1FARA

Raf-1 cysteine rich domain, nmr, minimized average structure
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
52
structure length
52
Chain Sequence
b'LTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the Raf-1 cysteine-rich domain: a novel ras and phospholipid binding site.
pubmed doi rcsb
molecule keywords RAF-1
source organism Homo sapiens
molecule tags Serine/threonine protein kinase
total genus 2
structure length 52
sequence length 52
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1farA00
1W4RA 1XA6A 1KBEA 3UGDA 1XBTA 2ENNA 5FUVA 1XX6A 4B6DA 1KBFA 2WVJA 4UXJA 3UGIA 4UXIA 1Y8FA 2J87A 1TBOA 3BJIA 3CXLA 3UEYA 3KY9A 3UFFA 2ORWA 2YUUA 2J9RA 1PTQA 5FUWA 1TBNA 1PTRA 1FARA 4UXHA 2E73A 2QPOA 1R79A 2QQEA 2UZ3A 4FKDA 5FUYA 2ORVA 3UGLA 1RFHA 2B8TA 2DB6A 2ROWA 5FUXA 1FAQA 3E2IA 2QQ0A 2ENZA 2ELIA 3UEJA 2VRWB 2JA1A 2FNFX 2GVIA 4L9MA
chains in the Genus database with same CATH superfamily
2NU2I 1FYBA 3HH2C 2JYYA 5DAEA 2NU4I 3UGDA 1CT2I 1LR7A 1ULNA 1ULMA 1UUCA 1XX6A 1YTPA 2OVOA 2P6AC 1NXUA 1MJAA 1MT1A 1WGCA 5E3PA 2V1CC 2CWHA 4UXIA 1M8CA 2SGDI 3SGBI 2J87A 2XRCA 2F3CI 2KCXA 2OZUA 3OXLA 3OVOA 1UHAA 3KY9A 1IW4A 4HGUA 1R0RI 2ERWA 2JZMA 2QQDA 1PCEA 2V1CA 1DS3I 4WP4A 5J8FA 1IY5A 2E73A 2QPOA 2QQEA 3R5CA 1V1HA 2ORVA 1P9GA 2ODDA 2DB6A 1TOTA 2ROWA 5EX0A 2QQ0A 1TUSA 2ENZA 3FSYA 2ARPF 1MJ9A 2DIPA 4B6DA 1W4RA 3TOBA 1KMAA 2GKVA 1N13A 4MPIA 1KBEA 2A20A 1XBTA 5EX3A 2L8EA 3SEKC 5FUVA 2B0UC 2OU2A 1CGJI 2GKRI 3TO7A 1S20A 1WTJA 1CGII 2M5XA 2NU0I 1FY7A 2LUYA 4GI3C 1TBOA 3SGQI 3CXLA 1TBRR 3E59A 3UFFA 3R5BA 1H0ZA 1U5KA 1X74A 2KMPA 1TBNA 1BMOA 1PTRA 4E1PA 3MEKA 4FKDA 3VDPA 1IY6A 1YU6C 1CT4I 2Y0MA 1TGSI 2CWGA 5FUYA 1Y1BA 9WGAA 2SGFI 3UGLA 1TURA 2B8TA 5HQ8A 1HPTA 3OL0A 3TJQA 1BUSA 3UEJA 2N52A 1OYVI 1WGTA 2L7XA 3VDUA 1WKXA 1K7UA 1W3SA 3QWPA 3RU0A 1DS2I 1XA6A 1SGQI 1HDLA 2SGPI 1OVOA 1LR9A 1SGDI 2CWFA 2RIJA 2KMRA 1CE3A 1VDDA 1KBFA 2X52A 1V1IA 2WVJA 4SGBI 2CJSC 1Y8FA 2N1AB 2LEOA 2WGCA 3UEYA 1PPFI 1SGRI 2BUSA 2ORWA 2KMQA 3OXGA 5E3QA 4DNCA 1HEVA 1PTQA 2QQCA 1X4SA 5FUWA 3TO6A 2LB7A 2SGEI 1SGNI 1OMUA 3UOEA 3FC3A 1LR8A 2W0TA 1TBQR 1RFHA 2GKTI 1UVGA 5CCLA 5FUXA 1Y1CA 3E2IA 1FAQA 2ELIA 3OXFA 2VRWB 3B4VC 2JA1A 4E1RA 2FNFX 3VE5A 2J9RA 4AMLA 2JXDA 2K9HA 5JHWC 4L9MA 3R5AA 4OVOA 3FSXA 1OMTA 2ENNA 2GIVA 2GVIA 1CT0I 3QAHA 3QTLD 1HJAI 1MJBA 3TOAA 4UXJA 5CCMA 2E5RA 5E3RA 1SGPI 3UGIA 1SGYI 2DKVA 5J8CA 1Q9BA 2UVOA 1M8BA 1NUBA 1AN1I 3BJIA 7WGAA 4A24A 2N17A 2OD1A 2YUUA 2N71A 1P9ZA 3R5DA 1SGEI 2V53A 1FARA 1Z2IA 2SGQI 2WCYA 4UXHA 2UZ3A 2PQ8A 1R79A 2KMOA 2YQPA 1UVFA 1CSOI 2NU1I 2RC4A 3D00A 1K7TA 3PDNA 1TIHA 1CHOI 3GOXA 2NU3I 4JCVE 5HI7A 2JW6A 2X3TA 1PJUA 3TO9A 1ULKA 1Z7KB 1K7VA
