1FAVA

The structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
78
structure length
78
Chain Sequence
IEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an HIV-1 specific cell entry inhibitor in complex with the HIV-1 gp41 trimeric core.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 ENVELOPE PROTEIN CHIMERA
total genus 35
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2000-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1favA00
2W6AA 5AW5B 2Q7CA 2Z5HA 3UIAA 3M06A 1DH3A 3M0DA 5APTA 2Q3IA 3HE4B 1CI6A 1OWAA 4KHXA 5AVRB 1NAFA 1H8AA 4JYCA 3M0AA 4LC1A 3A3YB 3P8MC 3VYIA 3I5CA 4B86A 5AW9B 1MFZA 3M91A 5AVWB 2C9NY 1OXZA 2W27A 2WPRA 3KQGA 3SWFA 2ZXEB 1J2JB 5AVSB 2XZRA 5APVA 3NMDA 3OAKA 2KP8A 2YO2A 5AW3B 1SLQA 3M9HA 2YNYA 1A02F 3VTPC 5APUA 1S9KD 3HE4A 3IR9A 5CMZA 4M3LA 1GU4A 2P67A 1G2CB 2R32A 2VRSA 1FOSE 5AVZB 4C7NA 3KDPB 2Q5UA 5AW6B 2QM8A 4EOTA 5AW2B 4C46A 1S9KE 3L35A 3HTKA 2XV5A 2H7HA 4AUWA 5APYA 2E42A 2JJLA 3A7OA 5APXA 2WTYA 1JNMA 1H88A 1GTWA 3P7KA 1A02J 1JUNA 3NTNA 1T2KC 5AW8B 2BASA 5AW4B 1GK4A 5AVQB 5AVYB 5AVVB 3V5BA 2P2UA 3MGNA 5APWA 2P7JA 2QM7A 2R5BA 2E43A 3A5TA 2N9BA 3MD0A 1SP4A 3HE5A 3A2AA 1H89A 1GZLA 1CZQA 3TK1A 1FAVA 4AQRD 1T2KD 3VMZA 5APQA 1HUCA 5AVTB 3NXSA 3TYYA 1HBWA 4I2LC 5AVUB 3NFQA 1HWTC 2Z5IA 3T97A 1HJBA 1YYCA 4RESB 4C7NB 2WPSA 3LIDA 3HE5B 1KQLA 2WT7A 5AW0B 2R3CA 3TNUA 3L37A 2YO3A 5AW1B 1GU5A 4HYTB 1MV8A 4DZOA 4JYBA 1CI6B 2IPPA 3VMXA 3LIEA 4GKGA 3VMYA 1MUUA 4I6MC 3M9BA 2XU6A 2WT7B 1X8YA 2R5DA 2WWWA 2ZFCA 1CSBA 3TNUB 4GT1A 4XE5B 3O8ZA 3V4QA 1IO4A 2WPQA 3P32A 1GD2E 5APSA 3VN0A 2C9LY 5AVXB 1NWQA 1FOSF 5AW7B 4AYCA 3V4WA 1GK6A 3L36A 3B8EB
chains in the Genus database with same CATH superfamily
1EC5A 3H1IE 1SS1A 2YKPA 1SVFA 1JY3N 2KK7A 2Q7CA 1SQVD 2WSCH 3A0HE 3BRTB 3TSIA 1T3UA 2W90A 3C8VA 3CXHD 2YXQB 2Q3IA 2OARA 1CI6A 3H1JJ 3M0DA 4PD4E 3FWNA 5AVRB 1S5LH 1H8AA 1H89A 3Q5RA 4IFFA 3GF7A 2W8ZA 3P8MC 1FDIA 4ASVA 1Q82Q 3H1ID 5CCGA 1NTZK 1LTJA 1FU1A 1SQXK 3IFMA 1SQQG 1NU1J 5GTHH 1U57A 1AA0A 2XNXA 3H1HD 3CL3D 2SPZA 2E75B 5CBNA 5KJ7C 1N73A 2PP6A 1LT1A 1J2JB 2UWJE 4IFDK 1NTMJ 3GW6A 1UIIA 2KZIA 3AEBC 4H13B 3OAKA 1L0NK 2J59M 3V2PA 3WMM0 4OVNF 5KKZC 3RBXA 1EZVD 1NOHA 1ZR2A 2B87A 4UB8E 2YNYA 3RL0g 2OYHC 2ITAA 1KB9D 4N6JA 3VTPC 5APUA 1YQ3C 4HH2A 1L0LE 3HE4A 2H43A 1QVFO 3FX0A 1KQGB 3HD7D 2ZAEB 2R32A 1FOSE 4C7NA 5B66H 1JCDA 4EOTA 5AW6B 2QM8A 2C0WA 1JO5A 1H0TA 4RKUJ 1NH4A 3BCCE 1S9KE 3HTKA 4OH8B 1OVVA 1ZLLA 2FYZA 5B66E 4AUWA 1M1JC 4W7ZA 1SQPJ 1KTMA 4QMAA 3A7OA 4BWNA 3H1LE 2WMMA 4H0LC 2M3BA 2WTYA 1OW7A 3HD7C 3MP7B 3RK2D 1EXJA 1QGKB 1YITP 1RQUA 2FXMA 3BASA 1URQD 3IAOA 3E7KA 1KQFB 2RN0A 1GTWA 5CHXA 1BDDA 2HFED 2QE7H 1S72P 5AW8B 3JC22 1LP1B 1GK4A 4OWFA 4GOEA 1M8OB 3Q5PA 5AVVB 2J58A 4HB1A 3PP5A 2Q1KA 4KJMA 4WB4A 5KJ7D 1IFPA 2P2UA 1VDFA 3L74G 3KXDA 5APWA 5CJ4A 5GTIE 2K37A 2KS1A 4GIFA 2LXBA 1JOCA 2QM7A 3JCUH 2M3EA 3LW5J 1PV3A 1S4XA 4RJTA 1N8RQ 3A2AA 1SQQD 1M7LA 1CZQA 3BATA 1FAVA 1T2KD 2FFDA 1N2DC 2IZ0A 1SQXD 4ASWA 1UIXA 3CCJP 2OYHA 3H1IG 1YIJP 1QEXA 1L0LK 3PRJA 2N1TA 3TF5A 4N78E 3TGUD 1LTAC 2V7QH 3KPEA 1HUCA 2FKWB 4LGDE 3V6IA 1HBWA 4H13C 2IBZE 5AVUB 3ZDMA 2HODA 3PTZA 1KYOI 1L4AB 2HG5D 3H1KE 3MZWB 5EFWB 4YPCA 3T97A 2ZYAA 4XA4A 1ZR4A 3CPWO 2OYIC 2WSFH 1VQKP 2CPSA 2FBWC 3L72J 5AW0B 1DH3A 1KMIZ 1LGHB 1ZRTD 4H44B 4D6TE 2KNCA 1IK9A 1FDOA 1RE4C 1KILB 1NVOA 2AXCA 2QRXA 2YO3A 3F5HA 3GHGC 4H0LD 5KLVG 1GU5A 3KYQA 4L73A 1FZCC 1VQ9P 1GL2D 1BCCD 4NPFX 1CI6B 3QWOC 5KAIE 3VMXA 1URQC 3B5NB 3WU2E 1PPJD 3B71A 3VMYA 1M90Q 3L72D 2QA4P 1PPJG 3CC7P 2AXTE 2BCCJ 1RHZB 1JMMA 1U7JA 1X8YA 2WSEJ 2ZFCA 3CX5I 1NU1E 3L4FA 2RKLA 5KLVD 4NPEA 2FY8A 3H1HG 2MKVA 2W83C 1LT9B 2IYPA 2KLUA 3FWLA 3L70G 2ZXXA 3L71J 3L74E 3RL0B 3CCQP 2NPSC 4I7ZC 2K9JA 4O9BA 1K05A 1VF5B 2YXRB 1M56D 4XE5B 3V4QA 3VP9A 1NTME 2D2CB 2FYUG 1OW8A 4OGQC 1NTKG 1KN7A 1FZBA 3VMAA 5AVXB 1URQB 3B5NC 3H1KJ 2P10A 4AYCA 4EYYQ 2CPBA 1LNQA 5AW5B 1BE3J 1AV1A 2KXPB 2Z5HA 1X0TA 3M06A 2W6BA 1JY3P 1NTKK 2YIUB 2ZT9D 3II6A 3PJSK 3HE4B 1RQVA 1LTJC 4PV1B 4PD4D 1NAFA 4OGQD 4W80A 5KAFE 2IYOA 1YTZI 4WBAA 1HTLC 3A3YB 3AE7C 2I8DA 3CX5D 2K1AA 3MTUE 3RK3B 3PLNA 2K9YA 5KJ7A 