1FAXL

Coagulation factor xa inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
TRKLCSLDNGDCDQFCHEEQASVVCSCARGYTLADNGKACIPTGPYPCGKQTLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of active site-inhibited clotting factor Xa. Implications for drug design and substrate recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Coagulation factor
molecule keywords FACTOR XA
total genus 10
structure length 55
sequence length 55
ec nomenclature ec 3.4.21.6: Coagulation factor Xa.
pdb deposition date 1996-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1faxL00
2PR3B 3GCWE 1A3PA 3K9XA 1HZ8A 2W3IB 3FFGL 1JBUL 3OLUA 2WPKE 5COXA 1IGXA 1UZPA 1LMJA 1CCFA 1AUTL 1G1RA 2KV4A 3KCGL 5JBAE 1IOEL 2B7DL 3LN1A 2P3FL 1PRHA 1EBVA 4O1ZA 1N7DA 1NFYB 1Z6EL 2BOHA 5JBBE 1CCVA 4RRZA 1PTHA 1EAIC 5KIRA 1EQGA 3ZYIB 2CJIB 1O5DL 3KK6A 4RRYA 3N8XA 1IQEL 2VVVL 5CISA 2BMGA 2Y82B 3HPTA 2W2OE 1HX2A 4ZH8B 3KQCL 2P93L 3EGFA 5F19A 1IVOC 3N8WB 1ATBA 2BOKL 1UZKA 2Y5FL 1IGZA 3ASIA 3CENL 4FM5A 2W2ME 4M10A 2VWOL 1MQ6L 2Y5HL 4X8UL 1HJ7A 4Y71B 4JZEL 2FLBL 3U7UG 2WPME 5IKVA 4BDWA 1NFUB 4D0FA 5JVZA 4G1MB 2KB9A 3RR3A 4Z0LA 1YUGA 2MGRA 1HRFA 2Y7XB 1KLOA 2RNLA 3N8WA 3KL6B 2J38B 2W3KB 4LMFA 1BF9A 1F7MA 4ISHL 2OYEP 3NT1A 2M74A 1P0SL 4XBMA 1FF7A 1EGFA 1XKAL 2PUQL 1N1IA 1XFEA 2OYUP 1UZJA 4NG9L 1NFXB 2XC4L 2Y81B 2Y80B 2WYJB 1IQML 2VWMK 2WG3C 1IQJL 3CA7A 1G1QA 1IQFL 1K36A 1G2LB 1EPIA 2XBXL 1Z6CA 1FE2A 2WPJE 1IQLL 2XBWL 3N8VA 4ZAEB 1HT5A 2P3TA 3TBDA 4NA9L 2F9BL 4D0EA 4BTUA 2UWOB 3KQDL 2UWPB 4NGAL 2XC0L 1URKA 3NJPC 3MQEA 1NT0A 4ZXYL 5CKQA 4OTYA 4RRXA 1IQGL 1G2MB 1DIYA 5L30L 3SOVA 1V3XB 1GK5A 1DX5I 3MDLA 4A7IA 2VJ3A 1LPGA 2EI6B 1EPHA 2PHBB 3N8YA 2UWLB 4JYVL 1L5GB 4C16A 2BQ7A 2XBYL 3LTFB 3HS6A 2NPRA 4Y7AB 4YT7L 3POYA 2J34B 3BPSE 1HAFA 1KIGL 4RRWA 3GISX 3QCWA 2P95L 5L2YL 1ZAQA 3LC3B 3TZIA 3R05A 5IKRA 1DQBA 4CSYA 3ZYGA 1F0SB 3TK6B 3H5CB 1F0RB 3F6UL 1APOA 1TOZA 1L3YA 2BO2A 3LN0A 1F7EA 1EMNA 1DVAL 4E1GA 1XKBA 2JKHL 1ATDA 5JW1A 3SOQA 3LC5B 3FBYA 2J4IB 3TK5B 5E8DA 1IOXA 4ISIL 4JZDL 5JB8E 1LPKA 2K2SB 2BOUA 4YT6L 5CKNA 2BZ6L 4PH9A 4Y79B 1UZQA 2I9BA 1CQEA 1LPZA 2WFTA 1PFXL 2W2QE 1HCGB 4ZHAB 2VVUL 1CVWL 4CUDA 2YGOA 5IKQA 1RFNB 2K2TA 4Y76B 3HS5A 4AQTA 1COUA 3ZYJB 2VVCK 1X7AL 4D90A 2WG4B 5EGMB 3HO4A 1SZBA 2WFXB 4RUTA 4JZFL 4XL1A 2TGFA 3HO5A 1EPJA 1FFMA 2MHPA 1HREA 2BQWA 4YZUB 1QFKL 5JB9E 1J9CL 4Y7BB 5FDQA 1OB1C 1EPGA 1JV2B 2P26A 3SW2A 1FAXL 1MOXC 4Z0KB 1IQKL 2AYLA 4LORA 2BQ6A 2I9AA 2G00L 2KL7A 1LQDA 2XBVL 3ELAL 2W2PE 3IJEB 4Y6DB 2ADXA 1YO8A 2FZZL 1CX2A 3HO3A 1K37A 1TLEA 3LIWB 1B9WA 3V65B 3QH0A 4MMYB 1IP0A 3M36L 2DDUA 2EI7B 2J94B 1YUFA 2P16L 3OLTA 3QMOA 5IKTA 3M37L 2VH6B 2J95B 3TGFA 1KSNB 4OTJA 1TPGA 2P3FN 2MGPA 2W2NE 1NZIA 5JBCE 1U8CB 4M11A 3KRKA 4X8SL 3TH3L 1Q4GA 1IQNL 2BOXA 5CKMA 1U67A 1CVUA 1FAKL 4COXA 4CUEA 3CFWA 4TGFA 1I0UA 4X8TL 1FSBA 3ENSA 2RA0L 2FLRL 3IITB 2P28B 6COXA 2GD4A 4BXWA 1WHFA 3DEMA 1W7XL 3SOBB 1ATAA 1WU1B 1KLJL 