1FARA

Raf-1 cysteine rich domain, nmr, minimized average structure
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
52
structure length
52
Chain Sequence
LTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAF-1
publication title The solution structure of the Raf-1 cysteine-rich domain: a novel ras and phospholipid binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine/threonine protein kinase
total genus 2
structure length 52
sequence length 52
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1farA00
2DB6A 1TBNA 2ORWA 3UGDA 4UXHA 5FUVA 5FUXA 3UFFA 2ORVA 4FKDA 1FAQA 2ELIA 1W4RA 1XBTA 2B8TA 2YUUA 3CXLA 4UXIA 2GVIA 2J9RA 2JA1A 2J87A 2E73A 1XX6A 3E2IA 3UGLA 2QQEA 3KY9A 3UEYA 3UEJA 5FUWA 1TBOA 4UXJA 1R79A 3UGIA 2QQ0A 2ROWA 1PTRA 1RFHA 1Y8FA 2QPOA 1KBFA 2ENNA 2VRWB 2WVJA 2ENZA 4L9MA 1XA6A 4B6DA 1KBEA 3BJIA 5FUYA 1FARA 2FNFX 1PTQA 2UZ3A
chains in the Genus database with same CATH superfamily
1TBNA 1CT4I 4MPIA 1TBQR 3QWPA 1K7TA 2KMQA 2ELIA 1W4RA 2JZMA 2OZUA 2YUUA 3R5CA 2PQ8A 4DNCA 2J87A 5DAEA 1SGDI 3TOBA 1MJAA 1V1IA 1CGII 2QQEA 3PDNA 1LR9A 3UEYA 1DS3I 3UEJA 4A24A 2KMOA 7WGAA 1TBOA 4UXJA 3OXFA 1KMAA 3E59A 4JCVE 2P6AC 2QQ0A 2LUYA 2V53A 3OVOA 2RIJA 1Q9BA 2ENZA 1XA6A 2QQCA 5EX0A 1SGYI 2NU2I 2E5RA 5FUYA 1SGNI 4WP4A 3OL0A 1H0ZA 1W3SA 1PTQA 2UZ3A 1OVOA 2X3TA 4OVOA 1CHOI 2JYYA 5HI7A 1BUSA 2WCYA 3UFFA 1WGTA 2V1CA 2ORVA 2V1CC 3FSYA 4FKDA 1SGEI 3GOXA 2BUSA 2ARPF 1XBTA 3TJQA 4AMLA 2GVIA 1S20A 1TBRR 1VDDA 2JA1A 3R5AA 2N71A 4GI3C 3SGQI 3E2IA 1FYBA 2RC4A 1PPFI 2SGPI 3KY9A 1M8CA 5JHWC 1TOTA 1TIHA 2M5XA 5HQ8A 2XRCA 3OXGA 3UGIA 2N1AB 2ROWA 1HDLA 1FY7A 1TUSA 1NUBA 1TURA 2LB7A 2CWHA 1P9ZA 2QPOA 3MEKA 2GIVA 1OMTA 5E3RA 2WVJA 2JXDA 2CWFA 5CCMA 1CGJI 1K7UA 5J8CA 3BJIA 1N13A 3HH2C 2KMPA 2SGDI 3R5DA 4L9MA 1ULNA 3QAHA 5E3PA 1ULKA 3TOAA 1KBFA 1IY5A 2ORWA 3VDUA 1P9GA 1MJBA 2Y0MA 5EX3A 1NXUA 1U5KA 1FAQA 2N17A 3R5BA 2CJSC 2W0TA 2GKVA 3CXLA 2KCXA 1TGSI 1PCEA 2JW6A 2DKVA 2E73A 2GKRI 1XX6A 1WTJA 1BMOA 3D00A 1Z2IA 3QTLD 1X4SA 5FUWA 1MJ9A 1PJUA 3VDPA 1R79A 1UUCA 4HGUA 2GKTI 2NU0I 1SGRI 1MT1A 4E1PA 1M8BA 1PTRA 2QQDA 3SEKC 1IW4A 1RFHA 1YTPA 1Y8FA 2DIPA 2OVOA 4E1RA 2NU1I 2ENNA 3TO7A 1Y1BA 2NU3I 1CSOI 2B0UC 1WKXA 1CT2I 1HPTA 2N52A 2DB6A 2UVOA 2YQPA 3SGBI 3UGDA 1Y1CA 4UXHA 5FUVA 5FUXA 2L7XA 1UVGA 1V1HA 2SGFI 1HJAI 5J8FA 3FC3A 1K7VA 1R0RI 1Z7KB 2B8TA 1ULMA 4UXIA 2SGQI 4SGBI 3RU0A 2J9RA 3UOEA 1AN1I 1UVFA 3OXLA 3UGLA 1CT0I 3TO9A 2KMRA 1LR7A 1DS2I 2ERWA 2LEOA 2OD1A 2WGCA 5CCLA 1IY6A 2A20A 2K9HA 3B4VC 2L8EA 1YU6C 2OU2A 5E3QA 1WGCA 2F3CI 1SGPI 3TO6A 2SGEI 9WGAA 1OYVI 1CE3A 2VRWB 1X74A 1LR8A 1OMUA 1KBEA 3FSXA 1SGQI 4B6DA 2NU4I 1FARA 3VE5A 2FNFX 2ODDA 2CWGA 2X52A 1HEVA 1UHAA
