1FAVA

The structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
78
structure length
78
Chain Sequence
IEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE PROTEIN CHIMERA
publication title The structure of an HIV-1 specific cell entry inhibitor in complex with the HIV-1 gp41 trimeric core.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 35
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2000-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1favA00
1JUNA 4HYTB 4I2LC 1A02J 4AYCA 2R3CA 3VMYA 1T2KC 1H89A 3M06A 3A7OA 4C7NA 5AW7B 3T97A 1CSBA 5AW1B 3NFQA 2IPPA 1HUCA 1S9KE 3KDPB 3P7KA 3LIDA 3NMDA 4I6MC 3HTKA 4XE5B 2Z5HA 3HE4A 2XV5A 2WTYA 2WPQA 2W27A 3OAKA 5APVA 2C9LY 2JJLA 5AVVB 5APQA 2R5BA 5AW4B 1NAFA 2Q7CA 3NTNA 1GTWA 4RESB 3M91A 2YNYA 4AQRD 3TNUA 5AW9B 3TK1A 3A5TA 5AW2B 3HE5A 2VRSA 1HBWA 1GU4A 5AVYB 2KP8A 4C46A 1FOSE 1J2JB 3VMXA 2P67A 5APXA 3P32A 1SLQA 5AVRB 3MGNA 1IO4A 3M9HA 3V5BA 1S9KD 1GD2E 2WWWA 1FOSF 2WPSA 1CI6A 1A02F 2Q5UA 2W6AA 5AW6B 2BASA 1GK6A 1MUUA 2P7JA 3M0AA 5AVSB 5AVXB 3VMZA 2XU6A 4C7NB 1HWTC 2Q3IA 3SWFA 2C9NY 5AW0B 2E42A 5APSA 2WPRA 2XZRA 3P8MC 4M3LA 2WT7A 1GK4A 2N9BA 2P2UA 2YO2A 1FAVA 3VYIA 1OWAA 2Z5IA 3HE4B 3I5CA 3B8EB 2ZFCA 1YYCA 5AVUB 3L35A 1KQLA 5AVZB 1T2KD 3O8ZA 2H7HA 5APWA 3TNUB 4JYBA 3V4WA 3HE5B 1H8AA 1G2CB 5APUA 3MD0A 2R32A 3IR9A 3KQGA 4AUWA 1SP4A 1NWQA 5AW8B 5AW3B 5AW5B 3V4QA 5AVWB 3M9BA 2R5DA 5CMZA 1JNMA 3M0DA 2E43A 4B86A 5AVQB 3VN0A 3L37A 1CI6B 1MFZA 1OXZA 3A2AA 2ZXEB 5AVTB 4EOTA 3UIAA 1HJBA 3L36A 4JYCA 4GT1A 3NXSA 4LC1A 2YO3A 2QM8A 2WT7B 3VTPC 1H88A 4DZOA 5APTA 1MV8A 1GZLA 3LIEA 3TYYA 1CZQA 4KHXA 1DH3A 5APYA 3A3YB 4GKGA 2QM7A 1X8YA 1GU5A
chains in the Genus database with same CATH superfamily
5KJ7A 4KT0J 3KYQA 1T2KC 3A7OA 5K5GB 4I7ZC 3TGUJ 3L70J 3A0BH 1RH5B 2FYNB 4O9BA 4IL6E 2G3AA 5TISE 4W7YA 3Q2YA 2FYUG 2AEMA 1SFCD 2JWAA 2Y0CA 2YNYA 5CJ0A 2FYUJ 1HVVA 3AEBC 5CCHC 1S72P 1KD1Q 3RK3D 4DT0A 1VQ9P 1BE3D 2WVRA 1FZCC 5AVSB 2XU6A 2C9NY 2C0WA 3B8EB 2A06D 3WU2E 1J1DB 3H1ID 2O1KA 4QMAA 5TJHA 5CCGD 3B5NA 3IR9A 4D6TJ 1M1JA 2GA1A 2LXCB 1KC8Q 1KB9E 3CC2P 3FWLA 1WRGA 3L37A 1LWUC 2Y9YA 1BCCE 1EC5A 2E5TA 3CL3D 2KB7P 1Q82Q 1RF1C 1NTKD 2QM8A 4DZOA 5KKZB 1VF5D 1G1JA 1JB0J 3QWOC 2KOGA 3WUVA 1DX7A 4I2LC 2WSEJ 3CX5D 1NU1G 2WTYA 2YKOA 3L71G 4OWFA 3GF3A 1GTWA 3GHGC 2Q6QA 1PZQA 3TF5A 3PP5A 3L71J 2PFXA 1EXJA 4U3FE 1JMBA 2P67A 2QIWA 5KJ7D 5KAFH 3AE8C 1D7MA 1L4AB 1T8ZA 5CJ4A 4YXDC 1NAYA 3CWBD 3GLMA 5AW0B 2XZRA 3OA7A 3I5CA 2NZ2A 2DW3A 4TT3H 3CC7P 5H2FE 1R5LA 4U7JA 5AVZB 4L76A 1Q86Q 2ZT9B 3QH9A 2OTLP 5APWA 3AEGC 2XNXA 3KPEA 4Z1MH 3PTZA 2YKPA 3Q5SA 5APUA 3GHGA 3L74D 3H1LG 3PHLA 1NWQA 5AW5B 5AVWB 1W5CE 3CLQA 1M56D 2ZXEB 2AXTH 2FXMA 2HFED 2V4HA 3UIAA 2YIUB 2K9YA 1FDOA 2N1TB 3LIEA 3H1KD 1KORA 2QEXP 3FXDA 1FDIA 3PH0A 1S9KE 3KDPB 3B5ND 4WVZA 1QVFO 3AE2C 2E75B 2N9YB 5KLVJ 1L2PA 1JMMA 2B9BA 4H0LD 5KTBA 1SQXJ 4ZKPA 2WMMA 1M90Q 1EQ7A 5E79E 3I56P 2D2CC 3CX5I 3AEDC 3CCMP 1AVOA 3FX0A 1GL2B 1PP9D 4W80A 3AEAC 2WPRA 2WT7A 1YJWP 2KS1A 1NJIQ 4GDOA 1FJPA 3II6A 2OYHA 1RE4C 1KTMA 1T3JA 3L72G 2R5DA 3O6QB 3H1JD 2J59M 3A2AA 2E5YA 2KUBA 3JSVC 1SQVG 3WUTA 1N2DC 2GUSA 1CZQA 2PGDA 5APYA 4GKGA 1VQ8P 5KLIC 1JCDA 1SQVJ 3H1HD 3R2PA 4AYCA 2NRGA 3M06A 5AW7B 5KAIE 3FWNA 4W7ZA 4IL6H 3RK3E 5TISH 1BE3E 1N7SC 2KZJA 3HE4A 1RE4A 4PV1C 2K37A 2W27A 2BCCG 4WY4B 3B4SA 3RK2B 1L0NJ 1N73C 3JC22 1WT6A 5APQA 3L75D 2QJPB 2A06E 2K1AA 3BRVB 3TNUA 2BCCJ 3H1IE 1JTHA 1SVFA 1S1CX 3G3ZA 2KK7A 1SQBK 3K5BA 1MZ9A 3L73G 3D6ZA 2P1JA 4NPDA 4H44B 2BASA 4EYYQ 3SWFA 5L8RJ 3H25A 1K05A 1VDFA 3WU2H 1NTMD 1G1IA 1NTKE 1N7SA 1HTLC 1ZLLA 1KILB 1VQ7P 1SFCC 1N73A 1KB9H 1UIXA 1PIXA 4DJGA 3CX5E 4BRYB 4B86A 3RK3C 1E5WA 3MP7B 4H13D 2IZ0A 1FZFA 1GZLA 3TYYA 1NTKK 1M7LA 1VQ6P 1GU5A 2AEJA 3CCEP 1FZBA 1JM0A 1KV4A 3VP8A 2E76B 2JKVA 1URQA 1VQLP 2HYNA 3HUSB 1EZVG 1SQPD 3CWBE 3RL0B 1RF0C 3TGUD 3SSUA 5AW4B 1L0LD 3M91A 3E1RA 1Y8AA 2E74B 2I1KA 2QJKB 3W68A 1AV1A 1S2EA 1PPJG 1VF5C 1FZAA 1RHZB 2Y0DA 4GOFA 2R44A 2OYIB 3S9OA 3H6PA 1CI6A 2FYUD 3L74E 2W6AA 1MUUA 3AE4C 2IBZG 4M3LA 2K88A 1Q2NA 4EIJA 1BGYG 4UB8E 1ZW0A 3H1KE 4RKUJ 4JYBA 1BGYJ 1J1DC 2JDIH 2M8RA 4HKZH 