3LAQA 3KQEL 2D1JB 5F1AA 3NTGA 3U73A 3LTGD 4MMXB 1FJSL 1PXXA 3KQBL 1APQA 3Q7DA 1DDXA 1EQHA 3C9AC 2Y38A 3F1SB 2Y7ZB 4MMZB 1HT8A 4ZXXL 1HAEA 1YUKB 2EI8B 4X8VL 1XDTR 1IQHL 2FLGA 1CEJA 1NFWB 1EMOA 3N8YB 4BXSA 4O02B 2P3UA 3PGHA 1PGEA 2WYGB 2XC5L 2VWNL 4BTIA 3N8ZA 4XLWA 1IJQA 1NPEB 5L2ZL 2RHPA 2W86A 1IQIL 1P9JA 1WHEA 2J2UB 1YGCL 3Q3KB 2WPIE 3GCXE 5K0HB 1W8BL 4BDXA 2WPLE 1G1SA 3V64C 1G1TA 1KLIL 2H9EL 2W26B 3P5BL 3FCSB 1M1XB 4BTTA 1JL9A 1EZQB 3NTBA 5JVYA 2Y5GL 2WPHE 2YGPA 4JYUL 2VH0B 2FD6A 4RS0A 1ATEA 2VWLL 2P94L 2Q1JB 1C5MF 3BT2A 5KN5C 3BT1A 3HS7A 4CUFA 1MQ5L 3CS7L 5I46L 1ADXA 4Z6AL 1NQLB
chains in the Genus database with same CATH superfamily
2PR3B 3GCWE 1A3PA 3K9XA 1HZ8A 2W3IB 3FFGL 1JBUL 3OLUA 2WPKE 5COXA 1IGXA 1UZPA 1LMJA 1CCFA 1AUTL 1G1RA 2KV4A 3KCGL 5JBAE 1IOEL 2B7DL 2BT8A 3LN1A 2P3FL 1PRHA 1EBVA 4O1ZA 1N7DA 1NFYB 1Z6EL 2BOHA 5JBBE 1CCVA 4RRZA 1PTHA 1EAIC 5KIRA 1EQGA 3ZYIB 2CJIB 1O5DL 3KK6A 4RRYA 3N8XA 1IQEL 2VVVL 5CISA 2BMGA 2Y82B 3HPTA 2W2OE 1HX2A 4ZH8B 3KQCL 2P93L 3EGFA 5F19A 1IVOC 3N8WB 1ATBA 2BOKL 1UZKA 2Y5FL 1IGZA 3ASIA 3CENL 4FM5A 2W2ME 4M10A 2VWOL 1MQ6L 2Y5HL 4X8UL 1HJ7A 4Y71B 4JZEL 2FLBL 2H9EC 2BSFA 3U7UG 2WPME 5IKVA 4BDWA 1NFUB 4D0FA 5JVZA 4G1MB 2KB9A 3RR3A 4Z0LA 1YUGA 2MGRA 1HRFA 1V1HA 2Y7XB 1KLOA 2RNLA 3N8WA 3KL6B 2J38B 2W3KB 2WZPP 4LMFA 1BF9A 1F7MA 4ISHL 2OYEP 1LK9A 3NT1A 2M74A 1P0SL 4XBMA 1FF7A 1EGFA 1XKAL 2PUQL 1N1IA 1XFEA 2OYUP 3S6XA 1UZJA 4NG9L 1NFXB 2XC4L 2Y81B 2Y80B 2WYJB 1IQML 2VWMK 2WG3C 1IQJL 3CA7A 1G1QA 1IQFL 1K36A 1G2LB 1EPIA 2XBXL 1Z6CA 1FE2A 2WPJE 1IQLL 2XBWL 3N8VA 4ZAEB 1HT5A 2P3TA 1KKEA 3TBDA 4NA9L 2F9BL 4D0EA 4BTUA 2UWOB 3KQDL 2UWPB 4NGAL 2XC0L 1URKA 3NJPC 3MQEA 1NT0A 4ZXYL 5CKQA 4OTYA 4RRXA 1IQGL 1G2MB 2YGQA 1DIYA 5L30L 3SOVA 4A94C 1V3XB 1GK5A 1DX5I 3MDLA 2BT7A 2KNIA 1V1IA 4A7IA 2VJ3A 1LPGA 2EI6B 1EPHA 2PHBB 3N8YA 2UWLB 4JYVL 1L5GB 4C16A 2BQ7A 2XBYL 3LTFB 3HS6A 2NPRA 4Y7AB 4YT7L 3POYA 2J34B 3BPSE 1HAFA 1KIGL 4RRWA 3GISX 3QCWA 2P95L 5L2YL 1ZAQA 3LC3B 3TZIA 3R05A 5IKRA 1DQBA 4CSYA 3ZYGA 1F0SB 3TK6B 3H5CB 1F0RB 3F6UL 1APOA 1TOZA 1L3YA 2VRSA 2BO2A 3LN0A 1F7EA 1EMNA 1DVAL 4E1GA 1XKBA 2JKHL 1ATDA 2HOXA 5JW1A 3SOQA 3LC5B 3FBYA 2J4IB 3TK5B 5E8DA 1IOXA 4ISIL 4JZDL 5JB8E 1LPKA 2K2SB 2BOUA 4YT6L 5CKNA 2JJLA 2BZ6L 4PH9A 4Y79B 1UZQA 2I9BA 1CQEA 1LPZA 2WFTA 4GU3A 1PFXL 2W2QE 1HCGB 4ZHAB 2VVUL 1CVWL 4CUDA 2YGOA 5IKQA 1RFNB 2K2TA 4Y76B 3HS5A 4AQTA 1COUA 3ZYJB 2VVCK 1X7AL 4D90A 2WG4B 5EGMB 3HO4A 1SZBA 2WFXB 4RUTA 4JZFL 4XL1A 2TGFA 3HO5A 1EPJA 1FFMA 2MHPA 1HREA 2BQWA 4YZUB 1QFKL 5JB9E 1J9CL 4Y7BB 5FDQA 1OB1C 1EPGA 1JV2B 2P26A 3SW2A 1FAXL 1MOXC 4Z0KB 1IQKL 2AYLA 2BQ6A 2I9AA 2G00L 2KL7A 1LQDA 2XBVL 3ELAL 4LORA 2W2PE 3IJEB 4Y6DB 2ADXA 1YO8A 2FZZL 1CX2A 3HO3A 1K37A 1TLEA 3LIWB 1B9WA 3V65B 3QH0A 4MMYB 1IP0A 3M36L 2DDUA 2EI7B 2J94B 1YUFA 2P16L 3OLTA 1QIUA 3QMOA 5IKTA 3M37L 2VH6B 2J95B 3TGFA 1KSNB 4OTJA 1TPGA 2P3FN 2MGPA 2W2NE 1NZIA 5JBCE 1U8CB 4M11A 3KRKA 4X8SL 3TH3L 