chains in the Genus database with same CATH topology
1TBNA 1CT4I 1TBQR 3QWPA 2KMQA 2ELIA 1W4RA 2JZMA 2YUUA 2J87A 5DAEA 1SGDI 1V1IA 1CGII 2QQEA 3PDNA 1LR9A 3UEYA 1DS3I 3UEJA 4A24A 2KMOA 1TBOA 4UXJA 3OXFA 1KMAA 3E59A 4JCVE 2P6AC 2QQ0A 2LUYA 2V53A 3OVOA 2ENZA 1XA6A 2QQCA 5EX0A 1SGYI 2NU2I 2E5RA 5FUYA 1SGNI 1H0ZA 3OL0A 1W3SA 1PTQA 2UZ3A 1OVOA 4OVOA 1CHOI 2JYYA 5HI7A 1BUSA 2WCYA 3UFFA 2V1CA 2V1CC 2ORVA 4FKDA 1SGEI 3GOXA 2BUSA 2ARPF 1XBTA 3TJQA 2GVIA 1VDDA 1TBRR 4GI3C 2JA1A 3SGQI 2N71A 3E2IA 1FYBA 1PPFI 2SGPI 3KY9A 1M8CA 5JHWC 1TOTA 1TIHA 2M5XA 5HQ8A 2XRCA 3OXGA 3UGIA 2N1AB 2ROWA 1HDLA 1TUSA 1NUBA 1TURA 2QPOA 3MEKA 1OMTA 2WVJA 2JXDA 5CCMA 1CGJI 3BJIA 1N13A 3HH2C 2KMPA 2SGDI 4L9MA 1KBFA 1IY5A 2ORWA 3VDUA 5EX3A 1U5KA 1FAQA 2N17A 2CJSC 2W0TA 2GKVA 3CXLA 2KCXA 1TGSI 1PCEA 2JW6A 2E73A 2GKRI 1XX6A 1BMOA 3D00A 3QTLD 1X4SA 5FUWA 1PJUA 3VDPA 1R79A 1UUCA 4HGUA 2GKTI 2NU0I 1SGRI 1MT1A 4E1PA 1M8BA 1PTRA 2QQDA 3SEKC 1IW4A 1RFHA 1YTPA 1Y8FA 2DIPA 2OVOA 4E1RA 2NU1I 2ENNA 1Y1BA 2NU3I 1CSOI 2B0UC 1CT2I 1HPTA 2N52A 2DB6A 2YQPA 3SGBI 3UGDA 1Y1CA 4UXHA 5FUVA 5FUXA 2L7XA 1UVGA 1V1HA 2SGFI 1HJAI 3FC3A 1R0RI 1Z7KB 2B8TA 4UXIA 2SGQI 4SGBI 3RU0A 2J9RA 1AN1I 1UVFA 3OXLA 3UGLA 1CT0I 2KMRA 1LR7A 1DS2I 2ERWA 2LEOA 2OD1A 5CCLA 1IY6A 2A20A 2K9HA 3B4VC 2L8EA 1YU6C 2F3CI 1SGPI 2SGEI 1OYVI 1CE3A 2VRWB 1X74A 1LR8A 1OMUA 1KBEA 4B6DA 1SGQI 2NU4I 1FARA 3VE5A 2FNFX 2ODDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB6 A;  1TBN A;  2ORW A;  3UGD A;  4UXH A;  5FUV A;  5FUX A;  3UFF A;  2ORV A;  4FKD A;  1FAQ A;  2ELI A;  1W4R A;  1XBT A;  2B8T A;  2YUU A;  3CXL A;  4UXI A;  2GVI A;  2J9R A;  2JA1 A;  2J87 A;  2E73 A;  1XX6 A;  3E2I A;  3UGL A;  2QQE A;  3KY9 A;  3UEY A;  3UEJ A;  5FUW A;  1TBO A;  4UXJ A;  1R79 A;  3UGI A;  2QQ0 A;  2ROW A;  1PTR A;  1RFH A;  1Y8F A;  2QPO A;  1KBF A;  2ENN A;  2VRW B;  2WVJ A;  2ENZ A;  4L9M A;  1XA6 A;  4B6D A;  1KBE A;  3BJI A;  5FUY A;  1FAR A;  2FNF X;  1PTQ A;  2UZ3 A; 
#chains in the Genus database with same CATH topology
