1FAVA

The structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
78
structure length
78
Chain Sequence
b'IEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE PROTEIN CHIMERA
publication title The structure of an HIV-1 specific cell entry inhibitor in complex with the HIV-1 gp41 trimeric core.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 35
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2000-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1favA00
4I6MC 5APTA 2Q7CA 1A02J 1GU5A 3VTPC 4EOTA 5AVUB 1OXZA 2R5BA 3P7KA 3M91A 1H88A 1NAFA 1HBWA 2R3CA 1IO4A 3V5BA 3A3YB 4M3LA 2ZXEB 3A7OA 3UIAA 2ZFCA 3MGNA 4C7NB 5APUA 4C7NA 3O8ZA 4JYBA 1GK6A 5AVWB 1S9KD 5AVSB 4C46A 1SP4A 5AW7B 2P67A 1YYCA 3L37A 5APWA 3HE5B 2XU6A 3HE5A 1H89A 3P32A 4DZOA 1MUUA 2WT7B 1GZLA 2QM7A 2WT7A 2WWWA 3NTNA 3VMYA 4B86A 1DH3A 2BASA 2E42A 2VRSA 3A2AA 3M0AA 5AVXB 2W6AA 3I5CA 4GT1A 2N9BA 2Z5HA 2JJLA 2W27A 3M06A 5AW2B 1GD2E 1MV8A 2WPSA 3L35A 5APQA 1GU4A 3TYYA 5AVTB 1J2JB 1CZQA 2P2UA 5APVA 1G2CB 1GK4A 4RESB 2WTYA 1T2KC 5APYA 1X8YA 5CMZA 4KHXA 4XE5B 5APSA 4HYTB 5AW6B 1NWQA 3KDPB 3SWFA 3VMZA 1SLQA 5AW0B 2R32A 3NXSA 3OAKA 1CI6B 3HE4B 5AW4B 1CI6A 3HE4A 5AW9B 1JUNA 1JNMA 3M0DA 2P7JA 1H8AA 3A5TA 5AVRB 3KQGA 1HWTC 3LIDA 1HUCA 1FOSF 3T97A 3IR9A 3MD0A 1A02F 3LIEA 1FOSE 3VYIA 5AW8B 2YNYA 2YO3A 4GKGA 5AVZB 3TNUB 4AYCA 3B8EB 5AVQB 3TNUA 3HTKA 1OWAA 1CSBA 4AQRD 2WPQA 3M9HA 2H7HA 3V4QA 2C9NY 3VN0A 2Q5UA 1MFZA 3NFQA 2WPRA 2YO2A 3V4WA 1HJBA 3L36A 3TK1A 1FAVA 5AW1B 5AW3B 2IPPA 4JYCA 2C9LY 2QM8A 5AVYB 2E43A 5AW5B 4AUWA 5APXA 3M9BA 3NMDA 5AVVB 1S9KE 2KP8A 1T2KD 2Q3IA 2R5DA 3VMXA 2XV5A 2Z5IA 4LC1A 2XZRA 1KQLA 1GTWA 4I2LC 3P8MC
chains in the Genus database with same CATH superfamily
4I6MC 4OGQD 4PD4I 3WU2E 2E75D 3KHUA 1JCDA 1IK9A 1GU5A 3CLQA 3CWBD 2B89A 2Q3EA 2XDJA 4YXDC 1FZGA 1IO4A 1K04A 1LTJC 3G3ZA 2G3AA 5KKZB 1JMBA 3O8ZA 2B87A 1SFCC 1LT1A 3HD7C 2AXTH 4O9BA 1L2PA 4BRYA 5TISE 1T8ZA 3L71E 2FYUE 4OH8B 4H13C 5B66H 4JQ0D 2BCCD 3H1JJ 1NTZE 4L74A 1VQ4P 3R4YA 1G2CA 3RBZA 5CMZA 1EDIA 3CC7P 4PJ0H 1LTAC 5DJTB 1CI6B 1KFNA 2P7JA 3L71G 3T97B 2WSCJ 2FYUG 5BU8B 1USDA 1NTZG 3KZIH 4RJTA 2KSEA 1AQ5A 1P84H 1LGHB 2Y0CA 1RF0C 2C9NY 1N86A 2KIKA 2W6BA 3E1IA 1NKNA 3EFGA 1FC2C 1N7SB 1N2DC 1QL1A 2ZYGA 1M56D 1YHQP 1GTWA 1OIPA 1QEXA 4XA4A 1PGQA 2BEQD 2O01H 1YI2P 3TF5A 1ZV8A 1JM0A 1FJKA 1GK6A 3V6IA 1KMIZ 2C0WA 3M0DC 3AEGC 3CCSP 2L5GB 3VMYA 1SQVK 2A06D 2E42A 5KLIC 3BCCJ 2FYUD 2N9BA 4YXWH 4RO0A 2JJLA 5AW2B 2QEXP 3TSIA 1WRGA 1SQQE 2D2CB 3H1HE 5APVA 3AE9C 2A45G 1SQBK 3CX5H 3JCUE 2HG5D 5AW9B 4OGQC 2E75C 3CCRP 3KQGA 3RK2B 2N1TA 1YITP 3O6QA 5KAFH 1CW5A 1BE3G 2IDBA 1LTGC 4K35A 2IFMA 3FXDA 3PH0A 3HTKA 1SQQG 2ZAEB 1KQGB 1VQNP 3AEEC 2PAJA 2WSEH 3CXHE 4JPZB 2Q3IA 1EXJA 1K73Q 1N7SD 3L73D 1USEA 3W67A 1QVGO 3G9RA 3PJSK 5KJ7A 5L8RJ 1NYHA 3CWBJ 3D6YA 1RE4A 1ZP0C 4HKZH 1OVVA 2CPBA 3E7KA 1SS1A 4PD4D 2P58A 1X0TA 1GDTA 2WSEJ 2WQYC 1NOHA 1SQVJ 2WWWA 1YIJP 1DH3A 4DJGA 3M0AA 2M8RA 3U59A 3BASA 1IZNB 1JO5A 4IL6H 2HODB 2NPSA 4HJGH 2WZ7A 1SQQD 3H1HD 1LP1A 1SQBJ 3FWNA 4U3FJ 2FYNC 4Y99C 3P8CE 2D2CD 1S2EA 1NTZK 1BDDA 2KUBA 3HE4B 3MZWB 1JCCA 3IR9A 2FFDA 2H8PD 4WWIA 3RK2D 2FY8A 3KXDA 1LWUC 2AXTE 5KKZC 2KS1A 5AW1B 1IFMA 3RBXA 1QVFO 1L0NK 1L0LD 3HD7B 1PGOA 2JKVA 2J58A 5B66E 1GL2C 1JY2P 4I7ZB 1Y8AA 3GG2A 3H1LD 5APTA 1EDJA 4H13B 2OQQA 4Y28J 4PJ0E 1H88A 1TU3F 3FWLA 2ZYDA 4N78E 1RF1A 3F5HA 1OW8A 1KYOI 4D6TE 3RGUA 3AEBC 1Q90D 3KZIE 4UB8H 5CJ0A 3AE2C 2JEEA 1P84E 2CPSA 3HE5A 2B88A 2IX7C 2KZIA 1MUUA 1GZLA 3A0HH 3QWOC 4WY4C 2K9JB 1PFIA 3JSVC 3L74E 4GT1A 2Z5HA 1SVFA 1VQPP 3L71J 4D6TG 2FYUJ 4LLHA 1GK4A 5APSA 1NTZJ 4RKUJ 3GHGA 1ZN5A 3KDPB 1N7SC 3VMZA 1OMIA 1LT9B 3LIDA 3H1JD 3L74G 2K37A 3H1KE 1JY3O 4EDFA 3D70A 2Q9IA 3G71P 5C39A 3M9HA 2J5UA 3K5BA 2OARA 1MFZA 1H0TB 2WPRA 3L36A 1VQKP 4DT0A 5AW3B 2PP6A 3H25A 1SQPK 3H1KG 1S9KE 5CCHD 3HD7D 1KZUB 3B5NA 1VDFA 5BVZA 4I2LC 2NRGA 1NVOA 3GLMA 3C8VA 1YTZT 3CX5E 4XFJA 1PPJD 1Y47A 4H13D 4OVNF 2D2CC 2ITAA 4N78D 5APUA 4C7NA 2KLVA 3HUSC 2WSFH 5EFWB 3L72E 3RK2C 1H89A 3H1IE 2AEMA 2KOGA 1AVYA 3MIWA 5DJUB 3I5CA 3L74D 1W2BO 5B5EH 1FBMA 4PV1C 4WVZA 3TGUE 2B9BA 5AVTB 3L72G 