  2RUC A;  3OOB A;  4IQC A;  3NRK A;  5DIV A;  3CGN A;  5J6E A;  4C02 B;  1FAP A;  2AWG A;  3EY6 A;  3O5R A;  4DRN A;  2Q5A A;  3KZ7 A;  1FKG A;  2FAP A;  2UZ5 A;  2L2S A;  4LAV A;  5HUA A;  3I6C A;  2N87 A;  3FAP A;  5DIU A;  3VAW A;  5HW6 A;  4ODO A;  2ZQT A;  4NNR A;  3UQI A;  2XP8 A;  5HWB A;  1FJD A;  2F21 A;  1FKD A;  1NMW A;  1B6C A;  1Q6I A;  3UF8 A;  2OFN A;  3O5G A;  2F2D A;  4DRJ A;  3O5O A;  1FKH A;  2ZR4 A; 
#chains in the Genus database with same CATH topology
 1JCH B;  2DT0 A;  3KAC A;  4W5U A;  1FKL A;  1D6O A;  4LAW A;  1NSG A;  2KE0 A;  3RFW A;  1JND A;  4MAV A;  2PV2 A;  3WD0 A;  1LQ0 A;  3CHF A;  3WQV A;  1QPL A;  4MNL A;  4ZPT R;  1ZU8 A;  3RM4 A;  4GGQ A;  2MNT A;  3RM8 A;  1E6N A;  2LGO A;  1YW5 A;  4DT4 A;  3UI5 A;  3O5L A;  4NSB A;  1LL6 A;  4DH0 A;  1YAT A;  3CHC A;  3FY1 A;  4XAK A;  3ARU A;  2F4E A;  2MLY A;  3EIP A;  5HTG A;  4TYO A;  1FFQ A;  3FXY A;  4JYS A;  3O5I A;  2PI6 A;  5HWC A;  4ODM A;  4QT3 A;  3ART A;  4ODL A;  5JH8 A;  2XP6 A;  2MLX A;  3ARQ A;  3MDY B;  2PPN A;  2WLY A;  1LG1 A;  4QT2 A;  4N19 A;  4DWS C;  2MPH A;  4ODN A;  1ZL1 A;  3ARV A;  2IF4 A;  3UQB A;  1NWT A;  5HT1 A;  1NWR A;  1EIB A;  3PRA A;  1JNT A;  1J6Y A;  5D75 A;  1E6R A;  2IUZ A;  4URI A;  3O5P A;  1FKJ A;  1JNE A;  2G8Z A;  2KI3 A;  3AS3 A;  4J4O A;  3WIJ A;  1L1P A;  2LKN A;  4DRK A;  2DSW A;  1IX5 A;  1TFV A;  2LPV A;  1XHG A;  4MGV A;  3CHE A;  3AQU A;  4W9O A;  1D7H A;  1W9P A;  1W9V A;  3ARW A;  1GPF A;  1WNO A;  3WD1 A;  4IQC A;  2RUC A;  3NRK A;  4C02 B;  1FKG A;  2FAP A;  2UZ5 A;  2L2S A;  2WLZ A;  3ARZ A;  4LAV A;  3FAP A;  4HAR A;  2ZQT A;  5HWB A;  4P8V A;  1NMW A;  2F2D A;  1ITX A;  2WK2 A;  1ROT A;  2Y78 A;  4IT4 A;  2LJ4 A;  3IKD A;  2O9O A;  4DRI A;  1J4H A;  1F8A B;  2KO7 A;  4ZPW R;  2RUQ A;  1FKR A;  1FFR A;  2ZQU A;  2DT1 A;  2P4V A;  3B8S A;  4DRH A;  3ALG A;  1FKF A;  1ZBV A;  5DF0 A;  4Z2H A;  1OWQ A;  4WKH A;  2DPE A;  2DSU A;  3QOK A;  3ARS A;  4Q7N A;  1E6Z A;  3O5D A;  4Z2K A;  3O5E A;  