1FAVA

The structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
78
structure length
78
Chain Sequence
IEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an HIV-1 specific cell entry inhibitor in complex with the HIV-1 gp41 trimeric core.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 ENVELOPE PROTEIN CHIMERA
total genus 35
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2000-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1favA00
2E42A 4JYCA 4C7NB 2Z5HA 2R3CA 5AW9B 1OWAA 4B86A 4GKGA 3P7KA 2E43A 1HUCA 1CI6A 1HWTC 4LC1A 1MUUA 2ZXEB 3VMYA 3UIAA 3VMZA 3KQGA 4AQRD 3A7OA 3OAKA 5AVQB 5AW5B 1GU5A 3M91A 3NFQA 4KHXA 3HE4B 3P8MC 1GU4A 3NMDA 1JNMA 5APXA 5AVYB 1T2KC 3P32A 5AW1B 5AW6B 3A5TA 5AW3B 4I2LC 1NWQA 2Q7CA 1S9KE 5AVZB 5AVWB 1CSBA 5CMZA 1MV8A 1GK6A 3A3YB 2W6AA 3HE4A 3I5CA 3VN0A 3SWFA 3M06A 5APQA 2P2UA 5APVA 5AW7B 1HBWA 1A02F 1JUNA 3T97A 2BASA 5AW8B 1GZLA 3V4WA 3VTPC 2H7HA 4HYTB 5AVXB 2YNYA 4JYBA 4DZOA 2Z5IA 2P67A 1GTWA 1X8YA 2Q5UA 3M9HA 3MD0A 5AW2B 2XV5A 5AVSB 2WT7B 1H89A 2ZFCA 3TNUB 3HE5A 5APTA 3TYYA 4AYCA 2R5DA 5AVUB 2WWWA 2R32A 1HJBA 5APYA 2C9LY 2WTYA 3HE5B 1T2KD 2YO2A 2WPQA 3LIDA 5AVTB 2XZRA 3M0AA 2QM8A 1MFZA 3NTNA 5APWA 2C9NY 5AW4B 1FAVA 2WPSA 4GT1A 4C7NA 1H88A 3IR9A 2QM7A 2WPRA 4EOTA 1GD2E 3O8ZA 2XU6A 1KQLA 3VYIA 2WT7A 2KP8A 5APUA 2Q3IA 4C46A 1S9KD 1SP4A 3V4QA 3M9BA 1H8AA 1YYCA 2R5BA 3LIEA 3NXSA 1CZQA 1J2JB 2JJLA 3M0DA 5AW0B 4I6MC 1FOSF 1DH3A 3B8EB 4RESB 3L36A 5AVRB 3V5BA 1IO4A 1A02J 3KDPB 1OXZA 1NAFA 1GK4A 2P7JA 2IPPA 2N9BA 3TNUA 4M3LA 3L35A 2VRSA 3L37A 3MGNA 5APSA 4AUWA 2YO3A 5AVVB 1FOSE 3TK1A 3A2AA 1CI6B 1SLQA 3HTKA 1G2CB 2W27A 3VMXA 4XE5B
chains in the Genus database with same CATH superfamily
1J1EC 1Y47A 3H1JG 3MUDC 2E42A 3D6YA 1EDLA 1KFMA 3L74G 4H0LC 4U3FJ 3L73J 5B5EH 3AECC 1K8AQ 1PPJE 1RY3A 1SQVK 2R3SA 1U57A 2YKQA 1SQPE 1MUUA 3B5NB 1QLED 3CCLP 1QGKB 2ZYGA 3L73D 2IBZD 2JP3A 4O9BA 1PGQA 3V6IA 5H2FE 3CCMP 1FDMA 5AW5B 1BGYJ 3O6QA 3BCCJ 3U59A 2ZT9C 3EWKA 1OFCX 3HE4B 2FFDC 3CC4P 3H32A 1HJ0A 1NVOA 1NTKK 1URQA 3V2PA 5AVYB 1JNMA 2NPSD 2RKLA 2FY8A 1X9VA 4WB4A 1HH0A 1TU3F 1KD1Q 1IJDB 4H0LD 1FZCC 1RF0C 2HODB 2WPVB 1H0TB 4XA4A 1SQXK 2B87B 4YTPC 5AVZB 1RF0A 1K73Q 2YXRB 1GMJA 1MZ9A 3A3YB 3P8CE 4RKUJ 1YBKA 3AE9C 1G1JA 2O1JA 3M06A 1VQ8P 3U1CA 1WT6A 1GW3A 1A02F 1LWUB 1JUNA 5DJTB 5CCGC 1N2DC 3E1RA 1SQQG 3T97A 1JO5A 3G9RA 3H1KE 1LTJB 4WY4A 1PV3A 2BASA 5AW8B 2CK3H 1KILA 1ZR4A 1JY2P 1NKNA 1LT9A 2QJYB 3P8CD 2KYVA 4HYTB 3WUTA 4OH8B 4N6JA 2WSFH 5AVXB 1LTAC 1IK9A 1JMMA 4CPGA 2Z5IA 1OW6A 2P67A 4MN4C 2XDJA 1X8YA 1BGYG 1YTZI 1LTJA 3M9HA 4K3AA 4WY4B 4DCKA 3CX5H 5AVSB 2KUBA 1SQVD 1GL2C 2ZXXA 3FWLA 3MHVA 3VP9A 3Q5SA 2FYNC 1H89A 3LW5J 1EXIA 3TF5A 3I55P 3RL0C 4YXWH 1N73B 1RE4A 4RJTA 3A0BE 1VQNP 2R32A 1N7SD 2WITA 2QIWA 3AEEC 3JSVC 3L70J 1AV1A 4U3FD 4DOJA 3QH9A 1HJBA 1K04A 3BCCD 4H13B 1T2KD 2WVRA 3GLMA 2WPQA 1RQVA 2QRXA 3LIDA 3QWOC 2W6BA 2PRRA 5AVTB 1P84I 3L71E 2XZRA 2YIUC 2YMYA 1LT9C 1SQQE 2BEQD 2IZ1A 4WVZA 2KK7A 2OYIC 2N1TB 3H1KG 2Y9YA 1OIPA 1VF5C 3RK2C 3S4RA 1NTKE 1P84E 1OX3A 1SQBK 2KIKA 2NZ2A 2KS1A 5C39A 1Q86Q 1RE3C 2QM7A 3PH0A 4Z1MH 3B5ND 3O8ZA 2XU6A 4H44B 4M3LA 1LTSC 1BCCD 2WT7A 1PP9J 2K9JA 2KP8A 1S9KD 4C46A 1N8RQ 1YQ3C 1VQMP 2ZYDA 1SQXD 1SVFA 1OW8A 3AE4C 2OYHB 3D70A 2R5BA 3G3ZA 3NXSA 4OGQC 2E74D 1DIPA 3WU2H 5CBOA 2KSEA 3HD7D 1X79B 1NU1D 2NPSB 1OVVA 2E75B 3A0BH 3GF3A 4JPZB 1EDJA 1RHZB 2NRGA 2SPZA 3JCUE 4LGDE 5AW0B 3MZWB 3H1JE 4L76A 4I6MC 5BU8B 1M1JA 1L0NK 1LP1B 2I8DA 5AVRB 1DH3A 1L0NJ 2GUSA 5KAIH 1WMKA 4U7JA 1SQPG 3SWKA 1URQB 2P7JA 2NPSA 4UB6E 2M8RA 3L73G 1IFNA 4R4LA 4BWNA 3SFEC 2WSCH 2V7QJ 1YITP 1KMIZ 1ZW0A 1SQPJ 2KOGA 1FZGA 2IPPA 2N9BA 3C8VA 1KILE 1SQBE 1ZLLA 1SQPK 2K3RA 2YKPA 3L35A 1JCDA 2B89A 3CXHD 3MGNA 1W2BO 2HODA 3H1JD 1K05A 3VOPA 1S5LH 2AEJA 3Q1MA 3H1LD 1R8EA 1CI6B 1SLQA 3PHLA 3USSA 1G2CB 1HF9A 1BGYD 5B5EE 3CL3D 2E75C 4IL6E 2NPSC 3Q5RA 1SQBJ 2HPCB 1PZQA 2M0BA 1VQ6P 4WY4D 2B87A 4OGQB 5AW9B 1JY3N 2YKOA 3P7KA 1Y9BA 1AVOA 1JMBA 2AXTH 1HUCA 3OJAB 3Q3DA 1CI6A 3KZIH 4KJMA 2I1JA 1OZHA 3VMYA 1HWTC 1VQ7P 1AVYA 3UIAA 3VMZA 5KLVE 1FJPA 1LNQA 1M1KQ 3B5NC 1VQKP 3A7OA 1GDTA 3CC7P 3BASA 