3CCQP 1BCCJ 3SFEC 1OVVA 2QJYB 2KNCB 1IFNA 1GDTA 1SQQG 1FZGA 2KIKA 1NTZG 2UWJE 1N7SD 1R5SA 3WMM0 1SQQJ 5KKZC 3FGAD 2IZ1A 2FXPA 3BATA 1ZMEC 4I6MC 2KSEA 1PP9E 4BXLA 3Q5RA 2ZXXA 5AVVB 1LP1B 2IYPA 1LTJB 3KZIE 3NTNA 3TK1A 2WZ7A 5E79H 4U3FJ 2MKVA 1NU1D 3CMAP 1Y9BA 1AFOA 5CBNA 5B5EH 3L71D 1VQNP 2WSFH 3VMZA 3AE3C 1URQD 3H1JE 2ZAEB 3A0HE 3B5NC 1WMKA 5B66E 1M1JC 3HRNA 4L74A 3PJSK 1NYHA 1YI2P 3L35A 3RGUA 2HPCA 4H0LC 2M5AA 2NPSB 4I1LA 1ZXGA 3H1HE 4IL6X 5AW3B 2ZT9C 1FS0E 3MIWA 2E43A 4Y99C 1OXZA 2B88A 2B87B 3AE6C 4D6TG 3NXSA 2YMYA 1GMJA 3L75E 2KYVA 2OQQA 3H1LD 2HR3A 2WPVB 1P84D 5KAIH 1L4AA 5CHXA 1CSBA 5BU8B 1RQUA 2M3BA 3HD7B 2QE7H 3BRTB 4L73A 1N86A 1EDLA 2W90A 1NTME 1VL2A 4Y28J 4GOEA 4JQ0D 2E75C 1HBWA 5CBOA 3L4FA 1OVRA 1XTCC 5BU5A 1IO4A 1X0TA 4WBAA 1JY2P 2WSFJ 3P8CD 1HF9A 1HWTC 3U1CA 5BVZA 2KZIA 2Q1KA 1OFCX 2N1TA 4OVNF 2ZFCA 1NTMK 1JY2O 1KQLA 2QG4A 4IOIH 4I7ZB 4PJ0E 1H8AA 3CX5H 1JO5A 1IFMA 1VQ5P 1SQBG 1OZHA 1SQPE 1K73Q 3L36A 3TGUE 1SQBJ 1IFDA 1H88A 3V2RA 4YPCA 1L0LE 4KHXA 3L72D 3D70A 3CCUP 1PV3A 3U59A 1VPCA 1GL2A 3GF7A 1BE3J 1H89A 1FZCB 3G9RA 1USDA 1RY3A 2FYUE 3E1IA 2HLOA 4YTPC 2J5UA 3GG2A 3MZWB 1Q81Q 1SQPK 5APVA 3CCLP 4H13C 2IFNA 1P84I 5DJTB 3A5TA 5AW9B 5AW2B 2AXCA 4WY4C 1L0LK 2KP8A 3RK2C 1LJ2A 1FOSE 5KLVG 3P32A 1EDJA 2GUVA 2BCCD 1LT9B 1L4AD 1SQXG 4OGQB 1LWUB 2OYHC 2MJZA 1RF1B 1GW3A 1LNQA 2FXOA 2N9BA 1FAVA 3N7NA 4UB8H 3AEEC 1HH0A 4YXWH 3L73D 2IFMA 2ZT9D 2I8DA 1FJKA 1IFPA 2WSSH 1IJDB 4WY4A 3GW6A 5AVQB 3BASA 1S5LX 1AQ5A 4R4MA 3F89A 1DIPA 3CXHD 2N1TD 3ABVC 1T3UA 2PP6A 2K9JB 4PD4D 3CCJP 1NU1E 2OTKE 2JO1A 2WQYC 1HGVA 3NFQA 3CWBJ 3PRJA 3P7KA 3CI9A 3L71E 3D71A 1DD3A 2E75D 2WPQA 3KZIH 2C9LY 2E76C 1NAFA 1Y47A 3G4SP 2YMKA 3N4XA 1U7JA 2ITAA 1LTGC 1EZVD 1L0NG 3L74J 3CMEP 4BRYA 1GD2E 2QA4P 1NU1K 1DD4A 3TDKA 1GL2D 4TLFA 2L91A 3A0HH 2QJKC 5B66H 3T97B 1Q90D 2WSCH 3CPWO 3P8MC 1AA0A 2LKMA 1PPJD 5EFWB 1G2CA 3Q3DA 3H1LE 4IFDK 2H7HA 3GMAA 1P84E 3WUUA 2IBZD 4HJGH 3HUSA 3BCCD 1KYOD 1QX8A 1TU3F 2O01H 1ZP0C 2ZYDA 1BGYD 2B89A 1SS1A 1URQC 2D2CB 1VQPP 1EXIA 3VMYA 1PP9J 5AW1B 2PRRA 2P58A 3IN6A 1OMIA 2Q9IA 1SQQD 5M1BA 3P8CE 2O01N 1NTZD 4WY4D 3CXHI 3RK2D 3OAKA 1DEEG 1IC2A 1FE6A 2V7QH 1PGOA 2WITA 2FFDB 1K9MQ 2K3RA 1VQKP 2FY8A 3M9QA 3MGNA 2WPSA 1M8OB 4H44D 1YHQP 1YTZT 2KNCA 4ZMDA 2KSJA 4KJMA 4XA4A 1GK6A 3OJAB 3L70D 2WSCJ 2E42A 1MFTA 1GK4A 2FYNC 3HTKB 1VQMP 1LTTC 2L5GB 3MUDA 2OTJP 1FC2C 4L75A 5KLIB 1K04A 1KILD 1JY2N 4PJ0H 3L72E 3H1HJ 3AEFC 3CCVP 3MD0A 4GIFA 3TSIA 1E79H 3USSA 4PV1B 2AEFA 2O01J 2OGUA 2OYOA 1LP1A 5H2FH 1LTJA 4EOTA 3S4RA 1K8AQ 3L75J 1XTGB 2SPZA 3BVHA 2RN0A 1BCCG 1KYOI 1LGHB 2O1JA 1A02J 1NTMG 2E76D 1X79B 2BCCE 4D6TD 1NVOA 4EDFA 2G8YA 3FXEA 4ASVA 3RL0D 1NTMJ 1FZEA 1CW5A 1M1KQ 3CCSP 2Q7CA 3HD7C 1SFCB 1YJNP 4AQRD 2NPSA 2E74D 3L73E 1H0TB 3MHVA 2HODB 3M0DC 1OW8A 1KQSO 5APXA 3G71P 2M3EA 1SLQA 2CPBA 3RK3B 2A45I 2B87A 2Y0EA 2H8PD 4U3FG 3M0AA 4N6JA 5AVXB 4C7NB 2JR8A 1GW4A 1J1EB 2Z5IA 3EQ2A 3JCUE 3CXHE 5GTIE 1KQGB 2QRXA 2POHA 1ZN5A 3HE5B 3HD7A 4PD4E 3F5HA 4OH8B 1SQPJ 3IFMA 4EI2A 2WSEH 2H43A 1LTSC 1L0LG 3M0DA 1QGKB 3E7KA 1L4AC 3V2PA 3SWKA 1L0LJ 1BDDA 2CPSA 1OVUA 1VF5B 1X8YA 1JUNA 1SQBD 1Q7YQ 1EZVE 3PLNA 2I1JA 1JCCA 3W67A 1MKMA 2XV5A 1IFJA 3H32B 2H88C 1U57A 1PPJE 1W2EA 1KN7A 2YIUC 3V2QA 3SWYA 2KLVA 1OW6A 1W2BO 3KHUA 2W83C 2N1TC 2WWWA 2IBZE 1FOSF 2W6JH 3BCCE 1KYOE 3RBZA 1ZRTD 3LW5H 5APSA 1BSHA 3ZDMA 1BGYE 1U7MA 3EFFK 1LT9C 5KLVD 4OGQC 5DJUB 5CCHA 1N8RQ 2RMZA 2M0BA 1SQXD 1FZCA 1P84H 4ZKUA 1YBKA 2NPSD 1IFIA 4JF7A 2PAJA 1X9VA 4WWIA 2HPCB 1LTAC 1T6AA 2M5AB 2Y9ZA 1GL2C 3RL0g 1SQQE 1NTZE 2OARA 4LC1A 1R8EA 1N7LA 1YIJP 2KI7B 2LXBA 1YTZI 1NU1J 2XNDH 1LT9A 1LWUA 1FDMA 1X22A 3VOPA 2BEZF 1RF1A 3HD7D 3B5NB 3NMDA 1M1JB 3L70E 1OW7A 1BE3G 1SQQK 4K35A 3VP9A 1NTZK 4H0LB 4XFJA 5AVYB 1KILE 4C46A 1RE3C 3U1AA 2A06G 3H1IG 3M9HA 1SQVD 4NPEA 4UB6E 4Y99B 1QEXA 2XDJA 1USEA 5AW6B 3CC4P 2P7JA 3LW5J 3H1IJ 1EDIA 1KQFB 3B71A 3AECC 1L0ND 3H1LJ 2K9JA 2IX7C 3EFGA 3O6QA 2QJPC 2JP3A 1T2KD 1NTKG 3V2NA 4N3YB 3C8VA 4AUWA 2FYUK 3V4QA 1JNMA 1UIIA 1NTKJ 1JY3P 1ZR4A 4D6TE 1RE3A 3OW2O 1NHLA 2RKLA 4H44C 5AVTB 5GTHE 1HJBA 4GT1A 2FKWB 2BEQD 2RH0A 1ZOYC 2C0XA 5APTA 1MV8A 4MN4C 