1FARA

Raf-1 cysteine rich domain, nmr, minimized average structure
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
52
structure length
52
Chain Sequence
LTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the Raf-1 cysteine-rich domain: a novel ras and phospholipid binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine/threonine protein kinase
molecule keywords RAF-1
total genus 2
structure length 52
sequence length 52
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1farA00
1PTQA 3UEJA 4UXJA 5FUVA 2J9RA 4UXHA 2GVIA 2ELIA 1KBFA 5FUYA 2E73A 1PTRA 2YUUA 5FUWA 2ROWA 3UGDA 2WVJA 1R79A 3UGLA 4L9MA 2FNFX 2ENZA 3E2IA 4UXIA 2B8TA 2ENNA 1TBOA 1Y8FA 2DB6A 1XX6A 1TBNA 2QPOA 3KY9A 3UEYA 1FAQA 1FARA 2J87A 1RFHA 4B6DA 1KBEA 3BJIA 2QQEA 2VRWB 3UFFA 2UZ3A 1XA6A 2ORVA 3CXLA 5FUXA 1W4RA 2JA1A 1XBTA 2QQ0A 4FKDA 3UGIA 2ORWA
chains in the Genus database with same CATH superfamily
5E3PA 1CHOI 1UUCA 2M5XA 2N52A 2NU2I 4GI3C 1CGJI 1SGRI 2CWGA 1PTRA 3FSYA 1NUBA 3TJQA 3UGLA 1R79A 4HGUA 1PPFI 1W3SA 1WKXA 1M8BA 2ENZA 2OVOA 1TUSA 1Z7KB 4L9MA 5HI7A 1LR7A 1TBOA 1ULNA 2CJSC 3OXLA 4E1RA 1IW4A 3KY9A 1FAQA 1FYBA 1N13A 1R0RI 1TGSI 1YTPA 1UVGA 3OL0A 1DS3I 2QQCA 3MEKA 2CWHA 3PDNA 2LB7A 2ODDA 2ORVA 3VE5A 2K9HA 1CT2I 1XBTA 1YU6C 3TOAA 3TO6A 4FKDA 1OYVI 1TBRR 2SGQI 1DS2I 3FSXA 3VDUA 1CT0I 1UVFA 1UHAA 4UXHA 1SGDI 2GVIA 4A24A 1M8CA 3SEKC 1CSOI 1H0ZA 2SGFI 1SGQI 2N17A 2NU4I 1ULKA 2RIJA 5FUYA 1IY5A 2UVOA 5EX0A 3UGDA 1WTJA 2L8EA 1X74A 2LUYA 5FUWA 3D00A 1S20A 1P9GA 2KCXA 1TOTA 2FNFX 1HJAI 1PJUA 1VDDA 2B8TA 2ENNA 2NU3I 1Y8FA 5EX3A 3UEYA 2QPOA 3UOEA 1FARA 2DKVA 2BUSA 2F3CI 1HPTA 3R5DA 2JXDA 3FC3A 5E3RA 2Y0MA 5JHWC 1WGTA 4WP4A 3QWPA 1SGNI 2A20A 1XA6A 2LEOA 2UZ3A 5DAEA 3UFFA 9WGAA 1OMUA 2CWFA 3CXLA 2V53A 2JA1A 1MJAA 7WGAA 3UGIA 2ORWA 3VDPA 1PCEA 1OVOA 1Q9BA 1V1IA 1TURA 2N1AB 4UXJA 2L7XA 2ELIA 5J8FA 3OXGA 1KBFA 2NU0I 1X4SA 2E73A 2YQPA 1SGYI 1SGPI 1K7UA 2ARPF 1Y1BA 2SGPI 2KMPA 2W0TA 4UXIA 2ERWA 3TO7A 1TBNA 2JZMA 4B6DA 1TIHA 4E1PA 1ULMA 3R5BA 4JCVE 3B4VC 2GKVA 4OVOA 1KBEA 5E3QA 1K7TA 1U5KA 2GIVA 2JW6A 2OU2A 1BUSA 2KMOA 3BJIA 2XRCA 1CGII 2VRWB 1LR8A 1HDLA 3TOBA 2E5RA 5FUXA 2B0UC 2OD1A 3QAHA 1KMAA 2DIPA 3R5AA 1K7VA 1AN1I 2X52A 3GOXA 1PTQA 2V1CA 2WGCA 3UEJA 5FUVA 2J9RA 4SGBI 2OZUA 5CCLA 2SGDI 4DNCA 1MJ9A 1NXUA 2YUUA 3TO9A 5HQ8A 2GKRI 2RC4A 2ROWA 2WVJA 2X3TA 2KMQA 2JYYA 3OXFA 3E2IA 4MPIA 3SGQI 2P6AC 2N71A 2QQDA 3SGBI 1V1HA 2DB6A 1XX6A 1CT4I 5J8CA 2PQ8A 1MT1A 1RFHA 2J87A 3HH2C 1IY6A 1P9ZA 2KMRA 1CE3A 3QTLD 5CCMA 1LR9A 3RU0A 1FY7A 1BMOA 2QQEA 2NU1I 3OVOA 3E59A 1OMTA 3R5CA 1MJBA 1SGEI 1TBQR 2WCYA 2SGEI 1Z2IA 1Y1CA 1W4RA 1WGCA 2GKTI 2QQ0A 1HEVA 2V1CC 4AMLA
