1FAQA

Raf-1 cysteine rich domain, nmr, 27 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
52
structure length
52
Chain Sequence
LTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAF-1
publication title The solution structure of the Raf-1 cysteine-rich domain: a novel ras and phospholipid binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine/threonine protein kinase
total genus 4
structure length 52
sequence length 52
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1faqA00
1KBFA 4UXHA 1XX6A 4UXIA 2UZ3A 3KY9A 3UFFA 1Y8FA 3CXLA 3UGDA 2E73A 1R79A 1FARA 2ELIA 2DB6A 2WVJA 1PTRA 2QQEA 2VRWB 4FKDA 2JA1A 3E2IA 4L9MA 2GVIA 4UXJA 5FUXA 2YUUA 2ORWA 1PTQA 1XA6A 2J9RA 5FUYA 3UGIA 1TBNA 1RFHA 2ORVA 1TBOA 1XBTA 3BJIA 1FAQA 1KBEA 3UGLA 2QPOA 2J87A 2QQ0A 2ENZA 3UEYA 1W4RA 5FUVA 4B6DA 3UEJA 2ENNA 5FUWA 2B8TA 2FNFX 2ROWA
chains in the Genus database with same CATH superfamily
1X4SA 1K7VA 1U5KA 1K7UA 1S20A 2QQDA 1HEVA 2GIVA 2ODDA 1PJUA 1HPTA 2GKRI 3OXLA 1TOTA 5CCLA 9WGAA 2L8EA 1TGSI 2OVOA 1YU6C 3HH2C 1KMAA 3FC3A 1Y8FA 1TURA 1MT1A 1V1HA 2E73A 2SGQI 3VDUA 3VE5A 1CGJI 1FARA 1LR7A 2WVJA 2CWFA 1VDDA 2VRWB 3TO7A 4FKDA 4A24A 4AMLA 5J8FA 2PQ8A 1YTPA 2V53A 1PCEA 2GKVA 1CT2I 2QQCA 3QWPA 1PTQA 1BMOA 1Y1CA 4E1PA 3R5DA 1OYVI 2ORVA 1SGYI 1XBTA 2CWGA 3BJIA 3OXGA 3QTLD 1FAQA 2N52A 2ENZA 1IY6A 1Y1BA 3SGBI 3TO6A 2KCXA 3TO9A 3UEJA 2NU0I 1PPFI 2WCYA 3FSYA 3VDPA 2BUSA 4UXIA 4UXHA 1NXUA 1XX6A 2V1CC 1MJAA 1N13A 2UVOA 2NU1I 1SGQI 5E3PA 5EX0A 1WGTA 3UFFA 2CJSC 4OVOA 2KMQA 5DAEA 1SGPI 3UGDA 7WGAA 1P9GA 2SGEI 2DB6A 1MJ9A 1WGCA 1H0ZA 2QQEA 3B4VC 4UXJA 2GVIA 2LUYA 3TOAA 1AN1I 3OXFA 2LEOA 2L7XA 2KMOA 2X52A 1DS3I 2RC4A 2N1AB 2SGDI 1X74A 1DS2I 1XA6A 5FUYA 1RFHA 2JXDA 5JHWC 1SGEI 3TJQA 1TBOA 1KBEA 1LR9A 1BUSA 5FUVA 3SEKC 2JYYA 1SGRI 2F3CI 2B0UC 2NU2I 1KBFA 2NU3I 1CHOI 2OD1A 1TBQR 1FY7A 2N71A 1SGNI 1ULMA 2SGFI 2JZMA 3KY9A 3MEKA 1UVFA 4MPIA 1K7TA 1R79A 2ELIA 2W0TA 1W3SA 2LB7A 1OMTA 3OVOA 3SGQI 5CCMA 2A20A 1OVOA 2JA1A 2XRCA 3E2IA 2E5RA 1CT0I 4SGBI 1WKXA 1NUBA 2NU4I 1HJAI 2DKVA 2RIJA 1OMUA 3E59A 3R5AA 1V1IA 1TUSA 1TBNA 1UHAA 1WTJA 3QAHA 1CSOI 1CT4I 1Z7KB 2JW6A 2QQ0A 2ERWA 3OL0A 3UEYA 3UGLA 1W4RA 1R0RI 1Q9BA 2M5XA 2Y0MA 3R5BA 1LR8A 2B8TA 2DIPA 3D00A 2ARPF 5FUWA 1CGII 3RU0A 1HDLA 4WP4A 1CE3A 3GOXA 2YQPA 2CWHA 1MJBA 3FSXA 1FYBA 1ULNA 4E1RA 2UZ3A 3PDNA 4DNCA 2K9HA 3CXLA 2OU2A 3R5CA 5HQ8A 1TBRR 5E3RA 1PTRA 4HGUA 4JCVE 5E3QA 1Z2IA 4L9MA 1UVGA 5FUXA 2SGPI 1TIHA 2YUUA 1IY5A 2ORWA 1P9ZA 2N17A 2GKTI 2WGCA 3UOEA 2KMRA 1UUCA 2J9RA 5EX3A 3UGIA 2KMPA 2X3TA 5J8CA 1M8BA 1IW4A 5HI7A 1SGDI 2OZUA 2QPOA 1M8CA 1ULKA 2J87A 4GI3C 4B6DA 2V1CA 2ENNA 3TOBA 2P6AC 2FNFX 2ROWA