4N78D 1DH3A 1JY3O 1NO4A 2KXPB 5CCHD 1S5LE 4CPGA 4WB4A 1LTBC 1KILC 3D6YA 4ASWA 2XKMA 2LR2A 3T97A 1S4XA 2YKQA 3AE1C 1QL2A 1KFMA 1AVYA 3S1KA 3GHGB 3A0BE 4HB1A 3Q5PA 1FU1A 5B5EE 2FYZA 1QL1A 3CWBG 1NKNA 1IK7A 1VQ4P 1NKZB 4DCKA 1LTIC 2J58A 3VMXA 2JWDA 1BSNA 5AVRB 3V5BA 2FFDC 4OGQD 1M57D 2Q3IA 1IK9A 2IYOA 1KILA 3JCUH 4IFMA 3L74G 3HUSC 2P2UA 3IAOA 2YO2A 3SFDC 3CXHH 3RL0C 5GTIH 3L72J 1PFIA 3G6EP 2ZJSE 5AVUB 1HGZA 3IF4A 4PD4H 4RO0A 2E74C 1SQBE 3CD6P 2R32A 1SP4A 2GM4A 2W8ZA 3H1KG 5CMZA 1NGMB 2OYIC 3VN0A 1ZR2A 4H13B 4LLHA 1NH4A 3H1KJ 2FFDA 3V6IA 4NPFX 1YJ9P 3MTUE 2WT7B 3VTPC 2KS1B 2ZYAA 2QM7A 2FBWC 1KFNA 4HYTB 2P10A 2R3CA 1KB9D 2IPPA 2OYHB 2YXQB 3LIDA 1NOHA 3HTKA 4XE5B 1ZRTE 2Z5HA 1BCCD 1KZUB 3VMAA 2JJLA 2QJYC 3KXDA 3AE5C 1PP9G 3L73J 4RESB 2OYIA 5KLVE 1KMIZ 4C7RA 2VRSA 1YITP 2JEEA 1AQTA 4RJTA 3Q1MA 1SQXE 1JOCA 4IFFA 1J2JB 3MUDC 3ITKA 1KYOH 1RQVA 5KAFE 1OX3A 4PD4I 2YXRB 3HE4B 1S3JA 1HJ0A 3H1JG 1YYCA 2ZYGA 2QSIA 3I55P 5KLVK 1LTJC 4K3AA 4U3FD 1J1EC 2O3JA 3TNUB 3H1JJ 3V4WA 1SQXK 1JTHB 1G2CB 2ZVNB 2H89C 4DOJA 3KQGA 3AE7C 5AW8B 3AE9C 2A45H 3H1HG 2IDBA 1PL5A 5CCGC 1SFCA 1EZVI 4JYCA 1PGPA 1AJYA 1H0TA 1PGJA 2AXTE 2HODA 2CK3H 4A7PA 2D2CD 2HG5D 1JEKA 1N7SB 1OIPA 1ZV8A 5C39A 3L75G 4C7NA 2NPSC 2KLUA 1N73B 1HUCA 4GODA 1SQVE 3C1LA 2W6BA 3R4YA 3RBXA 4R4LA 1QLED 2R5BA 2IBZI 3BCCG 1L0NE 1YQ3C 3HE5A 5CCGA 1GU4A 1KB9I 3CCRP 4HH2A 1RF0A 3BCCJ 4UB6H 1S9KD 1A02F 2Q5UA 1EDKA 1VQOP 1SQVK 2V7QJ 2QVAA 1PGQA 4JBZA 1URQB 5KJ7C 4JPZB 3VYIA 1OWAA 1LT1A 2Q3EA 4BWNA 4LGDE 4ZNCA 1L0NK 3O8ZA 4N78E 3EWKA 1Z56A 1IZNB 1QVGO 2A45G 3C9IA 2R3SA 4PV1D 2Z4EA 3M9BA 1NTZJ 3H32A 5GTHH 1FBMA 1CI6B 1MFZA 1YQ4C 2ZVOB 2YO3A 1SQPG 1S5LH 1BDCA 1JY3N 3A3YB 3TGUG 3L70G 1DEBA
chains in the Genus database with same CATH topology
5KJ7A 3KYQA 1LWUA 1T2KC 1FDMA 1FZBA 3A7OA 3VOPA 1HGVA 3NFQA 3VP8A 1RF1A 1URQA 3P7KA 3CI9A 3HD7D 2HYNA 3B5NB 3NMDA 3HUSB 4O9BA 1M1JB 3RL0B 1RF0C 2WPQA 4W7YA 1SQQK 2C9LY 3VP9A 1NTZK 5AW4B 1NAFA 1SFCD 3M91A 2YNYA 2I1KA 3N4XA 5CJ0A 5AVYB 4C46A 1LTGC 1RE3C 1HVVA 1FZAA 3U1AA 5CCHC 3M9HA 1GD2E 2OYIB 3RK3D 1NU1K 3H6PA 1CI6A 1GL2D 4Y99B 1FZCC 2W6AA 2XDJA 5AW6B 1MUUA 5AVSB 2P7JA 2XU6A 2C9NY 2WSCH 3P8MC 4M3LA 2C0WA 2LKMA 1G2CA 3B8EB 4EIJA 1J1DB 2IX7C 3EFGA 2O1KA 1T2KD 4IFDK 2H7HA 4JYBA 5CCGD 3B5NA 3V2NA 1J1DC 3IR9A 3HUSA 4N3YB 2M8RA 4AUWA 1M1JA 2FYUK 3V4QA 1JNMA 1ZR4A 1JY3P 2O01H 1RE3A 1NHLA 1WRGA 3L37A 1LWUC 5AVTB 1HJBA 1IFNA 3CL3D 2KB7P 4GT1A 1GDTA 1RF1C 1URQC 2FKWB 2QM8A 2C0XA 1FZGA 4DZOA 5APTA 1MV8A 1G1JA 4N78D 1DH3A 1JY3O 1NO4A 5CCHD 1N7SD 2KOGA 3WMM0 4WB4A 1DX7A 4I2LC 1LTBC 1KILC 3VMYA 2XKMA 3T97A 5AW1B 2YKQA 3BATA 1QL2A 1KFMA 2Q9IA 3GHGB 4I6MC 3P8CE 2WTYA 4WY4D 3RK2D 1FU1A 2YKOA 3OAKA 5AVVB 2FYZA 1IC2A 1QL1A 1LTJB 3NTNA 1NKNA 3GHGC 1GTWA 2WITA 3TK1A 2FFDB 2WZ7A 3PP5A 1NKZB 1LTIC 2J58A 3VMXA 2P67A 3M9QA 3MGNA 5AVRB 5KJ7D 3V5BA 1AFOA 2WPSA 2FFDC 1L4AB 1YTZT 1T8ZA 5CJ4A 2KSJA 4XA4A 2WSFH 1GK6A 3OJAB 3VMZA 2Q3IA 1IK9A 1URQD 5AW0B 2E42A 1KILA 2XZRA 3B5NC 4IFMA 1GK4A 3HUSC 2P2UA 2YO2A 1M1JC 3HRNA 3HTKB 3RL0C 1LTTC 2L5GB 3OA7A 3MUDA 3I5CA 1PFIA 5AVUB 3L35A 1KILD 1HGZA 1JY2N 5AVZB 2HPCA 5APWA 2NPSB 4I1LA 2XNXA 3KPEA 2YKPA 5APUA 3GHGA 3MD0A 2R32A 4GIFA 3TSIA 1SP4A 1NWQA 2GM4A 5AW3B 5AW5B 5AVWB 5CMZA 3CLQA 2OYIC 3MIWA 2E43A 3VN0A 4Y99C 1OXZA 1ZR2A 1LTJA 2ZXEB 4LLHA 4EOTA 2FXMA 1NH4A 2HFED 3UIAA 1XTGB 2FFDA 3NXSA 2YMYA 3MTUE 2WT7B 3VTPC 3BVHA 2N1TB 2KYVA 3LIEA 2QM7A 1KFNA 1LGHB 2O1JA 4HYTB 1L4AA 5CHXA 1A02J 2R3CA 1CSBA 5BU8B 1X79B 2IPPA 1S9KE 2OYHB 3KDPB 3B5ND 2M3BA 3LIDA 1NOHA 3HD7B 3BRTB 3HTKA 4XE5B 2Z5HA 3RL0D 1N86A 1KZUB 1FZEA 2JJLA 1CW5A 1JMMA 2Q7CA 3HD7C 5KTBA 4RESB 2OYIA 1SFCB 4ZKPA 4AQRD 2NPSA 4C7RA 2VRSA 1HBWA 2JEEA 1EQ7A 2HODB 3L4FA 3M0DC 1JOCA 4IFFA 1J2JB 5APXA 1XTCC 5BU5A 1SLQA 1IO4A 2CPBA 3RK3B 2A45I 1GL2B 4WBAA 1JY2P 4W80A 2H8PD 3P8CD 3M0AA 4N6JA 5AVXB 4C7NB 1HWTC 3U1CA 2WPRA 2WT7A 5BVZA 1GW4A 2N1TA 1J1EB 2Z5IA 3HE4B 3EQ2A 2ZFCA 1YYCA 1NTMK 1JY2O 1KQLA 5KLVK 1LTJC 1FJPA 2POHA 3II6A 1J1EC 1ZN5A 3TNUB 2OYHA 3V4WA 1RE4C 3HE5B 1SQXK 1JTHB 1T3JA 1G2CB 3HD7A 1H8AA 4DOJA 4OH8B 3KQGA 5AW8B 1JO5A 3IFMA 2H43A 2R5DA 2WSEH 1LTSC 1IFMA 