4KQZ A;  3RGC A;  3B7X A;  4MNJ A;  3B9E A;  1Q1C A;  1D7I A;  4DZ2 A;  3WD2 A;  4TX0 A;  4Z2L A;  4ITZ A;  1JVW A;  3ARY A;  3CHD A;  5GQB A;  2XPA A;  1LL7 A;  2M2A A;  4IT6 A;  4JFM A;  2M1I A;  2PV3 A;  4Q22 A;  4ODP A;  3ARR A;  2A3C A;  3ARX A;  4P8W A;  4JFI A;  3JYJ A;  1EDQ A;  3CZ8 A;  3ALF A;  3ODK A;  2VCD A;  5DIT A;  4FN2 A;  3UI6 A;  4Z2I A;  2DSV A;  1HXV A;  4LGX A;  2ZR5 A;  3RME A;  4ODK A;  3WD4 A;  1H0I A;  2YBU A;  3AS0 A;  4MNK A;  1NH6 A;  4HBE A;  3RM9 A;  1PBK A;  4ML4 A;  4JFK A;  1LG2 A;  2XP9 A;  1E15 A;  4IQ2 A;  4U84 A;  2AOS A;  2DG9 A;  4U85 A;  3B9D A;  1EHN A;  3OOB A;  4DWS B;  5DO2 A;  5DIV A;  3CGN A;  5J6E A;  4S3J A;  3O5R A;  4DRN A;  5HUA A;  2N87 A;  5DIU A;  3VAW A;  3PR9 A;  3GTY X;  2EUL A;  3G6M A;  1FJD A;  1OGB A;  3O5O A;  1TCO C;  3PA7 A;  3PRB A;  1N1A A;  2KFW A;  4AY1 A;  3H9R B;  4FAP A;  3WL1 A;  1C9H A;  1W9U A;  3WH0 A;  3OA5 A;  4S3K A;  3NTP A;  1FKT A;  4DZ3 A;  5BXJ A;  4QZV B;  4W9P A;  4LAX A;  2B31 A;  1WAW A;  4GIV A;  2FDM A;  4DWS A;  3KAD A;  1HJX A;  5I98 A;  2XP4 A;  3CGM A;  5HW7 A;  4ZS6 A;  2JZV A;  2DSZ A;  3KAG A;  2ESC A;  1OGG A;  3KAF A;  4WJX A;  1J4R A;  4W9Q A;  1LL4 A;  2QF8 A;  3IHZ A;  4BF8 A;  1E44 A;  4JFL A;  5GPG A;  4LAY A;  4DIP A;  1O6I A;  3KAI A;  1LJY A;  2PN0 A;  4DRQ A;  4HBO A;  1KFW A;  1X6N A;  2XP3 A;  3UI4 A;  4KR0 B;  1K9T A;  4ODR A;  3WL0 A;  3G6L A;  3WKZ A;  2D9F A;  1FD9 A;  3ARO A;  4PTM A;  2OLH A;  1P5Q A;  3WQW A;  3PRD A;  4G2P A;  3NI6 A;  4ODQ A;  3O5J A;  4NZC A;  1UR8 A;  5HW8 A;  3TC5 A;  3O5F A;  3O5M A;  1XRV A;  3KCE A;  1EYM A;  4U86 A;  5HBF A;  1HJV A;  4DRO A;  3WD3 A;  2PV1 A;  4Z2G A;  1W1Y A;  2KGJ A;  4TW8 A;  3IK8 A;  3O5K A;  2MLZ A;  3KAB A;  1BKF A;  4IPX A;  1ROU A;  2A3A A;  2ZR4 A;  1FKS A;  1FAP A;  1H0G A;  4WKA A;  2Q5A A;  1NWS A;  4WK9 A;  4NNR A;  1GOI A;  1FKD A;  2F21 A;  1B6C A;  2OFN A;  1J4I A;  3UQI A;  1NMV A;  3GPK A;  1PIN A;  1U79 A;  4TW6 A;  3JXV A;  1W26 A;  4WKF A;  3W4R