chains in the Genus database with same CATH topology
1X4SA 1U5KA 2QQDA 2ODDA 1PJUA 1HPTA 2GKRI 3OXLA 1TOTA 5CCLA 2L8EA 1TGSI 2OVOA 1YU6C 3HH2C 1KMAA 3FC3A 1Y8FA 1TURA 1MT1A 1V1HA 2E73A 2SGQI 3VDUA 3VE5A 1CGJI 1FARA 1LR7A 2WVJA 1VDDA 2VRWB 4FKDA 4A24A 1YTPA 2V53A 1PCEA 2GKVA 1CT2I 2QQCA 3QWPA 1PTQA 1BMOA 1Y1CA 4E1PA 1OYVI 2ORVA 1SGYI 1XBTA 3BJIA 3OXGA 1FAQA 3QTLD 2N52A 2ENZA 1IY6A 1Y1BA 3SGBI 3UEJA 2KCXA 2NU0I 1PPFI 2WCYA 3VDPA 2BUSA 4UXIA 4UXHA 1XX6A 2V1CC 1N13A 2NU1I 1SGQI 5EX0A 3UFFA 2CJSC 4OVOA 2KMQA 5DAEA 1SGPI 3UGDA 2SGEI 2DB6A 1H0ZA 2QQEA 3B4VC 4UXJA 2GVIA 2LUYA 1AN1I 3OXFA 2LEOA 2L7XA 2KMOA 1DS3I 2N1AB 2SGDI 1X74A 1DS2I 1XA6A 5FUYA 1RFHA 2JXDA 5JHWC 1SGEI 3TJQA 1TBOA 1KBEA 1LR9A 1BUSA 5FUVA 3SEKC 2JYYA 1SGRI 2F3CI 2B0UC 2NU2I 1KBFA 2NU3I 1CHOI 2OD1A 1TBQR 2N71A 1SGNI 2SGFI 2JZMA 3KY9A 3MEKA 1UVFA 1R79A 2ELIA 2W0TA 1W3SA 3OVOA 1OMTA 5CCMA 3SGQI 2A20A 1OVOA 2JA1A 2XRCA 3E2IA 2E5RA 1CT0I 4SGBI 1NUBA 2NU4I 1HJAI 1OMUA 3E59A 1V1IA 1TUSA 1TBNA 1CSOI 1CT4I 1Z7KB 2JW6A 2QQ0A 2ERWA 3OL0A 3UEYA 3UGLA 1W4RA 1R0RI 2M5XA 1LR8A 2B8TA 2DIPA 3D00A 2ARPF 5FUWA 1CGII 3RU0A 1HDLA 1CE3A 3GOXA 2YQPA 1FYBA 4E1RA 2UZ3A 3PDNA 5HQ8A 2K9HA 3CXLA 1TBRR 1PTRA 4HGUA 4JCVE 4L9MA 1UVGA 5FUXA 2SGPI 1TIHA 2YUUA 1IY5A 2ORWA 2N17A 2GKTI 2KMRA 1UUCA 2J9RA 5EX3A 3UGIA 2KMPA 1M8BA 1IW4A 5HI7A 1SGDI 2QPOA 1M8CA 2J87A 4GI3C 4B6DA 2V1CA 2ENNA 2P6AC 2FNFX 2ROWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBF A;  4UXH A;  1XX6 A;  4UXI A;  2UZ3 A;  3KY9 A;  3UFF A;  1Y8F A;  3CXL A;  3UGD A;  2E73 A;  1R79 A;  1FAR A;  2ELI A;  2DB6 A;  2WVJ A;  1PTR A;  2QQE A;  2VRW B;  4FKD A;  2JA1 A;  3E2I A;  4L9M A;  2GVI A;  4UXJ A;  5FUX A;  2YUU A;  2ORW A;  1PTQ A;  1XA6 A;  2J9R A;  5FUY A;  3UGI A;  1TBN A;  1RFH A;  2ORV A;  1TBO A;  1XBT A;  3BJI A;  1FAQ A;  1KBE A;  3UGL A;  2QPO A;  2J87 A;  2QQ0 A;  2ENZ A;  3UEY A;  1W4R A;  5FUV A;  4B6D A;  3UEJ A;  2ENN A;  5FUW A;  2B8T A;  2FNF X;  2ROW A; 
#chains in the Genus database with same CATH topology