2J59M 2A45H 3M0DA 1L4AC 3V2PA 5CCGC 3A2AA 1SFCA 3L36A 4JYCA 2CPSA 1IFDA 1H88A 3V2RA 2HODA 1N2DC 2GUSA 1CZQA 4KHXA 2HG5D 5APYA 4GKGA 1X8YA 1N7SB 1ZV8A 3U59A 1JUNA 1JCDA 1VPCA 1GL2A 3R2PA 4AYCA 1FZCB 1H89A 3M06A 4C7NA 5AW7B 2NPSC 2I1JA 4W7ZA 1N73B 1HUCA 1RY3A 2W6BA 1N7SC 3E1IA 1JCCA 2HLOA 3HE4A 1RE4A 2XV5A 2W27A 4WY4B 1IFJA 3RK2B 1SQPK 3H32B 5APVA 1N73C 1WT6A 5APQA 2R5BA 1W2EA 2IFNA 3V2QA 3BRVB 5AW9B 3TNUA 3SWYA 5AW2B 3A5TA 2KLVA 3HE5A 5CCGA 1JTHA 1SVFA 4WY4C 1GU4A 3G3ZA 1L0LK 2KP8A 3RK2C 4HH2A 2N1TC 1FOSE 1SQBK 1RF0A 1MZ9A 3P32A 2GUVA 1S9KD 1LT9B 2WWWA 1FOSF 1L4AD 2P1JA 1A02F 2Q5UA 1LWUB 2BASA 1SQVK 3LW5H 2OYHC 3SWFA 2MJZA 5APSA 1URQB 1RF1B 1GW3A 2N9BA 1VDFA 1LT9C 5KJ7C 1FAVA 3VYIA 3N7NA 1OWAA 1G1IA 5CCHA 1N7SA 4LGDE 1HH0A 1HTLC 1GU5A 2IFMA 1ZLLA 1KILB 1L0NK 3O8ZA 1FZCA 4N78E 4ZKUA 1SFCC 1Z56A 2NPSD 1IFIA 1N73A 2A45G 3C9IA 1FJKA 4JF7A 2PAJA 1X9VA 1IJDB 2Z4EA 3M9BA 4WY4A 2HPCB 1LTAC 3H32A 4B86A 3RK3C 5AVQB 1E5WA 3BASA 1FBMA 1CI6B 1GL2C 1MFZA 1AQ5A 1FZFA 2OARA 4LC1A 2YO3A 1N7LA 2N1TD 1T3UA 1GZLA 3TYYA 1NTKK 1YTZI 1JY3N 3A3YB 1M7LA 2PP6A 1DEBA 1LT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUN A;  4HYT B;  4I2L C;  1A02 J;  4AYC A;  2R3C A;  3VMY A;  1T2K C;  1H89 A;  3M06 A;  3A7O A;  4C7N A;  5AW7 B;  3T97 A;  1CSB A;  5AW1 B;  3NFQ A;  2IPP A;  1HUC A;  1S9K E;  3KDP B;  3P7K A;  3LID A;  3NMD A;  4I6M C;  3HTK A;  4XE5 B;  2Z5H A;  3HE4 A;  2XV5 A;  2WTY A;  2WPQ A;  2W27 A;  3OAK A;  5APV A;  2C9L Y;  2JJL A;  5AVV B;  5APQ A;  2R5B A;  5AW4 B;  1NAF A;  2Q7C A;  3NTN A;  1GTW A;  4RES B;  3M91 A;  2YNY A;  4AQR D;  3TNU A;  5AW9 B;  3TK1 A;  3A5T A;  5AW2 B;  3HE5 A;  2VRS A;  1HBW A;  1GU4 A;  5AVY B;  2KP8 A;  4C46 A;  1FOS E;  1J2J B;  3VMX A;  2P67 A;  5APX A;  3P32 A;  1SLQ A;  5AVR B;  3MGN A;  1IO4 A;  3M9H A;  3V5B A;  1S9K D;  1GD2 E;  2WWW A;  1FOS F;  2WPS A;  1CI6 A;  1A02 F;  2Q5U A;  2W6A A;  5AW6 B;  2BAS A;  1GK6 A;  1MUU A;  2P7J A;  3M0A A;  5AVS B;  5AVX B;  3VMZ A;  2XU6 A;  4C7N B;  1HWT C;  2Q3I A;  3SWF A;  2C9N Y;  5AW0 B;  2E42 A;  5APS A;  2WPR A;  2XZR A;  3P8M C;  4M3L A;  2WT7 A;  1GK4 A;  2N9B A;  2P2U A;  2YO2 A;  1FAV A;  3VYI A;  1OWA A;  2Z5I A;  3HE4 B;  3I5C A;  3B8E B;  2ZFC A;  1YYC A;  5AVU B;  3L35 A;  1KQL A;  5AVZ B;  1T2K D;  3O8Z A;  2H7H A;  5APW A;  3TNU B;  4JYB A;  3V4W A;  3HE5 B;  1H8A A;  1G2C B;  5APU A;  3MD0 A;  2R32 A;  3IR9 A;  3KQG A;  4AUW A;  1SP4 A;  1NWQ A;  5AW8 B;  5AW3 B;  5AW5 B;  3V4Q A;  5AVW B;  3M9B A;  2R5D A;  5CMZ A;  1JNM A;  3M0D A;  2E43 A;  4B86 A;  5AVQ B;  3VN0 A;  3L37 A;  1CI6 B;  1MFZ A;  1OXZ A;  3A2A A;  2ZXE B;  5AVT B;  4EOT A;  3UIA A;  1HJB A;  3L36 A;  4JYC A;  4GT1 A;  3NXS A;  4LC1 A;  2YO3 A;  2QM8 A;  2WT7 B;  3VTP C;  1H88 A;  4DZO A;  5APT A;  1MV8 A;  1GZL A;  3LIE A;  3TYY A;  1CZQ A;  4KHX A;  1DH3 A;  5APY A;  3A3Y B;  4GKG A;  2QM7 A;  1X8Y A;  1GU5 A; 
#chains in the Genus database with same CATH topology
 5KJ7 A;  4KT0 J;  3KYQ A;  1T2K C;  3A7O A;  5K5G B;  4I7Z C;  3TGU J;  3L70 J;  3A0B H;  1RH5 B;  2FYN B;  4O9B A;  4IL6 E;  2G3A A;  5TIS E;  4W7Y A;  3Q2Y A;  2FYU G;  2AEM A;  1SFC D;  2JWA A;  2Y0C A;  2YNY A;  5CJ0 A;  2FYU J;  1HVV A;  3AEB C;  5CCH C;  1S72 P;  1KD1 Q;  3RK3 D;  4DT0 A;  1VQ9 P;  1BE3 D;  2WVR A;  1FZC C;  5AVS B;  2XU6 A;  2C9N Y;  2C0W A;  3B8E B;  2A06 D;  3WU2 E;  1J1D B;  3H1I D;  2O1K A;  4QMA A;  5TJH A;  5CCG D;  3B5N A;  3IR9 A;  4D6T J;  1M1J A;  2GA1 A;  2LXC B;  1KC8 Q;  1KB9 E;  3CC2 P;  3FWL A;  1WRG A;  3L37 A;  1LWU C;  2Y9Y A;  1BCC E;  1EC5 A;  2E5T A;  3CL3 D;  2KB7 P;  1Q82 Q;  1RF1 C;  1NTK D;  2QM8 A;  4DZO A;  5KKZ B;  1VF5 D;  1G1J A;  1JB0 J;  3QWO C;  2KOG A;  3WUV A;  1DX7 A;  4I2L C;  2WSE J;  3CX5 D;  1NU1 G;  2WTY A;  2YKO A;  3L71 G;  4OWF A;  3GF3 A;  1GTW A;  3GHG C;  2Q6Q A;  1PZQ A;  3TF5 A;  3PP5 A;  3L71 J;  2PFX A;  1EXJ A;  4U3F E;  1JMB A;  2P67 A;  2QIW A;  5KJ7 D;  5KAF H;  3AE8 C;  1D7M A;  1L4A B;  1T8Z A;  5CJ4 A;  4YXD C;  1NAY A;  3CWB D;  3GLM A;  5AW0 B;  2XZR A;  3OA7 A;  3I5C A;  2NZ2 A;  2DW3 A;  