1FAYA

Winged bean acidic lectin complexed with methyl-alpha-d-galactose (monoclinic form)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
236
structure length
236
Chain Sequence
ETQSFNFDHFEENSKELNLQRQASIKSNGVLELTKLTKNGVPVWKSTGRALYAEPIKIWDSTTGNVASFETRFSFNITQPYAYPEPADGLTFFMVPPNSPQGEDGGNLGVFKPPEGDNAFAVEFDTFQNTWDPQVPHIGIDVNSIVSSKTLHFQLENGGVANVVIKYDSPTKILNVVLAFHSVGTVYTLSNIVDLKQEFPNSEWVNVGLSATTGYQKNAVETHEIISWSFTSSLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate specificity and salt-bridge mediated conformational change in acidic winged bean agglutinin.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords ACIDIC LECTIN
total genus 44
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fayA00
1WBLA 2DVBA 4R9DA 2EIGA 2RHPA 4LBJA 4U36A 2C9AA 3ILNA 4XOGA 4AVTA 1HQWA 3AJYA 1G9CA 1XQNA 1U0AA 4DFSA 3AXDA 4XJUA 4LBLA 2XG3A 1SBEA 1ONAA 1WW7A 2ZGUA 1W6OB 1UPSA 3POWA 4WZFA 4Y1UA 5GLUA 3N36A 3WHUA 4Q8LA 3ZSJA 4LBOA 1UL9A 2DUOA 3WDYA 1OKQA 2ZHKA 1WBFA 1MS1A 5EYXA 1MS5A 4K1YA 5DZEA 4XBNA 4M00A 1H30A 2DUPA 2E7QA 1AF9A 2XB6C 3AYEA 3ILFA 1SLAA 3BODA 4FOWA 1Q8OA 2YY1A 3WNXA 1DHKB 2OUHA 1H9WA 1SACA 2ZHNA 2D6PA 3VUOA 1GZCA 3RS6A 5AVAA 1D0HA 5HCBA 1LGBA 2A6WA 3FLTA 2EXHA 4FPGA 2GNTA 3OYWB 2ZGQA 4FPOB 4LBNA 1GYKA 4YW4A 1VALA 3VKLA 1C4RA 5T55A 1QNWA 1PZ7A 1Q8QA 2A6ZA 3N7LA 1QGLA 1RITA 2E53A 4YFZA 2WT1A 2JJ6A 3ZSLA 5JMCA 1URXA 2DWRA 4K21A 3APBA 2A3WA 2A71A 2CYFA 2DTYA 1QMJA 2E7TA 4DRVA 2AH2A 4BOWA 4ZKTB 2ZMKA 2ZHMA 3A4UA 1LHOA 4W65A 1WW5A 4L8QA 2JKBA 1A3KA 1DBNA 3AFKA 3RMYA 3ZXKA 1VLNA 4K20A 2V73A 4M3CE 4ISQA 4YGCA 1W6OA 3AX4A 3ZYPA 1FATA 4FPLA 4SLIA 1C1FA 1LU1A 1S1AA 4TYSA 2ERFA 4GXLA 1W6QB 4U2AA 3KM5A 3AZZA 1LGCA 4P14A 4XBLA 3UL2A 5GM0A 2OW4A 1UKGA 1LOGA 1DGLA 3BTAA 2R16A 1JUIA 1LJ7A 2EXKA 3OGGA 5E89A 5CA6A 1BQPA 1GNHA 2H0BA 3M3QA 3O5SA 4XJ8A 1S0JA 4M3CA 4XBQA 1S0GA 2UWBA 3AP6A 5E88A 3D6EA 3T1LA 5GZEA 2R0FA 1ZM1A 4LBQD 3OY8B 5GLVA 1G9AA 3HN1A 2ZKNA 1DQ0A 2PHTA 4YW2A 5KXDA 3W58A 2ZA9A 3B69A 3PMEA 3WG3A 1H9PA 3QCWA 4GKYA 3N7JA 1CN1A 3AZWA 2D6KA 1GICA 1W6MB 1JN2P 3C2UA 4Y24A 4FQZA 3AP5A 1X50A 5KXBA 2A6XA 2GN3A 1SLBA 4YZ3A 4JC1A 4Q2FA 2FMDA 1FYUA 2WT0A 4WVWA 1DYKA 1LEDA 2GNMA 2P37A 2GALA 