3CXHH 1HVVA 1DEEG 4H0LB 2BCCE 1SQPE 3H1JG 4BXLA 1M1JB 1W5CE 2B89A 1BCCJ 2LXCB 3L74D 4R4LA 5H2FH 3RL0D 1BGYE 2W27A 3L71E 4K35A 2WSEH 1JY2N 3KQGA 4U3FG 3RK2C 3SWFA 3CCLP 1LTIC 2ZXEB 3EFFK 5KLVK 4PJ0E 3W67A 2WITA 1KD1Q 5AVSB 2L5GB 2XZRA 3MUDA 3PH0A 1NU1K 2A06D 3VP8A 1LP1A 1PGQA 2R44A 4UB8H 2N1TC 1KYOD 2G3AA 4L76A 1KILD 1P84E 2Q6QA 1A02F 2O01N 1XTCC 2QSIA 1MKMA 3CLQA 2LR2A 1JY2P 4M3LA 5CMZA 1RF0A 1W2EA 3TGUJ 3WU2H 2P67A 1G2CB 1Y47A 1YJ9P 2VRSA 1HJ0A 1FS0E 3CI9A 2DW3A 3BVHA 2B9BA 3KDPB 2Q5UA 2V7QJ 2WZ7A 3P8CE 1VL2A 5AW2B 2I1KA 2K88A 1PGPA 2N1TD 4N78D 1S5LX 1OMIA 5APYA 1P84D 2MJZA 1GMJA 2E42A 3D70A 2RMZA 1FZGA 3CD6P 4H13D 1ZP0C 1VQ6P 1VQNP 1KYOH 2AXTH 2OTLP 4UB6H 3T97B 1H88A 2OYOA 1FZAA 2A45I 2KIKA 2NZ2A 2WPVB 3P7KA 1A02J 3P8CD 3G9RA 3OA7A 1T2KC 1LTJB 1SQXE 4PV1C 1JUNA 3I55P 1JCCA 3CCUP 5AVQB 1GL2A 1OVUA 1NU1G 2KSJA 3FXDA 1DX7A 1PZQA 1M57D 2WQYC 3U1CA 3OW2O 1GL2C 5C39A 2JDIH 5KAFH 1N73B 1SQPD 3MGNA 1OVRA 1JB0J 2QG4A 2P7JA 2IFMA 2JWDA 5BVZA 3CCEP 3AECC 2P58A 3CCVP 2N9BA 3MD0A 1SP4A 1JY2O 2O01J 1OW6A 2HYNA 3HE5A 1OFCX 1S5LE 1SFCB 3G3ZA 4PD4H 1RF0C 4PV1D 4WWIA 4HKZH 3TK1A 2B88A 4AQRD 1NO4A 2E75C 2O3JA 3RK2B 1NTZD 3A0HH 3AEDC 1EDIA 3IF4A 3RL0C 1LTBC 1ZMEC 1LT9A 5APTA 1R5SA 1GW3A 4WY4D 3GF3A 3Q2YA 2QJPC 4DT0A 1SQBG 2KLVA 2GA1A 3CWBE 5E79H 5CCHC 1VQPP 2JEEA 2IX7C 4L74A 1EZVI 1Y8AA 1YYCA 4YXDC 4C7NB 2WT7A 3FXEA 1KQLA 4EIJA 1HGZA 1BE3E 1L4AD 1LTGC 2KB7P 2R3CA 1DD3A 1ZRTE 3L75D 2YIUC 3WUVA 1SQVK 1KB9E 1P84H 1KYOE 1KILC 5AW1B 5KAIH 1SQPK 2NPSD 1BCCG 1EXIA 3H1HJ 3L71G 3MIWA 4U3FE 2IBZI 3CWBD 4DZOA 2XDJA 3SWKA 2HODB 3TNUB 4GKGA 2JWAA 3M9BA 1TU3F 1N7SB 1AVOA 5K5GB 1QL2A 4IL6H 4DCKA 1ZN5A 1CSBA 3SFEC 3M0DC 1RF1B 3H1JD 1DD4A 2E5YA 3B4SA 1R5LA 1KB9H 2KS1B 2WPQA 3P32A 1IFIA 4GOFA 1HF9A 1L0NG 1U7MA 5CCHD 1PGOA 3VN0A 1T3JA 3H1KG 3CWBJ 3AEFC 1HGVA 1EDJA 1MZ9A 2Y9ZA 1NAYA 3AE8C 1L2PA 2PFXA 4CPGA 3L36A 1OWAA 2W6AA 1FZCA 2WSCJ 3AE4C 4TT3H 1AQTA 3UIAA 2QVAA 3F89A 2G8YA 3L75J 1RE4A 3GHGA 1NTZG 3L73E 4LLHA 4WY4C 5CJ0A 3VOPA 1J1DC 2J5UA 2A45H 4KHXA 3JSVC 3L70E 3CC2P 2JKVA 2KSEA 1L4AA 3M0AA 4JYCA 5CBOA 2OYIB 3USSA 3B5ND 1G2CA 2ZJSE 1L4AC 3WUUA 2QEXP 3VYIA 3I5CA 3TGUG 1VQ4P 2E75D 2QJPB 3I56P 1AFOA 1FE6A 4R4MA 3TDKA 1MFZA 1NTZJ 2ZVNB 3M91A 3QH9A 1J1EB 2Y0CA 1E79H 2W6JH 3RBZA 1YHQP 2IBZD 2WPRA 1IFNA 5BU5A 1RY3A 1NTMK 3M9QA 3N4XA 2QJYC 1YTZT 3K5BA 3L72G 3OJAB 5GTIH 1L0NJ 5APVA 3NMDA 1SQBJ 1VQLP 2POHA 4WVZA 2Z4EA 2YO2A 2ZT9B 5AW3B 4ZMDA 1K9MQ 2A06E 4XFJA 1GL2B 4MN4C 1G1IA 3MHVA 1S2EA 2JR8A 2Y0EA 2IZ1A 1S9KD 2L91A 2WSFJ 1DEBA 2BCCG 3ABVC 3IR9A 5KKZB 1Z56A 2E76B 2YMYA 1IFMA 1PP9G 3KHUA 1FDMA 1URQA 2GUSA 5AVZB 3U59A 3LW5H 5B5EE 1S3JA 2IDBA 2M5AB 1L0LG 1ZOYC 3HD7B 1K8AQ 2FXPA 3L35A 1L0LD 2OGUA 2XV5A 3AE5C 3S9OA 2H7HA 4GODA 1ZW0A 1K04A 4EI2A 1FZFA 4PD4I 2JJLA 1EDKA 2H89C 1SQXG 1BCCE 1YI2P 2O1JA 5GTHE 3RGUA 3EFGA 3H32A 1R8EA 3L72E 1FZEA 3RK3E 3BCCD 4D6TJ 1NTMG 2FYUE 2O1KA 3JCUE 2E76C 3NTNA 4YTPC 4BRYB 3H25A 2BASA 1PL5A 2KNCB 1Y9BA 2WVRA 3L71D 2P1JA 4HJGH 1SQQE 1FJPA 3AE3C 3H1HE 4U3FJ 1VQ7P 3W68A 5H2FE 1BSNA 2FXOA 1RE3A 4JBZA 2HR3A 2H8PD 1JTHA 2OTJP 3A5TA 1PP9J 1AQ5A 1IJDB 1KC8Q 3C9IA 3AE6C 1X22A 1KORA 5E79E 1USDA 4Y99B 2NRGA 3L74J 3VMZA 5KLVE 4WY4A 1J1EC 5APQA 2AEMA 3HUSC 1RF1C 4Y28J 3L73G 5AVTB 3NXSA 3TYYA 1YJWP 3H1LJ 5DJTB 1WT6A 2PAJA 1HWTC 2YKQA 1N7LA 3G71P 3AEGC 4RESB 3LIDA 2Y9YA 3HE5B 1PFIA 1YQ4C 2HPCB 3L75E 2FYUJ 2ZVOB 2NPSA 1FZCB 1BE3D 1KILE 3CCRP 1QX8A 1SQXJ 1QVGO 1KV4A 1IFDA 3H1JE 1FC2C 3GHGB 1EZVE 2R3SA 3FGAD 1SQQJ 2ZYDA 3A0BE 3H1KD 3L70J 1D7MA 3L70D 1MV8A 2FYNB 1NKNA 4JYBA 3C1LA 3CCSP 1AJYA 3CXHI 3CX5H 3D6ZA 1IZNB 2WT7B 2KUBA 2C0XA 1RE3C 2M8RA 4DJGA 3CC4P 2R5DA 2QJKC 2N9YB 1JM0A 1VF5C 2WWWA 2FFDB 1BGYJ 1M1JA 4I1LA 2B87B 5KLVJ 5KTBA 1BE3G 1LT9C 2A06G 2BCCD 2K3RA 1WRGA 1AVYA 2YMKA 4L75A 1IO4A 1LJ2A 3CCMP 1N7SC 2JP3A 1SFCC 3U1AA 1SQBE 3CWBG 1GD2E 1OIPA 2C9LY 1GDTA 1QL1A 2Q3EA 1NHLA 1SFCA 1FOSF 1Q90D 3KZIE 3SWYA 1W2BO 3AE1C 3EWKA 2FYNC 2XKMA 3B8EB 3ITKA 4A7PA 3N7NA 2E43A 4DOJA 1CW5A 1IK7A 1SQVE 3O6QB 3R4YA 1KILA 3TGUE 2CK3H 1S1CX 2GUVA 4IOIH 3CMEP 4H44C 2V4HA 1HH0A 5TISE 3Q5SA 1SFCD 2AEFA 1BGYD 3AEAC 3BRVB 3SFDC 