4TT3 H;  3CC7 P;  5H2F E;  1R5L A;  4U7J A;  5AVZ B;  4L76 A;  1Q86 Q;  2ZT9 B;  3QH9 A;  2OTL P;  5APW A;  3AEG C;  2XNX A;  3KPE A;  4Z1M H;  3PTZ A;  2YKP A;  3Q5S A;  5APU A;  3GHG A;  3L74 D;  3H1L G;  3PHL A;  1NWQ A;  5AW5 B;  5AVW B;  1W5C E;  3CLQ A;  1M56 D;  2ZXE B;  2AXT H;  2FXM A;  2HFE D;  2V4H A;  3UIA A;  2YIU B;  2K9Y A;  1FDO A;  2N1T B;  3LIE A;  3H1K D;  1KOR A;  2QEX P;  3FXD A;  1FDI A;  3PH0 A;  1S9K E;  3KDP B;  3B5N D;  4WVZ A;  1QVF O;  3AE2 C;  2E75 B;  2N9Y B;  5KLV J;  1L2P A;  1JMM A;  2B9B A;  4H0L D;  5KTB A;  1SQX J;  4ZKP A;  2WMM A;  1M90 Q;  1EQ7 A;  5E79 E;  3I56 P;  2D2C C;  3CX5 I;  3AED C;  3CCM P;  1AVO A;  3FX0 A;  1GL2 B;  1PP9 D;  4W80 A;  3AEA C;  2WPR A;  2WT7 A;  1YJW P;  2KS1 A;  1NJI Q;  4GDO A;  1FJP A;  3II6 A;  2OYH A;  1RE4 C;  1KTM A;  1T3J A;  3L72 G;  2R5D A;  3O6Q B;  3H1J D;  2J59 M;  3A2A A;  2E5Y A;  2KUB A;  3JSV C;  1SQV G;  3WUT A;  1N2D C;  2GUS A;  1CZQ A;  2PGD A;  5APY A;  4GKG A;  1VQ8 P;  5KLI C;  1JCD A;  1SQV J;  3H1H D;  3R2P A;  4AYC A;  2NRG A;  3M06 A;  5AW7 B;  5KAI E;  3FWN A;  4W7Z A;  4IL6 H;  3RK3 E;  5TIS H;  1BE3 E;  1N7S C;  2KZJ A;  3HE4 A;  1RE4 A;  4PV1 C;  2K37 A;  2W27 A;  2BCC G;  4WY4 B;  3B4S A;  3RK2 B;  1L0N J;  1N73 C;  3JC2 2;  1WT6 A;  5APQ A;  3L75 D;  2QJP B;  2A06 E;  2K1A A;  3BRV B;  3TNU A;  2BCC J;  3H1I E;  1JTH A;  1SVF A;  1S1C X;  3G3Z A;  2KK7 A;  1SQB K;  3K5B A;  1MZ9 A;  3L73 G;  3D6Z A;  2P1J A;  4NPD A;  4H44 B;  2BAS A;  4EYY Q;  3SWF A;  5L8R J;  3H25 A;  1K05 A;  1VDF A;  3WU2 H;  1NTM D;  1G1I A;  1NTK E;  1N7S A;  1HTL C;  1ZLL A;  1KIL B;  1VQ7 P;  1SFC C;  1N73 A;  1KB9 H;  1UIX A;  1PIX A;  4DJG A;  3CX5 E;  4BRY B;  4B86 A;  3RK3 C;  1E5W A;  3MP7 B;  4H13 D;  2IZ0 A;  1FZF A;  1GZL A;  3TYY A;  1NTK K;  1M7L A;  1VQ6 P;  1GU5 A;  2AEJ A;  3CCE P;  1FZB A;  1JM0 A;  1KV4 A;  3VP8 A;  2E76 B;  2JKV A;  1URQ A;  1VQL P;  2HYN A;  3HUS B;  1EZV G;  1SQP D;  3CWB E;  3RL0 B;  1RF0 C;  3TGU D;  3SSU A;  5AW4 B;  1L0L D;  3M91 A;  3E1R A;  1Y8A A;  2E74 B;  2I1K A;  2QJK B;  3W68 A;  1AV1 A;  1S2E A;  1PPJ G;  1VF5 C;  1FZA A;  1RHZ B;  2Y0D A;  4GOF A;  2R44 A;  2OYI B;  3S9O A;  3H6P A;  1CI6 A;  2FYU D;  3L74 E;  2W6A A;  1MUU A;  3AE4 C;  2IBZ G;  4M3L A;  2K88 A;  1Q2N A;  4EIJ A;  1BGY G;  4UB8 E;  1ZW0 A;  3H1K E;  4RKU J;  4JYB A;  1BGY J;  1J1D C;  2JDI H;  2M8R A;  4HKZ H;  3CCQ P;  1BCC J;  3SFE C;  1OVV A;  2QJY B;  2KNC B;  1IFN A;  1GDT A;  1SQQ G;  1FZG A;  2KIK A;  1NTZ G;  2UWJ E;  1N7S D;  1R5S A;  3WMM 0;  1SQQ J;  5KKZ C;  3FGA D;  2IZ1 A;  2FXP A;  3BAT A;  1ZME C;  4I6M C;  2KSE A;  1PP9 E;  4BXL A;  3Q5R A;  2ZXX A;  5AVV B;  1LP1 B;  2IYP A;  1LTJ B;  3KZI E;  3NTN A;  3TK1 A;  2WZ7 A;  5E79 H;  4U3F J;  2MKV A;  1NU1 D;  3CMA P;  1Y9B A;  1AFO A;  5CBN A;  5B5E H;  3L71 D;  1VQN P;  2WSF H;  3VMZ A;  3AE3 C;  1URQ D;  3H1J E;  2ZAE B;  3A0H E;  3B5N C;  1WMK A;  5B66 E;  1M1J C;  3HRN A;  4L74 A;  3PJS K;  1NYH A;  1YI2 P;  3L35 A;  3RGU A;  2HPC A;  4H0L C;  2M5A A;  2NPS B;  4I1L A;  1ZXG A;  3H1H E;  4IL6 X;  5AW3 B;  2ZT9 C;  1FS0 E;  3MIW A;  2E43 A;  4Y99 C;  1OXZ A;  2B88 A;  2B87 B;  3AE6 C;  4D6T G;  3NXS A;  2YMY A;  1GMJ A;  3L75 E;  2KYV A;  2OQQ A;  3H1L D;  2HR3 A;  2WPV B;  1P84 D;  5KAI H;  1L4A A;  5CHX A;  1CSB A;  5BU8 B;  1RQU A;  2M3B A;  3HD7 B;  2QE7 H;  3BRT B;  4L73 A;  1N86 A;  1EDL A;  2W90 A;  1NTM E;  1VL2 A;  4Y28 J;  4GOE A;  4JQ0 D;  2E75 C;  1HBW A;  5CBO A;  3L4F A;  1OVR A;  1XTC C;  5BU5 A;  1IO4 A;  1X0T A;  4WBA A;  1JY2 P;  2WSF J;  3P8C D;  1HF9 A;  1HWT C;  3U1C A;  5BVZ A;  2KZI A;  2Q1K A;  1OFC X;  2N1T A;  4OVN F;  2ZFC A;  1NTM K;  1JY2 O;  1KQL A;  2QG4 A;  4IOI H;  4I7Z B;  4PJ0 E;  1H8A A;  3CX5 H;  1JO5 A;  1IFM A;  1VQ5 P;  1SQB G;  1OZH A;  1SQP E;  1K73 Q;  3L36 A;  3TGU E;  1SQB J;  1IFD A;  1H88 A;  3V2R A;  4YPC A;  1L0L E;  4KHX A;  3L72 D;  3D70 A;  3CCU P;  1PV3 A;  3U59 A;  1VPC A;  1GL2 A;  3GF7 A;  1BE3 J;  1H89 A;  1FZC B;  3G9R A;  1USD A;  1RY3 A;  2FYU E;  3E1I A;  2HLO A;  4YTP