2WMMA 3F5HA 4IOIH 2V7QH 1BGYE 4HH2A 5GTIH 3NFQA 5KAFH 1GU5A 1VQ4P 1FS0E 3P8MC 4UB6H 3RK2B 1NTKD 2O01H 4PD4I 1GU4A 2A06G 3OW2O 5APXA 1X22A 2M3BA 3D6ZA 1LT9B 1T2KC 2YIUB 1G2CA 5AW1B 3V2NA 2OYIB 5AW6B 1PGPA 2IYPA 2KLUA 3L74D 1PP9D 4Y99B 1EQ7A 1RE3A 3RBZA 3WUUA 5B66H 4PD4E 2KS1B 3GW6A 5KJ7D 4H13C 4GOEA 2O01J 4OWFA 3TGUD 1Y8AA 1PPJG 1BE3E 2FXPA 2ZAEB 3RBXA 3VN0A 2JWAA 3CI9A 3HD7A 4QMAA 4W7YA 3SWYA 1NU1E 1BSNA 1S1CX 1GL2D 2HFED 2P2UA 4H44D 5APVA 5TISH 2FYNB 1Z56A 4N78E 1JEKA 1NTMJ 4UB8H 2FYZA 1IFIA 3KZIE 1L0ND 1SFCD 4IFMA 2IBZE 3II6A 4YXDC 4HKZH 1KB9I 1FC2C 2FYUG 1GZLA 2P1JA 3HD7C 3V4WA 3S1KA 4ZNCA 3H1LJ 1L0LJ 1NTZJ 1ZRTD 3I56P 1HTLC 2E75D 4JYBA 2KZIA 4TT3H 3G71P 2Q5UA 2XKMA 3MD0A 4RO0A 1EZVD 1LTJC 5K5GB 2ZFCA 5B66E 1RF1B 1NYHA 3H1LE 3HE5A 5APTA 3L4FA 5CJ4A 1LTBC 1KYOD 2JDIH 3CCVP 3H32B 1R5LA 1N7SA 4EYYQ 1QVGO 2C9LY 1UIXA 2IX7C 2K9JB 3H1HE 1YJ9P 1M1JB 1W5CE 3HE5B 5CCGA 2Y9ZA 1DD4A 1FZCB 2K9YA 1FJKA 1SQVJ 1YTZT 1ZV8A 3BATA 2ITAA 1U7JA 1SQXE 3NTNA 1VQPP 1IZNB 1LT1A 4NPFX 1NTKJ 5H2FH 2KNCB 3L70D 2J59M 2AEMA 2LR2A 2O1KA 4AYCA 2M5AB 1H0TA 3H1LG 1IFDA 4EOTA 3B5NA 1KQLA 3L72D 2FYUJ 3L75D 3ZDMA 5BU5A 2WSEH 2J58A 2KSJA 3RGUA 3IN6A 2YXQB 2G3AA 1SQBG 3HRNA 2E5TA 5KLVK 2QEXP 1M90Q 1M57D 2HPCA 2OYHA 2K88A 3ABVC 4BXLA 1JCCA 1FZBA 5TJHA 3GHGB 2QVAA 3BVHA 1CZQA 1J1EB 1P84D 2BCCG 2P10A 2E5YA 1YJWP 1KB9E 4PV1C 1KILB 3CWBG 3H1JJ 5KLIC 3AEDC 1IO4A 1JY2N 1L2PA 1LP1A 3AEAC 4GODA 2Q1KA 4PV1B 3SFDC 1KC8Q 3RL0D 1YI2P 1VQ9P 1AJYA 3KPEA 3B71A 1EDIA 2BCCJ 1SQQD 1PFIA 4W80A 1JY3P 1L0NG 1PIXA 2N9YB 2I1KA 3OA7A 5DJUB 1LGHB 3KYQA 3CMAP 1S5LE 1SQXG 3GF7A 2GM4A 1KB9D 3ITKA 1M7LA 1OMIA 2YO3A 3PP5A 3T97B 1FOSE 1SFCC 1S3JA 2Y0EA 2A06E 1BCCE 3Q2YA 2ZYAA 1SS1A 3HTKA 3RK3B 3CX5D 1SQVG 2WSSH 1JY2O 1J1DB 3EFFK 4D6TJ 3AE6C 3F89A 3M9QA 2GUVA 4Y28J 1EC5A 3VP8A 2R3CA 4C7NB 4EI2A 2AEFA 1OWAA 4B86A 1VDFA 4GKGA 4I7ZB 1OW7A 3AE1C 2L91A 3H6PA 2FBWC 2QJPC 1KB9H 1OVRA 2B88A 4W7ZA 4H13D 4LC1A 4N78D 3KHUA 2IFMA 4PJ0E 5KLVJ 2JR8A 3IF4A 2A45H 5KKZB 1T6AA 2R44A 5AVQB 2OYOA 3H1IG 3AE2C 2MKVA 3HUSC 3M91A 4KHXA 2IYOA 4TLFA 1M56D 4N3YB 3CCUP 1N73A 1VQLP 4IFDK 1BDCA 3NMDA 1N7SC 1IK7A 3N4XA 3TNUA 2QJPB 1EDKA 1RF1A 2BEZF 2XNDH 3A5TA 5AW3B 1NWQA 2Q7CA 3BCCG 3CCJP 1CSBA 1USDA 1N86A 4IL6H 1MV8A 3HE4A 3I5CA 2D2CB 2W6AA 5CMZA 1USEA 3FGAD 2LKMA 1BCCG 2C0XA 2KXPB 5TISE 3E1IA 1Q7YQ 1DEEG 3GMAA 3SWFA 1FDOA 5APQA 1LTTC 1ZOYC 1FBMA 2FYUK 2RH0A 3MIWA 5AW7B 2C0WA 2E76C 1KQSO 1K9MQ 4EIJA 3CCEP 1ZMEC 3IFMA 2RN0A 5KAFE 1AFOA 1KORA 1SQQJ 3TDKA 2H7HA 2XNXA 1SQQK 3CWBD 3IAOA 2CPSA 2HYNA 2L5GB 4U3FE 2KI7B 4DZOA 4L75A 1NKZB 5AW2B 2XV5A 1KILC 3H1HD 5KAIE 4PV1D 5BVZA 1IFPA 4PD4H 2WT7B 1NAYA 1PP9E 1KQFB 4IL6X 2JKVA 1LTGC 1JOCA 2Y0CA 3GHGC 2E76D 2M5AA 2LXCB 4I1LA 5AVUB 3GHGA 3TYYA 2ZT9D 4D6TD 1EXJA 1IC2A 3CWBE 4HJGH 1NH4A 1OVUA 2WTYA 3JC22 2Y0DA 2BCCE 2JEEA 1FZCA 3CPWO 3PLNA 3L73E 1L0NE 2AXTE 2HLOA 2OARA 3AEBC 1NHLA 2W8ZA 3M0AA 1MKMA 2QM8A 1MFZA 2W90A 2C9NY 3CCRP 3EQ2A 5AW4B 2WSFJ 2WPSA 4GT1A 1ZXGA 4ZKPA 3B4SA 1L4AA 3S9OA 1BCCJ 5GTHH 1VPCA 1NU1K 3HTKB 1GD2E 1KTMA 1Q2NA 4U3FG 3VYIA 1EZVE 2P58A 5CCGD 4JBZA 5APUA 1L4AB 2OQQA 2Z4EA 1N7LA 3TGUE 1YYCA 3PRJA 1H8AA 2WZ7A 3N7NA 3LIEA 3C1LA 1QX8A 3MUDA 1EZVI 4BRYB 2UWJE 1RF1C 1J2JB 2OGUA 1S4XA 1PGOA 2JJLA 2JWDA 1KILD 3FXEA 5KLVG 2H43A 1FOSF 1QEXA 3B8EB 3M0DC 3L36A 1NTMD 4RESB 4WBAA 2A06D 3TGUJ 3L71J 3KDPB 1NTKG 1LWUA 2H89C 1OXZA 5CCHA 2KZJA 2E74B 1BE3J 5CCHC 1ZRTE 3A0HH 5EFWB 3HD7B 2H88C 3K5BA 3RL0g 3C9IA 1XTGB 1Q90D 2IBZI 3PTZA 2G8YA 1S2EA 3L70E 5E79H 4D6TG 2E74C 3L37A 4AUWA 2D2CC 1G1IA 1PPJD 2GA1A 5APSA 4C7RA 4GIFA 4H44C 2K1AA 3TK1A 1KQGB 1BE3G 1NTME 2QA4P 3RK3D 1URQD 1Q82Q 1QL1A 1KYOE 4DT0A 2W27A 1VF5D 2A45I 3VMXA 2FKWB 2N1TC 1EZVG 1BSHA 1N7SB 1FDIA 1JB0J 4XE5B 3W67A 1XTCC 3MTUE 3KXDA 4JYCA 1YHQP 2Z5HA 1IFMA 1MFTA 1SFCA 3D71A 3RK2D 2QG4A 1DEBA 1SQBD 2E43A 1L4AC 4ZMDA 2ZXEB 2OYIA 4PD4D 1FZFA 4IFFA 2DW3A 3KQGA 4AQRD 3MP7B 3RK3E 1DX7A 2KNCA 3OAKA 1P84H 3L70G 2WSCJ 4I7ZC 1AQ5A 2IBZG 5CHXA 3A0HE 1PL5A 4OGQD 5KJ7A 2FYUE 1HGVA 3R4YA 2OTJP 4DJGA 1NTMG 1JTHB 1X0TA 2ZVOB 3P32A 1QL2A 2O3JA 1E5WA 5E79E 5KTBA 1CW5A 1GW4A 4HB1A 1IFJA 2QSIA 