3ENRA 5DG1A 1DZQA 4LBMA 4YZ4A 5DUWA 2CY6A 2JECA 3VV1A 4AVVA 1SCRA 3H0OA 1G86A 4XDQA 1JYCA 4CRQA 2WT2A 1NLSA 4R9BA 3WDUA 4BLIA 4Y22B 3ZSMA 5CBLA 1I1EA 1LOEA 1WW4A 2VW1A 2GNBA 3M3OA 4I30A 5L73A 1APNA 4CTEA 1CQ9A 2NMNA 4GWNA 4Y22A 5F5QA 5T5JA 4DPNA 5JDBA 4DQAA 2DVFA 3MEPA 4FPYA 3AYDA 2ZMNA 3M2MA 3TAYA 3M3CA 1N47A 4M3CB 4YGDA 2YZ4A 1W6NB 2GDFA 5DUUA 4PQ9A 1WLCA 3MPPG 1N3PA 1S0FA 4YM1A 4JCKA 2OUJA 3IMNA 3V0BB 4Q1RA 4ATEA 3FUOA 2PHRA 3B3QE 2R0HA 1G9BA 4XJZA 1W6MA 3POYA 2NP0A 1GBGA 3A0KA 3WOGA 1CESA 5E8AA 1BYHA 2A3YA 3WLUA 4XIOA 4KBBA 4Q1PA 1AXYA 1G9DA 5FREA 2P3KA 3PVEA 2R1BA 4Z8BA 1LOFC 2D6MA 2YROA 3R4UA 4XXAA 1KJRA 5DUXA 3AYCA 1UZZA 1MS8A 3LSEA 3O0WA 4AGVA 1CVNA 2JE9A 3JU9A 1FV3A 3A0NA 2ZGSA 4YLZA 1LECA 3M1HA 4Q26A 1LCLA 1V6LA 1MZ5A 1YYNA 2PHFA 3SLIA 4XXPA 2PHWA 4PF5A 3WCSA 4YFWA 1FX5A 1RINA 4Y26A 1Q8VA 2AYHA 1JXNA 3OY8A 1KJLA 3CNAA 2ZGTA 4XMIA 4BLJA 1GZ9A 1VAMA 1Z0HA 3I8TA 4DRRA 2LTNA 3DGTA 3SISA 1IOAA 1S0IA 3AZYA 4PBPA 4P9WA 1LOAA 2WLQA 1S0CA 4TZDA 1MACA 1FNYA 3WCRA 4Y1YA 4YGEA 3ZXEA 2E51A 4FQ4A 1GV9A 3JUUA 2A3XA 3RMXA 1ULCA 2AGSA 4P9XA 4YGBA 3OBRA 3AP7A 1ENQA 1ZA4A 2D3SA 3MW2A 4GA9A 1LOBA 3T1MA 2DU0A 4XHBA 3UJOA 4Y1ZA 4AYUA 2VY0A 5IK7A 2ZGKA 2DYCA 1Q56A 1DLLA 1DQ5A 1QDOA 1V6MA 2GN7A 3FUQA 3V0BA 1GNZA 3UK9A 4F83A 2D6LX 4FPCA 1QDCA 2R49A 3WDWA 3O0VA 2D43A 1CPNA 2JD4A 5T54A 2NYYA 1FAYA 1ULDA 2NN8A 1DQ1A 4LBQB 2CWMA 4Q27A 2NM1A 3I4IA 3WUDA 2JE7A 5T50A 4UW3A 4XYXA 2D3RA 3UJQA 1S0EA 2A5ZA 1G9FA 1GKBA 5T5LA 2UWCA 2A6VA 5HCFA 3QLQA 5GZDA 4D69A 1UAIA 1Z78A 5JVVA 3WG4A 2PELA 3ILRA 1SBDA 1IS6A 2VXRA 3USUB 3OPZA 1MS4A 4XIKA 4DS0A 1PZ9A 4FP3A 1VAVA 5GZFA 2ZGNA 5F9TA 2D7FA 1IS3A 1QOSA 4Y1VA 1YO8A 1AX2A 1ULGA 3BOPA 1S0DA 1Y7BA 2WSUA 3SITA 5DXDA 2C5DA 2UWAA 4RL7A 1AJKA 2ZGOA 3AYAA 2ZHLA 3INAA 3KQRA 4Y20B 2A70A 5T52A 3AK0A 4XE9A 5H9SA 3V0AA 1BZWA 2DTWA 3OBTA 3GALA 4NOTA 3ZYRA 4XTPA 1LTEA 3FBYA 3SNMA 2VH9A 1CPMA 3B01A 4LBKA 4FPJA 4PBOA 3IM0A 5GLZA 1SLCA 4C1XA 1ENSA 1MVEA 4FOVA 1AX0A 2WNEA 3RQ0A 2AENA 5GZGA 2FHRA 2BQPA 3WUCA 2W08A 1LOCA 1MS0A 1WW6A 1W6QA 2ARBA 3B00A 3SH3A 1LENA 4OZXA 1FV2A 5IK4A 4CZSA 2DVGA 1I3HA 1JOJA 1CIWA 3D4KA 2GNDA 3GNEA 1LGNA 4JRAA 4UW6A 3ZVXA 4BMBA 2A6YA 5JOZA 4XJAA 3IPVB 2EF6A 