C;  2J5U A;  3GG2 A;  3MZW B;  1Q81 Q;  1SQP K;  5APV A;  3CCL P;  4H13 C;  2IFN A;  1P84 I;  5DJT B;  3A5T A;  5AW9 B;  5AW2 B;  2AXC A;  4WY4 C;  1L0L K;  2KP8 A;  3RK2 C;  1LJ2 A;  1FOS E;  5KLV G;  3P32 A;  1EDJ A;  2GUV A;  2BCC D;  1LT9 B;  1L4A D;  1SQX G;  4OGQ B;  1LWU B;  2OYH C;  2MJZ A;  1RF1 B;  1GW3 A;  1LNQ A;  2FXO A;  2N9B A;  1FAV A;  3N7N A;  4UB8 H;  3AEE C;  1HH0 A;  4YXW H;  3L73 D;  2IFM A;  2ZT9 D;  2I8D A;  1FJK A;  1IFP A;  2WSS H;  1IJD B;  4WY4 A;  3GW6 A;  5AVQ B;  3BAS A;  1S5L X;  1AQ5 A;  4R4M A;  3F89 A;  1DIP A;  3CXH D;  2N1T D;  3ABV C;  1T3U A;  2PP6 A;  2K9J B;  4PD4 D;  3CCJ P;  1NU1 E;  2OTK E;  2JO1 A;  2WQY C;  1HGV A;  3NFQ A;  3CWB J;  3PRJ A;  3P7K A;  3CI9 A;  3L71 E;  3D71 A;  1DD3 A;  2E75 D;  2WPQ A;  3KZI H;  2C9L Y;  2E76 C;  1NAF A;  1Y47 A;  3G4S P;  2YMK A;  3N4X A;  1U7J A;  2ITA A;  1LTG C;  1EZV D;  1L0N G;  3L74 J;  3CME P;  4BRY A;  1GD2 E;  2QA4 P;  1NU1 K;  1DD4 A;  3TDK A;  1GL2 D;  4TLF A;  2L91 A;  3A0H H;  2QJK C;  5B66 H;  3T97 B;  1Q90 D;  2WSC H;  3CPW O;  3P8M C;  1AA0 A;  2LKM A;  1PPJ D;  5EFW B;  1G2C A;  3Q3D A;  3H1L E;  4IFD K;  2H7H A;  3GMA A;  1P84 E;  3WUU A;  2IBZ D;  4HJG H;  3HUS A;  3BCC D;  1KYO D;  1QX8 A;  1TU3 F;  2O01 H;  1ZP0 C;  2ZYD A;  1BGY D;  2B89 A;  1SS1 A;  1URQ C;  2D2C B;  1VQP P;  1EXI A;  3VMY A;  1PP9 J;  5AW1 B;  2PRR A;  2P58 A;  3IN6 A;  1OMI A;  2Q9I A;  1SQQ D;  5M1B A;  3P8C E;  2O01 N;  1NTZ D;  4WY4 D;  3CXH I;  3RK2 D;  3OAK A;  1DEE G;  1IC2 A;  1FE6 A;  2V7Q H;  1PGO A;  2WIT A;  2FFD B;  1K9M Q;  2K3R A;  1VQK P;  2FY8 A;  3M9Q A;  3MGN A;  2WPS A;  1M8O B;  4H44 D;  1YHQ P;  1YTZ T;  2KNC A;  4ZMD A;  2KSJ A;  4KJM A;  4XA4 A;  1GK6 A;  3OJA B;  3L70 D;  2WSC J;  2E42 A;  1MFT A;  1GK4 A;  2FYN C;  3HTK B;  1VQM P;  1LTT C;  2L5G B;  3MUD A;  2OTJ P;  1FC2 C;  4L75 A;  5KLI B;  1K04 A;  1KIL D;  1JY2 N;  4PJ0 H;  3L72 E;  3H1H J;  3AEF C;  3CCV P;  3MD0 A;  4GIF A;  3TSI A;  1E79 H;  3USS A;  4PV1 B;  2AEF A;  2O01 J;  2OGU A;  2OYO A;  1LP1 A;  5H2F H;  1LTJ A;  4EOT A;  3S4R A;  1K8A Q;  3L75 J;  1XTG B;  2SPZ A;  3BVH A;  2RN0 A;  1BCC G;  1KYO I;  1LGH B;  2O1J A;  1A02 J;  1NTM G;  2E76 D;  1X79 B;  2BCC E;  4D6T D;  1NVO A;  4EDF A;  2G8Y A;  3FXE A;  4ASV A;  3RL0 D;  1NTM J;  1FZE A;  1CW5 A;  1M1K Q;  3CCS P;  2Q7C A;  3HD7 C;  1SFC B;  1YJN P;  4AQR D;  2NPS A;  2E74 D;  3L73 E;  1H0T B;  3MHV A;  2HOD B;  3M0D C;  1OW8 A;  1KQS O;  5APX A;  3G71 P;  2M3E A;  1SLQ A;  2CPB A;  3RK3 B;  2A45 I;  2B87 A;  2Y0E A;  2H8P D;  4U3F G;  3M0A A;  4N6J A;  5AVX B;  4C7N B;  2JR8 A;  1GW4 A;  1J1E B;  2Z5I A;  3EQ2 A;  3JCU E;  3CXH E;  5GTI E;  1KQG B;  2QRX A;  2POH A;  1ZN5 A;  3HE5 B;  3HD7 A;  4PD4 E;  3F5H A;  4OH8 B;  1SQP J;  3IFM A;  4EI2 A;  2WSE H;  2H43 A;  1LTS C;  1L0L G;  3M0D A;  1QGK B;  3E7K A;  1L4A C;  3V2P A;  3SWK A;  1L0L J;  1BDD A;  2CPS A;  1OVU A;  1VF5 B;  1X8Y A;  1JUN A;  1SQB D;  1Q7Y Q;  1EZV E;  3PLN A;  2I1J A;  1JCC A;  3W67 A;  1MKM A;  2XV5 A;  1IFJ A;  3H32 B;  2H88 C;  1U57 A;  1PPJ E;  1W2E A;  1KN7 A;  2YIU C;  3V2Q A;  3SWY A;  2KLV A;  1OW6 A;  1W2B O;  3KHU A;  2W83 C;  2N1T C;  2WWW A;  2IBZ E;  1FOS F;  2W6J H;  3BCC E;  1KYO E;  3RBZ A;  1ZRT D;  3LW5 H;  5APS A;  1BSH A;  3ZDM A;  1BGY E;  1U7M A;  3EFF K;  1LT9 C;  5KLV D;  4OGQ C;  5DJU B;  5CCH A;  1N8R Q;  2RMZ A;  2M0B A;  1SQX D;  1FZC A;  1P84 H;  4ZKU A;  1YBK A;  2NPS D;  1IFI A;  4JF7 A;  2PAJ A;  1X9V A;  4WWI A;  2HPC B;  1LTA C;  1T6A A;  2M5A B;  2Y9Z A;  1GL2 C;  3RL0 g;  1SQQ E;  1NTZ E;  2OAR A;  4LC1 A;  1R8E A;  1N7L A;  1YIJ P;  2KI7 B;  2LXB A;  1YTZ I;  1NU1 J;  2XND H;  1LT9 A;  1LWU A;  1FDM A;  1X22 A;  3VOP A;  2BEZ F;  1RF1 A;  3HD7 D;  3B5N B;  3NMD A;  1M1J B;  3L70 E;  1OW7 A;  1BE3 G;  1SQQ K;  4K35 A;  3VP9 A;  1NTZ K;  4H0L B;  4XFJ A;  5AVY B;  1KIL E;  4C46 A;  1RE3 C;  3U1A A;  2A06 G;  3H1I G;  3M9H A;  1SQV D;  4NPE A;  4UB6 E;  4Y99 B;  1QEX A;  2XDJ A;  1USE A;  5AW6 B;  3CC4 P;  2P7J A;  3LW5 J;  3H1I J;  1EDI A;  1KQF B;  3B71 A;  