1SQVE 4WY4C 1KV4A 4I2LC 5KLVD 3WUVA 1S9KE 4KT0J 1NTMK 1SFCB 2PAJA 3L74J 5AVWB 3V2RA 1AA0A 1GK6A 3CCQP 1NGMB 2YMKA 1PP9G 2W83C 1R5SA 2ZVNB 1LTIC 2POHA 2FYUD 2PGDA 5CCHD 3H1ID 2FXMA 2JO1A 3H1HJ 1HBWA 2HG5D 4ASWA 1SQPD 3L74E 3H1IJ 2OTKE 3H1KJ 3PJSK 3L71D 4JF7A 4A7PA 1T8ZA 1VQOP 2ZJSE 4GDOA 2QE7H 4LLHA 3VTPC 1URQC 2LXBA 4L73A 2KB7P 4WWIA 2AXCA 2YNYA 1HGZA 1HVVA 3O6QB 3SSUA 1BDDA 1GTWA 1Q81Q 3H1IE 1KYOI 3BCCE 1NOHA 2BCCD 3R2PA 1KN7A 1NO4A 3TNUB 2E76B 3Q5PA 1L0LK 1NTZK 2ZT9B 3CX5E 2R5DA 3EFGA 4L74A 2WWWA 3W68A 2B9BA 1YJNP 2FFDB 3CC2P 2J5UA 2OYHC 3VMAA 3FXDA 5APYA 3L72G 2KLVA 3L75G 3TGUG 1KFNA 1L0LG 1NTZG 5CJ0A 2FFDA 3E7KA 4JQ0D 2YO2A 3CMEP 1UIIA 3AE3C 2PP6A 2W6JH 3AE8C 3BRTB 4H0LB 4XFJA 3HUSA 2FXOA 3G6EP 1VF5B 1WRGA 2WQYC 2CPBA 4BRYA 3AE5C 1M1JC 3CXHI 1AQTA 4PJ0H 4D6TE 5APWA 3H25A 2N1TA 1VQ5P 1FAVA 1KZUB 4C7NA 5KJ7C 2Q9IA 2N1TD 2M3EA 2RMZA 1NU1J 2IZ0A 1D7MA 1H88A 2MJZA 3HUSB 3IR9A 2Q6QA 1JY3O 3AEFC 3TSIA 5KKZC 1S72P 3CD6P 2WPRA 3CXHE 4OVNF 2WSEJ 1T3UA 3FX0A 1L4AD 3GG2A 2Q3IA 3U1AA 1SP4A 3V4QA 3CCSP 1RQUA 3M9BA 1N73C 4ASVA 3L72J 3L75J 1L0LE 1NTZE 1S5LX 3AEGC 3RL0B 3H1HG 3FWNA 2A45G 2D2CD 3WMM0 4R4MA 1FZEA 1GL2B 1J1DC 1FE6A 1DD3A 1M8OB 1W2EA 3BRVB 4UB8E 2QJKB 2IFNA 2Q3EA 3M0DA 1RH5B 3RK3C 3WU2E 5CBNA 1QVFO 1PGJA 2HR3A 3G4SP 4EDFA 3H1KD 3L72E 3L75E 2QJKC 5M1BA 3V5BA 1YIJP 1A02J 4K35A 2O01N 3JCUH 4GOFA 4ZKUA 4NPDA 1NJIQ 1NAFA 1FZAA 1SQXJ 1ZP0C 2IDBA 1GK4A 2QJYC 1L0LD 1NTZD 1ZN5A 1VL2A 3V2QA 5L8RJ 1T3JA 3L71G 5GTIE 1FU1A 5GTHE 1YQ4C 1JM0A 3CLQA 3LW5H 3CX5I 2H8PD 2VRSA 1RE4C 4NPEA 1LWUC 5AVVB 1KYOH 3CXHH 1ZR2A 2V4HA 1E79H 3A2AA 2K37A 3CWBJ 5KLIB 4Y99C 2OTLP 1GL2A 1JTHA 1NU1G 2PFXA 3AE7C 1BE3D 4YPCA 1LJ2A 1U7MA
chains in the Genus database with same CATH topology
1J1EC 2E42A 1KFMA 1RY3A 1SQVK 2YKQA 1MUUA 3B5NB 4O9BA 5AW5B 3U59A 3HE4B 2FFDC 3H32A 1JNMA 1NTKK 1URQA 3V2PA 5AVYB 2NPSD 1X9VA 4WB4A 1HH0A 1IJDB 1FZCC 1RF0C 2HODB 4XA4A 1SQXK 5AVZB 1RF0A 1MZ9A 3A3YB 3P8CE 1G1JA 2O1JA 3M06A 3U1CA 1WT6A 1GW3A 1A02F 1LWUB 1JUNA 5CCGC 1N2DC 3T97A 1JO5A 1LTJB 4WY4A 2BASA 5AW8B 1KILA 1ZR4A 1JY2P 1NKNA 1LT9A 3P8CD 2KYVA 4HYTB 4OH8B 4N6JA 2WSFH 5AVXB 1LTAC 1IK9A 1JMMA 2Z5IA 2P67A 2XDJA 1X8YA 1YTZI 1LTJA 3M9HA 4WY4B 5AVSB 1GL2C 3VP9A 1H89A 3RL0C 1N73B 1RE4A 2R32A 1N7SD 2WITA 4DOJA 5KTBA 1HJBA 1T2KD 2WPQA 3LIDA 2W6BA 5AVTB 2XZRA 2YMYA 2OYIC 1LT9C 2N1TB 3RK2C 1SQBK 1RE3C 2QM7A 3B5ND 3O8ZA 2XU6A 1LTSC 2WT7A 2KP8A 1S9KD 4C46A 2OYHB 1SVFA 2R5BA 3G3ZA 3NXSA 3HD7D 1X79B 2NPSB 4LGDE 5AW0B 5BU8B 4I6MC 1M1JA 1L0NK 1DH3A 5AVRB 2GUSA 1URQB 2P7JA 2NPSA 2M8RA 1IFNA 2WSCH 2KOGA 1FZGA 2IPPA 2N9BA 3TNUA 4M3LA 3L35A 1ZLLA 1SQPK 3MGNA 2YKPA 1RF1A 1JCDA 2OYHA 2HODA 3VOPA 1CI6B 1SLQA 1G2CB 3CL3D 2NPSC 2HPCB 4WY4D 5AW9B 1JY3N 2YKOA 3P7KA 1HUCA 3OJAB 1CI6A 1HWTC 2I1JA 3VMYA 3UIAA 3VMZA 1FJPA 3B5NC 3A7OA 1GDTA 3BASA 1FDMA 1GU5A 4HH2A 3NFQA 3P8MC 3RK2B 2O01H 1GU4A 5APXA 2M3BA 1T2KC 1LT9B 2OYIB 1G2CA 5AW1B 3V2NA 5AW6B 4Y99B 1EQ7A 1RE3A 5KJ7D 3VN0A 3CI9A 3HD7A 4W7YA 3SWYA 1GL2D 2HFED 2P2UA 5APVA 1Z56A 4N78E 2FYZA 1IFIA 1SFCD 4IFMA 3II6A 3HD7C 1GZLA 2P1JA 3V4WA 1HTLC 4JYBA 2Q5UA 2XKMA 3MD0A 1LTJC 2ZFCA 1RF1B 3HE5A 5CJ4A 5APTA 3L4FA 1LTBC 3H32B 1N7SA 2C9LY 2IX7C 1M1JB 3HE5B 5CCGA 1FZCB 1FJKA 1YTZT 1ZV8A 3BATA 3NTNA 2J59M 2O1KA 1IFDA 4EOTA 3B5NA 1KQLA 5BU5A 2WSEH 2J58A 2KSJA 2H43A 3HRNA 5KLVK 2HPCA 1JCCA 1FZBA 3GHGB 3BVHA 1CZQA 1J1EB 1KILB 1IO4A 1JY2N 3RL0D 3KPEA 4W80A 1JY3P 3OA7A 2I1KA 1LGHB 3KYQA 2GM4A 1M7LA 2YO3A 3PP5A 1FOSE 1SFCC 3HTKA 3RK3B 1JY2O 1J1DB 3M9QA 2GUVA 3VP8A 4C7NB 2R3CA 4B86A 1OWAA 1VDFA 4GKGA 3H6PA 4W7ZA 4N78D 4LC1A 2IFMA 2A45H 5AVQB 3HUSC 3M91A 4KHXA 4N3YB 4IFDK 1N73A 3NMDA 1N7SC 3N4XA 3A5TA 5AW3B 1NWQA 2Q7CA 1CSBA 1N86A 5CMZA 1MV8A 3HE4A 3I5CA 2W6AA 1DX7A 2LKMA 2C0XA 3E1IA 3SWFA 5APQA 1LTTC 2FYUK 1FBMA 5AW7B 3MIWA 2C0WA 4EIJA 3IFMA 1AFOA 2H7HA 2XNXA 1SQQK 2CPSA 2HYNA 2L5GB 4DZOA 5AW2B 1NKZB 5BVZA 2XV5A 1KILC 2WT7B 1LTGC 1JOCA 3GHGC 3TYYA 4AYCA 4I1LA 5AVUB 3GHGA 1IC2A 1NH4A 2WTYA 2JEEA 1FZCA 2HLOA 2OARA 1NHLA 3M0AA 2QM8A 1MFZA 2C9NY 3EQ2A 5AW4B 2WPSA 4GT1A 4ZKPA 1L4AA 1VPCA 1NU1K 3HTKB 1GD2E 3VYIA 5CCGD 5APUA 1L4AB 2Z4EA 