1LU2A 2NZ9A 4HL0A 1IKPA 3BIWE 2ZAAA 4FPKA 4BM8A 4FPFA 5KXEA 5KXCA 3ZPYA 1ULEA 4BMEA 1J1TA 2W39A 2VW2A 2NMOA 2GMPA 3IPVA 4FOYA 2ES3A 2Z42A 1MS9A 2W68A 3OJBA 1DQ4A 5JOWA 2AR6A 2CTVA 4H55A 5HCAA 1N1YA 1JBCA 2D6NA 4AGGA 1CJPA 3IN9A 3POSA 2P3IA 4XHXA 5DZFA 1YI7A 4AGRA 2W52A 1UN1A 3AZXA 3WV6A 1UZYA 1QKQA 4YG3A 5GALA 4YM3A 4YZ1A 1DFQA 1WD4A 2ZGRA 5EXOA 3VKFC 4XTMA 3U4XA 3M3EA 4YM2A 3N7KA 2EAKA 4FVVA 3O12A 3WZ1A 3PJQA 4PCRA 4ITCA 4M01A 1QNYA 1DYPA 1GZWA 1SLTA 2WJSA 1N3QA 1GSLA 1JW6A 4NO4A 4FP2A 4M3CF 2UU8A 1JYIA 1LULA 3ASIA 4ASMB 4P9YA 1W6PB 1N3OA 3IKWA 1LHNA 1UMZA 1JHNA 2ARXA 2A75A 4FPHA 1KITA 2P3JA 4UW5A 4K1ZA 4GWMA 4XJ9A 4ZXKA 1CR7A 3PVOA 1OQ1A 5IUQA 3FLPA 3D5OA 1G7YA 4LBQA 5DG2A 5H9RA 2VU9A 3ZXJA 1MS3A 3ZSKA 3NWKA 2ZGMA 5CAZA 1SFYA 1IKQA 3LCPA 2PHUA 1QF3A 2JDZA 1SLLA 2DU1A 1RIRA 3ATGA 4C1WA 1MR5A 1NXD1 1G8WA 3USUA 1F31A 2A7AA 3WDXA 2G4IA 4GKXA 1V6OA 2ZACA 1AVBA 3B9CA 3WDTA 1W6PA 5IK5A 3NV3A 2P34A 4Y1XA 1AJOA 1DQ6A 1IS4A 1LODA 4YZ5A 5IK8A 4GALA 1MZ6A 1S0BA 1WLDA 4AWDA 2DUQA 1C1LA 2E6VA 3ZXLA 3V65A 3AZVA 2VUAA 1B09A 1CONA 3AP4A 1YRZA 5H9PA 3WVJA 1W0OA 3WHTA 3T2TA 2SBAA 2EXIA 4XMAA 5BYNA 1QOOA 1V6JA 1HDKA 2EXJA 3PVNA 3NV4A 4YG0A 2EALA 3SH5A 2GMEA 1QU0A 1O4ZA 4WV8A 1WLWA 3TB0A 3AJZA 4UW4A 2HYKA 2WQZC 4XILA 1YIFA 3V64A 5H9QA 3V0AB 4XJWA 1ULFA 1AZDA 1GANA 1Q8SA 2TEPA 5JLVA 2DURA 4Y20A 5SV8A 3RRDA 4R9CA 1W0PA 1MVQA 2V5YA 3AP9A 2ZGPA 1V00A 3FLRA 3MW4A 4Q8KA 3OYWA 3LSDA 2AREA 4IQPA 1QOTA 1F5FA 1F9KA 2ENRA 2GMMA 4BQ1A 1DQ2A 1EPWA 1FNZA 2D3PA 3DUIA 1YXWA 3WG2A 4MYEA 5JOXA 2OVUA 1WD3A 2D6OX 2CWSA 2ZBJA 1KDKA 1D2SA 1HQLA 2LALA 2P2KA 1V6NA 3WDVA 5DZGA 1GZWB 5GLWA 1SLIA 5T5OA 1KQRA 2SLIA 3VKNA 2CL2A 2B7YA 2WKKA 4WVVA 5JOYA 1C57A 1DIWA 1N1TA 2YV8A 4BPZA 3N7MA 4AVSA 1R1ZA 3Q9OA 4FPEA 5GLTA 2UURA 3HR9A 2YMZA 3NV1A 4XZPA 4YW5A 3R05A 5LK5A 2ZABA 1Q8PA 2R1DA 3MW3A 1UX6A 1W6NA 2KM2A 4YW3A 3NV2A 3W59A 3RG0A 1V6IA 3AXEA 5T5PA 2YXSA 1LHVA 2ZGLA 1LOFA 2I2SA 2ZMLA 3R4SA 1VIWB 3N3HA 1GLHA 3ZXFA 3N35A 1TEIA 3O0XA 3SH4A 5EWSA 4ATFA 1AXZA 5GZCA 2WSVA 5FRAA 1N1SA 4YG6A 2DV9A 2CNAA 2D44A 3HMYA 2Q5TA 1A8DA 2DVDA 3VKMA 1PZ8A 2DVAA 2PHXA 5IT6A 3WG1A 5DUVA 1BXHA 4R9AA 5EYYA 3VKOA 1BJQA 5CNAA 3RSJA 1LEMA 1IS5A 1AXKA 1KRIA 1O4YA 5CB7A 1A78A 1OFSA 4YM0A 4FOQA 4HANA 1LHWA 1KDMA 2ZZJA 1LESA 1SBFA 3FFZA 1LHUA 1WCSA 3L2YA 1AX1A 5GJ6A 1BKZA 2AUYA 1HLCA 1V6KA 2VW0A 1HKDA 4YW1A 1SCSA 4ISRA 4RA0A 1WUVA 1ENRA 4YZ2A 1N1VA