1Q4GA 1IQNL 2BOXA 5CKMA 1U67A 1CVUA 1FAKL 4COXA 4CUEA 3CFWA 4TGFA 1I0UA 4X8TL 1FSBA 3ENSA 2RA0L 2FLRL 3IITB 2P28B 6COXA 2GD4A 4BXWA 1WHFA 3DEMA 1W7XL 3SOBB 1ATAA 1WU1B 1KLJL 3LAQA 3KQEL 2D1JB 4GU4A 5F1AA 3NTGA 3U73A 3LTGD 4MMXB 1FJSL 1PXXA 3KQBL 1APQA 3Q7DA 1DDXA 1LMMA 1EQHA 3C9AC 2Y38A 3F1SB 2Y7ZB 4MMZB 1HT8A 4ZXXL 1HAEA 1YUKB 2EI8B 4X8VL 1XDTR 1IQHL 2FLGA 1CEJA 1NFWB 1EMOA 3N8YB 4BXSA 4O02B 2P3UA 3PGHA 1PGEA 2WYGB 2XC5L 2VWNL 4BTIA 3N8ZA 4XLWA 1IJQA 1NPEB 5L2ZL 2RHPA 2W86A 1IQIL 1P9JA 1WHEA 2J2UB 1YGCL 3Q3KB 2WPIE 3GCXE 5K0HB 1W8BL 4BDXA 2WPLE 1G1SA 3V64C 1G1TA 1KLIL 2H9EL 2W26B 3P5BL 3FCSB 1M1XB 4BTTA 1JL9A 1EZQB 3NTBA 5JVYA 2Y5GL 2WPHE 2YGPA 4JYUL 2VH0B 2FD6A 4RS0A 1ATEA 2VWLL 2HORA 2P94L 2Q1JB 1C5MF 3BT2A 5KN5C 3BT1A 3HS7A 4CUFA 1MQ5L 3CS7L 5I46L 1ADXA 4Z6AL 1NQLB
chains in the Genus database with same CATH topology
2PR3B 3GCWE 1A3PA 3K9XA 1HZ8A 2W3IB 3FFGL 1JBUL 3OLUA 2WPKE 5COXA 1IGXA 1UZPA 1LMJA 1CCFA 1AUTL 1G1RA 2KV4A 3KCGL 5JBAE 1IOEL 2B7DL 3LN1A 2P3FL 1PRHA 1EBVA 4O1ZA 1N7DA 1NFYB 1Z6EL 2BOHA 5JBBE 1CCVA 4RRZA 1PTHA 1EAIC 5KIRA 1EQGA 3ZYIB 2CJIB 1O5DL 3KK6A 4RRYA 3N8XA 1IQEL 2VVVL 5CISA 2BMGA 2Y82B 3HPTA 2W2OE 1HX2A 4ZH8B 3KQCL 2P93L 3EGFA 5F19A 1IVOC 3N8WB 1ATBA 2BOKL 1UZKA 2Y5FL 1IGZA 3ASIA 3CENL 4FM5A 2W2ME 4M10A 2VWOL 1MQ6L 2Y5HL 4X8UL 1HJ7A 4Y71B 4JZEL 2FLBL 2H9EC 3U7UG 2WPME 5IKVA 4BDWA 1NFUB 4D0FA 5JVZA 4G1MB 2KB9A 3RR3A 4Z0LA 1YUGA 2MGRA 1HRFA 2Y7XB 1KLOA 2RNLA 3N8WA 3KL6B 2J38B 2W3KB 2WZPP 4LMFA 1BF9A 1F7MA 4ISHL 2OYEP 3NT1A 2M74A 1P0SL 4XBMA 1FF7A 1EGFA 1XKAL 2PUQL 1N1IA 1XFEA 2OYUP 3S6XA 1UZJA 4NG9L 1NFXB 2XC4L 2Y81B 2Y80B 2WYJB 1IQML 2VWMK 2WG3C 1IQJL 3CA7A 1G1QA 1IQFL 1K36A 1G2LB 1EPIA 2XBXL 1Z6CA 1FE2A 2WPJE 1IQLL 2XBWL 3N8VA 4ZAEB 1HT5A 2P3TA 3TBDA 4NA9L 2F9BL 4D0EA 4BTUA 2UWOB 3KQDL 2UWPB 4NGAL 2XC0L 1URKA 3NJPC 3MQEA 1NT0A 4ZXYL 5CKQA 4OTYA 4RRXA 1IQGL 1G2MB 2YGQA 1DIYA 5L30L 3SOVA 4A94C 1V3XB 1GK5A 1DX5I 3MDLA 2KNIA 4A7IA 2VJ3A 1LPGA 2EI6B 1EPHA 2PHBB 3N8YA 2UWLB 4JYVL 1L5GB 4C16A 2BQ7A 2XBYL 3LTFB 3HS6A 2NPRA 4Y7AB 4YT7L 3POYA 2J34B 3BPSE 1HAFA 1KIGL 4RRWA 3GISX 3QCWA 2P95L 5L2YL 1ZAQA 3LC3B 3TZIA 3R05A 5IKRA 1DQBA 4CSYA 3ZYGA 1F0SB 3TK6B 3H5CB 1F0RB 3F6UL 1APOA 1TOZA 1L3YA 2BO2A 3LN0A 1F7EA 1EMNA 1DVAL 4E1GA 1XKBA 2JKHL 1ATDA 5JW1A 3SOQA 3LC5B 3FBYA 2J4IB 3TK5B 5E8DA 1IOXA 4ISIL 4JZDL 5JB8E 1LPKA 2K2SB 2BOUA 4YT6L 5CKNA 2BZ6L 4PH9A 4Y79B 1UZQA 2I9BA 1CQEA 1LPZA 2WFTA 1PFXL 2W2QE 1HCGB 4ZHAB 2VVUL 1CVWL 4CUDA 2YGOA 5IKQA 1RFNB 2K2TA 4Y76B 3HS5A 4AQTA 1COUA 3ZYJB 2VVCK 1X7AL 4D90A 2WG4B 5EGMB 3HO4A 1SZBA 2WFXB 4RUTA 4JZFL 4XL1A 2TGFA 3HO5A 1EPJA 1FFMA 2MHPA 1HREA 2BQWA 4YZUB 1QFKL 5JB9E 1J9CL 4Y7BB 5FDQA 1OB1C 1EPGA 1JV2B 2P26A 3SW2A 1FAXL 1MOXC 4Z0KB 1IQKL 2AYLA 4LORA 2BQ6A 2I9AA 2G00L 2KL7A 1LQDA 2XBVL 3ELAL 2W2PE 3IJEB 4Y6DB 2ADXA 1YO8A 2FZZL 1CX2A 3HO3A 1K37A 1TLEA 3LIWB 1B9WA 3V65B 3QH0A 4MMYB 1IP0A 3M36L 2DDUA 2EI7B 2J94B 1YUFA 2P16L 