1N7LA 1H8AA 1YYCA 2WZ7A 3N7NA 3LIEA 3MUDA 1RF1C 1J2JB 2JJLA 1KILD 1FOSF 3B8EB 3M0DC 3L36A 4RESB 4WBAA 3KDPB 1LWUA 5CCHA 1OXZA 5CCHC 3HD7B 3C9IA 1XTGB 4AUWA 3L37A 5APSA 1G1IA 4C7RA 4GIFA 3TK1A 3RK3D 1URQD 1QL1A 2W27A 3VMXA 2A45I 2N1TC 2FKWB 1N7SB 4XE5B 1XTCC 3MTUE 1PFIA 4JYCA 2Z5HA 1IFMA 1SFCA 3RK2D 1DEBA 2E43A 1L4AC 2ZXEB 2OYIA 1FZFA 4IFFA 3KQGA 4AQRD 3OAKA 1AQ5A 5CHXA 5KJ7A 1HGVA 1JTHB 3P32A 1QL2A 1E5WA 1CW5A 1GW4A 1IFJA 4WY4C 4I2LC 1S9KE 1NTMK 1SFCB 2PAJA 5AVWB 3V2RA 1GK6A 1LTIC 2POHA 5CCHD 2FXMA 1HBWA 2HG5D 4JF7A 1T8ZA 3VTPC 4LLHA 1URQC 2KB7P 2YNYA 1HGZA 1HVVA 1GTWA 1NOHA 3R2PA 1NO4A 3TNUB 1L0LK 1NTZK 3EFGA 2FFDB 2R5DA 2WWWA 2OYHC 5APYA 2KLVA 1KFNA 5CJ0A 2FFDA 2YO2A 2PP6A 3BRTB 3HUSA 1WRGA 2CPBA 1M1JC 5APWA 2N1TA 1FAVA 1KZUB 4C7NA 5KJ7C 2Q9IA 2N1TD 1H88A 2MJZA 3HUSB 3IR9A 3TSIA 1JY3O 2WPRA 1T3UA 1L4AD 2Q3IA 3U1AA 1SP4A 3V4QA 3M9BA 1N73C 3RL0B 2A45G 3WMM0 1FZEA 1GL2B 1J1DC 1W2EA 3BRVB 2IFNA 3M0DA 3RK3C 3V5BA 1A02J 4ZKUA 1NAFA 1FZAA 1GK4A 1ZN5A 3V2QA 1T3JA 1FU1A 3LW5H 3CLQA 2H8PD 2VRSA 1RE4C 1LWUC 5AVVB 1ZR2A 3A2AA 4Y99C 1GL2A 1JTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E42 A;  4JYC A;  4C7N B;  2Z5H A;  2R3C A;  5AW9 B;  1OWA A;  4B86 A;  4GKG A;  3P7K A;  2E43 A;  1HUC A;  1CI6 A;  1HWT C;  4LC1 A;  1MUU A;  2ZXE B;  3VMY A;  3UIA A;  3VMZ A;  3KQG A;  4AQR D;  3A7O A;  3OAK A;  5AVQ B;  5AW5 B;  1GU5 A;  3M91 A;  3NFQ A;  4KHX A;  3HE4 B;  3P8M C;  1GU4 A;  3NMD A;  1JNM A;  5APX A;  5AVY B;  1T2K C;  3P32 A;  5AW1 B;  5AW6 B;  3A5T A;  5AW3 B;  4I2L C;  1NWQ A;  2Q7C A;  1S9K E;  5AVZ B;  5AVW B;  1CSB A;  5CMZ A;  1MV8 A;  1GK6 A;  3A3Y B;  2W6A A;  3HE4 A;  3I5C A;  3VN0 A;  3SWF A;  3M06 A;  5APQ A;  2P2U A;  5APV A;  5AW7 B;  1HBW A;  1A02 F;  1JUN A;  3T97 A;  2BAS A;  5AW8 B;  1GZL A;  3V4W A;  3VTP C;  2H7H A;  4HYT B;  5AVX B;  2YNY A;  4JYB A;  4DZO A;  2Z5I A;  2P67 A;  1GTW A;  1X8Y A;  2Q5U A;  3M9H A;  3MD0 A;  5AW2 B;  2XV5 A;  5AVS B;  2WT7 B;  1H89 A;  2ZFC A;  3TNU B;  3HE5 A;  5APT A;  3TYY A;  4AYC A;  2R5D A;  5AVU B;  2WWW A;  2R32 A;  1HJB A;  5APY A;  2C9L Y;  2WTY A;  3HE5 B;  1T2K D;  2YO2 A;  2WPQ A;  3LID A;  5AVT B;  2XZR A;  3M0A A;  2QM8 A;  1MFZ A;  3NTN A;  5APW A;  2C9N Y;  5AW4 B;  1FAV A;  2WPS A;  4GT1 A;  4C7N A;  1H88 A;  3IR9 A;  2QM7 A;  2WPR A;  4EOT A;  1GD2 E;  3O8Z A;  2XU6 A;  1KQL A;  3VYI A;  2WT7 A;  2KP8 A;  5APU A;  2Q3I A;  4C46 A;  1S9K D;  1SP4 A;  3V4Q A;  3M9B A;  1H8A A;  1YYC A;  2R5B A;  3LIE A;  3NXS A;  1CZQ A;  1J2J B;  2JJL A;  3M0D A;  5AW0 B;  4I6M C;  1FOS F;  1DH3 A;  3B8E B;  4RES B;  3L36 A;  5AVR B;  3V5B A;  1IO4 A;  1A02 J;  3KDP B;  1OXZ A;  1NAF A;  1GK4 A;  2P7J A;  2IPP A;  2N9B A;  3TNU A;  4M3L A;  3L35 A;  2VRS A;  3L37 A;  3MGN A;  5APS A;  4AUW A;  2YO3 A;  5AVV B;  1FOS E;  3TK1 A;  3A2A A;  1CI6 B;  1SLQ A;  3HTK A;  1G2C B;  2W27 A;  3VMX A;  4XE5 B; 
#chains in the Genus database with same CATH topology
 1J1E C;  1Y47 A;  3H1J G;  3MUD C;  2E42 A;  3D6Y A;  1EDL A;  1KFM A;  3L74 G;  4H0L C;  4U3F J;  3L73 J;  5B5E H;  3AEC C;  1K8A Q;  1PPJ E;  1RY3 A;  1SQV K;  2R3S A;  1U57 A;  2YKQ A;  1SQP E;  1MUU A;  3B5N B;  1QLE D;  3CCL P;  1QGK B;  2ZYG A;  3L73 D;  2IBZ D;  2JP3 A;  4O9B A;  1PGQ A;  3V6I A;  5H2F E;  3CCM P;  1FDM A;  5AW5 B;  1BGY J;  3O6Q A;  3BCC J;  3U59 A;  2ZT9 C;  3EWK A;  1OFC X;  3HE4 B;  2FFD C;  3CC4 P;  3H32 A;  1HJ0 A;  1NVO A;  1NTK K;  1URQ A;  3V2P A;  5AVY B;  1JNM A;  2NPS D;  2RKL A;  2FY8 A;  1X9V A;  4WB4 A;  1HH0 A;  1TU3 F;  1KD1 Q;  1IJD B;  4H0L D;  1FZC C;  1RF0 C;  2HOD B;  2WPV B;  1H0T B;  4XA4 A;  1SQX K;  2B87 B;  4YTP C;  5AVZ B;  1RF0 A;  1K73 Q;  2YXR B;  1GMJ A;  1MZ9 A;  3A3Y B;  3P8C E;  4RKU J;  1YBK A;  3AE9 C;  1G1J A;  2O1J A;  3M06 A;  1VQ8 P;  3U1C A;  1WT6 A;  1GW3 A;  1A02 F;  1LWU B;  1JUN A;  5DJT B;  5CCG C;  1N2D C;  3E1R A;  1SQQ G;  3T97 A;  1JO5 A;  3G9R A;  3H1K E;  1LTJ B;  4WY4 A;  1PV3 A;  2BAS A;  5AW8 B;  2CK3 H;  1KIL A;  1ZR4 A;  1JY2 P;  1NKN A;  1LT9 A;  2QJY B;  3P8C D;  2KYV A;  4HYT B;  3WUT A;  4OH8 B;  