1EDLA 2IFNA 4LC1A 3Q3DA 1PGJA 3SSUA 4ZKUA 1KB9I 1Q86Q 4B86A 2HLOA 1Q2NA 3BCCJ 5AW9B 3V2QA 4D6TD 4EDFA 1VF5D 3CMAP 2E74B 2GM4A 4YXWH 5AVWB 3HUSB 1JMBA 4W7YA 2C9NY 3G4SP 1OXZA 1G1JA 2AEJA 1T6AA 2K9JB 1N86A 1NTMD 5L8RJ 5CCGC 2XNDH 4D6TG 2OQQA 3RK3D 4ZKPA 1LWUB 2FYUD 4IL6X 1Q81Q 2OYIA 1OX3A 1BSHA 2FYUK 2E5TA 1N7SA 4C7RA 1OZHA 2KP8A 1NU1D 1H0TB 1KFMA 3HTKB 1SLQA 4K3AA 3H1LD 1ZV8A 3M9HA 1RF1A 2RH0A 1NJIQ 3H1IJ 3GG2A 2N1TB 2PRRA 3KZIH 5TJHA 1GU4A 1NKZB 5KLIC 1LWUC 2KZJA 2E76D 1SQBD 1PP9D 1KQSO 4C46A 1DIPA 2JO1A 2PGDA 2LKMA 4N3YB 5APXA 1LTTC 1EZVG 1JNMA 4U3FD 1X9VA 4U7JA 1XTGB 3RK3C 3B5NA 5KLIB 1JEKA 1PIXA 3V2RA 1L0NE 3H1LG 3G6EP 3HD7A 5AW4B 1SQPG 1KFNA 5AVYB 1QLED 4TLFA 2IBZG 1BGYG 1VPCA 3S4RA 3V5BA 2OTKE 2E74D 2KYVA 4H44D 4PJ0H 1E5WA 3R2PA 2ZT9C 1KZUB 3AE2C 2R5BA 1L0LJ 1P84I 1Q7YQ 2BEZF 1JY3O 1VQMP 1SQBK 1IC2A 2QJYB 4UB6E 4OGQB 1K73Q 1GZLA 4BRYA 4IFMA 1LTSC 2Q9IA 3CXHE 4JF7A 3L73D 1ZXGA 3IN6A 1GW4A 2E74C 1YJNP 1BDCA 1SQVG 3E1RA 1VQ8P 2FFDC 4I2LC 1NYHA 1NTKE 3D6YA 3NFQA 3MUDC 2Z5IA 5TISH 3GLMA 3S1KA 1M1KQ 1HJBA 2I1JA 1FBMA 2WPSA 2KOGA 2M5AA 5BU8B 1L0ND 2D2CD 3WUTA 1SQVJ 1N73C 3L73J 4JPZB 3CX5E 1J1DB 3L37A 3TNUA 4WY4B 3O6QA 4IL6E 4NPDA 4ZNCA 3D71A 4HYTB 2A45G 4Y99C 1NTKD 1FJKA 1N7SD 3A0BH 3AE9C 2IPPA 4Z1MH 2O01H 3H32B 3BCCG 3LIEA 1PPJE 1RH5B 2BEQD 1MUUA 4I6MC 4JQ0D 3Q1MA 3EQ2A 1YBKA 2XU6A 2WSSH 4KT0J 1NTZE 1PP9E 1T8ZA 1SQQK 2D2CC 5CCHA 2HPCA 2OYHB 1IFJA 2QIWA 2NPSB 2YKOA 4I7ZB 2Y0DA 3GMAA 3V2NA 3HUSA 2M0BA 4GT1A 3L75G 3HRNA 3O8ZA 1X79B 2KI7B 1USEA 2QJKB 3AEEC 3PHLA 5CCGD 1VQ5P 1VQOP 1JTHB 2H88C 1WMKA 3E1IA 1LWUA 1MFTA 1NTKJ 5APSA 5M1BA 5B5EH 2ZYGA 5DJUB 1NWQA 1NGMB 1EQ7A 4RO0A 5AW7B 3V4WA 1GK6A 3H6PA 4GDOA
chains in the Genus database with same CATH topology
2YKPA 1SVFA 1JY3N 2Q7CA 2WSCH 3BRTB 3TSIA 1T3UA 4XA4A 3M0DA 5AVRB 2Q3IA 2OARA 1CI6A 1H8AA 4IFFA 3P8MC 5CCGA 1NTZK 1LTJA 1FU1A 1SQXK 3IFMA 2XNXA 3CL3D 5KJ7C 1N73A 2PP6A 1J2JB 4IFDK 3V2PA 3OAKA 1L0NK 2J59M 3WMM0 1NOHA 1ZR2A 2YNYA 4N6JA 3VTPC 5APUA 4HH2A 2H43A 3HE4A 3HD7D 2R32A 1FOSE 4C7NA 1JCDA 4EOTA 5AW6B 2QM8A 2C0WA 1NH4A 1S9KE 3HTKA 4OH8B 2FYZA 1ZLLA 4AUWA 1M1JC 4W7ZA 3A7OA 2WTYA 2M3BA 3HD7C 3RK2D 2FXMA 3BASA 1URQD 1GTWA 5CHXA 2HFED 5AW8B 1GK4A 5AVVB 2J58A 3PP5A 5KJ7D 4WB4A 2P2UA 1VDFA 5APWA 5CJ4A 4GIFA 1JOCA 2QM7A 3A2AA 1M7LA 1CZQA 3BATA 1FAVA 1T2KD 2FFDA 1N2DC 2OYHA 1L0LK 2N1TA 4N78E 1LTAC 3KPEA 1HUCA 2FKWB 4LGDE 1HBWA 5AVUB 2HODA 1L4AB 2HG5D 3T97A 1ZR4A 2OYIC 2WSFH 2CPSA 5AW0B 1LGHB 1IK9A 1RE4C 3GHGC 1KILB 2YO3A 1GU5A 3KYQA 1FZCC 1GL2D 1CI6B 3VMXA 1URQC 3B5NB 3VMYA 1JMMA 1X8YA 2ZFCA 3L4FA 5KLVK 3TNUB 1LT9B 3RL0B 2NPSC 4XE5B 4O9BA 3VP9A 3V4QA 2OYHC 1FZBA 5AVXB 1URQB 3B5NC 4AYCA 2CPBA 5AW5B 2Z5HA 3M06A 2W6BA 1JY3P 1NTKK 3II6A 1DH3A 5APTA 3HE4B 1LTJC 4W80A 1NAFA 1YTZI 4WBAA 1HTLC 3A3YB 3RK3B 3MTUE 1HVVA 1M1JB 3RL0D 1FZFA 2W27A 2WSEH 1JY2N 3KQGA 3RK2C 3SWFA 1LTIC 2ZXEB 2WITA 5AVSB 2L5GB 2XZRA 3MUDA 1NU1K 3VP8A 2N1TC 1A02F 1KILD 1XTCC 3CLQA 5CMZA 1JY2P 4M3LA 1RF0A 1W2EA 2P67A 1G2CB 2VRSA 3CI9A 3BVHA 3KDPB 2Q5UA 2WZ7A 3P8CE 5AW2B 2I1KA 2N1TD 4N78D 5APYA 2E42A 2MJZA 1FZGA 1H88A 1FZAA 2A45I 3P7KA 1A02J 1JUNA 3P8CD 1T2KC 3OA7A 1LTJB 1JCCA 5AVQB 1GL2A 2KSJA 1DX7A 3U1CA 1GL2C 1N73B 3MGNA 2P7JA 2IFMA 5BVZA 2N9BA 3MD0A 1JY2O 1SP4A 3HE5A 2HYNA 1SFCB 3G3ZA 1H89A 3TK1A 1RF0C 4AQRD 1NO4A 3RK2B 3RL0C 1LTBC 1LT9A 1GW3A 4WY4D 2KLVA 5CCHC 2JEEA 2IX7C 1YYCA 4C7NB 2WT7A 1KQLA 4EIJA 1LTGC 1HGZA 1L4AD 2KB7P 2R3CA 1SQVK 1KILC 5AW1B 1SQPK 2NPSD 3MIWA 4DZOA 2XDJA 2HODB 4GKGA 3M9BA 1N7SB 1QL2A 1ZN5A 1CSBA 3M0DC 1RF1B 2WPQA 3P32A 1IFIA 5CCHD 3VN0A 1T3JA 1HGVA 1MZ9A 3L36A 1OWAA 2W6AA 1FZCA 5KJ7A 3UIAA 1N73C 1RE4A 3GHGA 4WY4C 4LLHA 5CJ0A 3VOPA 1J1DC 2A45H 4KHXA 1L4AA 3M0AA 4JYCA 2OYIB 3B5ND 1G2CA 1L4AC 3VYIA 3I5CA 1AFOA 1MFZA 3M91A 1J1EB 2WPRA 1IFNA 5BU5A 1RY3A 1NTMK 3M9QA 3OJAB 3N4XA 1YTZT 5APVA 3NMDA 2POHA 2Z4EA 2YO2A 5AW3B 1GL2B 1G1IA 1S9KD 3IR9A 1DEBA 1Z56A 2YMYA 1IFMA 1FDMA 1URQA 2GUSA 5AVZB 3U59A 3LW5H 3HD7B 3L35A 1JO5A 2XV5A 2H7HA 2JJLA 2O1JA 3EFGA 3H32A 1FZEA 2O1KA 3NTNA 2BASA 2P1JA 1FJPA 1RE3A 2H8PD 1JTHA 3A5TA 1AQ5A 1IJDB 3C9IA 3VMZA 4WY4A 1J1EC 5APQA 