1LTJA 4RESB 2W90A 1AVOA 1FZCA 4MN4C 5AW6B 3H1IG 4IL6X 1SQQJ 3H1HJ 1SFCA 3AECC 1NU1E 1FOSE 3CXHH 2JDIH 1SQBE 1L4AB 1IFPA 3TGUG 1OWAA 2R3SA 2IYPA 3AE3C 1ZOYC 1CSBA 1QGKB 1MZ9A 4IFDK 5M1BA 4NPFX 1BDCA 4AUWA 3I55P 1NU1G 2QJPB 1RQVA 2I1JA 1URQA 2OYIB 4IL6E 1BGYE 2WSSH 2OYHA 2YMKA 3M91A 1KB9H 2HPCA 3MGNA 5KLVE 2E76B 1SP4A 1BGYG 5GTHH 3L37A 5CBOA 1T3UA 3H1ID 2A45I 1D7MA 3MTUE 1KYOD 1LWUB 1VQOP 4JBZA 5KLVG 3M06A 2E5TA 4HH2A 2QRXA 2M5AB 1N73C 1K05A 1S3JA 2QSIA 1SQVD 5CCHC 2L91A 4HYTB 2R32A 3NXSA 2IZ0A 1GL2B 3M0DA 4I7ZC 1FOSF 3MD0A 3AE5C 1OW6A 3CD6P 1SQBD 4U3FD 1ZXGA 1KC8Q 3VP8A 1L4AD 1EZVE 3NFQA 4UB8E 1W2EA 1JY3N 1VPCA 1ZMEC 3A0HE 1M7LA 2GUVA 1HF9A 5AVVB 3AE1C 2I1KA 4WY4B 2XZRA 1EZVG 3CXHI 3N7NA 1L0NE 3B71A 1KILB 1KILE 2I8DA 2QJKB 2ZT9B 3V5BA 2KK7A 1IK7A 1EDKA 2KZJA 1LT9C 1RQUA 2E76D 1L0NG 1M1JA 1FU1A 4D6TJ 4W7ZA 2AXCA 3A2AA 1PP9E 5AVXB 1VQLP 1AQTA 1GD2E 3L74J 3H32A 3ITKA 5APYA 4L76A 3GMAA 3OAKA 5E79H 1M1KQ 1PP9G 2YXQB 2IFNA 3L71D 1GL2D 1BE3E 3U1AA 5AVZB 3TNUB 1NTZD 2QA4P 2O01J 1NU1K 3H1KJ 2KNCB 2Q5UA 3HUSB 3RK3E 3U1CA 1PIXA 3CC2P 1LTIC 3FX0A 3Q5PA 3NMDA 1NTKE 2FBWC 2Q6QA 1T2KD 5B5EE 3L70E 2XV5A 2E74B 1A02J 1NJIQ 1EC5A 4WY4D 1SQPE 1L0ND 4PV1B 4EIJA 1HBWA 1BSNA 2XNXA 1KILD 3L75E 1RY3A 3II6A 4GIFA 1NTKG 2ZT9D 3L70G 2KSJA 4C46A 1Q7YQ 2AEFA 5KLVK 1X79B 1SQPG 2WT7B 1L4AC 3L72J 2PGDA 1P84I 3L75G 2CK3H 2M3BA 3H1IJ 3PHLA 3VP9A 1S4XA 3Q5RA 2W27A 5APQA 1N7LA 2HYNA 4XE5B 3TGUJ 1NWQA 1AFOA 2QJPC 1CI6A 1JUNA 2OYIC 2FKWB 1KB9E 1HJ0A 3T97A 2V7QH 3WUTA 3VYIA 2W83C 1BE3D 4GKGA 1W5CE 1NU1J 2H7HA 1ZR4A 5GTHE 2ZYAA 4ASWA 4CPGA 4IFMA 2WMMA 2E76C 2JO1A 3M9BA 3ABVC 1N7SA 3IAOA 3CCMP 1PGPA 3V2PA 5H2FH 4H0LB 1JTHB 1SQXE 1FDOA 2E74D 3VTPC 4EOTA 1KFMA 1BGYJ 1NAFA 1N73B 2KYVA 4PV1D 3CX5I 3PRJA 4IFFA 2Q1KA 3CXHD 2YKQA 1DEBA 1ZW0A 3Q5SA 1YQ3C 1QLED 1SQXG 5KLVJ 1KN7A 3V2QA 5CBNA 1BCCE 1M90Q 1NH4A 1G1JA 2FXMA 5KJ7C 2ZXXA 1Z56A 1VQ7P 2NZ2A 1T2KC 3MP7B 1X8YA 3EQ2A 1RE4C 1OZHA 2PFXA 5AW0B 1BCCG 1H8AA 2LXCB 2Y0DA 2HFED 3S1KA 1KILC 1KTMA 3AEDC 2YKPA 4R4LA 2QJKC 2ZT9C 2OTJP 3GW6A 3CI9A 2UWJE 3P8CD 3MUDC 3ZDMA 1KQFB 2V4HA 3AE8C 2NPSC 3GF3A 1GW4A 1PL5A 1T6AA 4DCKA 3AEAC 1YQ4C 2K88A 3VMXA 4A7PA 2FXOA 2FFDC 1NTKK 4H0LD 2Y9ZA 1JY2N 2R3CA 1L0NJ 3LW5H 3V2NA 2QJYB 5E79E 1VQ9P 2ZVOB 1MKMA 2JP3A 2B87B 3C1LA 4BRYB 1PZQA 3BCCG 2DW3A 1NTMK 4PD4H 1FS0E 4OWFA 3RK3C 3AE4C 1FE6A 4I1LA 1RE3A 1PP9J 2HODA 1YJWP 1IC2A 1G2CB 4D6TD 5CCGD 1RF1C 1X9VA 1P84D 4EI2A 3HE4A 1JNMA 4L73A 5BU5A 2E74C 1T3JA 4UB6H 1HWTC 4H44B 3CPWO 3LIEA 3OW2O 2YNYA 1NKZB 2BCCE 3SWYA 2KI7B 1VQ6P 1BE3J 3AE6C 1DD3A 2RMZA 1Q82Q 2WSFJ 1EZVI 4JYCA 5AVYB 5CCHA 3HD7A 4K3AA 5APXA 1BSHA 3GHGC 3SWKA 2GA1A 3H1KD 2BCCG 2JWDA 1Q86Q 1NTKJ 4KT0J 3VMAA 3L70J 4ZMDA 2WITA 4GOFA 1SQXK 3AEFC 2ZXEB 1SQPJ 3D6ZA 1YBKA 1OW7A 2IYOA 1JOCA 3RL0D 2SPZA 1S9KD 2XNDH 3L75J 1HGZA 3P32A 1FJPA 3B5NC 2YIUC 1OX3A 3CX5D 1IFIA 2K9JA 3WMM0 3V2RA 1RF0A 2KLUA 2W6AA 1JY3P 1DEEG 2LKMA 1G1IA 1MV8A 2WPSA 1GU4A 4GDOA 3EFFK 2C0XA 1KQSO 5H2FE 1J1EC 3L72D 4BXLA 4KHXA 1M57D 2G8YA 2FXPA 1N8RQ 5AVRB 1LT9A 2Y0EA 1HUCA 2N1TB 4H0LC 3O6QB 2WPVB 3IN6A 2O01N 4H44D 3HTKB 3GF7A 3TGUD 2O1JA 2LR2A 3VN0A 1H0TA 2P10A 3Q1MA 3S9OA 2C9LY 2QM8A 3IF4A 2E43A 5AW5B 1MFTA 2QE7H 1FZCC 1IFNA 1NU1D 1VF5B 5KAIH 1U57A 4LC1A 1KQLA 3HRNA 3L4FA 2WSCH 2Q7CA 3C9IA 2PRRA 2A06E 5CCGC 3WUVA 1SQXJ 5KTBA 5GTIE 4M3LA 1VL2A 3UIAA 1U7JA 2ZFCA 4KJMA 1GW3A 2BEZF 4QMAA 5AVSB 1FDMA 5AW7B 5CJ4A 1YYCA 3CMAP 4ZNCA 3R2PA 1BGYD 2XU6A 2QVAA 1UIIA 1URQC 2A06G 2O1KA 4ZKPA 3NTNA 2VRSA 4GOEA 1XTGB 2OYHC 4ZKUA 1BCCJ 3BVHA 3IFMA 3W68A 5KLVD 3L35A 2NPSB 1LP1B 2WTYA 2WVRA 2W8ZA 1Y9BA 2IBZE 1R5SA 2ZVNB 1YTZI 3OJAB 1VQ5P 2H88C 3VOPA 1LJ2A 2FFDB 1LTSC 2YXRB 2K3RA 1FZBA 2AEJA 1FZFA 3PLNA 1L4AA 4HB1A 2N1TD 3B8EB 1KB9I 3L73E 4NPDA 4AQRD 3V4QA 3RL0C 2QJYC 3B4SA 2YO2A 2IBZG 1U7MA 4TLFA 2KS1B 1HJBA 1RH5B 3USSA 4N3YB 2IPPA 1OFCX 2QG4A 2ZJSE 2IZ1A 4PD4E 3PP5A 2Z4EA 2OYIA 3L73G 4U7JA 2POHA 1VF5D 4WB4A 2HLOA 1EZVD 3N4XA 3RK3B 2R5BA 3CCUP 1RF1B 4GODA 5KJ7D 1AV1A 3WUUA 4UB6E 4YTPC 1JY2O 3HE5B 4H44C 1LTTC 1ZLLA 1E79H 2QM7A 2BASA 2XKMA 1UIXA 1AA0A 1LWUA 2Y9YA 1QL2A 3H1HG 3TYYA 2M5AA 1YJNP 4LGDE 1JB0J 