 1X4S A;  1K7V A;  1U5K A;  1K7U A;  1S20 A;  2QQD A;  1HEV A;  2GIV A;  2ODD A;  1PJU A;  1HPT A;  2GKR I;  3OXL A;  1TOT A;  5CCL A;  9WGA A;  2L8E A;  1TGS I;  2OVO A;  1YU6 C;  3HH2 C;  1KMA A;  3FC3 A;  1Y8F A;  1TUR A;  1MT1 A;  1V1H A;  2E73 A;  2SGQ I;  3VDU A;  3VE5 A;  1CGJ I;  1FAR A;  1LR7 A;  2WVJ A;  2CWF A;  1VDD A;  2VRW B;  3TO7 A;  4FKD A;  4A24 A;  4AML A;  5J8F A;  2PQ8 A;  1YTP A;  2V53 A;  1PCE A;  2GKV A;  1CT2 I;  2QQC A;  3QWP A;  1PTQ A;  1BMO A;  1Y1C A;  4E1P A;  3R5D A;  1OYV I;  2ORV A;  1SGY I;  1XBT A;  2CWG A;  3BJI A;  3OXG A;  3QTL D;  1FAQ A;  2N52 A;  2ENZ A;  1IY6 A;  1Y1B A;  3SGB I;  3TO6 A;  2KCX A;  3TO9 A;  3UEJ A;  2NU0 I;  1PPF I;  2WCY A;  3FSY A;  3VDP A;  2BUS A;  4UXI A;  4UXH A;  1NXU A;  1XX6 A;  2V1C C;  1MJA A;  1N13 A;  2UVO A;  2NU1 I;  1SGQ I;  5E3P A;  5EX0 A;  1WGT A;  3UFF A;  2CJS C;  4OVO A;  2KMQ A;  5DAE A;  1SGP I;  3UGD A;  7WGA A;  1P9G A;  2SGE I;  2DB6 A;  1MJ9 A;  1WGC A;  1H0Z A;  2QQE A;  3B4V C;  4UXJ A;  2GVI A;  2LUY A;  3TOA A;  1AN1 I;  3OXF A;  2LEO A;  2L7X A;  2KMO A;  2X52 A;  1DS3 I;  2RC4 A;  2N1A B;  2SGD I;  1X74 A;  1DS2 I;  1XA6 A;  5FUY A;  1RFH A;  2JXD A;  5JHW C;  1SGE I;  3TJQ A;  1TBO A;  1KBE A;  1LR9 A;  1BUS A;  5FUV A;  3SEK C;  2JYY A;  1SGR I;  2F3C I;  2B0U C;  2NU2 I;  1KBF A;  2NU3 I;  1CHO I;  2OD1 A;  1TBQ R;  1FY7 A;  2N71 A;  1SGN I;  1ULM A;  2SGF I;  2JZM A;  3KY9 A;  3MEK A;  1UVF A;  4MPI A;  1K7T A;  1R79 A;  2ELI A;  2W0T A;  1W3S A;  2LB7 A;  1OMT A;  3OVO A;  3SGQ I;  5CCM A;  2A20 A;  1OVO A;  2JA1 A;  2XRC A;  3E2I A;  2E5R A;  1CT0 I;  4SGB I;  1WKX A;  1NUB A;  2NU4 I;  1HJA I;  2DKV A;  2RIJ A;  1OMU A;  3E59 A;  3R5A A;  1V1I A;  1TUS A;  1TBN A;  1UHA A;  1WTJ A;  3QAH A;  1CSO I;  1CT4 I;  1Z7K B;  2JW6 A;  2QQ0 A;  2ERW A;  3OL0 A;  3UEY A;  3UGL A;  1W4R A;  1R0R I;  1Q9B A;  2M5X A;  2Y0M A;  3R5B A;  1LR8 A;  2B8T A;  2DIP A;  3D00 A;  2ARP F;  5FUW A;  1CGI I;  3RU0 A;  1HDL A;  4WP4 A;  1CE3 A;  3GOX A;  2YQP A;  2CWH A;  1MJB A;  3FSX A;  1FYB A;  1ULN A;  4E1R A;  2UZ3 A;  3PDN A;  4DNC A;  2K9H A;  3CXL A;  2OU2 A;  3R5C A;  5HQ8 A;  1TBR R;  5E3R A;  1PTR A;  4HGU A;  4JCV E;  5E3Q A;  1Z2I A;  4L9M A;  1UVG A;  5FUX A;  2SGP I;  1TIH A;  2YUU A;  1IY5 A;  2ORW A;  1P9Z A;  2N17 A;  2GKT I;  2WGC A;  3UOE A;  2KMR A;  1UUC A;  2J9R A;  5EX3 A;  3UGI A;  2KMP A;  2X3T A;  5J8C A;  1M8B A;  1IW4 A;  5HI7 A;  1SGD I;  2OZU A;  2QPO A;  1M8C A;  1ULK A;  2J87 A;  4GI3 C;  4B6D A;  2V1C A;  2ENN A;  3TOB A;  2P6A C;  2FNF X;  2ROW A; 