3HUSC 1RF1C 5AVTB 3NXSA 3TYYA 1HWTC 1WT6A 2PAJA 2YKQA 1N7LA 4RESB 3LIDA 3HE5B 1PFIA 2HPCB 1FZCB 2NPSA 1IFDA 3GHGB 1MV8A 1NKNA 4JYBA 2WT7B 2C0XA 1RE3C 2M8RA 2R5DA 2WWWA 2FFDB 1M1JA 4I1LA 5KTBA 1LT9C 1WRGA 1IO4A 1N7SC 1SFCC 3U1AA 1GD2E 2C9LY 1GDTA 1QL1A 1NHLA 1SFCA 1FOSF 3SWYA 2E43A 2XKMA 3B8EB 3N7NA 1CW5A 4DOJA 1KILA 2GUVA 1HH0A 1SFCD 3BRVB 2IFNA 4LC1A 4ZKUA 4B86A 2HLOA 3V2QA 5AW9B 2GM4A 5AVWB 3HUSB 4W7YA 2C9NY 1OXZA 1G1JA 1N86A 5CCGC 4ZKPA 3RK3D 1LWUB 2OYIA 2FYUK 4C7RA 1N7SA 2KP8A 1KFMA 3HTKB 1SLQA 1ZV8A 3M9HA 1RF1A 2N1TB 1GU4A 1NKZB 1LWUC 4C46A 2LKMA 4N3YB 5APXA 1LTTC 1JNMA 1X9VA 1XTGB 3RK3C 3B5NA 3V2RA 3HD7A 5AW4B 1KFNA 5AVYB 1VPCA 3V5BA 2KYVA 1E5WA 3R2PA 1KZUB 2R5BA 1JY3O 1IC2A 1SQBK 1GZLA 4IFMA 1LTSC 2Q9IA 4JF7A 1GW4A 2FFDC 4I2LC 3NFQA 2Z5IA 1HJBA 2I1JA 1FBMA 2WPSA 2KOGA 5BU8B 3TNUA 3L37A 1J1DB 4WY4B 4HYTB 2A45G 4Y99C 1FJKA 1N7SD 2IPPA 2O01H 3H32B 3LIEA 1MUUA 4I6MC 3EQ2A 2XU6A 5CCHA 1T8ZA 1SQQK 2HPCA 2OYHB 1IFJA 2NPSB 2YKOA 3V2NA 3HUSA 4GT1A 3HRNA 3O8ZA 1X79B 5CCGD 1JTHB 3E1IA 1LWUA 5APSA 1NWQA 1EQ7A 5AW7B 3V4WA 1GK6A 3H6PA 4Y99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W6A A;  5AW5 B;  2Q7C A;  2Z5H A;  3UIA A;  3M06 A;  1DH3 A;  3M0D A;  5APT A;  2Q3I A;  3HE4 B;  1CI6 A;  1OWA A;  4KHX A;  5AVR B;  1NAF A;  1H8A A;  4JYC A;  3M0A A;  4LC1 A;  3A3Y B;  3P8M C;  3VYI A;  3I5C A;  4B86 A;  5AW9 B;  1MFZ A;  3M91 A;  5AVW B;  2C9N Y;  1OXZ A;  2W27 A;  2WPR A;  3KQG A;  3SWF A;  2ZXE B;  1J2J B;  5AVS B;  2XZR A;  5APV A;  3NMD A;  3OAK A;  2KP8 A;  2YO2 A;  5AW3 B;  1SLQ A;  3M9H A;  2YNY A;  1A02 F;  3VTP C;  5APU A;  1S9K D;  3HE4 A;  3IR9 A;  5CMZ A;  4M3L A;  1GU4 A;  2P67 A;  1G2C B;  2R32 A;  2VRS A;  1FOS E;  5AVZ B;  4C7N A;  3KDP B;  2Q5U A;  5AW6 B;  2QM8 A;  4EOT A;  5AW2 B;  4C46 A;  1S9K E;  3L35 A;  3HTK A;  2XV5 A;  2H7H A;  4AUW A;  5APY A;  2E42 A;  2JJL A;  3A7O A;  5APX A;  2WTY A;  1JNM A;  1H88 A;  1GTW A;  3P7K A;  1A02 J;  1JUN A;  3NTN A;  1T2K C;  5AW8 B;  2BAS A;  5AW4 B;  1GK4 A;  5AVQ B;  5AVY B;  5AVV B;  3V5B A;  2P2U A;  3MGN A;  5APW A;  2P7J A;  2QM7 A;  2R5B A;  2E43 A;  3A5T A;  2N9B A;  3MD0 A;  1SP4 A;  3HE5 A;  3A2A A;  1H89 A;  1GZL A;  1CZQ A;  3TK1 A;  1FAV A;  4AQR D;  1T2K D;  3VMZ A;  5APQ A;  1HUC A;  5AVT B;  3NXS A;  3TYY A;  1HBW A;  4I2L C;  5AVU B;  3NFQ A;  1HWT C;  2Z5I A;  3T97 A;  1HJB A;  1YYC A;  4RES B;  4C7N B;  2WPS A;  3LID A;  3HE5 B;  1KQL A;  2WT7 A;  5AW0 B;  2R3C A;  3TNU A;  3L37 A;  2YO3 A;  5AW1 B;  1GU5 A;  4HYT B;  1MV8 A;  4DZO A;  4JYB A;  1CI6 B;  2IPP A;  3VMX A;  3LIE A;  4GKG A;  3VMY A;  1MUU A;  4I6M C;  3M9B A;  2XU6 A;  2WT7 B;  1X8Y A;  2R5D A;  2WWW A;  2ZFC A;  1CSB A;  3TNU B;  4GT1 A;  4XE5 B;  3O8Z A;  3V4Q A;  1IO4 A;  2WPQ A;  3P32 A;  1GD2 E;  5APS A;  3VN0 A;  2C9L Y;  5AVX B;  1NWQ A;  1FOS F;  5AW7 B;  4AYC A;  3V4W A;  1GK6 A;  3L36 A;  3B8E B; 
#chains in the Genus database with same CATH topology
 1EC5 A;  3H1I E;  1SS1 A;  2YKP A;  1SVF A;  1JY3 N;  2KK7 A;  2Q7C A;  1SQV D;  2WSC H;  3A0H E;  3BRT B;  3TSI A;  1T3U A;  2W90 A;  3C8V A;  3CXH D;  2YXQ B;  2Q3I A;  2OAR A;  1CI6 A;  3H1J J;  3M0D A;  4PD4 E;  3FWN A;  5AVR B;  1S5L H;  1H8A A;  1H89 A;  3Q5R A;  4IFF A;  3GF7 A;  2W8Z A;  3P8M C;  1FDI A;  4ASV A;  1Q82 Q;  3H1I D;  5CCG A;  1NTZ K;  1LTJ A;  1FU1 A;  1SQX K;  3IFM A;  1SQQ G;  1NU1 J;  5GTH H;  1U57 A;  1AA0 A;  2XNX A;  3H1H D;  3CL3 D;  2SPZ A;  2E75 B;  5CBN A;  5KJ7 C;  1N73 A;  2PP6 A;  1LT1 A;  1J2J B;  2UWJ E;  4IFD K;  1NTM J;  3GW6 A;  1UII A;  2KZI A;  3AEB C;  4H13 B;  3OAK A;  1L0N K;  2J59 M;  3V2P A;  3WMM 0;  4OVN F;  5KKZ C;  3RBX A;  1EZV D;  1NOH A;  1ZR2 A;  2B87 A;  4UB8 E;  2YNY A;  3RL0 g;  2OYH C;  2ITA A;  1KB9 D;  4N6J A;  3VTP C;  5APU A;  1YQ3 C;  4HH2 A;  1L0L E;  3HE4 A;  2H43 A;  1QVF O;  3FX0 A;  1KQG B;  3HD7 D;  2ZAE B;  2R32 A;  1FOS E;  4C7N A;  5B66 H;  1JCD A;  4EOT A;  5AW6 B;  2QM8 A;  2C0W A;  1JO5 A;  1H0T A;  4RKU J;  1NH4 A;  3BCC E;  1S9K E;  3HTK A;  4OH8 B;  1OVV A;  1ZLL A;  2FYZ A;  5B66 E;  4AUW A;  1M1J C;  