1VQMP 2NPSD 2LXBA 3GHGB 1OVUA 2P1JA 3SWFA 1NTME 2IBZD 1KD1Q 1L0LE 1KYOH 2GM4A 1GL2A 1GMJA 1J1DB 5CHXA 1Q2NA 1M1JC 1PP9D 2E5YA 3H1LE 1EDLA 1HTLC 1PGJA 2FYZA 3EWKA 3V4WA 2BCCJ 1NTMG 1QX8A 1L0LG 3BRTB 2OTLP 1IJDB 1Q81Q 4JF7A 2RN0A 1HH0A 1R5LA 2YIUB 3B5NB 4N6JA 3G6EP 2Z5IA 1NGMB 3I56P 3H1LG 4WY4A 3CL3D 2MKVA 4IOIH 4TT3H 1KILA 5AVUB 1AJYA 3P7KA 3KYQA 2RH0A 3A3YB 3A0BH 2H89C 2HR3A 3RK3D 1J1EB 4C7NB 2H43A 3MUDA 1NTKD 4JYBA 3Q3DA 1S5LH 2FYUK 3L70D 5APWA 2N1TC 2V7QJ 1XTCC 1SQPD 3H1JE 2OGUA 3CMEP 3QH9A 3L75D 3CC4P 5KAIE 1J2JB 2P2UA 1LTJB 1OVRA 3WU2H 3CCJP 1YJ9P 1FZCB 1VF5C 3E1RA 1NTMD 5AW4B 1SFCB 3CCLP 3H1JG 1R8EA 3A5TA 3M9QA 3FGAD 2YO3A 4W7YA 5AVQB 3TNUA 3JC22 1S1CX 4BWNA 2KNCA 5TISH 2N9YB 1FZAA 1KORA 3RL0g 1E5WA 1PPJE 3HUSA 4DOJA 1K8AQ 5GTIH 1NO4A 1KB9D 1DIPA 1URQB 2M0BA 2R5DA 3KPEA 3OA7A 2OYHB 3S4RA 2K1AA 3B5ND 4C7RA 1LNQA 3CCEP 1PPJG 1OXZA 1X22A 2JWAA 3TDKA 2OYOA 2HPCB 1S72P 1NAYA 1ZR2A 2P67A 1SQXD 4L75A 1K9MQ 3BCCE 1SQQK 1HGVA 2WT7A 3RL0B 3D71A 2J59M 3H6PA 1HVVA 3Q2YA 1JMMA 1SLQA 1JEKA 1ZRTE 1IFJA 1BCCD 4R4MA 1SFCD 5AW8B 1L0LK 2A45H 2MJZA 5KLIB 3LW5J 5K5GB 4W80A 3TK1A 3L73J 1FAVA 4YPCA 3PTZA 4EYYQ 1EQ7A 2W6JH 2GUSA 1NHLA 1DD4A 5KAFE 2KP8A 4OGQB 2E75B 2KB7P 3BATA 3P8MC 1JTHA 1URQD 3JCUH 4WBAA 3CWBE 1WT6A 2JR8A 1N73A 1KYOE 3A7OA 1KV4A 3BRVB 3MHVA 1VQ8P 1LTBC 4NPEA 5AVWB 2QIWA 1SQVE 1FZEA 3G4SP 3SFEC 2KXPB 1J1DC 1M1JB 4DZOA 1EXIA 3CWBG 3BCCD 4B86A 1S5LX 3F89A 2R44A 1RHZB 1WMKA 2M3EA 4U3FE 5CCGA 1CZQA 1SQVG 3H32B 5TJHA 2YMYA 3CCVP 2OTKE 2K9YA 4ASVA 1M8OB 1ZRTD 2IBZI 1PV3A 1FDIA 3CCQP 1A02F 1NTMJ 3A0BE 1SQBG 4U3FG 1L0LJ 4AYCA 2WPQA 1IFDA 1S5LE 1DX7A 3H1LJ 3AE7C 4Z1MH 1RE3C 3SSUA 2FYNB 4Y99B 3SFDC 3FXEA 2YKOA 2O3JA 2RKLA
chains in the Genus database with same CATH topology
4I6MC 4WB4A 2HLOA 3N4XA 1JCDA 1IK9A 1GU5A 3VTPC 4EOTA 1KFMA 3CLQA 1YTZT 3RK3B 2R5BA 2XDJA 1NAFA 1N73B 1FZGA 2KYVA 1IO4A 1LTJC 1RF1B 3G3ZA 5KJ7D 4N78D 5APUA 4C7NA 2KLVA 3HUSC 3O8ZA 4IFFA 2WSFH 2YKQA 1SFCC 1DEBA 1JY2O 3HD7C 3HE5B 3RK2C 1LTTC 1ZLLA 3V2QA 4O9BA 1H89A 2QM7A 1T8ZA 2BASA 2KOGA 2XKMA 1NH4A 4OH8B 1G1JA 3MIWA 3I5CA 2FXMA 1FBMA 1LWUA 1QL2A 5KJ7C 3TYYA 5AVTB 1Z56A 1LTJA 4RESB 1G2CA 4LGDE 1T2KC 1X8YA 5CMZA 2NPSD 3EQ2A 3GHGB 1FZCA 5AW6B 1RE4C 2P1JA 1LTAC 3SWFA 5AW0B 1CI6B 1KFNA 1SFCA 1H8AA 2GM4A 1GL2A 2P7JA 1J1DB 5CHXA 2HFED 1FOSE 1M1JC 5BU8B 1L4AB 1KILC 1OWAA 1HTLC 2YKPA 1AQ5A 1CSBA 1LGHB 1RF0C 2C9NY 1MZ9A 2FYZA 3CI9A 1N86A 3V4WA 2W6BA 3P8CD 4IFDK 3E1IA 2NPSC 1GW4A 3BRTB 4AUWA 1IJDB 1NKNA 4JF7A 3EFGA 1N7SB 1HH0A 1N2DC 2I1JA 3B5NB 1QL1A 4N6JA 1URQA 3VMXA 2OYIB 2Z5IA 4WY4A 1GTWA 3CL3D 4XA4A 2FFDC 2OYHA 1NTKK 1KILA 5AVUB 3P7KA 3M91A 3KYQA 1JY2N 2R3CA 2O01H 3A3YB 3LW5H 3V2NA 2HPCA 1ZV8A 3RK3D 1J1EB 3MGNA 4C7NB 1FJKA 2H43A 3MUDA 4JYBA 1GK6A 2C0WA 2FYUK 3M0DC 1SP4A 3L37A 5APWA 2N1TC 1T3UA 1XTCC 2L5GB 3VMYA 2A45I 1SQVK 2E42A 3MTUE 1NTMK 2N9BA 1LWUB 2JJLA 3M06A 5AW2B 3RK3C 3TSIA 4HH2A 1WRGA 4I1LA 1RE3A 2HODA 1N73C 1J2JB 1IC2A 1LTJB 2P2UA 5APVA 1G2CB 5CCGD 2A45G 1RF1C 1X9VA 5CCHC 1SQBK 1FZCB 4HYTB 2R32A 3NXSA 5AW4B 1SFCB 2HG5D 3HE4A 1GL2B 5AW9B 1JNMA 3M0DA 5BU5A 3A5TA 1T3JA 3KQGA 3M9QA 1HWTC 3RK2B 1FOSF 2N1TA 3MD0A 3LIEA 1CW5A 1LTGC 2IFMA 2YNYA 2YO3A 1NKZB 4W7YA 5AVQB 3TNUA 3SWYA 3HTKA 3VP8A 1L4AD 3NFQA 1W2EA 1FZAA 1JY3N 1E5WA 1VPCA 3HUSA 4DOJA 1NO4A 4JYCA 1M7LA 2GUVA 5AVYB 5CCHA 3HD7A 5APXA 5AVVB 3GHGC 2PAJA 2WSEH 2I1KA 1URQB 2Q3IA 2R5DA 4WY4B 3KPEA 2XZRA 1N7SD 3OA7A 2OYHB 3B5ND 3N7NA 4C7RA 1KILB 2WITA 1OXZA 5KJ7A 1SQXK 3V5BA 2HPCB 2ZXEB 1JOCA 1RE4A 3RL0D 2CPBA 1S9KD 1ZR2A 1GDTA 2P67A 1LT9C 1HGZA 3P32A 1M1JA 1FU1A 1FJPA 1SQQK 1HGVA 3B5NC 2WT7A 1NOHA 2WWWA 4W7ZA 1DH3A 1IFIA 3WMM0 3A2AA 3V2RA 3M0AA 5AVXB 1RF0A 2M8RA 3RL0B 2W6AA 3U59A 3BASA 1JY3P 1JO5A 2LKMA 2J59M 1GD2E 1G1IA 1MV8A 3H6PA 2WPSA 1HVVA 2HODB 1JMMA 1GU4A 2NPSA 2WZ7A 3H32A 2C0XA 1J1EC 5APYA 4Y99C 3P8CE 4KHXA 1NTZK 1SLQA 3OAKA 3HE4B 5AVRB 1IFJA 1LT9A 1HUCA 2N1TB 1JCCA 3IR9A 2FFDA 1SFCD 2IFNA 1GL2D 2H8PD 5AW8B 3U1AA 5AVZB 1L0LK 3RK2D 3TNUB 3HTKB 2A45H 2MJZA 2O1JA 1NU1K 3VN0A 2Q5UA 1LWUC 4W80A 3HUSB 3TK1A 1FAVA 5AW1B 1IFMA 3U1CA 1EQ7A 1L0NK 2C9LY 2QM8A 2E43A 3HD7B 5AW5B 