 1TBN A;  1CT4 I;  4MPI A;  1TBQ R;  3QWP A;  1K7T A;  2KMQ A;  2ELI A;  1W4R A;  2JZM A;  2OZU A;  2YUU A;  3R5C A;  2PQ8 A;  4DNC A;  2J87 A;  5DAE A;  1SGD I;  3TOB A;  1MJA A;  1V1I A;  1CGI I;  2QQE A;  3PDN A;  1LR9 A;  3UEY A;  1DS3 I;  3UEJ A;  4A24 A;  2KMO A;  7WGA A;  1TBO A;  4UXJ A;  3OXF A;  1KMA A;  3E59 A;  4JCV E;  2P6A C;  2QQ0 A;  2LUY A;  2V53 A;  3OVO A;  2RIJ A;  1Q9B A;  2ENZ A;  1XA6 A;  2QQC A;  5EX0 A;  1SGY I;  2NU2 I;  2E5R A;  5FUY A;  1SGN I;  4WP4 A;  3OL0 A;  1H0Z A;  1W3S A;  1PTQ A;  2UZ3 A;  1OVO A;  2X3T A;  4OVO A;  1CHO I;  2JYY A;  5HI7 A;  1BUS A;  2WCY A;  3UFF A;  1WGT A;  2V1C A;  2ORV A;  2V1C C;  3FSY A;  4FKD A;  1SGE I;  3GOX A;  2BUS A;  2ARP F;  1XBT A;  3TJQ A;  4AML A;  2GVI A;  1S20 A;  1TBR R;  1VDD A;  2JA1 A;  3R5A A;  2N71 A;  4GI3 C;  3SGQ I;  3E2I A;  1FYB A;  2RC4 A;  1PPF I;  2SGP I;  3KY9 A;  1M8C A;  5JHW C;  1TOT A;  1TIH A;  2M5X A;  5HQ8 A;  2XRC A;  3OXG A;  3UGI A;  2N1A B;  2ROW A;  1HDL A;  1FY7 A;  1TUS A;  1NUB A;  1TUR A;  2LB7 A;  2CWH A;  1P9Z A;  2QPO A;  3MEK A;  2GIV A;  1OMT A;  5E3R A;  2WVJ A;  2JXD A;  2CWF A;  5CCM A;  1CGJ I;  1K7U A;  5J8C A;  3BJI A;  1N13 A;  3HH2 C;  2KMP A;  2SGD I;  3R5D A;  4L9M A;  1ULN A;  3QAH A;  5E3P A;  1ULK A;  3TOA A;  1KBF A;  1IY5 A;  2ORW A;  3VDU A;  1P9G A;  1MJB A;  2Y0M A;  5EX3 A;  1NXU A;  1U5K A;  1FAQ A;  2N17 A;  3R5B A;  2CJS C;  2W0T A;  2GKV A;  3CXL A;  2KCX A;  1TGS I;  1PCE A;  2JW6 A;  2DKV A;  2E73 A;  2GKR I;  1XX6 A;  1WTJ A;  1BMO A;  3D00 A;  1Z2I A;  3QTL D;  1X4S A;  5FUW A;  1MJ9 A;  1PJU A;  3VDP A;  1R79 A;  1UUC A;  4HGU A;  2GKT I;  2NU0 I;  1SGR I;  1MT1 A;  4E1P A;  1M8B A;  1PTR A;  2QQD A;  3SEK C;  1IW4 A;  1RFH A;  1YTP A;  1Y8F A;  2DIP A;  2OVO A;  4E1R A;  2NU1 I;  2ENN A;  3TO7 A;  1Y1B A;  2NU3 I;  1CSO I;  2B0U C;  1WKX A;  1CT2 I;  1HPT A;  2N52 A;  2DB6 A;  2UVO A;  2YQP A;  3SGB I;  3UGD A;  1Y1C A;  4UXH A;  5FUV A;  5FUX A;  2L7X A;  1UVG A;  1V1H A;  2SGF I;  1HJA I;  5J8F A;  3FC3 A;  1K7V A;  1R0R I;  1Z7K B;  2B8T A;  1ULM A;  4UXI A;  2SGQ I;  4SGB I;  3RU0 A;  2J9R A;  3UOE A;  1AN1 I;  1UVF A;  3OXL A;  3UGL A;  1CT0 I;  3TO9 A;  2KMR A;  1LR7 A;  1DS2 I;  2ERW A;  2LEO A;  2OD1 A;  2WGC A;  5CCL A;  1IY6 A;  2A20 A;  2K9H A;  3B4V C;  2L8E A;  1YU6 C;  2OU2 A;  5E3Q A;  1WGC A;  2F3C I;  1SGP I;  3TO6 A;  2SGE I;  9WGA A;  1OYV I;  1CE3 A;  2VRW B;  1X74 A;  1LR8 A;  1OMU A;  1KBE A;  3FSX A;  1SGQ I;  4B6D A;  2NU4 I;  1FAR A;  3VE5 A;  2FNF X;  2ODD A;  2CWG A;  2X52 A;  1HEV A;  1UHA A; 