4W7Z A;  1SQP J;  1KTM A;  4QMA A;  3A7O A;  4BWN A;  3H1L E;  2WMM A;  4H0L C;  2M3B A;  2WTY A;  1OW7 A;  3HD7 C;  3MP7 B;  3RK2 D;  1EXJ A;  1QGK B;  1YIT P;  1RQU A;  2FXM A;  3BAS A;  1URQ D;  3IAO A;  3E7K A;  1KQF B;  2RN0 A;  1GTW A;  5CHX A;  1BDD A;  2HFE D;  2QE7 H;  1S72 P;  5AW8 B;  3JC2 2;  1LP1 B;  1GK4 A;  4OWF A;  4GOE A;  1M8O B;  3Q5P A;  5AVV B;  2J58 A;  4HB1 A;  3PP5 A;  2Q1K A;  4KJM A;  4WB4 A;  5KJ7 D;  1IFP A;  2P2U A;  1VDF A;  3L74 G;  3KXD A;  5APW A;  5CJ4 A;  5GTI E;  2K37 A;  2KS1 A;  4GIF A;  2LXB A;  1JOC A;  2QM7 A;  3JCU H;  2M3E A;  3LW5 J;  1PV3 A;  1S4X A;  4RJT A;  1N8R Q;  3A2A A;  1SQQ D;  1M7L A;  1CZQ A;  3BAT A;  1FAV A;  1T2K D;  2FFD A;  1N2D C;  2IZ0 A;  1SQX D;  4ASW A;  1UIX A;  3CCJ P;  2OYH A;  3H1I G;  1YIJ P;  1QEX A;  1L0L K;  3PRJ A;  2N1T A;  3TF5 A;  4N78 E;  3TGU D;  1LTA C;  2V7Q H;  3KPE A;  1HUC A;  2FKW B;  4LGD E;  3V6I A;  1HBW A;  4H13 C;  2IBZ E;  5AVU B;  3ZDM A;  2HOD A;  3PTZ A;  1KYO I;  1L4A B;  2HG5 D;  3H1K E;  3MZW B;  5EFW B;  4YPC A;  3T97 A;  2ZYA A;  4XA4 A;  1ZR4 A;  3CPW O;  2OYI C;  2WSF H;  1VQK P;  2CPS A;  2FBW C;  3L72 J;  5AW0 B;  1DH3 A;  1KMI Z;  1LGH B;  1ZRT D;  4H44 B;  4D6T E;  2KNC A;  1IK9 A;  1FDO A;  1RE4 C;  1KIL B;  1NVO A;  2AXC A;  2QRX A;  2YO3 A;  3F5H A;  3GHG C;  4H0L D;  5KLV G;  1GU5 A;  3KYQ A;  4L73 A;  1FZC C;  1VQ9 P;  1GL2 D;  1BCC D;  4NPF X;  1CI6 B;  3QWO C;  5KAI E;  3VMX A;  1URQ C;  3B5N B;  3WU2 E;  1PPJ D;  3B71 A;  3VMY A;  1M90 Q;  3L72 D;  2QA4 P;  1PPJ G;  3CC7 P;  2AXT E;  2BCC J;  1RHZ B;  1JMM A;  1U7J A;  1X8Y A;  2WSE J;  2ZFC A;  3CX5 I;  1NU1 E;  3L4F A;  2RKL A;  5KLV D;  4NPE A;  2FY8 A;  3H1H G;  2MKV A;  2W83 C;  1LT9 B;  2IYP A;  2KLU A;  3FWL A;  3L70 G;  2ZXX A;  3L71 J;  3L74 E;  3RL0 B;  3CCQ P;  2NPS C;  4I7Z C;  2K9J A;  4O9B A;  1K05 A;  1VF5 B;  2YXR B;  1M56 D;  4XE5 B;  3V4Q A;  3VP9 A;  1NTM E;  2D2C B;  2FYU G;  1OW8 A;  4OGQ C;  1NTK G;  1KN7 A;  1FZB A;  3VMA A;  5AVX B;  1URQ B;  3B5N C;  3H1K J;  2P10 A;  4AYC A;  4EYY Q;  2CPB A;  1LNQ A;  5AW5 B;  1BE3 J;  1AV1 A;  2KXP B;  2Z5H A;  1X0T A;  3M06 A;  2W6B A;  1JY3 P;  1NTK K;  2YIU B;  2ZT9 D;  3II6 A;  3PJS K;  3HE4 B;  1RQV A;  1LTJ C;  4PV1 B;  4PD4 D;  1NAF A;  4OGQ D;  4W80 A;  5KAF E;  2IYO A;  1YTZ I;  4WBA A;  1HTL C;  3A3Y B;  3AE7 C;  2I8D A;  3CX5 D;  2K1A A;  3MTU E;  3RK3 B;  3PLN A;  2K9Y A;  5KJ7 A;  3CXH H;  1HVV A;  1DEE G;  4H0L B;  2BCC E;  1SQP E;  3H1J G;  4BXL A;  1M1J B;  1W5C E;  2B89 A;  1BCC J;  2LXC B;  3L74 D;  4R4L A;  5H2F H;  3RL0 D;  1BGY E;  2W27 A;  3L71 E;  4K35 A;  2WSE H;  1JY2 N;  3KQG A;  4U3F G;  3RK2 C;  3SWF A;  3CCL P;  1LTI C;  2ZXE B;  3EFF K;  5KLV K;  4PJ0 E;  3W67 A;  2WIT A;  1KD1 Q;  5AVS B;  2L5G B;  2XZR A;  3MUD A;  3PH0 A;  1NU1 K;  2A06 D;  3VP8 A;  1LP1 A;  1PGQ A;  2R44 A;  4UB8 H;  2N1T C;  1KYO D;  2G3A A;  4L76 A;  1KIL D;  1P84 E;  2Q6Q A;  1A02 F;  2O01 N;  1XTC C;  2QSI A;  1MKM A;  3CLQ A;  2LR2 A;  1JY2 P;  4M3L A;  5CMZ A;  1RF0 A;  1W2E A;  3TGU J;  3WU2 H;  2P67 A;  1G2C B;  1Y47 A;  1YJ9 P;  2VRS A;  1HJ0 A;  1FS0 E;  3CI9 A;  2DW3 A;  3BVH A;  2B9B A;  3KDP B;  2Q5U A;  2V7Q J;  2WZ7 A;  3P8C E;  1VL2 A;  5AW2 B;  2I1K A;  2K88 A;  1PGP A;  2N1T D;  4N78 D;  1S5L X;  1OMI A;  5APY A;  1P84 D;  2MJZ A;  1GMJ A;  2E42 A;  3D70 A;  2RMZ A;  1FZG A;  3CD6 P;  4H13 D;  1ZP0 C;  1VQ6 P;  1VQN P;  1KYO H;  2AXT H;  2OTL P;  4UB6 H;  3T97 B;  1H88 A;  2OYO A;  1FZA A;  2A45 I;  2KIK A;  2NZ2 A;  2WPV B;  3P7K A;  1A02 J;  3P8C D;  3G9R A;  3OA7 A;  1T2K C;  1LTJ B;  1SQX E;  4PV1 C;  1JUN A;  3I55 P;  1JCC A;  3CCU P;  5AVQ B;  1GL2 A;  1OVU A;  1NU1 G;  2KSJ A;  3FXD A;  1DX7 A;  1PZQ A;  1M57 D;  2WQY C;  3U1C A;  3OW2 O;  1GL2 C;  5C39 A;  2JDI H;  5KAF H;  1N73 B;  1SQP D;  3MGN A;  1OVR A;  1JB0 J;  2QG4 A;  2P7J A;  2IFM A;  2JWD A;  5BVZ A;  3CCE P;  3AEC C;  2P58 A;  3CCV P;  2N9B A;  3MD0 A;  1SP4 A;  1JY2 O;  2O01 J;  1OW6 A;  2HYN A;  3HE5 A;  1OFC X;  1S5L E;  1SFC B;  3G3Z A;  4PD4 H;  1RF0 C;  4PV1 D;  