1LTIC 2GUSA 1NHLA 1FZCC 1IFNA 3NMDA 2J58A 1T2KD 2KP8A 2XV5A 4LC1A 1GL2C 1JY2P 1KQLA 2KB7P 3BATA 3P8MC 1JTHA 3HRNA 3L4FA 2WSCH 5APTA 2Q7CA 1URQD 1A02J 3C9IA 4WBAA 4WY4D 1WT6A 5CCGC 1H88A 4EIJA 5KTBA 1HBWA 1N73A 2XNXA 1KILD 4M3LA 1RY3A 3A7OA 4N78E 1RF1A 3UIAA 3II6A 4GIFA 2ZFCA 3BRVB 1GW3A 1LTBC 5AVWB 2KSJA 5AVSB 1FDMA 4C46A 5AW7B 1FZEA 5CJ4A 1YYCA 5CJ0A 3R2PA 1J1DC 2JEEA 2CPSA 2XU6A 3HE5A 1X79B 5KLVK 1M1JB 2IX7C 4DZOA 1MUUA 2WT7B 1GZLA 1URQC 2O1KA 1L4AC 4ZKPA 3NTNA 4B86A 4WY4C 2VRSA 1PFIA 1XTGB 2OYHC 4ZKUA 2M3BA 3VP9A 4GT1A 2Z5HA 2W27A 1SVFA 5CCGA 3BVHA 3IFMA 3L35A 5APQA 2NPSB 1CZQA 1N7LA 4LLHA 3H32B 2HYNA 1GK4A 2WTYA 2YMYA 4XE5B 5APSA 3GHGA 1NWQA 1ZN5A 3KDPB 1N7SC 3VMZA 1AFOA 1CI6A 1YTZI 1JUNA 2OYIC 3OJAB 2FKWB 1LT9B 3VOPA 3LIDA 2FFDB 3T97A 1LTSC 1A02F 1FZBA 3VYIA 1FZFA 1JY3O 1L4AA 4GKGA 2N1TD 4AYCA 3B8EB 2Q9IA 4AQRD 2WPQA 1IFDA 3M9HA 1ZR4A 2H7HA 3V4QA 3RL0C 2OARA 1MFZA 2WPRA 2YO2A 1DX7A 1HJBA 3L36A 5AW3B 4IFMA 1RE3C 4N3YB 2IPPA 2PP6A 1SQPK 4Y99B 3M9BA 1N7SA 1S9KE 5CCHD 3HD7D 3PP5A 1KZUB 3B5NA 2Z4EA 1VDFA 2YKOA 5BVZA 2OYIA 3V2PA 2POHA 4I2LC 1JTHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6M C;  5APT A;  2Q7C A;  1A02 J;  1GU5 A;  3VTP C;  4EOT A;  5AVU B;  1OXZ A;  2R5B A;  3P7K A;  3M91 A;  1H88 A;  1NAF A;  1HBW A;  2R3C A;  1IO4 A;  3V5B A;  3A3Y B;  4M3L A;  2ZXE B;  3A7O A;  3UIA A;  2ZFC A;  3MGN A;  4C7N B;  5APU A;  4C7N A;  3O8Z A;  4JYB A;  1GK6 A;  5AVW B;  1S9K D;  5AVS B;  4C46 A;  1SP4 A;  5AW7 B;  2P67 A;  1YYC A;  3L37 A;  5APW A;  3HE5 B;  2XU6 A;  3HE5 A;  1H89 A;  3P32 A;  4DZO A;  1MUU A;  2WT7 B;  1GZL A;  2QM7 A;  2WT7 A;  2WWW A;  3NTN A;  3VMY A;  4B86 A;  1DH3 A;  2BAS A;  2E42 A;  2VRS A;  3A2A A;  3M0A A;  5AVX B;  2W6A A;  3I5C A;  4GT1 A;  2N9B A;  2Z5H A;  2JJL A;  2W27 A;  3M06 A;  5AW2 B;  1GD2 E;  1MV8 A;  2WPS A;  3L35 A;  5APQ A;  1GU4 A;  3TYY A;  5AVT B;  1J2J B;  1CZQ A;  2P2U A;  5APV A;  1G2C B;  1GK4 A;  4RES B;  2WTY A;  1T2K C;  5APY A;  1X8Y A;  5CMZ A;  4KHX A;  4XE5 B;  5APS A;  4HYT B;  5AW6 B;  1NWQ A;  3KDP B;  3SWF A;  3VMZ A;  1SLQ A;  5AW0 B;  2R32 A;  3NXS A;  3OAK A;  1CI6 B;  3HE4 B;  5AW4 B;  1CI6 A;  3HE4 A;  5AW9 B;  1JUN A;  1JNM A;  3M0D A;  2P7J A;  1H8A A;  3A5T A;  5AVR B;  3KQG A;  1HWT C;  3LID A;  1HUC A;  1FOS F;  3T97 A;  3IR9 A;  3MD0 A;  1A02 F;  3LIE A;  1FOS E;  3VYI A;  5AW8 B;  2YNY A;  2YO3 A;  4GKG A;  5AVZ B;  3TNU B;  4AYC A;  3B8E B;  5AVQ B;  3TNU A;  3HTK A;  1OWA A;  1CSB A;  4AQR D;  2WPQ A;  3M9H A;  2H7H A;  3V4Q A;  2C9N Y;  3VN0 A;  2Q5U A;  1MFZ A;  3NFQ A;  2WPR A;  2YO2 A;  3V4W A;  1HJB A;  3L36 A;  3TK1 A;  1FAV A;  5AW1 B;  5AW3 B;  2IPP A;  4JYC A;  2C9L Y;  2QM8 A;  5AVY B;  2E43 A;  5AW5 B;  4AUW A;  5APX A;  3M9B A;  3NMD A;  5AVV B;  1S9K E;  2KP8 A;  1T2K D;  2Q3I A;  2R5D A;  3VMX A;  2XV5 A;  2Z5I A;  4LC1 A;  2XZR A;  1KQL A;  1GTW A;  4I2L C;  3P8M C; 
#chains in the Genus database with same CATH topology
 4I6M C;  4OGQ D;  4PD4 I;  3WU2 E;  2E75 D;  3KHU A;  1JCD A;  1IK9 A;  1GU5 A;  3CLQ A;  3CWB D;  2B89 A;  2Q3E A;  2XDJ A;  4YXD C;  1FZG A;  1IO4 A;  1K04 A;  1LTJ C;  3G3Z A;  2G3A A;  5KKZ B;  1JMB A;  3O8Z A;  2B87 A;  1SFC C;  1LT1 A;  3HD7 C;  2AXT H;  4O9B A;  1L2P A;  4BRY A;  5TIS E;  1T8Z A;  3L71 E;  2FYU E;  4OH8 B;  4H13 C;  5B66 H;  4JQ0 D;  2BCC D;  3H1J J;  1NTZ E;  4L74 A;  1VQ4 P;  3R4Y A;  1G2C A;  3RBZ A;  5CMZ A;  1EDI A;  3CC7 P;  4PJ0 H;  1LTA C;  5DJT B;  1CI6 B;  1KFN A;  2P7J A;  3L71 G;  3T97 B;  2WSC J;  2FYU G;  5BU8 B;  1USD A;  1NTZ G;  3KZI H;  4RJT A;  2KSE A;  1AQ5 A;  1P84 H;  1LGH B;  2Y0C A;  1RF0 C;  2C9N Y;  1N86 A;  2KIK A;  2W6B A;  3E1I A;  1NKN A;  3EFG A;  1FC2 C;  1N7S B;  1N2D C;  1QL1 A;  2ZYG A;  1M56 D;  1YHQ P;  1GTW A;  1OIP A;  1QEX A;  4XA4 A;  1PGQ A;  2BEQ D;  2O01 H;  1YI2 P;  3TF5 A;  1ZV8 A;  1JM0 A;  1FJK A;  1GK6 A;  3V6I A;  1KMI Z;  2C0W A;  3M0D C;  3AEG C;  3CCS P;  2L5G B;  3VMY A;  1SQV K;  2A06 D;  2E42 A;  5KLI C;  3BCC J;  2FYU D;  2N9B A;  4YXW H;  4RO0 A;  2JJL A;  5AW2 B;  2QEX P;  3TSI A;  1WRG A;  