chains in the Genus database with same CATH topology
2NU2I 1FYBA 3HH2C 2JYYA 5DAEA 2NU4I 3UGDA 1CT2I 1LR7A 1UUCA 1XX6A 1YTPA 2OVOA 2P6AC 4B6DA 1MT1A 2V1CC 4UXIA 1M8CA 2SGDI 3SGBI 2J87A 2XRCA 2F3CI 2KCXA 3OXLA 3OVOA 3KY9A 1IW4A 4HGUA 1R0RI 2ERWA 2JZMA 2QQDA 1PCEA 2V1CA 1DS3I 1IY5A 2E73A 2QPOA 2QQEA 1V1HA 2ORVA 2ODDA 2DB6A 1TOTA 2ROWA 5EX0A 2QQ0A 1TUSA 2ENZA 2ARPF 2DIPA 1W4RA 1KMAA 2GKVA 1N13A 1KBEA 2A20A 1XBTA 5EX3A 2L8EA 3SEKC 5FUVA 2B0UC 1CGJI 2GKRI 1CGII 2M5XA 2NU0I 2LUYA 4GI3C 1TBOA 3SGQI 3CXLA 1TBRR 3E59A 3UFFA 1H0ZA 1U5KA 1X74A 2KMPA 1TBNA 1BMOA 1PTRA 4E1PA 3MEKA 4FKDA 3VDPA 1IY6A 1YU6C 1CT4I 1TGSI 5FUYA 1Y1BA 2SGFI 3UGLA 1TURA 2B8TA 5HQ8A 1HPTA 3OL0A 3TJQA 1BUSA 3UEJA 2N52A 1OYVI 2L7XA 3VDUA 1W3SA 3QWPA 3RU0A 1DS2I 1XA6A 1SGQI 1HDLA 2SGPI 1OVOA 1LR9A 1SGDI 2KMRA 1CE3A 1VDDA 1KBFA 1V1IA 2WVJA 4SGBI 2CJSC 1Y8FA 2N1AB 2LEOA 3UEYA 1PPFI 1SGRI 2BUSA 2ORWA 2KMQA 3OXGA 1PTQA 2QQCA 1X4SA 5FUWA 2SGEI 1SGNI 1OMUA 1LR8A 2W0TA 1TBQR 1RFHA 2GKTI 1UVGA 5CCLA 5FUXA 1Y1CA 3E2IA 1FAQA 2ELIA 3OXFA 2VRWB 3B4VC 2JA1A 4E1RA 2FNFX 3VE5A 2J9RA 2JXDA 2K9HA 5JHWC 4L9MA 4OVOA 1OMTA 2ENNA 2GVIA 1CT0I 3QTLD 5CCMA 1HJAI 4UXJA 2E5RA 1SGPI 3UGIA 1SGYI 1M8BA 1NUBA 1AN1I 3BJIA 4A24A 2N17A 2OD1A 2YUUA 2N71A 1SGEI 2V53A 1FARA 2SGQI 2WCYA 4UXHA 2UZ3A 1R79A 2KMOA 2YQPA 1UVFA 1CSOI 2NU1I 3D00A 3PDNA 1TIHA 3GOXA 2NU3I 4JCVE 5HI7A 2JW6A 1PJUA 3FC3A 1CHOI 1Z7KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4R A;  1XA6 A;  1KBE A;  3UGD A;  1XBT A;  2ENN A;  5FUV A;  1XX6 A;  4B6D A;  1KBF A;  2WVJ A;  4UXJ A;  3UGI A;  4UXI A;  1Y8F A;  2J87 A;  1TBO A;  3BJI A;  3CXL A;  3UEY A;  3KY9 A;  3UFF A;  2ORW A;  2YUU A;  2J9R A;  1PTQ A;  5FUW A;  1TBN A;  1PTR A;  1FAR A;  4UXH A;  2E73 A;  2QPO A;  1R79 A;  2QQE A;  2UZ3 A;  4FKD A;  5FUY A;  2ORV A;  3UGL A;  1RFH A;  2B8T A;  2DB6 A;  2ROW A;  5FUX A;  1FAQ A;  3E2I A;  2QQ0 A;  2ENZ A;  2ELI A;  3UEJ A;  2VRW B;  2JA1 A;  2FNF X;  2GVI A;  4L9M A; 
#chains in the Genus database with same CATH topology