4WWI A;  4HKZ H;  3TK1 A;  2B88 A;  4AQR D;  1NO4 A;  2E75 C;  2O3J A;  3RK2 B;  1NTZ D;  3A0H H;  3AED C;  1EDI A;  3IF4 A;  3RL0 C;  1LTB C;  1ZME C;  1LT9 A;  5APT A;  1R5S A;  1GW3 A;  4WY4 D;  3GF3 A;  3Q2Y A;  2QJP C;  4DT0 A;  1SQB G;  2KLV A;  2GA1 A;  3CWB E;  5E79 H;  5CCH C;  1VQP P;  2JEE A;  2IX7 C;  4L74 A;  1EZV I;  1Y8A A;  1YYC A;  4YXD C;  4C7N B;  2WT7 A;  3FXE A;  1KQL A;  4EIJ A;  1HGZ A;  1BE3 E;  1L4A D;  1LTG C;  2KB7 P;  2R3C A;  1DD3 A;  1ZRT E;  3L75 D;  2YIU C;  3WUV A;  1SQV K;  1KB9 E;  1P84 H;  1KYO E;  1KIL C;  5AW1 B;  5KAI H;  1SQP K;  2NPS D;  1BCC G;  1EXI A;  3H1H J;  3L71 G;  3MIW A;  4U3F E;  2IBZ I;  3CWB D;  4DZO A;  2XDJ A;  3SWK A;  2HOD B;  3TNU B;  4GKG A;  2JWA A;  3M9B A;  1TU3 F;  1N7S B;  1AVO A;  5K5G B;  1QL2 A;  4IL6 H;  4DCK A;  1ZN5 A;  1CSB A;  3SFE C;  3M0D C;  1RF1 B;  3H1J D;  1DD4 A;  2E5Y A;  3B4S A;  1R5L A;  1KB9 H;  2KS1 B;  2WPQ A;  3P32 A;  1IFI A;  4GOF A;  1HF9 A;  1L0N G;  1U7M A;  5CCH D;  1PGO A;  3VN0 A;  1T3J A;  3H1K G;  3CWB J;  3AEF C;  1HGV A;  1EDJ A;  1MZ9 A;  2Y9Z A;  1NAY A;  3AE8 C;  1L2P A;  2PFX A;  4CPG A;  3L36 A;  1OWA A;  2W6A A;  1FZC A;  2WSC J;  3AE4 C;  4TT3 H;  1AQT A;  3UIA A;  2QVA A;  3F89 A;  2G8Y A;  3L75 J;  1RE4 A;  3GHG A;  1NTZ G;  3L73 E;  4LLH A;  4WY4 C;  5CJ0 A;  3VOP A;  1J1D C;  2J5U A;  2A45 H;  4KHX A;  3JSV C;  3L70 E;  3CC2 P;  2JKV A;  2KSE A;  1L4A A;  3M0A A;  4JYC A;  5CBO A;  2OYI B;  3USS A;  3B5N D;  1G2C A;  2ZJS E;  1L4A C;  3WUU A;  2QEX P;  3VYI A;  3I5C A;  3TGU G;  1VQ4 P;  2E75 D;  2QJP B;  3I56 P;  1AFO A;  1FE6 A;  4R4M A;  3TDK A;  1MFZ A;  1NTZ J;  2ZVN B;  3M91 A;  3QH9 A;  1J1E B;  2Y0C A;  1E79 H;  2W6J H;  3RBZ A;  1YHQ P;  2IBZ D;  2WPR A;  1IFN A;  5BU5 A;  1RY3 A;  1NTM K;  3M9Q A;  3N4X A;  2QJY C;  1YTZ T;  3K5B A;  3L72 G;  3OJA B;  5GTI H;  1L0N J;  5APV A;  3NMD A;  1SQB J;  1VQL P;  2POH A;  4WVZ A;  2Z4E A;  2YO2 A;  2ZT9 B;  5AW3 B;  4ZMD A;  1K9M Q;  2A06 E;  4XFJ A;  1GL2 B;  4MN4 C;  1G1I A;  3MHV A;  1S2E A;  2JR8 A;  2Y0E A;  2IZ1 A;  1S9K D;  2L91 A;  2WSF J;  1DEB A;  2BCC G;  3ABV C;  3IR9 A;  5KKZ B;  1Z56 A;  2E76 B;  2YMY A;  1IFM A;  1PP9 G;  3KHU A;  1FDM A;  1URQ A;  2GUS A;  5AVZ B;  3U59 A;  3LW5 H;  5B5E E;  1S3J A;  2IDB A;  2M5A B;  1L0L G;  1ZOY C;  3HD7 B;  1K8A Q;  2FXP A;  3L35 A;  1L0L D;  2OGU A;  2XV5 A;  3AE5 C;  3S9O A;  2H7H A;  4GOD A;  1ZW0 A;  1K04 A;  4EI2 A;  1FZF A;  4PD4 I;  2JJL A;  1EDK A;  2H89 C;  1SQX G;  1BCC E;  1YI2 P;  2O1J A;  5GTH E;  3RGU A;  3EFG A;  3H32 A;  1R8E A;  3L72 E;  1FZE A;  3RK3 E;  3BCC D;  4D6T J;  1NTM G;  2FYU E;  2O1K A;  3JCU E;  2E76 C;  3NTN A;  4YTP C;  4BRY B;  3H25 A;  2BAS A;  1PL5 A;  2KNC B;  1Y9B A;  2WVR A;  3L71 D;  2P1J A;  4HJG H;  1SQQ E;  1FJP A;  3AE3 C;  3H1H E;  4U3F J;  1VQ7 P;  3W68 A;  5H2F E;  1BSN A;  2FXO A;  1RE3 A;  4JBZ A;  2HR3 A;  2H8P D;  1JTH A;  2OTJ P;  3A5T A;  1PP9 J;  1AQ5 A;  1IJD B;  1KC8 Q;  3C9I A;  3AE6 C;  1X22 A;  1KOR A;  5E79 E;  1USD A;  4Y99 B;  2NRG A;  3L74 J;  3VMZ A;  5KLV E;  4WY4 A;  1J1E C;  5APQ A;  2AEM A;  3HUS C;  1RF1 C;  4Y28 J;  3L73 G;  5AVT B;  3NXS A;  3TYY A;  1YJW P;  3H1L J;  5DJT B;  1WT6 A;  2PAJ A;  1HWT C;  2YKQ A;  1N7L A;  3G71 P;  3AEG C;  4RES B;  3LID A;  2Y9Y A;  3HE5 B;  1PFI A;  1YQ4 C;  2HPC B;  3L75 E;  2FYU J;  2ZVO B;  2NPS A;  1FZC B;  1BE3 D;  1KIL E;  3CCR P;  1QX8 A;  1SQX J;  1QVG O;  1KV4 A;  1IFD A;  3H1J E;  1FC2 C;  3GHG B;  1EZV E;  2R3S A;  3FGA D;  1SQQ J;  2ZYD A;  3A0B E;  3H1K D;  3L70 J;  1D7M A;  3L70 D;  1MV8 A;  2FYN B;  1NKN A;  4JYB A;  3C1L A;  3CCS P;  1AJY A;  3CXH I;  3CX5 H;  3D6Z A;  1IZN B;  2WT7 B;  2KUB A;  2C0X A;  1RE3 C;  2M8R A;  4DJG A;  3CC4 P;  2R5D A;  2QJK C;  2N9Y B;  1JM0 A;  1VF5 C;  2WWW A;  2FFD B;  1BGY J;  1M1J A;  4I1L A;  2B87 B;  5KLV J;  5KTB A;  1BE3 G;  1LT9 C;  2A06 G;  2BCC D;  2K3R A;  1WRG A;  1AVY A;  2YMK A;  4L75 A;  1IO4 A;  1LJ2 A;  3CCM P;  1N7S C;  2JP3 A;  1SFC C;  3U1A A;  1SQB E;  3CWB G;  1GD2 E;  1OIP A;  2C9L Y;  1GDT A;  1QL1 