chains in the Genus database with same CATH topology
1CHOI 1UUCA 2M5XA 2N52A 2NU2I 4GI3C 1CGJI 1SGRI 1PTRA 1NUBA 3TJQA 3UGLA 1R79A 4HGUA 1PPFI 1W3SA 2ENZA 1M8BA 2OVOA 4L9MA 1TUSA 1Z7KB 5HI7A 1LR7A 1TBOA 2CJSC 4E1RA 3OXLA 1IW4A 1FAQA 3KY9A 1FYBA 1N13A 1R0RI 1TGSI 1YTPA 1UVGA 3OL0A 1DS3I 2QQCA 3MEKA 3PDNA 2ODDA 2ORVA 3VE5A 2K9HA 1CT2I 1XBTA 1YU6C 4FKDA 1OYVI 1TBRR 2SGQI 1DS2I 3VDUA 1CT0I 1UVFA 4UXHA 1SGDI 2GVIA 4A24A 1M8CA 3SEKC 1CSOI 1H0ZA 2SGFI 1SGQI 2N17A 2NU4I 1IY5A 5FUYA 5EX0A 2L8EA 1X74A 2LUYA 5FUWA 3D00A 2KCXA 1TOTA 2FNFX 1HJAI 1PJUA 1VDDA 2B8TA 2ENNA 2NU3I 1Y8FA 5EX3A 3UEYA 2QPOA 1FARA 2BUSA 2F3CI 1HPTA 2JXDA 3FC3A 5JHWC 3UFFA 3QWPA 1SGNI 2A20A 1XA6A 2LEOA 2UZ3A 5DAEA 1OMUA 3CXLA 2V53A 2JA1A 3UGIA 2ORWA 3VDPA 1PCEA 1OVOA 1V1IA 1TURA 2N1AB 4UXJA 2L7XA 2ELIA 1KBFA 3OXGA 2NU0I 1X4SA 2E73A 2YQPA 1SGYI 1SGPI 2ARPF 1Y1BA 2SGPI 2KMPA 2W0TA 4UXIA 2ERWA 1TBNA 2JZMA 4B6DA 1TIHA 4E1PA 4JCVE 3B4VC 2GKVA 4OVOA 1KBEA 1U5KA 2JW6A 1BUSA 2KMOA 3BJIA 2XRCA 1CGII 2VRWB 1LR8A 1HDLA 2E5RA 5FUXA 2B0UC 2OD1A 1KMAA 2DIPA 1AN1I 3GOXA 1PTQA 2V1CA 3UEJA 5FUVA 2J9RA 4SGBI 5CCLA 2SGDI 2YUUA 5HQ8A 2GKRI 2ROWA 3OXFA 2WVJA 3UGDA 2KMQA 2JYYA 3E2IA 3SGQI 2P6AC 2N71A 2QQDA 3SGBI 1V1HA 2DB6A 1XX6A 1CT4I 3HH2C 1MT1A 1RFHA 2J87A 1IY6A 2KMRA 1CE3A 3QTLD 5CCMA 1LR9A 3RU0A 1BMOA 2QQEA 2NU1I 3OVOA 3E59A 1OMTA 1SGEI 1TBQR 2WCYA 2SGEI 1Y1CA 1W4RA 2GKTI 2QQ0A 2V1CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTQ A;  3UEJ A;  4UXJ A;  5FUV A;  2J9R A;  4UXH A;  2GVI A;  2ELI A;  1KBF A;  5FUY A;  2E73 A;  1PTR A;  2YUU A;  5FUW A;  2ROW A;  3UGD A;  2WVJ A;  1R79 A;  3UGL A;  4L9M A;  2FNF X;  2ENZ A;  3E2I A;  4UXI A;  2B8T A;  2ENN A;  1TBO A;  1Y8F A;  2DB6 A;  1XX6 A;  1TBN A;  2QPO A;  3KY9 A;  3UEY A;  1FAQ A;  1FAR A;  2J87 A;  1RFH A;  4B6D A;  1KBE A;  3BJI A;  2QQE A;  2VRW B;  3UFF A;  2UZ3 A;  1XA6 A;  2ORV A;  3CXL A;  5FUX A;  1W4R A;  2JA1 A;  1XBT A;  2QQ0 A;  4FKD A;  3UGI A;  2ORW A; 
#chains in the Genus database with same CATH topology