3OLTA 3QMOA 5IKTA 3M37L 2VH6B 2J95B 3TGFA 1KSNB 4OTJA 1TPGA 2P3FN 2MGPA 2W2NE 1NZIA 5JBCE 1U8CB 4M11A 3KRKA 4X8SL 3TH3L 1Q4GA 1IQNL 2BOXA 5CKMA 1U67A 1CVUA 1FAKL 4COXA 4CUEA 3CFWA 4TGFA 1I0UA 4X8TL 1FSBA 3ENSA 2RA0L 2FLRL 3IITB 2P28B 6COXA 2GD4A 4BXWA 1WHFA 3DEMA 1W7XL 3SOBB 1ATAA 1WU1B 1KLJL 3LAQA 3KQEL 2D1JB 5F1AA 3NTGA 3U73A 3LTGD 4MMXB 1FJSL 1PXXA 3KQBL 1APQA 3Q7DA 1DDXA 1LMMA 1EQHA 3C9AC 2Y38A 3F1SB 2Y7ZB 4MMZB 1HT8A 4ZXXL 1HAEA 1YUKB 2EI8B 4X8VL 1XDTR 1IQHL 2FLGA 1CEJA 1NFWB 1EMOA 3N8YB 4BXSA 4O02B 2P3UA 3PGHA 1PGEA 2WYGB 2XC5L 2VWNL 4BTIA 3N8ZA 4XLWA 1IJQA 1NPEB 5L2ZL 2RHPA 2W86A 1IQIL 1P9JA 1WHEA 2J2UB 1YGCL 3Q3KB 2WPIE 3GCXE 5K0HB 1W8BL 4BDXA 2WPLE 1G1SA 3V64C 1G1TA 1KLIL 2H9EL 2W26B 3P5BL 3FCSB 1M1XB 4BTTA 1JL9A 1EZQB 3NTBA 5JVYA 2Y5GL 2WPHE 2YGPA 4JYUL 2VH0B 2FD6A 4RS0A 1ATEA 2VWLL 2P94L 2Q1JB 1C5MF 3BT2A 5KN5C 3BT1A 3HS7A 4CUFA 1MQ5L 3CS7L 5I46L 1ADXA 4Z6AL 1NQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR3 B;  3GCW E;  1A3P A;  3K9X A;  1HZ8 A;  2W3I B;  3FFG L;  1JBU L;  3OLU A;  2WPK E;  5COX A;  1IGX A;  1UZP A;  1LMJ A;  1CCF A;  1AUT L;  1G1R A;  2KV4 A;  3KCG L;  5JBA E;  1IOE L;  2B7D L;  3LN1 A;  2P3F L;  1PRH A;  1EBV A;  4O1Z A;  1N7D A;  1NFY B;  1Z6E L;  2BOH A;  5JBB E;  1CCV A;  4RRZ A;  1PTH A;  1EAI C;  5KIR A;  1EQG A;  3ZYI B;  2CJI B;  1O5D L;  3KK6 A;  4RRY A;  3N8X A;  1IQE L;  2VVV L;  5CIS A;  2BMG A;  2Y82 B;  3HPT A;  2W2O E;  1HX2 A;  4ZH8 B;  3KQC L;  2P93 L;  3EGF A;  5F19 A;  1IVO C;  3N8W B;  1ATB A;  2BOK L;  1UZK A;  2Y5F L;  1IGZ A;  3ASI A;  3CEN L;  4FM5 A;  2W2M E;  4M10 A;  2VWO L;  1MQ6 L;  2Y5H L;  4X8U L;  1HJ7 A;  4Y71 B;  4JZE L;  2FLB L;  3U7U G;  2WPM E;  5IKV A;  4BDW A;  1NFU B;  4D0F A;  5JVZ A;  4G1M B;  2KB9 A;  3RR3 A;  4Z0L A;  1YUG A;  2MGR A;  1HRF A;  2Y7X B;  1KLO A;  2RNL A;  3N8W A;  3KL6 B;  2J38 B;  2W3K B;  4LMF A;  1BF9 A;  1F7M A;  4ISH L;  2OYE P;  3NT1 A;  2M74 A;  1P0S L;  4XBM A;  1FF7 A;  1EGF A;  1XKA L;  2PUQ L;  1N1I A;  1XFE A;  2OYU P;  1UZJ A;  4NG9 L;  1NFX B;  2XC4 L;  2Y81 B;  2Y80 B;  2WYJ B;  1IQM L;  2VWM K;  2WG3 C;  1IQJ L;  3CA7 A;  1G1Q A;  1IQF L;  1K36 A;  1G2L B;  1EPI A;  2XBX L;  1Z6C A;  1FE2 A;  2WPJ E;  1IQL L;  2XBW L;  3N8V A;  4ZAE B;  1HT5 A;  2P3T A;  3TBD A;  4NA9 L;  2F9B L;  4D0E A;  4BTU A;  2UWO B;  3KQD L;  2UWP B;  4NGA L;  2XC0 L;  1URK A;  3NJP C;  3MQE A;  1NT0 A;  4ZXY L;  5CKQ A;  4OTY A;  4RRX A;  1IQG L;  1G2M B;  1DIY A;  5L30 L;  3SOV A;  1V3X B;  1GK5 A;  1DX5 I;  3MDL A;  4A7I A;  2VJ3 A;  1LPG A;  2EI6 B;  1EPH A;  2PHB B;  3N8Y A;  2UWL B;  4JYV L;  1L5G B;  4C16 A;  2BQ7 A;  2XBY L;  3LTF B;  3HS6 A;  2NPR A;  4Y7A B;  4YT7 L;  3POY A;  2J34 B;  3BPS E;  1HAF A;  1KIG L;  4RRW A;  3GIS X;  3QCW A;  2P95 L;  5L2Y L;  1ZAQ A;  3LC3 B;  3TZI A;  3R05 A;  5IKR A;  1DQB A;  4CSY A;  3ZYG A;  1F0S B;  3TK6 B;  3H5C B;  1F0R B;  3F6U L;  