1SQQ E;  2D2C B;  3H1H E;  5APV A;  3AE9 C;  2A45 G;  1SQB K;  3CX5 H;  3JCU E;  2HG5 D;  5AW9 B;  4OGQ C;  2E75 C;  3CCR P;  3KQG A;  3RK2 B;  2N1T A;  1YIT P;  3O6Q A;  5KAF H;  1CW5 A;  1BE3 G;  2IDB A;  1LTG C;  4K35 A;  2IFM A;  3FXD A;  3PH0 A;  3HTK A;  1SQQ G;  2ZAE B;  1KQG B;  1VQN P;  3AEE C;  2PAJ A;  2WSE H;  3CXH E;  4JPZ B;  2Q3I A;  1EXJ A;  1K73 Q;  1N7S D;  3L73 D;  1USE A;  3W67 A;  1QVG O;  3G9R A;  3PJS K;  5KJ7 A;  5L8R J;  1NYH A;  3CWB J;  3D6Y A;  1RE4 A;  1ZP0 C;  4HKZ H;  1OVV A;  2CPB A;  3E7K A;  1SS1 A;  4PD4 D;  2P58 A;  1X0T A;  1GDT A;  2WSE J;  2WQY C;  1NOH A;  1SQV J;  2WWW A;  1YIJ P;  1DH3 A;  4DJG A;  3M0A A;  2M8R A;  3U59 A;  3BAS A;  1IZN B;  1JO5 A;  4IL6 H;  2HOD B;  2NPS A;  4HJG H;  2WZ7 A;  1SQQ D;  3H1H D;  1LP1 A;  1SQB J;  3FWN A;  4U3F J;  2FYN C;  4Y99 C;  3P8C E;  2D2C D;  1S2E A;  1NTZ K;  1BDD A;  2KUB A;  3HE4 B;  3MZW B;  1JCC A;  3IR9 A;  2FFD A;  2H8P D;  4WWI A;  3RK2 D;  2FY8 A;  3KXD A;  1LWU C;  2AXT E;  5KKZ C;  2KS1 A;  5AW1 B;  1IFM A;  3RBX A;  1QVF O;  1L0N K;  1L0L D;  3HD7 B;  1PGO A;  2JKV A;  2J58 A;  5B66 E;  1GL2 C;  1JY2 P;  4I7Z B;  1Y8A A;  3GG2 A;  3H1L D;  5APT A;  1EDJ A;  4H13 B;  2OQQ A;  4Y28 J;  4PJ0 E;  1H88 A;  1TU3 F;  3FWL A;  2ZYD A;  4N78 E;  1RF1 A;  3F5H A;  1OW8 A;  1KYO I;  4D6T E;  3RGU A;  3AEB C;  1Q90 D;  3KZI E;  4UB8 H;  5CJ0 A;  3AE2 C;  2JEE A;  1P84 E;  2CPS A;  3HE5 A;  2B88 A;  2IX7 C;  2KZI A;  1MUU A;  1GZL A;  3A0H H;  3QWO C;  4WY4 C;  2K9J B;  1PFI A;  3JSV C;  3L74 E;  4GT1 A;  2Z5H A;  1SVF A;  1VQP P;  3L71 J;  4D6T G;  2FYU J;  4LLH A;  1GK4 A;  5APS A;  1NTZ J;  4RKU J;  3GHG A;  1ZN5 A;  3KDP B;  1N7S C;  3VMZ A;  1OMI A;  1LT9 B;  3LID A;  3H1J D;  3L74 G;  2K37 A;  3H1K E;  1JY3 O;  4EDF A;  3D70 A;  2Q9I A;  3G71 P;  5C39 A;  3M9H A;  2J5U A;  3K5B A;  2OAR A;  1MFZ A;  1H0T B;  2WPR A;  3L36 A;  1VQK P;  4DT0 A;  5AW3 B;  2PP6 A;  3H25 A;  1SQP K;  3H1K G;  1S9K E;  5CCH D;  3HD7 D;  1KZU B;  3B5N A;  1VDF A;  5BVZ A;  4I2L C;  2NRG A;  1NVO A;  3GLM A;  3C8V A;  1YTZ T;  3CX5 E;  4XFJ A;  1PPJ D;  1Y47 A;  4H13 D;  4OVN F;  2D2C C;  2ITA A;  4N78 D;  5APU A;  4C7N A;  2KLV A;  3HUS C;  2WSF H;  5EFW B;  3L72 E;  3RK2 C;  1H89 A;  3H1I E;  2AEM A;  2KOG A;  1AVY A;  3MIW A;  5DJU B;  3I5C A;  3L74 D;  1W2B O;  5B5E H;  1FBM A;  4PV1 C;  4WVZ A;  3TGU E;  2B9B A;  5AVT B;  3L72 G;  1LTJ A;  4RES B;  2W90 A;  1AVO A;  1FZC A;  4MN4 C;  5AW6 B;  3H1I G;  4IL6 X;  1SQQ J;  3H1H J;  1SFC A;  3AEC C;  1NU1 E;  1FOS E;  3CXH H;  2JDI H;  1SQB E;  1L4A B;  1IFP A;  3TGU G;  1OWA A;  2R3S A;  2IYP A;  3AE3 C;  1ZOY C;  1CSB A;  1QGK B;  1MZ9 A;  4IFD K;  5M1B A;  4NPF X;  1BDC A;  4AUW A;  3I55 P;  1NU1 G;  2QJP B;  1RQV A;  2I1J A;  1URQ A;  2OYI B;  4IL6 E;  1BGY E;  2WSS H;  2OYH A;  2YMK A;  3M91 A;  1KB9 H;  2HPC A;  3MGN A;  5KLV E;  2E76 B;  1SP4 A;  1BGY G;  5GTH H;  3L37 A;  5CBO A;  1T3U A;  3H1I D;  2A45 I;  1D7M A;  3MTU E;  1KYO D;  1LWU B;  1VQO P;  4JBZ A;  5KLV G;  3M06 A;  2E5T A;  4HH2 A;  2QRX A;  2M5A B;  1N73 C;  1K05 A;  1S3J A;  2QSI A;  1SQV D;  5CCH C;  2L91 A;  4HYT B;  2R32 A;  3NXS A;  2IZ0 A;  1GL2 B;  3M0D A;  4I7Z C;  1FOS F;  3MD0 A;  3AE5 C;  1OW6 A;  3CD6 P;  1SQB D;  4U3F D;  1ZXG A;  1KC8 Q;  3VP8 A;  1L4A D;  1EZV E;  3NFQ A;  4UB8 E;  1W2E A;  1JY3 N;  1VPC A;  1ZME C;  3A0H E;  1M7L A;  2GUV A;  1HF9 A;  5AVV B;  3AE1 C;  2I1K A;  4WY4 B;  2XZR A;  1EZV G;  3CXH I;  3N7N A;  1L0N E;  3B71 A;  1KIL B;  1KIL E;  2I8D A;  2QJK B;  2ZT9 B;  3V5B A;  2KK7 A;  1IK7 A;  1EDK A;  2KZJ A;  1LT9 C;  1RQU A;  2E76 D;  1L0N G;  1M1J A;  1FU1 A;  4D6T J;  4W7Z A;  2AXC A;  3A2A A;  1PP9 E;  5AVX B;  1VQL P;  1AQT A;  1GD2 E;  3L74 J;  3H32 A;  3ITK A;  5APY A;  4L76 A;  3GMA A;  3OAK A;  5E79 H;  1M1K Q;  1PP9 G;  2YXQ B;  2IFN A;  3L71 D;  1GL2 D;  1BE3 E;  3U1A A;  5AVZ B;  3TNU B;  1NTZ D;  2QA4 P;  2O01 J;  1NU1 K;  3H1K J;  2KNC B;  2Q5U A;  3HUS B;  3RK3 E;  3U1C A;  1PIX A;  3CC2 P;  1LTI C;  3FX0 A;  3Q5P A;  3NMD A;  1NTK E;  2FBW C;  2Q6Q