 5E3P A;  1CHO I;  1UUC A;  2M5X A;  2N52 A;  2NU2 I;  4GI3 C;  1CGJ I;  1SGR I;  2CWG A;  1PTR A;  3FSY A;  1NUB A;  3TJQ A;  3UGL A;  1R79 A;  4HGU A;  1PPF I;  1W3S A;  1WKX A;  1M8B A;  2ENZ A;  2OVO A;  1TUS A;  1Z7K B;  4L9M A;  5HI7 A;  1LR7 A;  1TBO A;  1ULN A;  2CJS C;  3OXL A;  4E1R A;  1IW4 A;  3KY9 A;  1FAQ A;  1FYB A;  1N13 A;  1R0R I;  1TGS I;  1YTP A;  1UVG A;  3OL0 A;  1DS3 I;  2QQC A;  3MEK A;  2CWH A;  3PDN A;  2LB7 A;  2ODD A;  2ORV A;  3VE5 A;  2K9H A;  1CT2 I;  1XBT A;  1YU6 C;  3TOA A;  3TO6 A;  4FKD A;  1OYV I;  1TBR R;  2SGQ I;  1DS2 I;  3FSX A;  3VDU A;  1CT0 I;  1UVF A;  1UHA A;  4UXH A;  1SGD I;  2GVI A;  4A24 A;  1M8C A;  3SEK C;  1CSO I;  1H0Z A;  2SGF I;  1SGQ I;  2N17 A;  2NU4 I;  1ULK A;  2RIJ A;  5FUY A;  1IY5 A;  2UVO A;  5EX0 A;  3UGD A;  1WTJ A;  2L8E A;  1X74 A;  2LUY A;  5FUW A;  3D00 A;  1S20 A;  1P9G A;  2KCX A;  1TOT A;  2FNF X;  1HJA I;  1PJU A;  1VDD A;  2B8T A;  2ENN A;  2NU3 I;  1Y8F A;  5EX3 A;  3UEY A;  2QPO A;  3UOE A;  1FAR A;  2DKV A;  2BUS A;  2F3C I;  1HPT A;  3R5D A;  2JXD A;  3FC3 A;  5E3R A;  2Y0M A;  5JHW C;  1WGT A;  4WP4 A;  3QWP A;  1SGN I;  2A20 A;  1XA6 A;  2LEO A;  2UZ3 A;  5DAE A;  3UFF A;  9WGA A;  1OMU A;  2CWF A;  3CXL A;  2V53 A;  2JA1 A;  1MJA A;  7WGA A;  3UGI A;  2ORW A;  3VDP A;  1PCE A;  1OVO A;  1Q9B A;  1V1I A;  1TUR A;  2N1A B;  4UXJ A;  2L7X A;  2ELI A;  5J8F A;  3OXG A;  1KBF A;  2NU0 I;  1X4S A;  2E73 A;  2YQP A;  1SGY I;  1SGP I;  1K7U A;  2ARP F;  1Y1B A;  2SGP I;  2KMP A;  2W0T A;  4UXI A;  2ERW A;  3TO7 A;  1TBN A;  2JZM A;  4B6D A;  1TIH A;  4E1P A;  1ULM A;  3R5B A;  4JCV E;  3B4V C;  2GKV A;  4OVO A;  1KBE A;  5E3Q A;  1K7T A;  1U5K A;  2GIV A;  2JW6 A;  2OU2 A;  1BUS A;  2KMO A;  3BJI A;  2XRC A;  1CGI I;  2VRW B;  1LR8 A;  1HDL A;  3TOB A;  2E5R A;  5FUX A;  2B0U C;  2OD1 A;  3QAH A;  1KMA A;  2DIP A;  3R5A A;  1K7V A;  1AN1 I;  2X52 A;  3GOX A;  1PTQ A;  2V1C A;  2WGC A;  3UEJ A;  5FUV A;  2J9R A;  4SGB I;  2OZU A;  5CCL A;  2SGD I;  4DNC A;  1MJ9 A;  1NXU A;  2YUU A;  3TO9 A;  5HQ8 A;  2GKR I;  2RC4 A;  2ROW A;  2WVJ A;  2X3T A;  2KMQ A;  2JYY A;  3OXF A;  3E2I A;  4MPI A;  3SGQ I;  2P6A C;  2N71 A;  2QQD A;  3SGB I;  1V1H A;  2DB6 A;  1XX6 A;  1CT4 I;  5J8C A;  2PQ8 A;  1MT1 A;  1RFH A;  2J87 A;  3HH2 C;  1IY6 A;  1P9Z A;  2KMR A;  1CE3 A;  3QTL D;  5CCM A;  1LR9 A;  3RU0 A;  1FY7 A;  1BMO A;  2QQE A;  2NU1 I;  3OVO A;  3E59 A;  1OMT A;  3R5C A;  1MJB A;  1SGE I;  1TBQ R;  2WCY A;  2SGE I;  1Z2I A;  1Y1C A;  1W4R A;  1WGC A;  2GKT I;  2QQ0 A;  1HEV A;  2V1C C;  4AML A; 