1APO A;  1TOZ A;  1L3Y A;  2BO2 A;  3LN0 A;  1F7E A;  1EMN A;  1DVA L;  4E1G A;  1XKB A;  2JKH L;  1ATD A;  5JW1 A;  3SOQ A;  3LC5 B;  3FBY A;  2J4I B;  3TK5 B;  5E8D A;  1IOX A;  4ISI L;  4JZD L;  5JB8 E;  1LPK A;  2K2S B;  2BOU A;  4YT6 L;  5CKN A;  2BZ6 L;  4PH9 A;  4Y79 B;  1UZQ A;  2I9B A;  1CQE A;  1LPZ A;  2WFT A;  1PFX L;  2W2Q E;  1HCG B;  4ZHA B;  2VVU L;  1CVW L;  4CUD A;  2YGO A;  5IKQ A;  1RFN B;  2K2T A;  4Y76 B;  3HS5 A;  4AQT A;  1COU A;  3ZYJ B;  2VVC K;  1X7A L;  4D90 A;  2WG4 B;  5EGM B;  3HO4 A;  1SZB A;  2WFX B;  4RUT A;  4JZF L;  4XL1 A;  2TGF A;  3HO5 A;  1EPJ A;  1FFM A;  2MHP A;  1HRE A;  2BQW A;  4YZU B;  1QFK L;  5JB9 E;  1J9C L;  4Y7B B;  5FDQ A;  1OB1 C;  1EPG A;  1JV2 B;  2P26 A;  3SW2 A;  1FAX L;  1MOX C;  4Z0K B;  1IQK L;  2AYL A;  4LOR A;  2BQ6 A;  2I9A A;  2G00 L;  2KL7 A;  1LQD A;  2XBV L;  3ELA L;  2W2P E;  3IJE B;  4Y6D B;  2ADX A;  1YO8 A;  2FZZ L;  1CX2 A;  3HO3 A;  1K37 A;  1TLE A;  3LIW B;  1B9W A;  3V65 B;  3QH0 A;  4MMY B;  1IP0 A;  3M36 L;  2DDU A;  2EI7 B;  2J94 B;  1YUF A;  2P16 L;  3OLT A;  3QMO A;  5IKT A;  3M37 L;  2VH6 B;  2J95 B;  3TGF A;  1KSN B;  4OTJ A;  1TPG A;  2P3F N;  2MGP A;  2W2N E;  1NZI A;  5JBC E;  1U8C B;  4M11 A;  3KRK A;  4X8S L;  3TH3 L;  1Q4G A;  1IQN L;  2BOX A;  5CKM A;  1U67 A;  1CVU A;  1FAK L;  4COX A;  4CUE A;  3CFW A;  4TGF A;  1I0U A;  4X8T L;  1FSB A;  3ENS A;  2RA0 L;  2FLR L;  3IIT B;  2P28 B;  6COX A;  2GD4 A;  4BXW A;  1WHF A;  3DEM A;  1W7X L;  3SOB B;  1ATA A;  1WU1 B;  1KLJ L;  3LAQ A;  3KQE L;  2D1J B;  5F1A A;  3NTG A;  3U73 A;  3LTG D;  4MMX B;  1FJS L;  1PXX A;  3KQB L;  1APQ A;  3Q7D A;  1DDX A;  1EQH A;  3C9A C;  2Y38 A;  3F1S B;  2Y7Z B;  4MMZ B;  1HT8 A;  4ZXX L;  1HAE A;  1YUK B;  2EI8 B;  4X8V L;  1XDT R;  1IQH L;  2FLG A;  1CEJ A;  1NFW B;  1EMO A;  3N8Y B;  4BXS A;  4O02 B;  2P3U A;  3PGH A;  1PGE A;  2WYG B;  2XC5 L;  2VWN L;  4BTI A;  3N8Z A;  4XLW A;  1IJQ A;  1NPE B;  5L2Z L;  2RHP A;  2W86 A;  1IQI L;  1P9J A;  1WHE A;  2J2U B;  1YGC L;  3Q3K B;  2WPI E;  3GCX E;  5K0H B;  1W8B L;  4BDX A;  2WPL E;  1G1S A;  3V64 C;  1G1T A;  1KLI L;  2H9E L;  2W26 B;  3P5B L;  3FCS B;  1M1X B;  4BTT A;  1JL9 A;  1EZQ B;  3NTB A;  5JVY A;  2Y5G L;  2WPH E;  2YGP A;  4JYU L;  2VH0 B;  2FD6 A;  4RS0 A;  1ATE A;  2VWL L;  2P94 L;  2Q1J B;  1C5M F;  3BT2 A;  5KN5 C;  3BT1 A;  3HS7 A;  4CUF A;  1MQ5 L;  3CS7 L;  5I46 L;  1ADX A;  4Z6A L;  1NQL B; 
#chains in the Genus database with same CATH topology