A;  5HKG A;  4DWS D;  1F40 A;  2F23 A;  1D2K A;  1FKB A;  1E9L A;  1QZ2 A;  2XP7 A;  4Z2J A;  1GUV A;  4MPK A;  4TW7 A;  1WB0 A;  2FKE A;  2A3E A;  4P8U A;  1ZB5 A;  2XP5 A;  2DG4 A;  2G41 A;  3B9A A;  1ZBC A;  2XPB A;  4JFJ A;  2M08 A;  2MF9 A;  2DT3 A;  2RQS A;  5B8I C;  1EQ3 A;  2YBT A;  2RUD A;  2RUR A;  2KR7 A;  1Q6H A;  2K8I A;  3TCZ A;  1UR9 A;  3KAH A;  1X6L A;  1HKM A;  3UQA A;  1Q6U A;  2ZQV A;  4DRP A;  3ARP A;  1HJW A;  3CH9 A;  3O5Q A;  5GPR A;  1FKK A;  3TDB A;  1W1T A;  1BL4 A;  2O92 A;  4R0X A;  1HKK A;  3JYM A;  1W1V A;  1D7J A;  1FKI A;  2WM0 A;  3BXW A;  1NWU A;  4TNS A;  2ZQS A;  3AS1 A;  4DRM A;  3LUO A;  2ETN A;  1GRJ A;  1ZBK A;  3AS2 A;  4O2T A;  1JNS A;  4G50 A;  4QIB A;  2PPO A;  1R9H A;  1ZCN A;  1Y0O A;  2DG3 A;  1M5Y A;  4MSP A;  2DT2 A;  2RSE A;  2PPP A;  1KT0 A;  1ZK6 A;  1HKJ A;  3IKG A;  4UDM A;  4R5E A;  1T11 A;  2A3B A;  2ITK A;  3BMB A;  4P8X A;  2PBC A;  2ZR6 A;  4ZPV R;  2VN1 A;  1HKI A;  1A7X A;  1ZBW A;  1QPF A;  4L3N A;  4J4N A;  1KT1 A;  1SR0 A;  1RD6 A;  2B5U B;  3EY6 A;  1E6P A;  2AWG A;  3GU0 A;  3KZ7 A;  1CTN A;  5DEZ A;  3I6C A;  1W1P A;  1VF8 A;  5HW6 A;  4MNM A;  4L72 B;  4ODO A;  1SYT A;  2XP8 A;  1Q6I A;  3UF8 A;  4DRJ A;  4WIW A;  4MTV A;  1FKH A;  3O5G A; 
#chains in the Genus database with same CATH homology
 2DT0 A;  3KAC A;  4W5U A;  1FKL A;  1D6O A;  4LAW A;  1NSG A;  2KE0 A;  3RFW A;  1JND A;  4MAV A;  2PV2 A;  3WD0 A;  1LQ0 A;  3CHF A;  3WQV A;  1QPL A;  4MNL A;  4ZPT R;  1ZU8 A;  3RM4 A;  4GGQ A;  2MNT A;  3RM8 A;  1E6N A;  2LGO A;  1YW5 A;  4DT4 A;  3UI5 A;  3O5L A;  4NSB A;  1LL6 A;  4DH0 A;  1YAT A;  3CHC A;  3FY1 A;  4XAK A;  3ARU A;  2F4E A;  2MLY A;  5HTG A;  4TYO A;  1FFQ A;  3FXY A;  4JYS A;  3O5I A;  2PI6 A;  5HWC A;  4ODM A;  4QT3 A;  3ART A;  4ODL A;  5JH8 A;  2XP6 A;  2MLX A;  3ARQ A;  3MDY B;  2PPN A;  2WLY A;  1LG1 A;  4QT2 A;  4N19 A;  4DWS C;  2MPH A;  4ODN A;  1ZL1 A;  3ARV A;  2IF4 A;  3UQB A;  1NWT A;  5HT1 A;  1NWR A;  1EIB A;  3PRA A;  1JNT