4N6J A;  2WSF H;  5AVX B;  1LTA C;  1IK9 A;  1JMM A;  4CPG A;  2Z5I A;  1OW6 A;  2P67 A;  4MN4 C;  2XDJ A;  1X8Y A;  1BGY G;  1YTZ I;  1LTJ A;  3M9H A;  4K3A A;  4WY4 B;  4DCK A;  3CX5 H;  5AVS B;  2KUB A;  1SQV D;  1GL2 C;  2ZXX A;  3FWL A;  3MHV A;  3VP9 A;  3Q5S A;  2FYN C;  1H89 A;  3LW5 J;  1EXI A;  3TF5 A;  3I55 P;  3RL0 C;  4YXW H;  1N73 B;  1RE4 A;  4RJT A;  3A0B E;  1VQN P;  2R32 A;  1N7S D;  2WIT A;  2QIW A;  3AEE C;  3JSV C;  3L70 J;  1AV1 A;  4U3F D;  4DOJ A;  3QH9 A;  1HJB A;  1K04 A;  3BCC D;  4H13 B;  1T2K D;  2WVR A;  3GLM A;  2WPQ A;  1RQV A;  2QRX A;  3LID A;  3QWO C;  2W6B A;  2PRR A;  5AVT B;  1P84 I;  3L71 E;  2XZR A;  2YIU C;  2YMY A;  1LT9 C;  1SQQ E;  2BEQ D;  2IZ1 A;  4WVZ A;  2KK7 A;  2OYI C;  2N1T B;  3H1K G;  2Y9Y A;  1OIP A;  1VF5 C;  3RK2 C;  3S4R A;  1NTK E;  1P84 E;  1OX3 A;  1SQB K;  2KIK A;  2NZ2 A;  2KS1 A;  5C39 A;  1Q86 Q;  1RE3 C;  2QM7 A;  3PH0 A;  4Z1M H;  3B5N D;  3O8Z A;  2XU6 A;  4H44 B;  4M3L A;  1LTS C;  1BCC D;  2WT7 A;  1PP9 J;  2K9J A;  2KP8 A;  1S9K D;  4C46 A;  1N8R Q;  1YQ3 C;  1VQM P;  2ZYD A;  1SQX D;  1SVF A;  1OW8 A;  3AE4 C;  2OYH B;  3D70 A;  2R5B A;  3G3Z A;  3NXS A;  4OGQ C;  2E74 D;  1DIP A;  3WU2 H;  5CBO A;  2KSE A;  3HD7 D;  1X79 B;  1NU1 D;  2NPS B;  1OVV A;  2E75 B;  3A0B H;  3GF3 A;  4JPZ B;  1EDJ A;  1RHZ B;  2NRG A;  2SPZ A;  3JCU E;  4LGD E;  5AW0 B;  3MZW B;  3H1J E;  4L76 A;  4I6M C;  5BU8 B;  1M1J A;  1L0N K;  1LP1 B;  2I8D A;  5AVR B;  1DH3 A;  1L0N J;  2GUS A;  5KAI H;  1WMK A;  4U7J A;  1SQP G;  3SWK A;  1URQ B;  2P7J A;  2NPS A;  4UB6 E;  2M8R A;  3L73 G;  1IFN A;  4R4L A;  4BWN A;  3SFE C;  2WSC H;  2V7Q J;  1YIT P;  1KMI Z;  1ZW0 A;  1SQP J;  2KOG A;  1FZG A;  2IPP A;  2N9B A;  3C8V A;  1KIL E;  1SQB E;  1ZLL A;  1SQP K;  2K3R A;  2YKP A;  3L35 A;  1JCD A;  2B89 A;  3CXH D;  3MGN A;  1W2B O;  2HOD A;  3H1J D;  1K05 A;  3VOP A;  1S5L H;  2AEJ A;  3Q1M A;  3H1L D;  1R8E A;  1CI6 B;  1SLQ A;  3PHL A;  3USS A;  1G2C B;  1HF9 A;  1BGY D;  5B5E E;  3CL3 D;  2E75 C;  4IL6 E;  2NPS C;  3Q5R A;  1SQB J;  2HPC B;  1PZQ A;  2M0B A;  1VQ6 P;  4WY4 D;  2B87 A;  4OGQ B;  5AW9 B;  1JY3 N;  2YKO A;  3P7K A;  1Y9B A;  1AVO A;  1JMB A;  2AXT H;  1HUC A;  3OJA B;  3Q3D A;  1CI6 A;  3KZI H;  4KJM A;  2I1J A;  1OZH A;  3VMY A;  1HWT C;  1VQ7 P;  1AVY A;  3UIA A;  3VMZ A;  5KLV E;  1FJP A;  1LNQ A;  1M1K Q;  3B5N C;  1VQK P;  3A7O A;  1GDT A;  3CC7 P;  3BAS A;  2WMM A;  3F5H A;  4IOI H;  2V7Q H;  1BGY E;  4HH2 A;  5GTI H;  3NFQ A;  5KAF H;  1GU5 A;  1VQ4 P;  1FS0 E;  3P8M C;  4UB6 H;  3RK2 B;  1NTK D;  2O01 H;  4PD4 I;  1GU4 A;  2A06 G;  3OW2 O;  5APX A;  1X22 A;  2M3B A;  3D6Z A;  1LT9 B;  1T2K C;  2YIU B;  1G2C A;  5AW1 B;  3V2N A;  2OYI B;  5AW6 B;  1PGP A;  2IYP A;  2KLU A;  3L74 D;  1PP9 D;  4Y99 B;  1EQ7 A;  1RE3 A;  3RBZ A;  3WUU A;  5B66 H;  4PD4 E;  2KS1 B;  3GW6 A;  5KJ7 D;  4H13 C;  4GOE A;  2O01 J;  4OWF A;  3TGU D;  1Y8A A;  1PPJ G;  1BE3 E;  2FXP A;  2ZAE B;  3RBX A;  3VN0 A;  2JWA A;  3CI9 A;  3HD7 A;  4QMA A;  4W7Y A;  3SWY A;  1NU1 E;  1BSN A;  1S1C X;  1GL2 D;  2HFE D;  2P2U A;  4H44 D;  5APV A;  5TIS H;  2FYN B;  1Z56 A;  4N78 E;  1JEK A;  1NTM J;  4UB8 H;  2FYZ A;  1IFI A;  3KZI E;  1L0N D;  1SFC D;  4IFM A;  2IBZ E;  3II6 A;  4YXD C;  4HKZ H;  1KB9 I;  1FC2 C;  2FYU G;  1GZL A;  2P1J A;  3HD7 C;  3V4W A;  3S1K A;  4ZNC A;  3H1L J;  1L0L J;  1NTZ J;  1ZRT D;  3I56 P;  1HTL C;  2E75 D;  4JYB A;  2KZI A;  4TT3 H;  3G71 P;  2Q5U A;  2XKM A;  3MD0 A;  4RO0 A;  1EZV D;  1LTJ C;  5K5G B;  2ZFC A;  5B66 E;  1RF1 B;  1NYH A;  3H1L E;  3HE5 A;  5APT A;  3L4F A;  5CJ4 A;  1LTB C;  1KYO D;  2JDI H;  3CCV P;  3H32 B;  1R5L A;  1N7S A;  4EYY Q;  1QVG O;  2C9L Y;  1UIX A;  2IX7 C;  2K9J B;  3H1H E;  1YJ9 P;  1M1J B;  1W5C E;  3HE5 B;  5CCG A;  2Y9Z A;  1DD4 A;  1FZC B;  2K9Y A;  1FJK A;  1SQV J;  1YTZ T;  1ZV8 A;  3BAT A;  2ITA A;  1U7J A;  1SQX E;  3NTN A;  1VQP P;  1IZN B;  1LT1 A;  4NPF X;  1NTK J;  5H2F H;  2KNC B;  3L70 D;  2J59 M;  2AEM A;  2LR2 A;  2O1K A;  4AYC A;  2M5A B;  1H0T A;  3H1L G;  1IFD A;  4EOT A;  