chains in the Genus database with same CATH superfamily
1WBLA 1CAWA 2DVBA 2EIGA 3BVCA 1VRH2 4LBJA 2C9AA 4XOGA 4AVTA 5A70A 1HQWA 3ZYHA 1C5IA 4CUGA 5LB6A 4I01A 2FZ2A 4E4HA 4FTEA 1U0AA 4XAAA 4Q4X2 4XJUA 2Y0IA 1PVXA 4BCUA 3FL7A 2RS33 1W6OB 3LGRA 4ZXEA 3ZSJA 5FYHA 2Y26A 2BOIA 2DUOA 1OKQA 4YW7A 4K1YA 4KWLA 1ODNA 4AK3A 3RZLA 2WNVA 2XB6C 1QJY1 3OSDA 3BODA 4L0PA 4UFJA 1Q8OA 2YY1A 4CUCA 5FIXA 4IXLA 1W3XA 2ZHNA 2D6PA 5JXJA 1CZTA 2ZX4A 5AVAA 1NY72 3RS6A 1LGBA 2HH9A 2XOMA 1EV11 4FPGA 4LBNA 1GYKA 4O9GA 5A3OA 1C4RA 5EJZB 4K9SA 1PZ7A 1Q8QA 3AFGA 3N7LA 1QGLA 1VBE3 1HRV1 2X10A 5I8YA 5JMCA 3BI3A 5FZEA 3PJYA 5BNOC 2XXZA 1QMJA 3BU7A 4WVZA 4DRVA 1ULOA 1W9YA 2CU5A 4BWOA 1UU4A 5JUVA 4XACA 3RNSA 5TSWA 3J8F1 4Q4W1 1A3KA 3VL9A 5FZ9A 2IXHA 2VG9A 2RVAA 4YGCA 4M3CE 2JICA 1W6OA 1S2KA 3AX4A 4UAPA 3ZYPA 1HV0A 1LU1A 1S1AA 2W92A 2ERFA 4TYSA 4XF4A 5IVYA 4CYDA 3VDDC 4V2WA 3W5NA 4P14A 1NCQA 1UD1A 1US3A 3PU3A 4D8MA 5FZ0A 1JUIA 1LJ7A 4B7EA 2VNRA 4JX0A 3S5AA 2ZEYA 4NE9A 3K4AA 4MGSA 1OXCA 4L9BA 3A22A 4IV1B 4XBQA 2Y34A 2VZ3A 4NIIA 1QJFA 3Q8BA 1V70A 3EQEA 1AUYA 4Z07A 5CG9A 2R061 1DQ0A 2GP5A 4YW2A 1EAH3 2J1VA 4OULA 4Q4V3 3PMEA 3THPA 5FY5A 3W9AA 4GKYA 2WDBA 3N7JA 1CN1A 1NLRA 4L92A 4LQRA 1GICA 4Y24A 1JN2P 5FZKA 2JDPA 5A3PA 3EXUA 5J7MA 4XC9A 5KXBA 1GQGA 5BNOA 1PIV2 5FCCA 4RHV3 1POV0 2FMDA 4JGYB 4H7LA 1FYUA 4OI4A 4XFGA 4CE8A 1DYKA 3WX5A 4DXRA 5K8SA 4AI0A 1M06G 5DG1A 3ENRA 3VV1A 5DUWA 4Z2WA 4CDXC 2HWD1 4KMQA 3WNKA 1UOFA 1ZBA2 3H0OA 4ONUA 1WCQA 3WY6A 4QPGA 2WQ4A 1JYCA 4XDQA 5CFCB 3BUCA 5CFDC 4KNCA 5CBLA 1FMD3 1WLTA 2PA7A 4OFGA 3VD7A 1I5PA 4ARYA 4QQOA 2GNBA 3TWIA 1DU3D 4I30A 5FR3A 5FY9A 4QHZA 2NMNA 3SHRA 5F5QA 4NJ4A 5FPAA 5JDBA 4DQAA 3AYDA 3M2MA 2WN2A 3M3CA 4M3CB 5FO9B 1H8TC 1FMD2 1REDA 1YIPA 2A1XA 2YZ4A 4YSFA 1YHFA 1NZIA 1IG3A 1WLCA 1QJY3 2Y60A 1W8OA 3MPPG 5JSOA 4MG2A 1S0FA 1ND3A 4CVUA 4JRLA 4LO4B 4QPWA 1OA3A 4Q1RA 4ATEA 4D3WA 4QD2A 2JENA 3B3QE 4LO5B 2OZ6A 2WC2A 3POYA 4BXSV 2NP0A 4GMP1 1JOPA 2G9GA 4FCAA 5E8AA 3JQWA 2XBO2 4Q1PA 1AXYA 