#chains in the Genus database with same CATH homology
 1TBN A;  1CT4 I;  1TBQ R;  3QWP A;  2KMQ A;  2ELI A;  1W4R A;  2JZM A;  2YUU A;  2J87 A;  5DAE A;  1SGD I;  1V1I A;  1CGI I;  2QQE A;  3PDN A;  1LR9 A;  3UEY A;  1DS3 I;  3UEJ A;  4A24 A;  2KMO A;  1TBO A;  4UXJ A;  3OXF A;  1KMA A;  3E59 A;  4JCV E;  2P6A C;  2QQ0 A;  2LUY A;  2V53 A;  3OVO A;  2ENZ A;  1XA6 A;  2QQC A;  5EX0 A;  1SGY I;  2NU2 I;  2E5R A;  5FUY A;  1SGN I;  1H0Z A;  3OL0 A;  1W3S A;  1PTQ A;  2UZ3 A;  1OVO A;  4OVO A;  1CHO I;  2JYY A;  5HI7 A;  1BUS A;  2WCY A;  3UFF A;  2V1C A;  2V1C C;  2ORV A;  4FKD A;  1SGE I;  3GOX A;  2BUS A;  2ARP F;  1XBT A;  3TJQ A;  2GVI A;  1VDD A;  1TBR R;  4GI3 C;  2JA1 A;  3SGQ I;  2N71 A;  3E2I A;  1FYB A;  1PPF I;  2SGP I;  3KY9 A;  1M8C A;  5JHW C;  1TOT A;  1TIH A;  2M5X A;  5HQ8 A;  2XRC A;  3OXG A;  3UGI A;  2N1A B;  2ROW A;  1HDL A;  1TUS A;  1NUB A;  1TUR A;  2QPO A;  3MEK A;  1OMT A;  2WVJ A;  2JXD A;  5CCM A;  1CGJ I;  3BJI A;  1N13 A;  3HH2 C;  2KMP A;  2SGD I;  4L9M A;  1KBF A;  1IY5 A;  2ORW A;  3VDU A;  5EX3 A;  1U5K A;  1FAQ A;  2N17 A;  2CJS C;  2W0T A;  2GKV A;  3CXL A;  2KCX A;  1TGS I;  1PCE A;  2JW6 A;  2E73 A;  2GKR I;  1XX6 A;  1BMO A;  3D00 A;  3QTL D;  1X4S A;  5FUW A;  1PJU A;  3VDP A;  1R79 A;  1UUC A;  4HGU A;  2GKT I;  2NU0 I;  1SGR I;  1MT1 A;  4E1P A;  1M8B A;  1PTR A;  2QQD A;  3SEK C;  1IW4 A;  1RFH A;  1YTP A;  1Y8F A;  2DIP A;  2OVO A;  4E1R A;  2NU1 I;  2ENN A;  1Y1B A;  2NU3 I;  1CSO I;  2B0U C;  1CT2 I;  1HPT A;  2N52 A;  2DB6 A;  2YQP A;  3SGB I;  3UGD A;  1Y1C A;  4UXH A;  5FUV A;  5FUX A;  2L7X A;  1UVG A;  1V1H A;  2SGF I;  1HJA I;  3FC3 A;  1R0R I;  1Z7K B;  2B8T A;  4UXI A;  2SGQ I;  4SGB I;  3RU0 A;  2J9R A;  1AN1 I;  1UVF A;  3OXL A;  3UGL A;  1CT0 I;  2KMR A;  1LR7 A;  1DS2 I;  2ERW A;  2LEO A;  2OD1 A;  5CCL A;  1IY6 A;  2A20 A;  2K9H A;  3B4V C;  2L8E A;  1YU6 C;  2F3C I;  1SGP I;  2SGE I;  1OYV I;  1CE3 A;  2VRW B;  1X74 A;  1LR8 A;  1OMU A;  1KBE A;  4B6D A;  1SGQ I;  2NU4 I;  1FAR A;  3VE5 A;  2FNF X;  2ODD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...