3B5N A;  1KQL A;  3L72 D;  2FYU J;  3L75 D;  3ZDM A;  5BU5 A;  2WSE H;  2J58 A;  2KSJ A;  3RGU A;  3IN6 A;  2YXQ B;  2G3A A;  1SQB G;  3HRN A;  2E5T A;  5KLV K;  2QEX P;  1M90 Q;  1M57 D;  2HPC A;  2OYH A;  2K88 A;  3ABV C;  4BXL A;  1JCC A;  1FZB A;  5TJH A;  3GHG B;  2QVA A;  3BVH A;  1CZQ A;  1J1E B;  1P84 D;  2BCC G;  2P10 A;  2E5Y A;  1YJW P;  1KB9 E;  4PV1 C;  1KIL B;  3CWB G;  3H1J J;  5KLI C;  3AED C;  1IO4 A;  1JY2 N;  1L2P A;  1LP1 A;  3AEA C;  4GOD A;  2Q1K A;  4PV1 B;  3SFD C;  1KC8 Q;  3RL0 D;  1YI2 P;  1VQ9 P;  1AJY A;  3KPE A;  3B71 A;  1EDI A;  2BCC J;  1SQQ D;  1PFI A;  4W80 A;  1JY3 P;  1L0N G;  1PIX A;  2N9Y B;  2I1K A;  3OA7 A;  5DJU B;  1LGH B;  3KYQ A;  3CMA P;  1S5L E;  1SQX G;  3GF7 A;  2GM4 A;  1KB9 D;  3ITK A;  1M7L A;  1OMI A;  2YO3 A;  3PP5 A;  3T97 B;  1FOS E;  1SFC C;  1S3J A;  2Y0E A;  2A06 E;  1BCC E;  3Q2Y A;  2ZYA A;  1SS1 A;  3HTK A;  3RK3 B;  3CX5 D;  1SQV G;  2WSS H;  1JY2 O;  1J1D B;  3EFF K;  4D6T J;  3AE6 C;  3F89 A;  3M9Q A;  2GUV A;  4Y28 J;  1EC5 A;  3VP8 A;  2R3C A;  4C7N B;  4EI2 A;  2AEF A;  1OWA A;  4B86 A;  1VDF A;  4GKG A;  4I7Z B;  1OW7 A;  3AE1 C;  2L91 A;  3H6P A;  2FBW C;  2QJP C;  1KB9 H;  1OVR A;  2B88 A;  4W7Z A;  4H13 D;  4LC1 A;  4N78 D;  3KHU A;  2IFM A;  4PJ0 E;  5KLV J;  2JR8 A;  3IF4 A;  2A45 H;  5KKZ B;  1T6A A;  2R44 A;  5AVQ B;  2OYO A;  3H1I G;  3AE2 C;  2MKV A;  3HUS C;  3M91 A;  4KHX A;  2IYO A;  4TLF A;  1M56 D;  4N3Y B;  3CCU P;  1N73 A;  1VQL P;  4IFD K;  1BDC A;  3NMD A;  1N7S C;  1IK7 A;  3N4X A;  3TNU A;  2QJP B;  1EDK A;  1RF1 A;  2BEZ F;  2XND H;  3A5T A;  5AW3 B;  1NWQ A;  2Q7C A;  3BCC G;  3CCJ P;  1CSB A;  1USD A;  1N86 A;  4IL6 H;  1MV8 A;  3HE4 A;  3I5C A;  2D2C B;  2W6A A;  5CMZ A;  1USE A;  3FGA D;  2LKM A;  1BCC G;  2C0X A;  2KXP B;  5TIS E;  3E1I A;  1Q7Y Q;  1DEE G;  3GMA A;  3SWF A;  1FDO A;  5APQ A;  1LTT C;  1ZOY C;  1FBM A;  2FYU K;  2RH0 A;  3MIW A;  5AW7 B;  2C0W A;  2E76 C;  1KQS O;  1K9M Q;  4EIJ A;  3CCE P;  1ZME C;  3IFM A;  2RN0 A;  5KAF E;  1AFO A;  1KOR A;  1SQQ J;  3TDK A;  2H7H A;  2XNX A;  1SQQ K;  3CWB D;  3IAO A;  2CPS A;  2HYN A;  2L5G B;  4U3F E;  2KI7 B;  4DZO A;  4L75 A;  1NKZ B;  5AW2 B;  2XV5 A;  1KIL C;  3H1H D;  5KAI E;  4PV1 D;  5BVZ A;  1IFP A;  4PD4 H;  2WT7 B;  1NAY A;  1PP9 E;  1KQF B;  4IL6 X;  2JKV A;  1LTG C;  1JOC A;  2Y0C A;  3GHG C;  2E76 D;  2M5A A;  2LXC B;  4I1L A;  5AVU B;  3GHG A;  3TYY A;  2ZT9 D;  4D6T D;  1EXJ A;  1IC2 A;  3CWB E;  4HJG H;  1NH4 A;  1OVU A;  2WTY A;  3JC2 2;  2Y0D A;  2BCC E;  2JEE A;  1FZC A;  3CPW O;  3PLN A;  3L73 E;  1L0N E;  2AXT E;  2HLO A;  2OAR A;  3AEB C;  1NHL A;  2W8Z A;  3M0A A;  1MKM A;  2QM8 A;  1MFZ A;  2W90 A;  2C9N Y;  3CCR P;  3EQ2 A;  5AW4 B;  2WSF J;  2WPS A;  4GT1 A;  1ZXG A;  4ZKP A;  3B4S A;  1L4A A;  3S9O A;  1BCC J;  5GTH H;  1VPC A;  1NU1 K;  3HTK B;  1GD2 E;  1KTM A;  1Q2N A;  4U3F G;  3VYI A;  1EZV E;  2P58 A;  5CCG D;  4JBZ A;  5APU A;  1L4A B;  2OQQ A;  2Z4E A;  1N7L A;  3TGU E;  1YYC A;  3PRJ A;  1H8A A;  2WZ7 A;  3N7N A;  3LIE A;  3C1L A;  1QX8 A;  3MUD A;  1EZV I;  4BRY B;  2UWJ E;  1RF1 C;  1J2J B;  2OGU A;  1S4X A;  1PGO A;  2JJL A;  2JWD A;  1KIL D;  3FXE A;  5KLV G;  2H43 A;  1FOS F;  1QEX A;  3B8E B;  3M0D C;  3L36 A;  1NTM D;  4RES B;  4WBA A;  2A06 D;  3TGU J;  3L71 J;  3KDP B;  1NTK G;  1LWU A;  2H89 C;  1OXZ A;  5CCH A;  2KZJ A;  2E74 B;  1BE3 J;  5CCH C;  1ZRT E;  3A0H H;  5EFW B;  3HD7 B;  2H88 C;  3K5B A;  3RL0 g;  3C9I A;  1XTG B;  1Q90 D;  2IBZ I;  3PTZ A;  2G8Y A;  1S2E A;  3L70 E;  5E79 H;  4D6T G;  2E74 C;  3L37 A;  4AUW A;  2D2C C;  1G1I A;  1PPJ D;  2GA1 A;  5APS A;  4C7R A;  4GIF A;  4H44 C;  2K1A A;  3TK1 A;  1KQG B;  1BE3 G;  1NTM E;  2QA4 P;  3RK3 D;  1URQ D;  1Q82 Q;  1QL1 A;  1KYO E;  4DT0 A;  2W27 A;  1VF5 D;  2A45 I;  3VMX A;  2FKW B;  2N1T C;  1EZV G;  1BSH A;  1N7S B;  1FDI A;  1JB0 J;  4XE5 B;  3W67 A;  1XTC C;  3MTU E;  3KXD A;  4JYC A;  1YHQ P;  2Z5H A;  1IFM A;  1MFT A;  1SFC A;  3D71 A;  3RK2 D;  2QG4 A;  1DEB A;  1SQB D;  2E43 A;  1L4A C;  4ZMD A;  2ZXE B;  2OYI A;  4PD4 