5FREA 1W2OA 2D6MA 3OD0A 2WFPA 4NN0A 1X33A 2WWUA 3GGLA 3PURA 4IE5A 4XXAA 3AYCA 5DUXA 3U4SA 3VBFB 5CISA 5JXHA 3O0WA 3B5LB 5M0TA 3RSJA 3T2QA 5BNQA 1DDLA 2J1RA 5JI9A 2JE9A 3JU9A 1FV3A 3A0NA 3PU8A 1SPPB 2ZGSA 4AAXA 5FZCA 2J1TA 3M1HA 1IPKA 1KFUL 4PHZA 2BNOA 2WQ8A 3QH7A 1MZ5A 1H2NA 5FUNA 4XXPA 1ZZ6A 4WM8B 2C24A 2EIDA 4AEKA 3J7LA 2VBDA 3OEBA 4G4FA 4YFWA 1R64A 2OZJA 3UV9A 1JYVA 2BFUL 5D21A 2YUEA 2JDYA 1KJLA 3MUY1 1UY1A 4NRPA 2FDIA 1CIYA 2ZGTA 3FZ3A 3GM8A 3HPNA 1VAMA 1Z0HA 2Z5WA 1OHFA 1BMV1 4EN6B 3DGTA 3SISA 3BU0A 5IAVA 3AZYA 3I3DA 4P9WA 5FZ8A 2QQUA 1SFNA 5C70A 3OPWA 2WLQA 3ZYIB 2Q0AA 4QXHA 5G04L 4FXGB 5I0TA 1FNYA 5LY2A 1LRHA 4RGAA 5A7PA 1OPOA 2E51A 1KD7A 3CHXA 3NNGA 3IAPA 5KC5A 2HWB2 3ZR5A 1VMFA 3TEWA 4CP2A 3NRUA 2Y6FA 5BNPC 3RZJA 3R4DB 3LOBA 4GA9A 4P08A 4IE0A 2O8QA 4EJRA 2HWF1 5AFEA 1OVSA 2DU0A 3UJOA 5IK7A 4Y1ZA 4AYUA 4IEXA 4YVSC 2ZGKA 4I02A 4LIUA 2PHLA 1Q56A 4DB5A 4LKDA 4XQWA 3KV6A 2GN7A 1VP6A 2RM22 4QPGC 3WF4A 4E4DX 4A3XA 3ZOIA 5CFCA 5FZFA 3VL8A 4GH4A 1RTVA 1QQP3 1CGPA 1RUI3 3GZTB 4HFSA 2WN3A 1FOD3 3KZ4C 4FXKB 1D7PM 2NN8A 4IGQA 3MLJA 3UYJA 2WNVB 4DXSA 1A34A 1JTZX 2CWMA 2FQPA 4ZS2A 2PTMA 2QQLA 4WM7C 2JE7A 3ZYGA 3LA3A 4O65A 1F15A 1G9FA 1GKBA 5FQ0B 5HCFA 1OUXA 1RUC1 5GZDA 1UAIA 1YQ6A 5J37A 3WG4A 3T0AA 2VXRA 2VMDA 4MADA 1YI9A 3BPZA 3EYPA 1ND3B 2Y0OA 4LJHA 1F8VA 1VBA2 2D40A 5I91A 1OLQA 5GZFA 4FP3A 2PAEA 1H6XA 2ARCA 2D7FA 1IS3A 2QQMA 5JWPA 4FTSA 1YEWA 3OGVA 3IDCB 1ULGA 3GBFA 2DCKA 1JS9A 1KEXA 4JAAA 3SITA 5DXDA 3H1MA 4CCDA 3ME2A 4QX1A 3UKNA 4A44A 2Q8OA 4JGZB 3AYAA 3INAA 2A70A 1AYN1 3H3LA 2VVEA 4K8RB 4W6XA 1SDDB 3PL0A 3THTA 5H9SA 1PGW2 2WFF2 3MIGA 5B4XA 1BZWA 1H4GA 2JG8A 3GALA 3OGSA 1A6CA 3ZYRA 1HXS3 4XTPA 1K42A 2C6SA 1CAVB 2VOWA 3OBAA 4FPJA 2MEV2 3IM0A 1SLCA 1VBC3 1MVEA 1VBC2 1S4CA 2VMEA 2VZRA 2DBIA 4FOVA 1NCQC 3WP5A 2BQPA 1OH4A 2R30A 2PLV1 1AR92 1GNYA 1RUNA 4CEYA 4BU2A 5JMOA 1RL3A 1FV2A 3VDDB 4CZSA 1RUF2 1JOJA 2HLEA 4HOOA 2GNDA 4UW6A 4QHOA 5D2AA 3ZVXA 5K0UB 1J59A 3PIJA 4QKFA 2PXJA 3POIA 4COYA 3WINE 3X29B 3NNFA 4AQSA 3VHNA 4CEWA 5KXEA 1X9PA 3I2FA 2W39A 2D93A 3I54A 3OJBA 5FUPA 2W68A 3HEIA 1OOPB 1EV13 5JXGA 4IE7A 3POSA 4XHXA 2EA7A 2P3IA 5HBAA 1YI7A 2JX9A 2W52A 4AGRA 1UZYA 1VBB2 1YWKA 1BK0A 3VZKA 