 2PR3 B;  3GCW E;  1A3P A;  3K9X A;  1HZ8 A;  2W3I B;  3FFG L;  1JBU L;  3OLU A;  2WPK E;  5COX A;  1IGX A;  1UZP A;  1LMJ A;  1CCF A;  1AUT L;  1G1R A;  2KV4 A;  3KCG L;  5JBA E;  1IOE L;  2B7D L;  2BT8 A;  3LN1 A;  2P3F L;  1PRH A;  1EBV A;  4O1Z A;  1N7D A;  1NFY B;  1Z6E L;  2BOH A;  5JBB E;  1CCV A;  4RRZ A;  1PTH A;  1EAI C;  5KIR A;  1EQG A;  3ZYI B;  2CJI B;  1O5D L;  3KK6 A;  4RRY A;  3N8X A;  1IQE L;  2VVV L;  5CIS A;  2BMG A;  2Y82 B;  3HPT A;  2W2O E;  1HX2 A;  4ZH8 B;  3KQC L;  2P93 L;  3EGF A;  5F19 A;  1IVO C;  3N8W B;  1ATB A;  2BOK L;  1UZK A;  2Y5F L;  1IGZ A;  3ASI A;  3CEN L;  4FM5 A;  2W2M E;  4M10 A;  2VWO L;  1MQ6 L;  2Y5H L;  4X8U L;  1HJ7 A;  4Y71 B;  4JZE L;  2FLB L;  2H9E C;  2BSF A;  3U7U G;  2WPM E;  5IKV A;  4BDW A;  1NFU B;  4D0F A;  5JVZ A;  4G1M B;  2KB9 A;  3RR3 A;  4Z0L A;  1YUG A;  2MGR A;  1HRF A;  1V1H A;  2Y7X B;  1KLO A;  2RNL A;  3N8W A;  3KL6 B;  2J38 B;  2W3K B;  2WZP P;  4LMF A;  1BF9 A;  1F7M A;  4ISH L;  2OYE P;  1LK9 A;  3NT1 A;  2M74 A;  1P0S L;  4XBM A;  1FF7 A;  1EGF A;  1XKA L;  2PUQ L;  1N1I A;  1XFE A;  2OYU P;  3S6X A;  1UZJ A;  4NG9 L;  1NFX B;  2XC4 L;  2Y81 B;  2Y80 B;  2WYJ B;  1IQM L;  2VWM K;  2WG3 C;  1IQJ L;  3CA7 A;  1G1Q A;  1IQF L;  1K36 A;  1G2L B;  1EPI A;  2XBX L;  1Z6C A;  1FE2 A;  2WPJ E;  1IQL L;  2XBW L;  3N8V A;  4ZAE B;  1HT5 A;  2P3T A;  1KKE A;  3TBD A;  4NA9 L;  2F9B L;  4D0E A;  4BTU A;  2UWO B;  3KQD L;  2UWP B;  4NGA L;  2XC0 L;  1URK A;  3NJP C;  3MQE A;  1NT0 A;  4ZXY L;  5CKQ A;  4OTY A;  4RRX A;  1IQG L;  1G2M B;  2YGQ A;  1DIY A;  5L30 L;  3SOV A;  4A94 C;  1V3X B;  1GK5 A;  1DX5 I;  3MDL A;  2BT7 A;  2KNI A;  1V1I A;  4A7I A;  2VJ3 A;  1LPG A;  2EI6 B;  1EPH A;  2PHB B;  3N8Y A;  2UWL B;  4JYV L;  1L5G B;  4C16 A;  2BQ7 A;  2XBY L;  3LTF B;  3HS6 A;  2NPR A;  4Y7A B;  4YT7 L;  3POY A;  2J34 B;  3BPS E;  1HAF A;  1KIG L;  4RRW A;  3GIS X;  3QCW A;  2P95 L;  5L2Y L;  1ZAQ A;  3LC3 B;  3TZI A;  3R05 A;  5IKR A;  1DQB A;  4CSY A;  3ZYG A;  1F0S B;  3TK6 B;  3H5C B;  1F0R B;  3F6U L;  1APO A;  1TOZ A;  1L3Y A;  2VRS A;  2BO2 A;  3LN0 A;  1F7E A;  1EMN A;  1DVA L;  4E1G A;  1XKB A;  2JKH L;  1ATD A;  2HOX A;  5JW1 A;  3SOQ A;  3LC5 B;  3FBY A;  2J4I B;  3TK5 B;  5E8D A;  1IOX A;  4ISI L;  4JZD L;  5JB8 E;  1LPK A;  2K2S B;  2BOU A;  4YT6 L;  5CKN A;  2JJL A;  2BZ6 L;  4PH9 A;  4Y79 B;  1UZQ A;  2I9B A;  1CQE A;  1LPZ A;  2WFT A;  4GU3 A;  1PFX L;  2W2Q E;  1HCG B;  4ZHA B;  2VVU L;  1CVW L;  4CUD A;  2YGO A;  5IKQ A;  1RFN B;  2K2T A;  4Y76 B;  3HS5 A;  4AQT A;  1COU A;  3ZYJ B;  2VVC K;  1X7A L;  4D90 A;  2WG4 B;  5EGM B;  3HO4 A;  1SZB A;  2WFX B;  4RUT A;  4JZF L;  4XL1 A;  2TGF A;  3HO5 A;  1EPJ A;  1FFM A;  2MHP A;  1HRE A;  2BQW A;  4YZU B;  1QFK L;  5JB9 E;  1J9C L;  4Y7B B;  5FDQ A;  1OB1 C;  1EPG A;  1JV2 B;  2P26 A;  3SW2 A;  1FAX L;  1MOX C;  4Z0K B;  1IQK L;  2AYL A;  2BQ6 A;  2I9A A;  2G00 L;  2KL7 A;  1LQD A;  2XBV L;  3ELA L;  4LOR A;  2W2P E;  3IJE B;  4Y6D B;  2ADX A;  1YO8 A;  2FZZ L;  1CX2 A;  3HO3 A;  1K37 A;  1TLE A;  3LIW B;  1B9W A;  3V65 B;  3QH0 A;  4MMY B;  1IP0 A;  3M36 L;  2DDU A;  2EI7 B;  2J94 B;  1YUF A;  2P16 L;  3OLT A;  1QIU A;  3QMO A;  5IKT A;  3M37 L;  2VH6 B;  2J95 B;  3TGF A;  1KSN B;  4OTJ A;  1TPG A;  2P3F N;  2MGP A;  2W2N E;  1NZI A;  