 2NU2 I;  1FYB A;  3HH2 C;  2JYY A;  5DAE A;  2NU4 I;  3UGD A;  1CT2 I;  1LR7 A;  1ULN A;  1ULM A;  1UUC A;  1XX6 A;  1YTP A;  2OVO A;  2P6A C;  1NXU A;  1MJA A;  1MT1 A;  1WGC A;  5E3P A;  2V1C C;  2CWH A;  4UXI A;  1M8C A;  2SGD I;  3SGB I;  2J87 A;  2XRC A;  2F3C I;  2KCX A;  2OZU A;  3OXL A;  3OVO A;  1UHA A;  3KY9 A;  1IW4 A;  4HGU A;  1R0R I;  2ERW A;  2JZM A;  2QQD A;  1PCE A;  2V1C A;  1DS3 I;  4WP4 A;  5J8F A;  1IY5 A;  2E73 A;  2QPO A;  2QQE A;  3R5C A;  1V1H A;  2ORV A;  1P9G A;  2ODD A;  2DB6 A;  1TOT A;  2ROW A;  5EX0 A;  2QQ0 A;  1TUS A;  2ENZ A;  3FSY A;  2ARP F;  1MJ9 A;  2DIP A;  4B6D A;  1W4R A;  3TOB A;  1KMA A;  2GKV A;  1N13 A;  4MPI A;  1KBE A;  2A20 A;  1XBT A;  5EX3 A;  2L8E A;  3SEK C;  5FUV A;  2B0U C;  2OU2 A;  1CGJ I;  2GKR I;  3TO7 A;  1S20 A;  1WTJ A;  1CGI I;  2M5X A;  2NU0 I;  1FY7 A;  2LUY A;  4GI3 C;  1TBO A;  3SGQ I;  3CXL A;  1TBR R;  3E59 A;  3UFF A;  3R5B A;  1H0Z A;  1U5K A;  1X74 A;  2KMP A;  1TBN A;  1BMO A;  1PTR A;  4E1P A;  3MEK A;  4FKD A;  3VDP A;  1IY6 A;  1YU6 C;  1CT4 I;  2Y0M A;  1TGS I;  2CWG A;  5FUY A;  1Y1B A;  9WGA A;  2SGF I;  3UGL A;  1TUR A;  2B8T A;  5HQ8 A;  1HPT A;  3OL0 A;  3TJQ A;  1BUS A;  3UEJ A;  2N52 A;  1OYV I;  1WGT A;  2L7X A;  3VDU A;  1WKX A;  1K7U A;  1W3S A;  3QWP A;  3RU0 A;  1DS2 I;  1XA6 A;  1SGQ I;  1HDL A;  2SGP I;  1OVO A;  1LR9 A;  1SGD I;  2CWF A;  2RIJ A;  2KMR A;  1CE3 A;  1VDD A;  1KBF A;  2X52 A;  1V1I A;  2WVJ A;  4SGB I;  2CJS C;  1Y8F A;  2N1A B;  2LEO A;  2WGC A;  3UEY A;  1PPF I;  1SGR I;  2BUS A;  2ORW A;  2KMQ A;  3OXG A;  5E3Q A;  4DNC A;  1HEV A;  1PTQ A;  2QQC A;  1X4S A;  5FUW A;  3TO6 A;  2LB7 A;  2SGE I;  1SGN I;  1OMU A;  3UOE A;  3FC3 A;  1LR8 A;  2W0T A;  1TBQ R;  1RFH A;  2GKT I;  1UVG A;  5CCL A;  5FUX A;  1Y1C A;  3E2I A;  1FAQ A;  2ELI A;  3OXF A;  2VRW B;  3B4V C;  2JA1 A;  4E1R A;  2FNF X;  3VE5 A;  2J9R A;  4AML A;  2JXD A;  2K9H A;  5JHW C;  4L9M A;  3R5A A;  4OVO A;  3FSX A;  1OMT A;  2ENN A;  2GIV A;  2GVI A;  1CT0 I;  3QAH A;  3QTL D;  1HJA I;  1MJB A;  3TOA A;  4UXJ A;  5CCM A;  2E5R A;  5E3R A;  1SGP I;  3UGI A;  1SGY I;  2DKV A;  5J8C A;  1Q9B A;  2UVO A;  1M8B A;  1NUB A;  1AN1 I;  3BJI A;  7WGA A;  4A24 A;  2N17 A;  2OD1 A;  2YUU A;  2N71 A;  1P9Z A;  3R5D A;  1SGE I;  2V53 A;  1FAR A;  1Z2I A;  2SGQ I;  2WCY A;  4UXH A;  2UZ3 A;  2PQ8 A;  1R79 A;  2KMO A;  2YQP A;  1UVF A;  1CSO I;  2NU1 I;  2RC4 A;  3D00 A;  1K7T A;  3PDN A;  1TIH A;  1CHO I;  3GOX A;  2NU3 I;  4JCV E;  5HI7 A;  2JW6 A;  2X3T A;  1PJU A;  3TO9 A;  1ULK A;  1Z7K B;  1K7V A; 