5EXOA 1WD4A 5LEKA 2Y38A 1HB2A 2RS53 3K75B 5IHRA 1ZZBA 3FC0A 3RZMA 1W39A 1XSQA 1EP0A 2ATFA 2QKDA 1SLTA 2WJSA 4QKDA 4HT1T 5L7OB 1N3QA 4FP2A 4GWJA 1RC6A 1ZRRA 4Q4Y2 5LK7B 3ASIA 1QHDA 3ZFGB 1XE7A 1OQDA 1NG0A 1W6PB 1LHNA 4D6SA 4JHZA 1JHNA 2PHDA 2BJSA 2E7AA 3RWNA 4ZXKA 4GWMA 4XJ9A 1OQ1A 2QQJA 2WR9A 3C7GA 1G7YA 4LBQA 3S6PA 2FDFA 4RHV2 1CZSA 3H8UA 1MS3A 4W4ZA 4CCOA 3KS7A 5CAZA 2ADEA 1IKQA 1IQDC 3K2OA 4JTOA 4N7UA 3KF5A 1SLLA 2VNGA 5C4WA 5A32B 3HVDA 4LMFA 1X9TA 3QACA 5FP3A 5AC93 5KR7A 2YU2A 1MR5A 2WWSA 2PMWB 4QPIC 4GKXA 3GJBA 2VQUA 3WDTA 5KC6A 2MEV3 2GH8A 1RUG2 3LDRA 3NV3A 2P34A 1UYXA 4CDQB 4BHPA 1IS4A 3E6CC 5IK8A 2IC1A 4JGYC 4META 1MZ6A 1S0BA 4AWDA 1C1LA 1MPXA 4YRDA 1H4HA 4COZA 1MEC1 1W9FA 4C90A 2YDEA 5CKNA 3EBRA 1J58A 1CONA 1OBNA 3ITQA 4NUBA 5SV5A 5A1AA 1D4M2 3T2TA 2AZ5A 4D6QA 2VC9A 4A7YA 2X09A 3AMHA 3I7DA 3N9OA 4L99A 3ZYBA 5JI7A 1VMHA 2EXJA 1UOBA 5BNOB 3NV4A 4A45A 4JDMA 2EALA 1W0NA 1NZCA 1UXXX 2W1QA 2HWE1 2XLFA 4ZHNA 4Z92B 3FN9A 2IUWA 3PUSA 3T4VA 2GSYA 1K5MC 3CZUA 4MZUA 4UW4A 1VR3A 2BZDA 2RMU1 4HK8A 1ZYBA 1RUH3 3D0SA 4AQ6A 4ZZ8A 1ULFA 3TYJA 1RJ7A 3WQBA 1AZDA 1RVF3 2QQIA 3VDDA 4R9CA 4YYOA 3U75A 4EN8B 2J1SA 3AP9A 3MW4A 4Q4X3 4YVWB 3U78A 3OYWA 3LSDA 2ZEXA 3OBZA 2BP6A 4AEDA 5FJHA 1OLMA 2VZUA 2ENRA 3IT8A 2GMMA 2RJLA 1EPWA 1FNZA 2ORXA 3DPRA 4TLGA 2Y6LA 4XVHA 2TBVA 4OHVA 2HWB3 1QWRA 3WDVA 1RB8G 5GLWA 3FHQA 4HPKA 1QJU1 3PUIA 5BNPB 2WKKA 1XNKA 3HWJA 5FTTC 3OG2A 1N1TA 1JZ6A 4Q4V1 4AVSA 4OUEA 5IVBA 4H14A 2VNOA 3HR9A 2P3YA 4DUWA 5LRSA 4B4RA 5LK5A 3GHMA 2BYVE 4XF0A 2XJSA 4KH9A 1Q8PA 3DF0A 5J36A 1W6NA 1YFYA 3W59A 3RG0A 3RJ2X 1Y9MA 5KHKA 4P5HA 3PUAA 5A1FA 3AXEA 5T5PA 4C0BA 1AR63 4N9HA 2ZGLA 4FAGA 1ZZ7A 2I2SA 1UY4A 5AC91 4P9JA 1VIWB 3VD3A 1T6GC 1GLHA 5BNNC 3N35A 3H1YA 3C3VA 1AXZA 4ATFA 5GZCA 4Y5SA 2VCAA 1N1SA 1HQNA 3Q8AA 3E5UA 3T2OA 3IDAA 3HMYA 1SMVA 5F3GA 4FBFA 4DUXA 1VRBA 1VAKA 4LXLA 3WG1A 5DAXA 4AOCA 5DUVA 4OYUA 1JODA 5EYYA 1TE1B 5C9AA 1ZZ9A 2Q30A 3I59A 1LEMA 4MGZE 5IYYA 3LF7A 3FBMA 2PQQA 5CB7A 2YC0A 1Y43B 4RYDA 1BCXA 4YM0A 1MZEA 2BWCA 3B94A 3I97A 3KCYA 4FOQA 3ZFGC 3D0JA 2Y6KA 3VBFC 3L2YA 2VO5A 3VBSC 4RD7A 3WF3A 4Q0SA 3T4HB 4NHMA 2JDAA 4YVSA 2FD8A 1ACCA 4ISRA 4F7ZA 4XFFA 4AFDA 1ENRA 1UYZA 4QXBA 