A;  1T2K D;  5B5E E;  3L70 E;  2XV5 A;  2E74 B;  1A02 J;  1NJI Q;  1EC5 A;  4WY4 D;  1SQP E;  1L0N D;  4PV1 B;  4EIJ A;  1HBW A;  1BSN A;  2XNX A;  1KIL D;  3L75 E;  1RY3 A;  3II6 A;  4GIF A;  1NTK G;  2ZT9 D;  3L70 G;  2KSJ A;  4C46 A;  1Q7Y Q;  2AEF A;  5KLV K;  1X79 B;  1SQP G;  2WT7 B;  1L4A C;  3L72 J;  2PGD A;  1P84 I;  3L75 G;  2CK3 H;  2M3B A;  3H1I J;  3PHL A;  3VP9 A;  1S4X A;  3Q5R A;  2W27 A;  5APQ A;  1N7L A;  2HYN A;  4XE5 B;  3TGU J;  1NWQ A;  1AFO A;  2QJP C;  1CI6 A;  1JUN A;  2OYI C;  2FKW B;  1KB9 E;  1HJ0 A;  3T97 A;  2V7Q H;  3WUT A;  3VYI A;  2W83 C;  1BE3 D;  4GKG A;  1W5C E;  1NU1 J;  2H7H A;  1ZR4 A;  5GTH E;  2ZYA A;  4ASW A;  4CPG A;  4IFM A;  2WMM A;  2E76 C;  2JO1 A;  3M9B A;  3ABV C;  1N7S A;  3IAO A;  3CCM P;  1PGP A;  3V2P A;  5H2F H;  4H0L B;  1JTH B;  1SQX E;  1FDO A;  2E74 D;  3VTP C;  4EOT A;  1KFM A;  1BGY J;  1NAF A;  1N73 B;  2KYV A;  4PV1 D;  3CX5 I;  3PRJ A;  4IFF A;  2Q1K A;  3CXH D;  2YKQ A;  1DEB A;  1ZW0 A;  3Q5S A;  1YQ3 C;  1QLE D;  1SQX G;  5KLV J;  1KN7 A;  3V2Q A;  5CBN A;  1BCC E;  1M90 Q;  1NH4 A;  1G1J A;  2FXM A;  5KJ7 C;  2ZXX A;  1Z56 A;  1VQ7 P;  2NZ2 A;  1T2K C;  3MP7 B;  1X8Y A;  3EQ2 A;  1RE4 C;  1OZH A;  2PFX A;  5AW0 B;  1BCC G;  1H8A A;  2LXC B;  2Y0D A;  2HFE D;  3S1K A;  1KIL C;  1KTM A;  3AED C;  2YKP A;  4R4L A;  2QJK C;  2ZT9 C;  2OTJ P;  3GW6 A;  3CI9 A;  2UWJ E;  3P8C D;  3MUD C;  3ZDM A;  1KQF B;  2V4H A;  3AE8 C;  2NPS C;  3GF3 A;  1GW4 A;  1PL5 A;  1T6A A;  4DCK A;  3AEA C;  1YQ4 C;  2K88 A;  3VMX A;  4A7P A;  2FXO A;  2FFD C;  1NTK K;  4H0L D;  2Y9Z A;  1JY2 N;  2R3C A;  1L0N J;  3LW5 H;  3V2N A;  2QJY B;  5E79 E;  1VQ9 P;  2ZVO B;  1MKM A;  2JP3 A;  2B87 B;  3C1L A;  4BRY B;  1PZQ A;  3BCC G;  2DW3 A;  1NTM K;  4PD4 H;  1FS0 E;  4OWF A;  3RK3 C;  3AE4 C;  1FE6 A;  4I1L A;  1RE3 A;  1PP9 J;  2HOD A;  1YJW P;  1IC2 A;  1G2C B;  4D6T D;  5CCG D;  1RF1 C;  1X9V A;  1P84 D;  4EI2 A;  3HE4 A;  1JNM A;  4L73 A;  5BU5 A;  2E74 C;  1T3J A;  4UB6 H;  1HWT C;  4H44 B;  3CPW O;  3LIE A;  3OW2 O;  2YNY A;  1NKZ B;  2BCC E;  3SWY A;  2KI7 B;  1VQ6 P;  1BE3 J;  3AE6 C;  1DD3 A;  2RMZ A;  1Q82 Q;  2WSF J;  1EZV I;  4JYC A;  5AVY B;  5CCH A;  3HD7 A;  4K3A A;  5APX A;  1BSH A;  3GHG C;  3SWK A;  2GA1 A;  3H1K D;  2BCC G;  2JWD A;  1Q86 Q;  1NTK J;  4KT0 J;  3VMA A;  3L70 J;  4ZMD A;  2WIT A;  4GOF A;  1SQX K;  3AEF C;  2ZXE B;  1SQP J;  3D6Z A;  1YBK A;  1OW7 A;  2IYO A;  1JOC A;  3RL0 D;  2SPZ A;  1S9K D;  2XND H;  3L75 J;  1HGZ A;  3P32 A;  1FJP A;  3B5N C;  2YIU C;  1OX3 A;  3CX5 D;  1IFI A;  2K9J A;  3WMM 0;  3V2R A;  1RF0 A;  2KLU A;  2W6A A;  1JY3 P;  1DEE G;  2LKM A;  1G1I A;  1MV8 A;  2WPS A;  1GU4 A;  4GDO A;  3EFF K;  2C0X A;  1KQS O;  5H2F E;  1J1E C;  3L72 D;  4BXL A;  4KHX A;  1M57 D;  2G8Y A;  2FXP A;  1N8R Q;  5AVR B;  1LT9 A;  2Y0E A;  1HUC A;  2N1T B;  4H0L C;  3O6Q B;  2WPV B;  3IN6 A;  2O01 N;  4H44 D;  3HTK B;  3GF7 A;  3TGU D;  2O1J A;  2LR2 A;  3VN0 A;  1H0T A;  2P10 A;  3Q1M A;  3S9O A;  2C9L Y;  2QM8 A;  3IF4 A;  2E43 A;  5AW5 B;  1MFT A;  2QE7 H;  1FZC C;  1IFN A;  1NU1 D;  1VF5 B;  5KAI H;  1U57 A;  4LC1 A;  1KQL A;  3HRN A;  3L4F A;  2WSC H;  2Q7C A;  3C9I A;  2PRR A;  2A06 E;  5CCG C;  3WUV A;  1SQX J;  5KTB A;  5GTI E;  4M3L A;  1VL2 A;  3UIA A;  1U7J A;  2ZFC A;  4KJM A;  1GW3 A;  2BEZ F;  4QMA A;  5AVS B;  1FDM A;  5AW7 B;  5CJ4 A;  1YYC A;  3CMA P;  4ZNC A;  3R2P A;  1BGY D;  2XU6 A;  2QVA A;  1UII A;  1URQ C;  2A06 G;  2O1K A;  4ZKP A;  3NTN A;  2VRS A;  4GOE A;  1XTG B;  2OYH C;  4ZKU A;  1BCC J;  3BVH A;  3IFM A;  3W68 A;  5KLV D;  3L35 A;  2NPS B;  1LP1 B;  2WTY A;  2WVR A;  2W8Z A;  1Y9B A;  2IBZ E;  1R5S A;  2ZVN B;  1YTZ I;  3OJA B;  1VQ5 P;  2H88 C;  3VOP A;  1LJ2 A;  2FFD B;  1LTS C;  2YXR B;  2K3R A;  1FZB A;  2AEJ A;  1FZF A;  3PLN A;  1L4A A;  4HB1 A;  2N1T D;  3B8E B;  1KB9 I;  3L73 E;  4NPD A;  4AQR D;  3V4Q A;  3RL0 C;  2QJY C;  3B4S A;  2YO2 A;  2IBZ G;  1U7M A;  4TLF A;  2KS1 B;  1HJB A;  1RH5 B;  3USS A;  4N3Y B;  2IPP A;  1OFC X;  2QG4 A;  2ZJS E;  2IZ1 A;  4PD4 E;  3PP5 A;  