A;  2Q3E A;  1NHL A;  1SFC A;  1FOS F;  1Q90 D;  3KZI E;  3SWY A;  1W2B O;  3AE1 C;  3EWK A;  2FYN C;  2XKM A;  3B8E B;  3ITK A;  4A7P A;  3N7N A;  2E43 A;  4DOJ A;  1CW5 A;  1IK7 A;  1SQV E;  3O6Q B;  3R4Y A;  1KIL A;  3TGU E;  2CK3 H;  1S1C X;  2GUV A;  4IOI H;  3CME P;  4H44 C;  2V4H A;  1HH0 A;  5TIS E;  3Q5S A;  1SFC D;  2AEF A;  1BGY D;  3AEA C;  3BRV B;  3SFD C;  1EDL A;  2IFN A;  4LC1 A;  3Q3D A;  1PGJ A;  3SSU A;  4ZKU A;  1KB9 I;  1Q86 Q;  4B86 A;  2HLO A;  1Q2N A;  3BCC J;  5AW9 B;  3V2Q A;  4D6T D;  4EDF A;  1VF5 D;  3CMA P;  2E74 B;  2GM4 A;  4YXW H;  5AVW B;  3HUS B;  1JMB A;  4W7Y A;  2C9N Y;  3G4S P;  1OXZ A;  1G1J A;  2AEJ A;  1T6A A;  2K9J B;  1N86 A;  1NTM D;  5L8R J;  5CCG C;  2XND H;  4D6T G;  2OQQ A;  3RK3 D;  4ZKP A;  1LWU B;  2FYU D;  4IL6 X;  1Q81 Q;  2OYI A;  1OX3 A;  1BSH A;  2FYU K;  2E5T A;  1N7S A;  4C7R A;  1OZH A;  2KP8 A;  1NU1 D;  1H0T B;  1KFM A;  3HTK B;  1SLQ A;  4K3A A;  3H1L D;  1ZV8 A;  3M9H A;  1RF1 A;  2RH0 A;  1NJI Q;  3H1I J;  3GG2 A;  2N1T B;  2PRR A;  3KZI H;  5TJH A;  1GU4 A;  1NKZ B;  5KLI C;  1LWU C;  2KZJ A;  2E76 D;  1SQB D;  1PP9 D;  1KQS O;  4C46 A;  1DIP A;  2JO1 A;  2PGD A;  2LKM A;  4N3Y B;  5APX A;  1LTT C;  1EZV G;  1JNM A;  4U3F D;  1X9V A;  4U7J A;  1XTG B;  3RK3 C;  3B5N A;  5KLI B;  1JEK A;  1PIX A;  3V2R A;  1L0N E;  3H1L G;  3G6E P;  3HD7 A;  5AW4 B;  1SQP G;  1KFN A;  5AVY B;  1QLE D;  4TLF A;  2IBZ G;  1BGY G;  1VPC A;  3S4R A;  3V5B A;  2OTK E;  2E74 D;  2KYV A;  4H44 D;  4PJ0 H;  1E5W A;  3R2P A;  2ZT9 C;  1KZU B;  3AE2 C;  2R5B A;  1L0L J;  1P84 I;  1Q7Y Q;  2BEZ F;  1JY3 O;  1VQM P;  1SQB K;  1IC2 A;  2QJY B;  4UB6 E;  4OGQ B;  1K73 Q;  1GZL A;  4BRY A;  4IFM A;  1LTS C;  2Q9I A;  3CXH E;  4JF7 A;  3L73 D;  1ZXG A;  3IN6 A;  1GW4 A;  2E74 C;  1YJN P;  1BDC A;  1SQV G;  3E1R A;  1VQ8 P;  2FFD C;  4I2L C;  1NYH A;  1NTK E;  3D6Y A;  3NFQ A;  3MUD C;  2Z5I A;  5TIS H;  3GLM A;  3S1K A;  1M1K Q;  1HJB A;  2I1J A;  1FBM A;  2WPS A;  2KOG A;  2M5A A;  5BU8 B;  1L0N D;  2D2C D;  3WUT A;  1SQV J;  1N73 C;  3L73 J;  4JPZ B;  3CX5 E;  1J1D B;  3L37 A;  3TNU A;  4WY4 B;  3O6Q A;  4IL6 E;  4NPD A;  4ZNC A;  3D71 A;  4HYT B;  2A45 G;  4Y99 C;  1NTK D;  1FJK A;  1N7S D;  3A0B H;  3AE9 C;  2IPP A;  4Z1M H;  2O01 H;  3H32 B;  3BCC G;  3LIE A;  1PPJ E;  1RH5 B;  2BEQ D;  1MUU A;  4I6M C;  4JQ0 D;  3Q1M A;  3EQ2 A;  1YBK A;  2XU6 A;  2WSS H;  4KT0 J;  1NTZ E;  1PP9 E;  1T8Z A;  1SQQ K;  2D2C C;  5CCH A;  2HPC A;  2OYH B;  1IFJ A;  2QIW A;  2NPS B;  2YKO A;  4I7Z B;  2Y0D A;  3GMA A;  3V2N A;  3HUS A;  2M0B A;  4GT1 A;  3L75 G;  3HRN A;  3O8Z A;  1X79 B;  2KI7 B;  1USE A;  2QJK B;  3AEE C;  3PHL A;  5CCG D;  1VQ5 P;  1VQO P;  1JTH B;  2H88 C;  1WMK A;  3E1I A;  1LWU A;  1MFT A;  1NTK J;  5APS A;  5M1B A;  5B5E H;  2ZYG A;  5DJU B;  1NWQ A;  1NGM B;  1EQ7 A;  4RO0 A;  5AW7 B;  3V4W A;  1GK6 A;  3H6P A;  4GDO A; 
#chains in the Genus database with same CATH homology
 2YKP A;  1SVF A;  1JY3 N;  2Q7C A;  2WSC H;  3BRT B;  3TSI A;  1T3U A;  4XA4 A;  3M0D A;  5AVR B;  2Q3I A;  2OAR A;  1CI6 A;  1H8A A;  4IFF A;  3P8M C;  5CCG A;  1NTZ K;  1LTJ A;  1FU1 A;  1SQX K;  3IFM A;  2XNX A;  3CL3 D;  5KJ7 C;  1N73 A;  2PP6 A;  1J2J B;  4IFD K;  3V2P A;  3OAK A;  1L0N K;  2J59 M;  3WMM 0;  1NOH A;  1ZR2 A;  2YNY A;  4N6J A;  3VTP C;  5APU A;  4HH2 A;  2H43 A;  3HE4 A;  3HD7 D;  2R32 A;  1FOS E;  4C7N A;  1JCD A;  4EOT A;  5AW6 B;  2QM8 A;  2C0W A;  1NH4 A;  1S9K E;  3HTK A;  4OH8 B;  2FYZ A;  1ZLL A;  4AUW A;  1M1J C;  4W7Z A;  3A7O A;  2WTY A;  2M3B A;  3HD7 C;  3RK2 D;  2FXM A;  3BAS A;  1URQ D;  1GTW A;  5CHX A;  2HFE D;  5AW8 B;  1GK4 A;  5AVV B;  2J58 A;  3PP5 A;  5KJ7 D;  4WB4 A;  2P2U A;  1VDF A;  5APW A;  5CJ4 A;  4GIF A;  1JOC A;  2QM7 A;  3A2A A;  1M7L A;  1CZQ A;  3BAT A;  1FAV A;  1T2K D;  2FFD A;  1N2D C;  2OYH A;  1L0L K;  2N1T A;  4N78 E;  1LTA C;  3KPE A;  1HUC A;  2FKW B;  4LGD E;  1HBW A;  5AVU B;  2HOD A;  1L4A B;  2HG5 D;  3T97 A;  1ZR4 A;  2OYI C;  2WSF H;  2CPS A;  5AW0 B;  1LGH B;  1IK9 A;  1RE4 C;  3GHG C;  1KIL B;  2YO3 