A;  1J6Y A;  5D75 A;  1E6R A;  2IUZ A;  4URI A;  3O5P A;  1FKJ A;  1JNE A;  2G8Z A;  2KI3 A;  3AS3 A;  4J4O A;  3WIJ A;  1L1P A;  2LKN A;  4DRK A;  2DSW A;  1IX5 A;  1TFV A;  2LPV A;  1XHG A;  4MGV A;  3CHE A;  3AQU A;  4W9O A;  1D7H A;  1W9P A;  1W9V A;  3ARW A;  1GPF A;  1WNO A;  3WD1 A;  4IQC A;  2RUC A;  3NRK A;  4C02 B;  1FKG A;  2FAP A;  2UZ5 A;  2L2S A;  2WLZ A;  3ARZ A;  4LAV A;  3FAP A;  4HAR A;  2ZQT A;  5HWB A;  4P8V A;  1NMW A;  2F2D A;  1ITX A;  2WK2 A;  1ROT A;  2Y78 A;  4IT4 A;  2LJ4 A;  3IKD A;  2O9O A;  4DRI A;  1J4H A;  1F8A B;  2KO7 A;  4ZPW R;  2RUQ A;  1FKR A;  1FFR A;  2ZQU A;  2DT1 A;  3B8S A;  4DRH A;  3ALG A;  1FKF A;  1ZBV A;  5DF0 A;  4Z2H A;  1OWQ A;  4WKH A;  2DPE A;  2DSU A;  3QOK A;  3ARS A;  4Q7N A;  1E6Z A;  3O5D A;  4Z2K A;  3O5E A;  4KQZ A;  3RGC A;  3B7X A;  4MNJ A;  3B9E A;  1Q1C A;  1D7I A;  4DZ2 A;  3WD2 A;  4TX0 A;  4Z2L A;  4ITZ A;  1JVW A;  3ARY A;  3CHD A;  5GQB A;  2XPA A;  1LL7 A;  2M2A A;  4IT6 A;  4JFM A;  2M1I A;  2PV3 A;  4Q22 A;  4ODP A;  3ARR A;  2A3C A;  3ARX A;  4P8W A;  4JFI A;  3JYJ A;  1EDQ A;  3CZ8 A;  3ALF A;  3ODK A;  2VCD A;  5DIT A;  4FN2 A;  3UI6 A;  4Z2I A;  2DSV A;  1HXV A;  4LGX A;  2ZR5 A;  3RME A;  4ODK A;  3WD4 A;  1H0I A;  2YBU A;  3AS0 A;  4MNK A;  1NH6 A;  4HBE A;  3RM9 A;  1PBK A;  4ML4 A;  4JFK A;  1LG2 A;  2XP9 A;  1E15 A;  4IQ2 A;  4U84 A;  2AOS A;  2DG9 A;  4U85 A;  3B9D A;  1EHN A;  3OOB A;  4DWS B;  5DO2 A;  5DIV A;  3CGN A;  5J6E A;  4S3J A;  3O5R A;  4DRN A;  5HUA A;  2N87 A;  5DIU A;  3VAW A;  3PR9 A;  3G6M A;  1FJD A;  1OGB A;  3O5O A;  1TCO C;  3PA7 A;  3PRB A;  1N1A A;  2KFW A;  4AY1 A;  3H9R B;  4FAP A;  3WL1 A;  1C9H A;  1W9U A;  3WH0 A;  3OA5 A;  4S3K A;  3NTP A;  1FKT A;  4DZ3 A;  5BXJ A;  4QZV B;  4W9P A;  4LAX A;  2B31 A;  1WAW A;  4GIV A;  2FDM A;  4DWS A;  3KAD A;  1HJX A;  5I98 A;  2XP4 A;  3CGM A;  5HW7 A;  4ZS6 A;  2JZV A;  2DSZ A;  3KAG A;  2ESC A;  1OGG A;  3KAF A;  4WJX A;  1J4R A;  4W9Q A;  1LL4 A;  2QF8 A;  3IHZ A;  4BF8 A;  