3MZHA 2RHPA 1ENXA 3POBA 5A7SA 2KD7A 3K3OA 4MV2A 1W8FA 2VMHA 1UZWA 1XQNA 2QQVA 1W8NA 1RUC2 3NL1A 4UWDA 1H8TB 2MEV1 2XG3A 1SBEA 2ZGUA 2RDNA 1UPSA 3VHOA 5FLHA 5GLUA 4BYYA 1XRUA 1RUJ2 1KGYA 3MIEA 3WHUA 1ZREA 5ABJC 4N53A 1AR91 2ZHKA 1MS1A 1MS5A 1V9U1 3LFIA 1UPIA 4M00A 1H30A 2BU9A 3AYEA 2QTWB 4FOWA 1TVGA 4Y4RA 3WNXA 2W46A 2OUHA 4N90A 4UYBA 3VBUC 1SACA 4AF9A 4XETA 3MHZA 5CYYA 3A7QA 3FLTA 4UBGA 2JDMA 1TMF2 3AMNA 5C3OA 2UY8A 1F35A 1PGW1 2WFF1 3MIHA 3ACFA 5FUIA 5A33A 1WGPA 4B1MA 5E6HA 1RMU3 4A42A 1CD3G 1NXMA 1OVPA 4AE2A 3ZXDA 2WZR2 4A6SA 1QQP1 1XYNA 2JJ6A 2WT1A 2BTVC 1URXA 3P1IA 2ZKLA 3G7DA 4JZRA 2VOKA 3APBA 3H3UA 4HN0A 1DG6A 2DTYA 1K5MB 2JB8A 3PUHA 3TNPB 5FY0A 4COWA 4W65A 4HSJA 4HMZA 3USSA 5FZDA 3ZXKA 3RMYA 2BNNA 2JIJA 5BPXA 1DGWX 4E27A 3GXUA 4SLIA 2VNVA 1ZX5A 2UYAA 3VZLA 4B3NA 3KF3A 4U2AA 1RUD1 2VZPA 3AZZA 1O4TA 1U5ZA 4P02B 3ABZA 1EY2A 2O8OA 2P6HA 1WMEA 3BGAA 2OW4A 1UKGA 1LOGA 5E89A 1RUH2 2VE1A 2EXKA 3HQXA 5CKMA 2F4PA 3MLKA 4GZ9A 2QZ2A 3SQOA 3WD5A 3O1PA 1TG7A 3AC0A 2ARAA 3DV8A 1AR81 4H2AA 2R0FA 5A3WA 4DINB 4LBQD 3FHAA 3O1MA 5GLVA 2GAUA 5FY1A 4AG4A 2ZKNA 2XVLA 1WMXA 4QB2A 1RXFA 1H9PA 4QPIB 1I5ZA 4Q29A 3CJIC 2Q4SA 3C2UA 4OZOA 1SFPA 4FQZA 2R071 1BBT2 3AP5A 3P5BA 4YZ3A 1ZRDA 3VZNA 2GC2A 4JC1A 4BZ4A 2CGNA 2PLV2 1QJX3 1VBE2 5K4LA 1REFA 5D8AB 2GNMA 4DEQA 2P37A 2GALA 3M7AA 1T2XA 3OF1A 4NAOA 4AZZA 2JECA 4W6YA 3ZMOA 1AL0G 1COV1 3HBZA 3JQXA 2XLAA 3DYOA 2CSGA 1UU5A 1I1EA 1RUE1 4EN0A 2FDHA 1IPJA 1LOEA 1WW4A 2RS31 5FPZA 4QDRA 1N1VA 5L73A 4MSVA 2ZAHA 1F4AA 3JD73 5T5JA 1CAXB 1PM7A 3MEPA 3TN92 4MGIE 1C8NA 2RS52 3MLLA 4K3UA 1NCRB 1RHI3 1TMF3 1WA4A 2HWE2 2WUHA 4YGDA 4XF9A 5CADA 1W6NB 5FPXA 4PQ9A 2ZCWA 4CP1A 4WM8A 3R6SA 4Q5OA 2OQ7A 1RUG1 3HAGA 2Q1MA 5FXXA 4MGKE 3E5XA 4B8EA 2BFUS 1K45A 4LEJA 4A7KA 5A3TA 2VL4A 2XHKA 1G9BA 1W6MA 3A0KA 3WOGA 2W2IA 1CX1A 2HEYF 2B4KA 4AHWA 4GJYA 3DKWA 5C6CA 1G9DA 2BEOA 2P3KA 4C8DA 3PVEA 1E5HA 1R1A3 3JB8A 2VD7A 5FLJA 3D3AA 1HB3A 4LOTA 4PDWC 1PHMA 3VBHB 3ETQA 4BQYA 2LUWA 3I59B 4AGVA 5LCWL 1CVNA 4S2FA 3RWKX 3LEIA 1D0GA 1CZVA 1CAUB 1UU6A 1MQTA 3CQOA 1I6XA 5FZLA 4NWVA 3QH6A 2BOJA 4RSUA 1DYOA 5JSPA 1AR73 3VDCA 2AACA 4AVBA 3EB7A 3N9NA 1RINA 4Y26A 4TSVA 2AYHA 4KG8A 4YVSB 2WZPP 3WQ7A 