3AEC C;  1L0N D;  3H1L J;  2K9J A;  2IX7 C;  3EFG A;  3O6Q A;  2QJP C;  2JP3 A;  1T2K D;  1NTK G;  3V2N A;  4N3Y B;  3C8V A;  4AUW A;  2FYU K;  3V4Q A;  1JNM A;  1UII A;  1NTK J;  1JY3 P;  1ZR4 A;  4D6T E;  1RE3 A;  3OW2 O;  1NHL A;  2RKL A;  4H44 C;  5AVT B;  5GTH E;  1HJB A;  4GT1 A;  2FKW B;  2BEQ D;  2RH0 A;  1ZOY C;  2C0X A;  5APT A;  1MV8 A;  4MN4 C;  4N78 D;  1DH3 A;  1JY3 O;  1NO4 A;  2KXP B;  5CCH D;  1S5L E;  4CPG A;  4WB4 A;  1LTB C;  1KIL C;  3D6Y A;  4ASW A;  2XKM A;  2LR2 A;  3T97 A;  1S4X A;  2YKQ A;  3AE1 C;  1QL2 A;  1KFM A;  1AVY A;  3S1K A;  3GHG B;  3A0B E;  4HB1 A;  3Q5P A;  1FU1 A;  5B5E E;  2FYZ A;  1QL1 A;  3CWB G;  1NKN A;  1IK7 A;  1VQ4 P;  1NKZ B;  4DCK A;  1LTI C;  2J58 A;  3VMX A;  2JWD A;  1BSN A;  5AVR B;  3V5B A;  2FFD C;  4OGQ D;  1M57 D;  2Q3I A;  1IK9 A;  2IYO A;  1KIL A;  3JCU H;  4IFM A;  3L74 G;  3HUS C;  2P2U A;  3IAO A;  2YO2 A;  3SFD C;  3CXH H;  3RL0 C;  5GTI H;  3L72 J;  1PFI A;  3G6E P;  2ZJS E;  5AVU B;  1HGZ A;  3IF4 A;  4PD4 H;  4RO0 A;  2E74 C;  1SQB E;  3CD6 P;  2R32 A;  1SP4 A;  2GM4 A;  2W8Z A;  3H1K G;  5CMZ A;  1NGM B;  2OYI C;  3VN0 A;  1ZR2 A;  4H13 B;  4LLH A;  1NH4 A;  3H1K J;  2FFD A;  3V6I A;  4NPF X;  1YJ9 P;  3MTU E;  2WT7 B;  3VTP C;  2KS1 B;  2ZYA A;  2QM7 A;  2FBW C;  1KFN A;  4HYT B;  2P10 A;  2R3C A;  1KB9 D;  2IPP A;  2OYH B;  2YXQ B;  3LID A;  1NOH A;  3HTK A;  4XE5 B;  1ZRT E;  2Z5H A;  1BCC D;  1KZU B;  3VMA A;  2JJL A;  2QJY C;  3KXD A;  3AE5 C;  1PP9 G;  3L73 J;  4RES B;  2OYI A;  5KLV E;  1KMI Z;  4C7R A;  2VRS A;  1YIT P;  2JEE A;  1AQT A;  4RJT A;  3Q1M A;  1SQX E;  1JOC A;  4IFF A;  1J2J B;  3MUD C;  3ITK A;  1KYO H;  1RQV A;  5KAF E;  1OX3 A;  4PD4 I;  2YXR B;  3HE4 B;  1S3J A;  1HJ0 A;  3H1J G;  1YYC A;  2ZYG A;  2QSI A;  3I55 P;  5KLV K;  1LTJ C;  4K3A A;  4U3F D;  1J1E C;  2O3J A;  3TNU B;  3H1J J;  3V4W A;  1SQX K;  1JTH B;  1G2C B;  2ZVN B;  2H89 C;  4DOJ A;  3KQG A;  3AE7 C;  5AW8 B;  3AE9 C;  2A45 H;  3H1H G;  2IDB A;  1PL5 A;  5CCG C;  1SFC A;  1EZV I;  4JYC A;  1PGP A;  1AJY A;  1H0T A;  1PGJ A;  2AXT E;  2HOD A;  2CK3 H;  4A7P A;  2D2C D;  2HG5 D;  1JEK A;  1N7S B;  1OIP A;  1ZV8 A;  5C39 A;  3L75 G;  4C7N A;  2NPS C;  2KLU A;  1N73 B;  1HUC A;  4GOD A;  1SQV E;  3C1L A;  2W6B A;  3R4Y A;  3RBX A;  4R4L A;  1QLE D;  2R5B A;  2IBZ I;  3BCC G;  1L0N E;  1YQ3 C;  3HE5 A;  5CCG A;  1GU4 A;  1KB9 I;  3CCR P;  4HH2 A;  1RF0 A;  3BCC J;  4UB6 H;  1S9K D;  1A02 F;  2Q5U A;  1EDK A;  1VQO P;  1SQV K;  2V7Q J;  2QVA A;  1PGQ A;  4JBZ A;  1URQ B;  5KJ7 C;  4JPZ B;  3VYI A;  1OWA A;  1LT1 A;  2Q3E A;  4BWN A;  4LGD E;  4ZNC A;  1L0N K;  3O8Z A;  4N78 E;  3EWK A;  1Z56 A;  1IZN B;  1QVG O;  2A45 G;  3C9I A;  2R3S A;  4PV1 D;  2Z4E A;  3M9B A;  1NTZ J;  3H32 A;  5GTH H;  1FBM A;  1CI6 B;  1MFZ A;  1YQ4 C;  2ZVO B;  2YO3 A;  1SQP G;  1S5L H;  1BDC A;  1JY3 N;  3A3Y B;  3TGU G;  3L70 G;  1DEB A; 
#chains in the Genus database with same CATH homology
 5KJ7 A;  3KYQ A;  1LWU A;  1T2K C;  1FDM A;  1FZB A;  3A7O A;  3VOP A;  1HGV A;  3NFQ A;  3VP8 A;  1RF1 A;  1URQ A;  3P7K A;  3CI9 A;  3HD7 D;  2HYN A;  3B5N B;  3NMD A;  3HUS B;  4O9B A;  1M1J B;  3RL0 B;  1RF0 C;  2WPQ A;  4W7Y A;  1SQQ K;  2C9L Y;  3VP9 A;  1NTZ K;  5AW4 B;  1NAF A;  1SFC D;  3M91 A;  2YNY A;  2I1K A;  3N4X A;  5CJ0 A;  5AVY B;  4C46 A;  1LTG C;  1RE3 C;  1HVV A;  1FZA A;  3U1A A;  5CCH C;  3M9H A;  1GD2 E;  2OYI B;  3RK3 D;  1NU1 K;  3H6P A;  1CI6 A;  1GL2 D;  4Y99 B;  1FZC C;  2W6A A;  2XDJ A;  5AW6 B;  1MUU A;  5AVS B;  2P7J A;  2XU6 A;  2C9N Y;  2WSC H;  3P8M C;  4M3L A;  2C0W A;  2LKM A;  1G2C A;  3B8E B;  4EIJ A;  1J1D B;  2IX7 C;  3EFG A;  2O1K A;  1T2K D;  4IFD K;  2H7H A;  4JYB A;  5CCG D;  3B5N A;  3V2N A;  1J1D C;  3IR9 A;  3HUS A;  4N3Y B;  2M8R A;  4AUW A;  1M1J A;  2FYU K;  3V4Q A;  1JNM A;  1ZR4 A;  1JY3 P;  2O01 H;  1RE3 A;  1NHL A;  1WRG A;  3L37 A;  1LWU C;  5AVT B;  1HJB A;  1IFN A;  3CL3 D;  2KB7 P;  4GT1 A;  1GDT A;  1RF1 C;  1URQ C;  2FKW B;  2QM8 A;  2C0X A;  1FZG A;  4DZO A;  5APT A;  1MV8 A;  1G1J A;  4N78 D;  1DH3 A;  