A;  1GU5 A;  3KYQ A;  1FZC C;  1GL2 D;  1CI6 B;  3VMX A;  1URQ C;  3B5N B;  3VMY A;  1JMM A;  1X8Y A;  2ZFC A;  3L4F A;  5KLV K;  3TNU B;  1LT9 B;  3RL0 B;  2NPS C;  4XE5 B;  4O9B A;  3VP9 A;  3V4Q A;  2OYH C;  1FZB A;  5AVX B;  1URQ B;  3B5N C;  4AYC A;  2CPB A;  5AW5 B;  2Z5H A;  3M06 A;  2W6B A;  1JY3 P;  1NTK K;  3II6 A;  1DH3 A;  5APT A;  3HE4 B;  1LTJ C;  4W80 A;  1NAF A;  1YTZ I;  4WBA A;  1HTL C;  3A3Y B;  3RK3 B;  3MTU E;  1HVV A;  1M1J B;  3RL0 D;  1FZF A;  2W27 A;  2WSE H;  1JY2 N;  3KQG A;  3RK2 C;  3SWF A;  1LTI C;  2ZXE B;  2WIT A;  5AVS B;  2L5G B;  2XZR A;  3MUD A;  1NU1 K;  3VP8 A;  2N1T C;  1A02 F;  1KIL D;  1XTC C;  3CLQ A;  5CMZ A;  1JY2 P;  4M3L A;  1RF0 A;  1W2E A;  2P67 A;  1G2C B;  2VRS A;  3CI9 A;  3BVH A;  3KDP B;  2Q5U A;  2WZ7 A;  3P8C E;  5AW2 B;  2I1K A;  2N1T D;  4N78 D;  5APY A;  2E42 A;  2MJZ A;  1FZG A;  1H88 A;  1FZA A;  2A45 I;  3P7K A;  1A02 J;  1JUN A;  3P8C D;  1T2K C;  3OA7 A;  1LTJ B;  1JCC A;  5AVQ B;  1GL2 A;  2KSJ A;  1DX7 A;  3U1C A;  1GL2 C;  1N73 B;  3MGN A;  2P7J A;  2IFM A;  5BVZ A;  2N9B A;  3MD0 A;  1JY2 O;  1SP4 A;  3HE5 A;  2HYN A;  1SFC B;  3G3Z A;  1H89 A;  3TK1 A;  1RF0 C;  4AQR D;  1NO4 A;  3RK2 B;  3RL0 C;  1LTB C;  1LT9 A;  1GW3 A;  4WY4 D;  2KLV A;  5CCH C;  2JEE A;  2IX7 C;  1YYC A;  4C7N B;  2WT7 A;  1KQL A;  4EIJ A;  1LTG C;  1HGZ A;  1L4A D;  2KB7 P;  2R3C A;  1SQV K;  1KIL C;  5AW1 B;  1SQP K;  2NPS D;  3MIW A;  4DZO A;  2XDJ A;  2HOD B;  4GKG A;  3M9B A;  1N7S B;  1QL2 A;  1ZN5 A;  1CSB A;  3M0D C;  1RF1 B;  2WPQ A;  3P32 A;  1IFI A;  5CCH D;  3VN0 A;  1T3J A;  1HGV A;  1MZ9 A;  3L36 A;  1OWA A;  2W6A A;  1FZC A;  5KJ7 A;  3UIA A;  1N73 C;  1RE4 A;  3GHG A;  4WY4 C;  4LLH A;  5CJ0 A;  3VOP A;  1J1D C;  2A45 H;  4KHX A;  1L4A A;  3M0A A;  4JYC A;  2OYI B;  3B5N D;  1G2C A;  1L4A C;  3VYI A;  3I5C A;  1AFO A;  1MFZ A;  3M91 A;  1J1E B;  2WPR A;  1IFN A;  5BU5 A;  1RY3 A;  1NTM K;  3M9Q A;  3OJA B;  3N4X A;  1YTZ T;  5APV A;  3NMD A;  2POH A;  2Z4E A;  2YO2 A;  5AW3 B;  1GL2 B;  1G1I A;  1S9K D;  3IR9 A;  1DEB A;  1Z56 A;  2YMY A;  1IFM A;  1FDM A;  1URQ A;  2GUS A;  5AVZ B;  3U59 A;  3LW5 H;  3HD7 B;  3L35 A;  1JO5 A;  2XV5 A;  2H7H A;  2JJL A;  2O1J A;  3EFG A;  3H32 A;  1FZE A;  2O1K A;  3NTN A;  2BAS A;  2P1J A;  1FJP A;  1RE3 A;  2H8P D;  1JTH A;  3A5T A;  1AQ5 A;  1IJD B;  3C9I A;  3VMZ A;  4WY4 A;  1J1E C;  5APQ A;  3HUS C;  1RF1 C;  5AVT B;  3NXS A;  3TYY A;  1HWT C;  1WT6 A;  2PAJ A;  2YKQ A;  1N7L A;  4RES B;  3LID A;  3HE5 B;  1PFI A;  2HPC B;  1FZC B;  2NPS A;  1IFD A;  3GHG B;  1MV8 A;  1NKN A;  4JYB A;  2WT7 B;  2C0X A;  1RE3 C;  2M8R A;  2R5D A;  2WWW A;  2FFD B;  1M1J A;  4I1L A;  5KTB A;  1LT9 C;  1WRG A;  1IO4 A;  1N7S C;  1SFC C;  3U1A A;  1GD2 E;  2C9L Y;  1GDT A;  1QL1 A;  1NHL A;  1SFC A;  1FOS F;  3SWY A;  2E43 A;  2XKM A;  3B8E B;  3N7N A;  1CW5 A;  4DOJ A;  1KIL A;  2GUV A;  1HH0 A;  1SFC D;  3BRV B;  2IFN A;  4LC1 A;  4ZKU A;  4B86 A;  2HLO A;  3V2Q A;  5AW9 B;  2GM4 A;  5AVW B;  3HUS B;  4W7Y A;  2C9N Y;  1OXZ A;  1G1J A;  1N86 A;  5CCG C;  4ZKP A;  3RK3 D;  1LWU B;  2OYI A;  2FYU K;  4C7R A;  1N7S A;  2KP8 A;  1KFM A;  3HTK B;  1SLQ A;  1ZV8 A;  3M9H A;  1RF1 A;  2N1T B;  1GU4 A;  1NKZ B;  1LWU C;  4C46 A;  2LKM A;  4N3Y B;  5APX A;  1LTT C;  1JNM A;  1X9V A;  1XTG B;  3RK3 C;  3B5N A;  3V2R A;  3HD7 A;  5AW4 B;  1KFN A;  5AVY B;  1VPC A;  3V5B A;  2KYV A;  1E5W A;  3R2P A;  1KZU B;  2R5B A;  1JY3 O;  1IC2 A;  1SQB K;  1GZL A;  4IFM A;  1LTS C;  2Q9I A;  4JF7 A;  1GW4 A;  2FFD C;  4I2L C;  3NFQ A;  2Z5I A;  1HJB A;  2I1J A;  1FBM A;  2WPS A;  2KOG A;  5BU8 B;  3TNU A;  3L37 A;  1J1D B;  4WY4 B;  4HYT B;  2A45 G;  4Y99 C;  1FJK A;  1N7S D;  2IPP A;  2O01 H;  3H32 B;  3LIE A;  1MUU A;  4I6M C;  3EQ2 A;  2XU6 A;  5CCH A;  1T8Z A;  1SQQ K;  2HPC A;  2OYH B;  1IFJ A;  2NPS B;  2YKO A;  3V2N A;  3HUS A;  4GT1 A;  3HRN A;  3O8Z A;  1X79 B;  5CCG D;  1JTH B;  3E1I A;  1LWU A;  5APS A;  1NWQ A;  1EQ7 A;  5AW7 B;  3V4W A;  1GK6 A;  3H6P A;  4Y99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...