#chains in the Genus database with same CATH homology
 2NU2 I;  1FYB A;  3HH2 C;  2JYY A;  5DAE A;  2NU4 I;  3UGD A;  1CT2 I;  1LR7 A;  1UUC A;  1XX6 A;  1YTP A;  2OVO A;  2P6A C;  4B6D A;  1MT1 A;  2V1C C;  4UXI A;  1M8C A;  2SGD I;  3SGB I;  2J87 A;  2XRC A;  2F3C I;  2KCX A;  3OXL A;  3OVO A;  3KY9 A;  1IW4 A;  4HGU A;  1R0R I;  2ERW A;  2JZM A;  2QQD A;  1PCE A;  2V1C A;  1DS3 I;  1IY5 A;  2E73 A;  2QPO A;  2QQE A;  1V1H A;  2ORV A;  2ODD A;  2DB6 A;  1TOT A;  2ROW A;  5EX0 A;  2QQ0 A;  1TUS A;  2ENZ A;  2ARP F;  2DIP A;  1W4R A;  1KMA A;  2GKV A;  1N13 A;  1KBE A;  2A20 A;  1XBT A;  5EX3 A;  2L8E A;  3SEK C;  5FUV A;  2B0U C;  1CGJ I;  2GKR I;  1CGI I;  2M5X A;  2NU0 I;  2LUY A;  4GI3 C;  1TBO A;  3SGQ I;  3CXL A;  1TBR R;  3E59 A;  3UFF A;  1H0Z A;  1U5K A;  1X74 A;  2KMP A;  1TBN A;  1BMO A;  1PTR A;  4E1P A;  3MEK A;  4FKD A;  3VDP A;  1IY6 A;  1YU6 C;  1CT4 I;  1TGS I;  5FUY A;  1Y1B A;  2SGF I;  3UGL A;  1TUR A;  2B8T A;  5HQ8 A;  1HPT A;  3OL0 A;  3TJQ A;  1BUS A;  3UEJ A;  2N52 A;  1OYV I;  2L7X A;  3VDU A;  1W3S A;  3QWP A;  3RU0 A;  1DS2 I;  1XA6 A;  1SGQ I;  1HDL A;  2SGP I;  1OVO A;  1LR9 A;  1SGD I;  2KMR A;  1CE3 A;  1VDD A;  1KBF A;  1V1I A;  2WVJ A;  4SGB I;  2CJS C;  1Y8F A;  2N1A B;  2LEO A;  3UEY A;  1PPF I;  1SGR I;  2BUS A;  2ORW A;  2KMQ A;  3OXG A;  1PTQ A;  2QQC A;  1X4S A;  5FUW A;  2SGE I;  1SGN I;  1OMU A;  1LR8 A;  2W0T A;  1TBQ R;  1RFH A;  2GKT I;  1UVG A;  5CCL A;  5FUX A;  1Y1C A;  3E2I A;  1FAQ A;  2ELI A;  3OXF A;  2VRW B;  3B4V C;  2JA1 A;  4E1R A;  2FNF X;  3VE5 A;  2J9R A;  2JXD A;  2K9H A;  5JHW C;  4L9M A;  4OVO A;  1OMT A;  2ENN A;  2GVI A;  1CT0 I;  3QTL D;  5CCM A;  1HJA I;  4UXJ A;  2E5R A;  1SGP I;  3UGI A;  1SGY I;  1M8B A;  1NUB A;  1AN1 I;  3BJI A;  4A24 A;  2N17 A;  2OD1 A;  2YUU A;  2N71 A;  1SGE I;  2V53 A;  1FAR A;  2SGQ I;  2WCY A;  4UXH A;  2UZ3 A;  1R79 A;  2KMO A;  2YQP A;  1UVF A;  1CSO I;  2NU1 I;  3D00 A;  3PDN A;  1TIH A;  3GOX A;  2NU3 I;  4JCV E;  5HI7 A;  2JW6 A;  1PJU A;  3FC3 A;  1CHO I;  1Z7K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...