2Z4E A;  2OYI A;  3L73 G;  4U7J A;  2POH A;  1VF5 D;  4WB4 A;  2HLO A;  1EZV D;  3N4X A;  3RK3 B;  2R5B A;  3CCU P;  1RF1 B;  4GOD A;  5KJ7 D;  1AV1 A;  3WUU A;  4UB6 E;  4YTP C;  1JY2 O;  3HE5 B;  4H44 C;  1LTT C;  1ZLL A;  1E79 H;  2QM7 A;  2BAS A;  2XKM A;  1UIX A;  1AA0 A;  1LWU A;  2Y9Y A;  1QL2 A;  3H1H G;  3TYY A;  2M5A A;  1YJN P;  4LGD E;  1JB0 J;  1VQM P;  2NPS D;  2LXB A;  3GHG B;  1OVU A;  2P1J A;  3SWF A;  1NTM E;  2IBZ D;  1KD1 Q;  1L0L E;  1KYO H;  2GM4 A;  1GL2 A;  1GMJ A;  1J1D B;  5CHX A;  1Q2N A;  1M1J C;  1PP9 D;  2E5Y A;  3H1L E;  1EDL A;  1HTL C;  1PGJ A;  2FYZ A;  3EWK A;  3V4W A;  2BCC J;  1NTM G;  1QX8 A;  1L0L G;  3BRT B;  2OTL P;  1IJD B;  1Q81 Q;  4JF7 A;  2RN0 A;  1HH0 A;  1R5L A;  2YIU B;  3B5N B;  4N6J A;  3G6E P;  2Z5I A;  1NGM B;  3I56 P;  3H1L G;  4WY4 A;  3CL3 D;  2MKV A;  4IOI H;  4TT3 H;  1KIL A;  5AVU B;  1AJY A;  3P7K A;  3KYQ A;  2RH0 A;  3A3Y B;  3A0B H;  2H89 C;  2HR3 A;  3RK3 D;  1J1E B;  4C7N B;  2H43 A;  3MUD A;  1NTK D;  4JYB A;  3Q3D A;  1S5L H;  2FYU K;  3L70 D;  5APW A;  2N1T C;  2V7Q J;  1XTC C;  1SQP D;  3H1J E;  2OGU A;  3CME P;  3QH9 A;  3L75 D;  3CC4 P;  5KAI E;  1J2J B;  2P2U A;  1LTJ B;  1OVR A;  3WU2 H;  3CCJ P;  1YJ9 P;  1FZC B;  1VF5 C;  3E1R A;  1NTM D;  5AW4 B;  1SFC B;  3CCL P;  3H1J G;  1R8E A;  3A5T A;  3M9Q A;  3FGA D;  2YO3 A;  4W7Y A;  5AVQ B;  3TNU A;  3JC2 2;  1S1C X;  4BWN A;  2KNC A;  5TIS H;  2N9Y B;  1FZA A;  1KOR A;  3RL0 g;  1E5W A;  1PPJ E;  3HUS A;  4DOJ A;  1K8A Q;  5GTI H;  1NO4 A;  1KB9 D;  1DIP A;  1URQ B;  2M0B A;  2R5D A;  3KPE A;  3OA7 A;  2OYH B;  3S4R A;  2K1A A;  3B5N D;  4C7R A;  1LNQ A;  3CCE P;  1PPJ G;  1OXZ A;  1X22 A;  2JWA A;  3TDK A;  2OYO A;  2HPC B;  1S72 P;  1NAY A;  1ZR2 A;  2P67 A;  1SQX D;  4L75 A;  1K9M Q;  3BCC E;  1SQQ K;  1HGV A;  2WT7 A;  3RL0 B;  3D71 A;  2J59 M;  3H6P A;  1HVV A;  3Q2Y A;  1JMM A;  1SLQ A;  1JEK A;  1ZRT E;  1IFJ A;  1BCC D;  4R4M A;  1SFC D;  5AW8 B;  1L0L K;  2A45 H;  2MJZ A;  5KLI B;  3LW5 J;  5K5G B;  4W80 A;  3TK1 A;  3L73 J;  1FAV A;  4YPC A;  3PTZ A;  4EYY Q;  1EQ7 A;  2W6J H;  2GUS A;  1NHL A;  1DD4 A;  5KAF E;  2KP8 A;  4OGQ B;  2E75 B;  2KB7 P;  3BAT A;  3P8M C;  1JTH A;  1URQ D;  3JCU H;  4WBA A;  3CWB E;  1WT6 A;  2JR8 A;  1N73 A;  1KYO E;  3A7O A;  1KV4 A;  3BRV B;  3MHV A;  1VQ8 P;  1LTB C;  4NPE A;  5AVW B;  2QIW A;  1SQV E;  1FZE A;  3G4S P;  3SFE C;  2KXP B;  1J1D C;  1M1J B;  4DZO A;  1EXI A;  3CWB G;  3BCC D;  4B86 A;  1S5L X;  3F89 A;  2R44 A;  1RHZ B;  1WMK A;  2M3E A;  4U3F E;  5CCG A;  1CZQ A;  1SQV G;  3H32 B;  5TJH A;  2YMY A;  3CCV P;  2OTK E;  2K9Y A;  4ASV A;  1M8O B;  1ZRT D;  2IBZ I;  1PV3 A;  1FDI A;  3CCQ P;  1A02 F;  1NTM J;  3A0B E;  1SQB G;  4U3F G;  1L0L J;  4AYC A;  2WPQ A;  1IFD A;  1S5L E;  1DX7 A;  3H1L J;  3AE7 C;  4Z1M H;  1RE3 C;  3SSU A;  2FYN B;  4Y99 B;  3SFD C;  3FXE A;  2YKO A;  2O3J A;  2RKL A; 
#chains in the Genus database with same CATH homology
 4I6M C;  4WB4 A;  2HLO A;  3N4X A;  1JCD A;  1IK9 A;  1GU5 A;  3VTP C;  4EOT A;  1KFM A;  3CLQ A;  1YTZ T;  3RK3 B;  2R5B A;  2XDJ A;  1NAF A;  1N73 B;  1FZG A;  2KYV A;  1IO4 A;  1LTJ C;  1RF1 B;  3G3Z A;  5KJ7 D;  4N78 D;  5APU A;  4C7N A;  2KLV A;  3HUS C;  3O8Z A;  4IFF A;  2WSF H;  2YKQ A;  1SFC C;  1DEB A;  1JY2 O;  3HD7 C;  3HE5 B;  3RK2 C;  1LTT C;  1ZLL A;  3V2Q A;  4O9B A;  1H89 A;  2QM7 A;  1T8Z A;  2BAS A;  2KOG A;  2XKM A;  1NH4 A;  4OH8 B;  1G1J A;  3MIW A;  3I5C A;  2FXM A;  1FBM A;  1LWU A;  1QL2 A;  5KJ7 C;  3TYY A;  5AVT B;  1Z56 A;  1LTJ A;  4RES B;  1G2C A;  4LGD E;  1T2K C;  1X8Y A;  5CMZ A;  2NPS D;  3EQ2 A;  3GHG B;  1FZC A;  5AW6 B;  1RE4 C;  2P1J A;  1LTA C;  3SWF A;  5AW0 B;  1CI6 B;  1KFN A;  1SFC A;  1H8A A;  2GM4 A;  1GL2 A;  2P7J A;  1J1D B;  5CHX A;  2HFE D;  1FOS E;  1M1J C;  5BU8 B;  1L4A B;  1KIL C;  1OWA A;  1HTL C;  2YKP A;  1AQ5 A;  1CSB A;  1LGH B;  1RF0 C;  2C9N Y;  1MZ9 A;  2FYZ A;  3CI9 A;  1N86 A;  3V4W A;  2W6B A;  3P8C D;  4IFD K;  3E1I A;  2NPS C;  1GW4 A;  3BRT B;  4AUW A;  1IJD B;  1NKN A;  4JF7 A;  3EFG A;  1N7S B;  