4JFL A;  5GPG A;  4LAY A;  4DIP A;  1O6I A;  3KAI A;  1LJY A;  4DRQ A;  4HBO A;  1KFW A;  1X6N A;  2XP3 A;  3UI4 A;  4KR0 B;  1K9T A;  4ODR A;  3WL0 A;  3G6L A;  3WKZ A;  2D9F A;  1FD9 A;  3ARO A;  4PTM A;  2OLH A;  1P5Q A;  3WQW A;  3PRD A;  4G2P A;  3NI6 A;  4ODQ A;  3O5J A;  4NZC A;  1UR8 A;  5HW8 A;  3TC5 A;  3O5F A;  3O5M A;  1XRV A;  3KCE A;  1EYM A;  4U86 A;  5HBF A;  1HJV A;  4DRO A;  3WD3 A;  2PV1 A;  4Z2G A;  1W1Y A;  2KGJ A;  4TW8 A;  3IK8 A;  3O5K A;  2MLZ A;  3KAB A;  1BKF A;  4IPX A;  1ROU A;  2A3A A;  2ZR4 A;  1FKS A;  1FAP A;  1H0G A;  4WKA A;  2Q5A A;  1NWS A;  4WK9 A;  4NNR A;  1GOI A;  1FKD A;  2F21 A;  1B6C A;  2OFN A;  1J4I A;  3UQI A;  1NMV A;  3GPK A;  1PIN A;  1U79 A;  4TW6 A;  3JXV A;  1W26 A;  4WKF A;  3W4R A;  5HKG A;  4DWS D;  1F40 A;  1D2K A;  1FKB A;  1E9L A;  1QZ2 A;  2XP7 A;  4Z2J A;  1GUV A;  4MPK A;  4TW7 A;  1WB0 A;  2FKE A;  2A3E A;  4P8U A;  1ZB5 A;  2XP5 A;  2DG4 A;  2G41 A;  3B9A A;  1ZBC A;  2XPB A;  4JFJ A;  2M08 A;  2MF9 A;  2DT3 A;  2RQS A;  5B8I C;  1EQ3 A;  2YBT A;  2RUD A;  2RUR A;  2KR7 A;  1Q6H A;  2K8I A;  3TCZ A;  1UR9 A;  3KAH A;  1X6L A;  1HKM A;  3UQA A;  1Q6U A;  2ZQV A;  4DRP A;  3ARP A;  1HJW A;  3CH9 A;  3O5Q A;  5GPR A;  1FKK A;  3TDB A;  1W1T A;  1BL4 A;  2O92 A;  4R0X A;  1HKK A;  3JYM A;  1W1V A;  1D7J A;  1FKI A;  2WM0 A;  3BXW A;  1NWU A;  4TNS A;  2ZQS A;  3AS1 A;  4DRM A;  3LUO A;  1ZBK A;  3AS2 A;  4O2T A;  1JNS A;  4G50 A;  4QIB A;  2PPO A;  1R9H A;  1ZCN A;  1Y0O A;  2DG3 A;  1M5Y A;  4MSP A;  2DT2 A;  2RSE A;  2PPP A;  1KT0 A;  1ZK6 A;  1HKJ A;  3IKG A;  4R5E A;  1T11 A;  2A3B A;  2ITK A;  4P8X A;  2PBC A;  2ZR6 A;  4ZPV R;  2VN1 A;  1HKI A;  1A7X A;  1ZBW A;  1QPF A;  4L3N A;  4J4N A;  1KT1 A;  1SR0 A;  1RD6 A;  3EY6 A;  1E6P A;  2AWG A;  3KZ7 A;  1CTN A;  5DEZ A;  3I6C A;  1W1P A;  1VF8 A;  5HW6 A;  4MNM A;  4L72 B;  4ODO A;  1SYT A;  2XP8 A;  1Q6I A;  3UF8 A;  4DRJ A;  4WIW A;  4MTV A;  1FKH A;  3O5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...