D;  1FZF A;  4IFF A;  2DW3 A;  3KQG A;  4AQR D;  3MP7 B;  3RK3 E;  1DX7 A;  2KNC A;  3OAK A;  1P84 H;  3L70 G;  2WSC J;  4I7Z C;  1AQ5 A;  2IBZ G;  5CHX A;  3A0H E;  1PL5 A;  4OGQ D;  5KJ7 A;  2FYU E;  1HGV A;  3R4Y A;  2OTJ P;  4DJG A;  1NTM G;  1JTH B;  1X0T A;  2ZVO B;  3P32 A;  1QL2 A;  2O3J A;  1E5W A;  5E79 E;  5KTB A;  1CW5 A;  1GW4 A;  4HB1 A;  1IFJ A;  2QSI A;  1SQV E;  4WY4 C;  1KV4 A;  4I2L C;  5KLV D;  3WUV A;  1S9K E;  4KT0 J;  1NTM K;  1SFC B;  2PAJ A;  3L74 J;  5AVW B;  3V2R A;  1AA0 A;  1GK6 A;  3CCQ P;  1NGM B;  2YMK A;  1PP9 G;  2W83 C;  1R5S A;  2ZVN B;  1LTI C;  2POH A;  2FYU D;  2PGD A;  5CCH D;  3H1I D;  2FXM A;  2JO1 A;  3H1H J;  1HBW A;  2HG5 D;  4ASW A;  1SQP D;  3L74 E;  3H1I J;  2OTK E;  3H1K J;  3PJS K;  3L71 D;  4JF7 A;  4A7P A;  1T8Z A;  1VQO P;  2ZJS E;  4GDO A;  2QE7 H;  4LLH A;  3VTP C;  1URQ C;  2LXB A;  4L73 A;  2KB7 P;  4WWI A;  2AXC A;  2YNY A;  1HGZ A;  1HVV A;  3O6Q B;  3SSU A;  1BDD A;  1GTW A;  1Q81 Q;  3H1I E;  1KYO I;  3BCC E;  1NOH A;  2BCC D;  3R2P A;  1KN7 A;  1NO4 A;  3TNU B;  2E76 B;  3Q5P A;  1L0L K;  1NTZ K;  2ZT9 B;  3CX5 E;  2R5D A;  3EFG A;  4L74 A;  2WWW A;  3W68 A;  2B9B A;  1YJN P;  2FFD B;  3CC2 P;  2J5U A;  2OYH C;  3VMA A;  3FXD A;  5APY A;  3L72 G;  2KLV A;  3L75 G;  3TGU G;  1KFN A;  1L0L G;  1NTZ G;  5CJ0 A;  2FFD A;  3E7K A;  4JQ0 D;  2YO2 A;  3CME P;  1UII A;  3AE3 C;  2PP6 A;  2W6J H;  3AE8 C;  3BRT B;  4H0L B;  4XFJ A;  3HUS A;  2FXO A;  3G6E P;  1VF5 B;  1WRG A;  2WQY C;  2CPB A;  4BRY A;  3AE5 C;  1M1J C;  3CXH I;  1AQT A;  4PJ0 H;  4D6T E;  5APW A;  3H25 A;  2N1T A;  1VQ5 P;  1FAV A;  1KZU B;  4C7N A;  5KJ7 C;  2Q9I A;  2N1T D;  2M3E A;  2RMZ A;  1NU1 J;  2IZ0 A;  1D7M A;  1H88 A;  2MJZ A;  3HUS B;  3IR9 A;  2Q6Q A;  1JY3 O;  3AEF C;  3TSI A;  5KKZ C;  1S72 P;  3CD6 P;  2WPR A;  3CXH E;  4OVN F;  2WSE J;  1T3U A;  3FX0 A;  1L4A D;  3GG2 A;  2Q3I A;  3U1A A;  1SP4 A;  3V4Q A;  3CCS P;  1RQU A;  3M9B A;  1N73 C;  4ASV A;  3L72 J;  3L75 J;  1L0L E;  1NTZ E;  1S5L X;  3AEG C;  3RL0 B;  3H1H G;  3FWN A;  2A45 G;  2D2C D;  3WMM 0;  4R4M A;  1FZE A;  1GL2 B;  1J1D C;  1FE6 A;  1DD3 A;  1M8O B;  1W2E A;  3BRV B;  4UB8 E;  2QJK B;  2IFN A;  2Q3E A;  3M0D A;  1RH5 B;  3RK3 C;  3WU2 E;  5CBN A;  1QVF O;  1PGJ A;  2HR3 A;  3G4S P;  4EDF A;  3H1K D;  3L72 E;  3L75 E;  2QJK C;  5M1B A;  3V5B A;  1YIJ P;  1A02 J;  4K35 A;  2O01 N;  3JCU H;  4GOF A;  4ZKU A;  4NPD A;  1NJI Q;  1NAF A;  1FZA A;  1SQX J;  1ZP0 C;  2IDB A;  1GK4 A;  2QJY C;  1L0L D;  1NTZ D;  1ZN5 A;  1VL2 A;  3V2Q A;  5L8R J;  1T3J A;  3L71 G;  5GTI E;  1FU1 A;  5GTH E;  1YQ4 C;  1JM0 A;  3CLQ A;  3LW5 H;  3CX5 I;  2H8P D;  2VRS A;  1RE4 C;  4NPE A;  1LWU C;  5AVV B;  1KYO H;  3CXH H;  1ZR2 A;  2V4H A;  1E79 H;  3A2A A;  2K37 A;  3CWB J;  5KLI B;  4Y99 C;  2OTL P;  1GL2 A;  1JTH A;  1NU1 G;  2PFX A;  3AE7 C;  1BE3 D;  4YPC A;  1LJ2 A;  1U7M A; 
#chains in the Genus database with same CATH homology
 1J1E C;  2E42 A;  1KFM A;  1RY3 A;  1SQV K;  2YKQ A;  1MUU A;  3B5N B;  4O9B A;  5AW5 B;  3U59 A;  3HE4 B;  2FFD C;  3H32 A;  1JNM A;  1NTK K;  1URQ A;  3V2P A;  5AVY B;  2NPS D;  1X9V A;  4WB4 A;  1HH0 A;  1IJD B;  1FZC C;  1RF0 C;  2HOD B;  4XA4 A;  1SQX K;  5AVZ B;  1RF0 A;  1MZ9 A;  3A3Y B;  3P8C E;  1G1J A;  2O1J A;  3M06 A;  3U1C A;  1WT6 A;  1GW3 A;  1A02 F;  1LWU B;  1JUN A;  5CCG C;  1N2D C;  3T97 A;  1JO5 A;  1LTJ B;  4WY4 A;  2BAS A;  5AW8 B;  1KIL A;  1ZR4 A;  1JY2 P;  1NKN A;  1LT9 A;  3P8C D;  2KYV A;  4HYT B;  4OH8 B;  4N6J A;  2WSF H;  5AVX B;  1LTA C;  1IK9 A;  1JMM A;  2Z5I A;  2P67 A;  2XDJ A;  1X8Y A;  1YTZ I;  1LTJ A;  3M9H A;  4WY4 B;  5AVS B;  1GL2 C;  3VP9 A;  1H89 A;  3RL0 C;  1N73 B;  1RE4 A;  2R32 A;  1N7S D;  2WIT A;  4DOJ A;  5KTB A;  1HJB A;  1T2K D;  2WPQ A;  3LID A;  2W6B A;  5AVT B;  2XZR A;  2YMY A;  2OYI C;  1LT9 C;  2N1T B;  3RK2 C;  1SQB K;  1RE3 C;  2QM7 A;  3B5N D;  3O8Z A;  2XU6 A;  1LTS C;  2WT7 A;  2KP8 A;  1S9K D;  4C46 A;  2OYH B;  1SVF A;  2R5B A;  3G3Z A;  3NXS A;  3HD7 D;  1X79 B;  2NPS B;  4LGD E;  5AW0 B;  5BU8 B;  4I6M