5JBC E;  1U8C B;  4M11 A;  3KRK A;  4X8S L;  3TH3 L;  1Q4G A;  1IQN L;  2BOX A;  5CKM A;  1U67 A;  1CVU A;  1FAK L;  4COX A;  4CUE A;  3CFW A;  4TGF A;  1I0U A;  4X8T L;  1FSB A;  3ENS A;  2RA0 L;  2FLR L;  3IIT B;  2P28 B;  6COX A;  2GD4 A;  4BXW A;  1WHF A;  3DEM A;  1W7X L;  3SOB B;  1ATA A;  1WU1 B;  1KLJ L;  3LAQ A;  3KQE L;  2D1J B;  4GU4 A;  5F1A A;  3NTG A;  3U73 A;  3LTG D;  4MMX B;  1FJS L;  1PXX A;  3KQB L;  1APQ A;  3Q7D A;  1DDX A;  1LMM A;  1EQH A;  3C9A C;  2Y38 A;  3F1S B;  2Y7Z B;  4MMZ B;  1HT8 A;  4ZXX L;  1HAE A;  1YUK B;  2EI8 B;  4X8V L;  1XDT R;  1IQH L;  2FLG A;  1CEJ A;  1NFW B;  1EMO A;  3N8Y B;  4BXS A;  4O02 B;  2P3U A;  3PGH A;  1PGE A;  2WYG B;  2XC5 L;  2VWN L;  4BTI A;  3N8Z A;  4XLW A;  1IJQ A;  1NPE B;  5L2Z L;  2RHP A;  2W86 A;  1IQI L;  1P9J A;  1WHE A;  2J2U B;  1YGC L;  3Q3K B;  2WPI E;  3GCX E;  5K0H B;  1W8B L;  4BDX A;  2WPL E;  1G1S A;  3V64 C;  1G1T A;  1KLI L;  2H9E L;  2W26 B;  3P5B L;  3FCS B;  1M1X B;  4BTT A;  1JL9 A;  1EZQ B;  3NTB A;  5JVY A;  2Y5G L;  2WPH E;  2YGP A;  4JYU L;  2VH0 B;  2FD6 A;  4RS0 A;  1ATE A;  2VWL L;  2HOR A;  2P94 L;  2Q1J B;  1C5M F;  3BT2 A;  5KN5 C;  3BT1 A;  3HS7 A;  4CUF A;  1MQ5 L;  3CS7 L;  5I46 L;  1ADX A;  4Z6A L;  1NQL B; 
#chains in the Genus database with same CATH homology
 2PR3 B;  3GCW E;  1A3P A;  3K9X A;  1HZ8 A;  2W3I B;  3FFG L;  1JBU L;  3OLU A;  2WPK E;  5COX A;  1IGX A;  1UZP A;  1LMJ A;  1CCF A;  1AUT L;  1G1R A;  2KV4 A;  3KCG L;  5JBA E;  1IOE L;  2B7D L;  3LN1 A;  2P3F L;  1PRH A;  1EBV A;  4O1Z A;  1N7D A;  1NFY B;  1Z6E L;  2BOH A;  5JBB E;  1CCV A;  4RRZ A;  1PTH A;  1EAI C;  5KIR A;  1EQG A;  3ZYI B;  2CJI B;  1O5D L;  3KK6 A;  4RRY A;  3N8X A;  1IQE L;  2VVV L;  5CIS A;  2BMG A;  2Y82 B;  3HPT A;  2W2O E;  1HX2 A;  4ZH8 B;  3KQC L;  2P93 L;  3EGF A;  5F19 A;  1IVO C;  3N8W B;  1ATB A;  2BOK L;  1UZK A;  2Y5F L;  1IGZ A;  3ASI A;  3CEN L;  4FM5 A;  2W2M E;  4M10 A;  2VWO L;  1MQ6 L;  2Y5H L;  4X8U L;  1HJ7 A;  4Y71 B;  4JZE L;  2FLB L;  2H9E C;  3U7U G;  2WPM E;  5IKV A;  4BDW A;  1NFU B;  4D0F A;  5JVZ A;  4G1M B;  2KB9 A;  3RR3 A;  4Z0L A;  1YUG A;  2MGR A;  1HRF A;  2Y7X B;  1KLO A;  2RNL A;  3N8W A;  3KL6 B;  2J38 B;  2W3K B;  2WZP P;  4LMF A;  1BF9 A;  1F7M A;  4ISH L;  2OYE P;  3NT1 A;  2M74 A;  1P0S L;  4XBM A;  1FF7 A;  1EGF A;  1XKA L;  2PUQ L;  1N1I A;  1XFE A;  2OYU P;  3S6X A;  1UZJ A;  4NG9 L;  1NFX B;  2XC4 L;  2Y81 B;  2Y80 B;  2WYJ B;  1IQM L;  2VWM K;  2WG3 C;  1IQJ L;  3CA7 A;  1G1Q A;  1IQF L;  1K36 A;  1G2L B;  1EPI A;  2XBX L;  1Z6C A;  1FE2 A;  2WPJ E;  1IQL L;  2XBW L;  3N8V A;  4ZAE B;  1HT5 A;  2P3T A;  3TBD A;  4NA9 L;  2F9B L;  4D0E A;  4BTU A;  2UWO B;  3KQD L;  2UWP B;  4NGA L;  2XC0 L;  1URK A;  3NJP C;  3MQE A;  1NT0 A;  4ZXY L;  5CKQ A;  4OTY A;  4RRX A;  1IQG L;  1G2M B;  2YGQ A;  1DIY A;  5L30 L;  3SOV A;  4A94 C;  1V3X B;  1GK5 A;  1DX5 