1JY3 O;  1NO4 A;  5CCH D;  1N7S D;  2KOG A;  3WMM 0;  4WB4 A;  1DX7 A;  4I2L C;  1LTB C;  1KIL C;  3VMY A;  2XKM A;  3T97 A;  5AW1 B;  2YKQ A;  3BAT A;  1QL2 A;  1KFM A;  2Q9I A;  3GHG B;  4I6M C;  3P8C E;  2WTY A;  4WY4 D;  3RK2 D;  1FU1 A;  2YKO A;  3OAK A;  5AVV B;  2FYZ A;  1IC2 A;  1QL1 A;  1LTJ B;  3NTN A;  1NKN A;  3GHG C;  1GTW A;  2WIT A;  3TK1 A;  2FFD B;  2WZ7 A;  3PP5 A;  1NKZ B;  1LTI C;  2J58 A;  3VMX A;  2P67 A;  3M9Q A;  3MGN A;  5AVR B;  5KJ7 D;  3V5B A;  1AFO A;  2WPS A;  2FFD C;  1L4A B;  1YTZ T;  1T8Z A;  5CJ4 A;  2KSJ A;  4XA4 A;  2WSF H;  1GK6 A;  3OJA B;  3VMZ A;  2Q3I A;  1IK9 A;  1URQ D;  5AW0 B;  2E42 A;  1KIL A;  2XZR A;  3B5N C;  4IFM A;  1GK4 A;  3HUS C;  2P2U A;  2YO2 A;  1M1J C;  3HRN A;  3HTK B;  3RL0 C;  1LTT C;  2L5G B;  3OA7 A;  3MUD A;  3I5C A;  1PFI A;  5AVU B;  3L35 A;  1KIL D;  1HGZ A;  1JY2 N;  5AVZ B;  2HPC A;  5APW A;  2NPS B;  4I1L A;  2XNX A;  3KPE A;  2YKP A;  5APU A;  3GHG A;  3MD0 A;  2R32 A;  4GIF A;  3TSI A;  1SP4 A;  1NWQ A;  2GM4 A;  5AW3 B;  5AW5 B;  5AVW B;  5CMZ A;  3CLQ A;  2OYI C;  3MIW A;  2E43 A;  3VN0 A;  4Y99 C;  1OXZ A;  1ZR2 A;  1LTJ A;  2ZXE B;  4LLH A;  4EOT A;  2FXM A;  1NH4 A;  2HFE D;  3UIA A;  1XTG B;  2FFD A;  3NXS A;  2YMY A;  3MTU E;  2WT7 B;  3VTP C;  3BVH A;  2N1T B;  2KYV A;  3LIE A;  2QM7 A;  1KFN A;  1LGH B;  2O1J A;  4HYT B;  1L4A A;  5CHX A;  1A02 J;  2R3C A;  1CSB A;  5BU8 B;  1X79 B;  2IPP A;  1S9K E;  2OYH B;  3KDP B;  3B5N D;  2M3B A;  3LID A;  1NOH A;  3HD7 B;  3BRT B;  3HTK A;  4XE5 B;  2Z5H A;  3RL0 D;  1N86 A;  1KZU B;  1FZE A;  2JJL A;  1CW5 A;  1JMM A;  2Q7C A;  3HD7 C;  5KTB A;  4RES B;  2OYI A;  1SFC B;  4ZKP A;  4AQR D;  2NPS A;  4C7R A;  2VRS A;  1HBW A;  2JEE A;  1EQ7 A;  2HOD B;  3L4F A;  3M0D C;  1JOC A;  4IFF A;  1J2J B;  5APX A;  1XTC C;  5BU5 A;  1SLQ A;  1IO4 A;  2CPB A;  3RK3 B;  2A45 I;  1GL2 B;  4WBA A;  1JY2 P;  4W80 A;  2H8P D;  3P8C D;  3M0A A;  4N6J A;  5AVX B;  4C7N B;  1HWT C;  3U1C A;  2WPR A;  2WT7 A;  5BVZ A;  1GW4 A;  2N1T A;  1J1E B;  2Z5I A;  3HE4 B;  3EQ2 A;  2ZFC A;  1YYC A;  1NTM K;  1JY2 O;  1KQL A;  5KLV K;  1LTJ C;  1FJP A;  2POH A;  3II6 A;  1J1E C;  1ZN5 A;  3TNU B;  2OYH A;  3V4W A;  1RE4 C;  3HE5 B;  1SQX K;  1JTH B;  1T3J A;  1G2C B;  3HD7 A;  1H8A A;  4DOJ A;  4OH8 B;  3KQG A;  5AW8 B;  1JO5 A;  3IFM A;  2H43 A;  2R5D A;  2WSE H;  1LTS C;  1IFM A;  2J59 M;  2A45 H;  3M0D A;  1L4A C;  3V2P A;  5CCG C;  3A2A A;  1SFC A;  3L36 A;  4JYC A;  2CPS A;  1IFD A;  1H88 A;  3V2R A;  2HOD A;  1N2D C;  2GUS A;  1CZQ A;  4KHX A;  2HG5 D;  5APY A;  4GKG A;  1X8Y A;  1N7S B;  1ZV8 A;  3U59 A;  1JUN A;  1JCD A;  1VPC A;  1GL2 A;  3R2P A;  4AYC A;  1FZC B;  1H89 A;  3M06 A;  4C7N A;  5AW7 B;  2NPS C;  2I1J A;  4W7Z A;  1N73 B;  1HUC A;  1RY3 A;  2W6B A;  1N7S C;  3E1I A;  1JCC A;  2HLO A;  3HE4 A;  1RE4 A;  2XV5 A;  2W27 A;  4WY4 B;  1IFJ A;  3RK2 B;  1SQP K;  3H32 B;  5APV A;  1N73 C;  1WT6 A;  5APQ A;  2R5B A;  1W2E A;  2IFN A;  3V2Q A;  3BRV B;  5AW9 B;  3TNU A;  3SWY A;  5AW2 B;  3A5T A;  2KLV A;  3HE5 A;  5CCG A;  1JTH A;  1SVF A;  4WY4 C;  1GU4 A;  3G3Z A;  1L0L K;  2KP8 A;  3RK2 C;  4HH2 A;  2N1T C;  1FOS E;  1SQB K;  1RF0 A;  1MZ9 A;  3P32 A;  2GUV A;  1S9K D;  1LT9 B;  2WWW A;  1FOS F;  1L4A D;  2P1J A;  1A02 F;  2Q5U A;  1LWU B;  2BAS A;  1SQV K;  3LW5 H;  2OYH C;  3SWF A;  2MJZ A;  5APS A;  1URQ B;  1RF1 B;  1GW3 A;  2N9B A;  1VDF A;  1LT9 C;  5KJ7 C;  1FAV A;  3VYI A;  3N7N A;  1OWA A;  1G1I A;  5CCH A;  1N7S A;  4LGD E;  1HH0 A;  1HTL C;  1GU5 A;  2IFM A;  1ZLL A;  1KIL B;  1L0N K;  3O8Z A;  1FZC A;  4N78 E;  4ZKU A;  1SFC C;  1Z56 A;  2NPS D;  1IFI A;  1N73 A;  2A45 G;  3C9I A;  1FJK A;  4JF7 A;  2PAJ A;  1X9V A;  1IJD B;  2Z4E A;  3M9B A;  4WY4 A;  2HPC B;  1LTA C;  3H32 A;  4B86 A;  3RK3 C;  5AVQ B;  1E5W A;  3BAS A;  1FBM A;  1CI6 B;  1GL2 C;  1MFZ A;  1AQ5 A;  1FZF A;  2OAR A;  4LC1 A;  2YO3 A;  1N7L A;  2N1T D;  1T3U A;  1GZL A;  3TYY A;  1NTK K;  1YTZ I;  1JY3 N;  3A3Y B;  1M7L A;  2PP6 A;  1DEB A;  1LT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...