C;  1M1J A;  1L0N K;  1DH3 A;  5AVR B;  2GUS A;  1URQ B;  2P7J A;  2NPS A;  2M8R A;  1IFN A;  2WSC H;  2KOG A;  1FZG A;  2IPP A;  2N9B A;  3TNU A;  4M3L A;  3L35 A;  1ZLL A;  1SQP K;  3MGN A;  2YKP A;  1RF1 A;  1JCD A;  2OYH A;  2HOD A;  3VOP A;  1CI6 B;  1SLQ A;  1G2C B;  3CL3 D;  2NPS C;  2HPC B;  4WY4 D;  5AW9 B;  1JY3 N;  2YKO A;  3P7K A;  1HUC A;  3OJA B;  1CI6 A;  1HWT C;  2I1J A;  3VMY A;  3UIA A;  3VMZ A;  1FJP A;  3B5N C;  3A7O A;  1GDT A;  3BAS A;  1FDM A;  1GU5 A;  4HH2 A;  3NFQ A;  3P8M C;  3RK2 B;  2O01 H;  1GU4 A;  5APX A;  2M3B A;  1T2K C;  1LT9 B;  2OYI B;  1G2C A;  5AW1 B;  3V2N A;  5AW6 B;  4Y99 B;  1EQ7 A;  1RE3 A;  5KJ7 D;  3VN0 A;  3CI9 A;  3HD7 A;  4W7Y A;  3SWY A;  1GL2 D;  2HFE D;  2P2U A;  5APV A;  1Z56 A;  4N78 E;  2FYZ A;  1IFI A;  1SFC D;  4IFM A;  3II6 A;  3HD7 C;  1GZL A;  2P1J A;  3V4W A;  1HTL C;  4JYB A;  2Q5U A;  2XKM A;  3MD0 A;  1LTJ C;  2ZFC A;  1RF1 B;  3HE5 A;  5CJ4 A;  5APT A;  3L4F A;  1LTB C;  3H32 B;  1N7S A;  2C9L Y;  2IX7 C;  1M1J B;  3HE5 B;  5CCG A;  1FZC B;  1FJK A;  1YTZ T;  1ZV8 A;  3BAT A;  3NTN A;  2J59 M;  2O1K A;  1IFD A;  4EOT A;  3B5N A;  1KQL A;  5BU5 A;  2WSE H;  2J58 A;  2KSJ A;  2H43 A;  3HRN A;  5KLV K;  2HPC A;  1JCC A;  1FZB A;  3GHG B;  3BVH A;  1CZQ A;  1J1E B;  1KIL B;  1IO4 A;  1JY2 N;  3RL0 D;  3KPE A;  4W80 A;  1JY3 P;  3OA7 A;  2I1K A;  1LGH B;  3KYQ A;  2GM4 A;  1M7L A;  2YO3 A;  3PP5 A;  1FOS E;  1SFC C;  3HTK A;  3RK3 B;  1JY2 O;  1J1D B;  3M9Q A;  2GUV A;  3VP8 A;  4C7N B;  2R3C A;  4B86 A;  1OWA A;  1VDF A;  4GKG A;  3H6P A;  4W7Z A;  4N78 D;  4LC1 A;  2IFM A;  2A45 H;  5AVQ B;  3HUS C;  3M91 A;  4KHX A;  4N3Y B;  4IFD K;  1N73 A;  3NMD A;  1N7S C;  3N4X A;  3A5T A;  5AW3 B;  1NWQ A;  2Q7C A;  1CSB A;  1N86 A;  5CMZ A;  1MV8 A;  3HE4 A;  3I5C A;  2W6A A;  1DX7 A;  2LKM A;  2C0X A;  3E1I A;  3SWF A;  5APQ A;  1LTT C;  2FYU K;  1FBM A;  5AW7 B;  3MIW A;  2C0W A;  4EIJ A;  3IFM A;  1AFO A;  2H7H A;  2XNX A;  1SQQ K;  2CPS A;  2HYN A;  2L5G B;  4DZO A;  5AW2 B;  1NKZ B;  5BVZ A;  2XV5 A;  1KIL C;  2WT7 B;  1LTG C;  1JOC A;  3GHG C;  3TYY A;  4AYC A;  4I1L A;  5AVU B;  3GHG A;  1IC2 A;  1NH4 A;  2WTY A;  2JEE A;  1FZC A;  2HLO A;  2OAR A;  1NHL A;  3M0A A;  2QM8 A;  1MFZ A;  2C9N Y;  3EQ2 A;  5AW4 B;  2WPS A;  4GT1 A;  4ZKP A;  1L4A A;  1VPC A;  1NU1 K;  3HTK B;  1GD2 E;  3VYI A;  5CCG D;  5APU A;  1L4A B;  2Z4E A;  1N7L A;  1H8A A;  1YYC A;  2WZ7 A;  3N7N A;  3LIE A;  3MUD A;  1RF1 C;  1J2J B;  2JJL A;  1KIL D;  1FOS F;  3B8E B;  3M0D C;  3L36 A;  4RES B;  4WBA A;  3KDP B;  1LWU A;  5CCH A;  1OXZ A;  5CCH C;  3HD7 B;  3C9I A;  1XTG B;  4AUW A;  3L37 A;  5APS A;  1G1I A;  4C7R A;  4GIF A;  3TK1 A;  3RK3 D;  1URQ D;  1QL1 A;  2W27 A;  3VMX A;  2A45 I;  2N1T C;  2FKW B;  1N7S B;  4XE5 B;  1XTC C;  3MTU E;  1PFI A;  4JYC A;  2Z5H A;  1IFM A;  1SFC A;  3RK2 D;  1DEB A;  2E43 A;  1L4A C;  2ZXE B;  2OYI A;  1FZF A;  4IFF A;  3KQG A;  4AQR D;  3OAK A;  1AQ5 A;  5CHX A;  5KJ7 A;  1HGV A;  1JTH B;  3P32 A;  1QL2 A;  1E5W A;  1CW5 A;  1GW4 A;  1IFJ A;  4WY4 C;  4I2L C;  1S9K E;  1NTM K;  1SFC B;  2PAJ A;  5AVW B;  3V2R A;  1GK6 A;  1LTI C;  2POH A;  5CCH D;  2FXM A;  1HBW A;  2HG5 D;  4JF7 A;  1T8Z A;  3VTP C;  4LLH A;  1URQ C;  2KB7 P;  2YNY A;  1HGZ A;  1HVV A;  1GTW A;  1NOH A;  3R2P A;  1NO4 A;  3TNU B;  1L0L K;  1NTZ K;  3EFG A;  2FFD B;  2R5D A;  2WWW A;  2OYH C;  5APY A;  2KLV A;  1KFN A;  5CJ0 A;  2FFD A;  2YO2 A;  2PP6 A;  3BRT B;  3HUS A;  1WRG A;  2CPB A;  1M1J C;  5APW A;  2N1T A;  1FAV A;  1KZU B;  4C7N A;  5KJ7 C;  2Q9I A;  2N1T D;  1H88 A;  2MJZ A;  3HUS B;  3IR9 A;  3TSI A;  1JY3 O;  2WPR A;  1T3U A;  1L4A D;  2Q3I A;  3U1A A;  1SP4 A;  3V4Q A;  3M9B A;  1N73 C;  3RL0 B;  2A45 G;  3WMM 0;  1FZE A;  1GL2 B;  1J1D C;  1W2E A;  3BRV B;  2IFN A;  3M0D A;  3RK3 C;  3V5B A;  1A02 J;  4ZKU A;  1NAF A;  1FZA A;  1GK4 A;  1ZN5 A;  3V2Q A;  1T3J A;  1FU1 A;  3LW5 H;  3CLQ A;  2H8P D;  2VRS A;  1RE4 C;  1LWU C;  5AVV B;  1ZR2 A;  3A2A A;  4Y99 C;  1GL2 A;  1JTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...