#chains in the Genus database with same CATH homology
 1CHO I;  1UUC A;  2M5X A;  2N52 A;  2NU2 I;  4GI3 C;  1CGJ I;  1SGR I;  1PTR A;  1NUB A;  3TJQ A;  3UGL A;  1R79 A;  4HGU A;  1PPF I;  1W3S A;  2ENZ A;  1M8B A;  2OVO A;  4L9M A;  1TUS A;  1Z7K B;  5HI7 A;  1LR7 A;  1TBO A;  2CJS C;  4E1R A;  3OXL A;  1IW4 A;  1FAQ A;  3KY9 A;  1FYB A;  1N13 A;  1R0R I;  1TGS I;  1YTP A;  1UVG A;  3OL0 A;  1DS3 I;  2QQC A;  3MEK A;  3PDN A;  2ODD A;  2ORV A;  3VE5 A;  2K9H A;  1CT2 I;  1XBT A;  1YU6 C;  4FKD A;  1OYV I;  1TBR R;  2SGQ I;  1DS2 I;  3VDU A;  1CT0 I;  1UVF A;  4UXH A;  1SGD I;  2GVI A;  4A24 A;  1M8C A;  3SEK C;  1CSO I;  1H0Z A;  2SGF I;  1SGQ I;  2N17 A;  2NU4 I;  1IY5 A;  5FUY A;  5EX0 A;  2L8E A;  1X74 A;  2LUY A;  5FUW A;  3D00 A;  2KCX A;  1TOT A;  2FNF X;  1HJA I;  1PJU A;  1VDD A;  2B8T A;  2ENN A;  2NU3 I;  1Y8F A;  5EX3 A;  3UEY A;  2QPO A;  1FAR A;  2BUS A;  2F3C I;  1HPT A;  2JXD A;  3FC3 A;  5JHW C;  3UFF A;  3QWP A;  1SGN I;  2A20 A;  1XA6 A;  2LEO A;  2UZ3 A;  5DAE A;  1OMU A;  3CXL A;  2V53 A;  2JA1 A;  3UGI A;  2ORW A;  3VDP A;  1PCE A;  1OVO A;  1V1I A;  1TUR A;  2N1A B;  4UXJ A;  2L7X A;  2ELI A;  1KBF A;  3OXG A;  2NU0 I;  1X4S A;  2E73 A;  2YQP A;  1SGY I;  1SGP I;  2ARP F;  1Y1B A;  2SGP I;  2KMP A;  2W0T A;  4UXI A;  2ERW A;  1TBN A;  2JZM A;  4B6D A;  1TIH A;  4E1P A;  4JCV E;  3B4V C;  2GKV A;  4OVO A;  1KBE A;  1U5K A;  2JW6 A;  1BUS A;  2KMO A;  3BJI A;  2XRC A;  1CGI I;  2VRW B;  1LR8 A;  1HDL A;  2E5R A;  5FUX A;  2B0U C;  2OD1 A;  1KMA A;  2DIP A;  1AN1 I;  3GOX A;  1PTQ A;  2V1C A;  3UEJ A;  5FUV A;  2J9R A;  4SGB I;  5CCL A;  2SGD I;  2YUU A;  5HQ8 A;  2GKR I;  2ROW A;  3OXF A;  2WVJ A;  3UGD A;  2KMQ A;  2JYY A;  3E2I A;  3SGQ I;  2P6A C;  2N71 A;  2QQD A;  3SGB I;  1V1H A;  2DB6 A;  1XX6 A;  1CT4 I;  3HH2 C;  1MT1 A;  1RFH A;  2J87 A;  1IY6 A;  2KMR A;  1CE3 A;  3QTL D;  5CCM A;  1LR9 A;  3RU0 A;  1BMO A;  2QQE A;  2NU1 I;  3OVO A;  3E59 A;  1OMT A;  1SGE I;  1TBQ R;  2WCY A;  2SGE I;  1Y1C A;  1W4R A;  2GKT I;  2QQ0 A;  2V1C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...