#chains in the Genus database with same CATH homology
 1X4S A;  1U5K A;  2QQD A;  2ODD A;  1PJU A;  1HPT A;  2GKR I;  3OXL A;  1TOT A;  5CCL A;  2L8E A;  1TGS I;  2OVO A;  1YU6 C;  3HH2 C;  1KMA A;  3FC3 A;  1Y8F A;  1TUR A;  1MT1 A;  1V1H A;  2E73 A;  2SGQ I;  3VDU A;  3VE5 A;  1CGJ I;  1FAR A;  1LR7 A;  2WVJ A;  1VDD A;  2VRW B;  4FKD A;  4A24 A;  1YTP A;  2V53 A;  1PCE A;  2GKV A;  1CT2 I;  2QQC A;  3QWP A;  1PTQ A;  1BMO A;  1Y1C A;  4E1P A;  1OYV I;  2ORV A;  1SGY I;  1XBT A;  3BJI A;  3OXG A;  1FAQ A;  3QTL D;  2N52 A;  2ENZ A;  1IY6 A;  1Y1B A;  3SGB I;  3UEJ A;  2KCX A;  2NU0 I;  1PPF I;  2WCY A;  3VDP A;  2BUS A;  4UXI A;  4UXH A;  1XX6 A;  2V1C C;  1N13 A;  2NU1 I;  1SGQ I;  5EX0 A;  3UFF A;  2CJS C;  4OVO A;  2KMQ A;  5DAE A;  1SGP I;  3UGD A;  2SGE I;  2DB6 A;  1H0Z A;  2QQE A;  3B4V C;  4UXJ A;  2GVI A;  2LUY A;  1AN1 I;  3OXF A;  2LEO A;  2L7X A;  2KMO A;  1DS3 I;  2N1A B;  2SGD I;  1X74 A;  1DS2 I;  1XA6 A;  5FUY A;  1RFH A;  2JXD A;  5JHW C;  1SGE I;  3TJQ A;  1TBO A;  1KBE A;  1LR9 A;  1BUS A;  5FUV A;  3SEK C;  2JYY A;  1SGR I;  2F3C I;  2B0U C;  2NU2 I;  1KBF A;  2NU3 I;  1CHO I;  2OD1 A;  1TBQ R;  2N71 A;  1SGN I;  2SGF I;  2JZM A;  3KY9 A;  3MEK A;  1UVF A;  1R79 A;  2ELI A;  2W0T A;  1W3S A;  3OVO A;  1OMT A;  5CCM A;  3SGQ I;  2A20 A;  1OVO A;  2JA1 A;  2XRC A;  3E2I A;  2E5R A;  1CT0 I;  4SGB I;  1NUB A;  2NU4 I;  1HJA I;  1OMU A;  3E59 A;  1V1I A;  1TUS A;  1TBN A;  1CSO I;  1CT4 I;  1Z7K B;  2JW6 A;  2QQ0 A;  2ERW A;  3OL0 A;  3UEY A;  3UGL A;  1W4R A;  1R0R I;  2M5X A;  1LR8 A;  2B8T A;  2DIP A;  3D00 A;  2ARP F;  5FUW A;  1CGI I;  3RU0 A;  1HDL A;  1CE3 A;  3GOX A;  2YQP A;  1FYB A;  4E1R A;  2UZ3 A;  3PDN A;  5HQ8 A;  2K9H A;  3CXL A;  1TBR R;  1PTR A;  4HGU A;  4JCV E;  4L9M A;  1UVG A;  5FUX A;  2SGP I;  1TIH A;  2YUU A;  1IY5 A;  2ORW A;  2N17 A;  2GKT I;  2KMR A;  1UUC A;  2J9R A;  5EX3 A;  3UGI A;  2KMP A;  1M8B A;  1IW4 A;  5HI7 A;  1SGD I;  2QPO A;  1M8C A;  2J87 A;  4GI3 C;  4B6D A;  2V1C A;  2ENN A;  2P6A C;  2FNF X;  2ROW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...