1HH0 A;  1N2D C;  2I1J A;  3B5N B;  1QL1 A;  4N6J A;  1URQ A;  3VMX A;  2OYI B;  2Z5I A;  4WY4 A;  1GTW A;  3CL3 D;  4XA4 A;  2FFD C;  2OYH A;  1NTK K;  1KIL A;  5AVU B;  3P7K A;  3M91 A;  3KYQ A;  1JY2 N;  2R3C A;  2O01 H;  3A3Y B;  3LW5 H;  3V2N A;  2HPC A;  1ZV8 A;  3RK3 D;  1J1E B;  3MGN A;  4C7N B;  1FJK A;  2H43 A;  3MUD A;  4JYB A;  1GK6 A;  2C0W A;  2FYU K;  3M0D C;  1SP4 A;  3L37 A;  5APW A;  2N1T C;  1T3U A;  1XTC C;  2L5G B;  3VMY A;  2A45 I;  1SQV K;  2E42 A;  3MTU E;  1NTM K;  2N9B A;  1LWU B;  2JJL A;  3M06 A;  5AW2 B;  3RK3 C;  3TSI A;  4HH2 A;  1WRG A;  4I1L A;  1RE3 A;  2HOD A;  1N73 C;  1J2J B;  1IC2 A;  1LTJ B;  2P2U A;  5APV A;  1G2C B;  5CCG D;  2A45 G;  1RF1 C;  1X9V A;  5CCH C;  1SQB K;  1FZC B;  4HYT B;  2R32 A;  3NXS A;  5AW4 B;  1SFC B;  2HG5 D;  3HE4 A;  1GL2 B;  5AW9 B;  1JNM A;  3M0D A;  5BU5 A;  3A5T A;  1T3J A;  3KQG A;  3M9Q A;  1HWT C;  3RK2 B;  1FOS F;  2N1T A;  3MD0 A;  3LIE A;  1CW5 A;  1LTG C;  2IFM A;  2YNY A;  2YO3 A;  1NKZ B;  4W7Y A;  5AVQ B;  3TNU A;  3SWY A;  3HTK A;  3VP8 A;  1L4A D;  3NFQ A;  1W2E A;  1FZA A;  1JY3 N;  1E5W A;  1VPC A;  3HUS A;  4DOJ A;  1NO4 A;  4JYC A;  1M7L A;  2GUV A;  5AVY B;  5CCH A;  3HD7 A;  5APX A;  5AVV B;  3GHG C;  2PAJ A;  2WSE H;  2I1K A;  1URQ B;  2Q3I A;  2R5D A;  4WY4 B;  3KPE A;  2XZR A;  1N7S D;  3OA7 A;  2OYH B;  3B5N D;  3N7N A;  4C7R A;  1KIL B;  2WIT A;  1OXZ A;  5KJ7 A;  1SQX K;  3V5B A;  2HPC B;  2ZXE B;  1JOC A;  1RE4 A;  3RL0 D;  2CPB A;  1S9K D;  1ZR2 A;  1GDT A;  2P67 A;  1LT9 C;  1HGZ A;  3P32 A;  1M1J A;  1FU1 A;  1FJP A;  1SQQ K;  1HGV A;  3B5N C;  2WT7 A;  1NOH A;  2WWW A;  4W7Z A;  1DH3 A;  1IFI A;  3WMM 0;  3A2A A;  3V2R A;  3M0A A;  5AVX B;  1RF0 A;  2M8R A;  3RL0 B;  2W6A A;  3U59 A;  3BAS A;  1JY3 P;  1JO5 A;  2LKM A;  2J59 M;  1GD2 E;  1G1I A;  1MV8 A;  3H6P A;  2WPS A;  1HVV A;  2HOD B;  1JMM A;  1GU4 A;  2NPS A;  2WZ7 A;  3H32 A;  2C0X A;  1J1E C;  5APY A;  4Y99 C;  3P8C E;  4KHX A;  1NTZ K;  1SLQ A;  3OAK A;  3HE4 B;  5AVR B;  1IFJ A;  1LT9 A;  1HUC A;  2N1T B;  1JCC A;  3IR9 A;  2FFD A;  1SFC D;  2IFN A;  1GL2 D;  2H8P D;  5AW8 B;  3U1A A;  5AVZ B;  1L0L K;  3RK2 D;  3TNU B;  3HTK B;  2A45 H;  2MJZ A;  2O1J A;  1NU1 K;  3VN0 A;  2Q5U A;  1LWU C;  4W80 A;  3HUS B;  3TK1 A;  1FAV A;  5AW1 B;  1IFM A;  3U1C A;  1EQ7 A;  1L0N K;  2C9L Y;  2QM8 A;  2E43 A;  3HD7 B;  5AW5 B;  1LTI C;  2GUS A;  1NHL A;  1FZC C;  1IFN A;  3NMD A;  2J58 A;  1T2K D;  2KP8 A;  2XV5 A;  4LC1 A;  1GL2 C;  1JY2 P;  1KQL A;  2KB7 P;  3BAT A;  3P8M C;  1JTH A;  3HRN A;  3L4F A;  2WSC H;  5APT A;  2Q7C A;  1URQ D;  1A02 J;  3C9I A;  4WBA A;  4WY4 D;  1WT6 A;  5CCG C;  1H88 A;  4EIJ A;  5KTB A;  1HBW A;  1N73 A;  2XNX A;  1KIL D;  4M3L A;  1RY3 A;  3A7O A;  4N78 E;  1RF1 A;  3UIA A;  3II6 A;  4GIF A;  2ZFC A;  3BRV B;  1GW3 A;  1LTB C;  5AVW B;  2KSJ A;  5AVS B;  1FDM A;  4C46 A;  5AW7 B;  1FZE A;  5CJ4 A;  1YYC A;  5CJ0 A;  3R2P A;  1J1D C;  2JEE A;  2CPS A;  2XU6 A;  3HE5 A;  1X79 B;  5KLV K;  1M1J B;  2IX7 C;  4DZO A;  1MUU A;  2WT7 B;  1GZL A;  1URQ C;  2O1K A;  1L4A C;  4ZKP A;  3NTN A;  4B86 A;  4WY4 C;  2VRS A;  1PFI A;  1XTG B;  2OYH C;  4ZKU A;  2M3B A;  3VP9 A;  4GT1 A;  2Z5H A;  2W27 A;  1SVF A;  5CCG A;  3BVH A;  3IFM A;  3L35 A;  5APQ A;  2NPS B;  1CZQ A;  1N7L A;  4LLH A;  3H32 B;  2HYN A;  1GK4 A;  2WTY A;  2YMY A;  4XE5 B;  5APS A;  3GHG A;  1NWQ A;  1ZN5 A;  3KDP B;  1N7S C;  3VMZ A;  1AFO A;  1CI6 A;  1YTZ I;  1JUN A;  2OYI C;  3OJA B;  2FKW B;  1LT9 B;  3VOP A;  3LID A;  2FFD B;  3T97 A;  1LTS C;  1A02 F;  1FZB A;  3VYI A;  1FZF A;  1JY3 O;  1L4A A;  4GKG A;  2N1T D;  4AYC A;  3B8E B;  2Q9I A;  4AQR D;  2WPQ A;  1IFD A;  3M9H A;  1ZR4 A;  2H7H A;  3V4Q A;  3RL0 C;  2OAR A;  1MFZ A;  2WPR A;  2YO2 A;  1DX7 A;  1HJB A;  3L36 A;  5AW3 B;  4IFM A;  1RE3 C;  4N3Y B;  2IPP A;  2PP6 A;  1SQP K;  4Y99 B;  3M9B A;  1N7S A;  1S9K E;  5CCH D;  3HD7 D;  3PP5 A;  1KZU B;  3B5N A;  2Z4E A;  1VDF A;  2YKO A;  5BVZ A;  2OYI A;  3V2P A;  2POH A;  4I2L C;  1JTH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...