I;  3MDL A;  2KNI A;  4A7I A;  2VJ3 A;  1LPG A;  2EI6 B;  1EPH A;  2PHB B;  3N8Y A;  2UWL B;  4JYV L;  1L5G B;  4C16 A;  2BQ7 A;  2XBY L;  3LTF B;  3HS6 A;  2NPR A;  4Y7A B;  4YT7 L;  3POY A;  2J34 B;  3BPS E;  1HAF A;  1KIG L;  4RRW A;  3GIS X;  3QCW A;  2P95 L;  5L2Y L;  1ZAQ A;  3LC3 B;  3TZI A;  3R05 A;  5IKR A;  1DQB A;  4CSY A;  3ZYG A;  1F0S B;  3TK6 B;  3H5C B;  1F0R B;  3F6U L;  1APO A;  1TOZ A;  1L3Y A;  2BO2 A;  3LN0 A;  1F7E A;  1EMN A;  1DVA L;  4E1G A;  1XKB A;  2JKH L;  1ATD A;  5JW1 A;  3SOQ A;  3LC5 B;  3FBY A;  2J4I B;  3TK5 B;  5E8D A;  1IOX A;  4ISI L;  4JZD L;  5JB8 E;  1LPK A;  2K2S B;  2BOU A;  4YT6 L;  5CKN A;  2BZ6 L;  4PH9 A;  4Y79 B;  1UZQ A;  2I9B A;  1CQE A;  1LPZ A;  2WFT A;  1PFX L;  2W2Q E;  1HCG B;  4ZHA B;  2VVU L;  1CVW L;  4CUD A;  2YGO A;  5IKQ A;  1RFN B;  2K2T A;  4Y76 B;  3HS5 A;  4AQT A;  1COU A;  3ZYJ B;  2VVC K;  1X7A L;  4D90 A;  2WG4 B;  5EGM B;  3HO4 A;  1SZB A;  2WFX B;  4RUT A;  4JZF L;  4XL1 A;  2TGF A;  3HO5 A;  1EPJ A;  1FFM A;  2MHP A;  1HRE A;  2BQW A;  4YZU B;  1QFK L;  5JB9 E;  1J9C L;  4Y7B B;  5FDQ A;  1OB1 C;  1EPG A;  1JV2 B;  2P26 A;  3SW2 A;  1FAX L;  1MOX C;  4Z0K B;  1IQK L;  2AYL A;  4LOR A;  2BQ6 A;  2I9A A;  2G00 L;  2KL7 A;  1LQD A;  2XBV L;  3ELA L;  2W2P E;  3IJE B;  4Y6D B;  2ADX A;  1YO8 A;  2FZZ L;  1CX2 A;  3HO3 A;  1K37 A;  1TLE A;  3LIW B;  1B9W A;  3V65 B;  3QH0 A;  4MMY B;  1IP0 A;  3M36 L;  2DDU A;  2EI7 B;  2J94 B;  1YUF A;  2P16 L;  3OLT A;  3QMO A;  5IKT A;  3M37 L;  2VH6 B;  2J95 B;  3TGF A;  1KSN B;  4OTJ A;  1TPG A;  2P3F N;  2MGP A;  2W2N E;  1NZI A;  5JBC E;  1U8C B;  4M11 A;  3KRK A;  4X8S L;  3TH3 L;  1Q4G A;  1IQN L;  2BOX A;  5CKM A;  1U67 A;  1CVU A;  1FAK L;  4COX A;  4CUE A;  3CFW A;  4TGF A;  1I0U A;  4X8T L;  1FSB A;  3ENS A;  2RA0 L;  2FLR L;  3IIT B;  2P28 B;  6COX A;  2GD4 A;  4BXW A;  1WHF A;  3DEM A;  1W7X L;  3SOB B;  1ATA A;  1WU1 B;  1KLJ L;  3LAQ A;  3KQE L;  2D1J B;  5F1A A;  3NTG A;  3U73 A;  3LTG D;  4MMX B;  1FJS L;  1PXX A;  3KQB L;  1APQ A;  3Q7D A;  1DDX A;  1LMM A;  1EQH A;  3C9A C;  2Y38 A;  3F1S B;  2Y7Z B;  4MMZ B;  1HT8 A;  4ZXX L;  1HAE A;  1YUK B;  2EI8 B;  4X8V L;  1XDT R;  1IQH L;  2FLG A;  1CEJ A;  1NFW B;  1EMO A;  3N8Y B;  4BXS A;  4O02 B;  2P3U A;  3PGH A;  1PGE A;  2WYG B;  2XC5 L;  2VWN L;  4BTI A;  3N8Z A;  4XLW A;  1IJQ A;  1NPE B;  5L2Z L;  2RHP A;  2W86 A;  1IQI L;  1P9J A;  1WHE A;  2J2U B;  1YGC L;  3Q3K B;  2WPI E;  3GCX E;  5K0H B;  1W8B L;  4BDX A;  2WPL E;  1G1S A;  3V64 C;  1G1T A;  1KLI L;  2H9E L;  2W26 B;  3P5B L;  3FCS B;  1M1X B;  4BTT A;  1JL9 A;  1EZQ B;  3NTB A;  5JVY A;  2Y5G L;  2WPH E;  2YGP A;  4JYU L;  2VH0 B;  2FD6 A;  4RS0 A;  1ATE A;  2VWL L;  2P94 L;  2Q1J B;  1C5M F;  3BT2 A;  5KN5 C;  3BT1 A;  3HS7 A;  4CUF A;  1MQ5 L;  3CS7 L;  5I46 L;  1ADX A;  4Z6A L;  1NQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...