2B9VA 4TXWA 2UYBA 3CNAA 4BLJA 3HOBA 4CU7A 4IV1A 2YGMA 1JZ7A 2LTNA 1ZVFA 3LQCA 5A80A 1S0IA 2HEVF 3DKQA 3J4UH 4I0WB 3GCXA 5DDJ2 3T3YA 4OVEA 3ZR6A 3ZDVA 4Y5TA 3E97A 4TZDA 2JDKA 5FXZA 3WCRA 4Y1YA 1X7NA 2QBXA 4IV3C 4YGEA 1LB2A 4P9LA 1KFXL 3BB6A 3ZXEA 2IXJA 4Q0VA 4D6RA 3LIGA 3VBHA 2FDGA 5LW9A 3HNMA 1FMD1 3RZGA 3BOWA 1JYTA 1RHI2 1ULCA 3MUZ1 1ZRIA 2IXCA 1WMFA 1ENQA 2YPDA 2MHFA 5FY8A 1OI6A 4P00B 3MDPA 4CDWA 5IVFA 4KWJA 3F95A 3T1MA 3J8F3 2ZX1A 4Q4W3 2VY0A 4KG0A 1DLLA 1LKNA 1V6MA 4OHWA 5CKQA 5FK7A 3VBOA 5A33B 5JSRA 5KHGA 3V0BA 1UYPA 1AL21 1SG3A 1W3VA 5FP8A 3PMSA 1GNZA 3JBG3 2D6LX 2BBVA 5FZ1A 2X5IC 3VBSA 5I93A 1SDWA 2Q1ZB 4CU8A 4JGYA 3VDBA 5FZMA 3HBKA 1EAH1 5KHIA 2HBTA 2BV4A 2WAOA 4UW3A 4CDXB 1UYYA 3GJAA 1S0EA 3DL3A 3B9IA 1R081 3DXTA 1HRI1 2A6VA 3NVCA 2XWJB 3QLQA 4GJZA 1HXS2 2WZEA 4LUKA 4UBHA 5DQ0A 5JVVA 1ZRFA 4R4XA 4AXOA 2JDUA 3USUB 1IS6A 3ECQA 4AHZA 3MYXA 2X05A 4UOJA 1QJX2 1W8TA 3ACLA 2ZGNA 3UGGA 3WR0A 3RJRA 2QQOA 4Y1VA 2WINB 5LEJA 4JDOA 4ZONA 1NKGA 3ZYJB 3BOPA 3PLQA 5IVJA 2VTXJ 1XB9A 2WSUA 2C5DA 1UMHA 2R042 4QX0A 2UWAA 1XNTA 1O8SA 3KQRA 1GWKA 1U5YA 2B46X 4PDWA 4PLNA 5T52A 1D2QA 5EPAA 2R6QA 1AL23 3KMHA 3DCQA 4QX3A 3ZFGA 2LW8A 4H7MA 1HRV3 2VZTA 5DAWA 3O14A 3SC7X 3VBFA 1O7FA 5FV3A 5JPMB 3GBWA 4LKSA 5L9RA 2HWC2 2E9QA 1LTEA 1GUIA 3FBYA 2VH9A 4XUNA 3ZXGA 3B01A 2K46A 1VPHA 4AW7A 1QXJA 5FMOS 1JH5A 2MPFA 1RVF1 3NJXA 2WNEA 1X8EA 5GZGA 5HXVA 3H7YA 4KGGA 4ET7A 1MS0A 2ARBA 2WYSA 1RMU2 3AMMA 4B4PA 1JU3A 1LENA 4OZXA 4YW6A 5A7WB 5IK4A 4LULA 4BMBA 1LGNA 4XJAA 3IPVB 4AVCA 1LU2A 4L11A 2NZ9A 4HL0A 5FY4A 4LO6B 2ZAAA 5FFOC 4LR4A 2CV6A 4BM8A 5KXCA 4F3JA 2QQPA 5L19A 1VB2A 1TMF1 1J1TA 2LRPA 4BMEA 2NMOA 2GMPA 3IPVA 3LAGA 3ZFFB 2Z42A 1JYWA 3M4FA 5HCAA 2NLRA 4H55A 1EPZA 1JBCA 1N1YA 2D6NA 2WZR1 1CJPA 3JBG2 3VBUA 4AGGA 4CDUC 1BEV1 4ES9A 5C8CC 3AZXA 3H8OA 3WV6A 4YM3A 4E4SA 1OA2A 5FMDA 5FAXA 4YZ1A 1DFQA 2ZGRA 1OD3A 2W91A 2XJPA 3GDBA 4UFLA 1O3TA 4IE4A 3M3EA 5BXXA 3U4XA 2EAKA 4FVVA 4GIQA 4YPJA 1ND3C 4Y3OA 2XQRA 4YFZA 2B42B 2VUDA 1IZ3A 2BERA 4ITCA 3U1XA 3AL5A 1D4M3 3WP6A 2RS11 3M3IA 1GZWA 3ZFFA 1FPN1 2QFEA 5JIUA 1WMDA 1JW6A 3CL1A 2IVIB 1V9U2 4EN7B 4M3CF 5DDJ3 3IAQA 5A3LA 3I2KA 3VLBB 4XUQA 3ZIWA 4ZZ5A 4P9YA 5FPLA 4CU6A 1N3OA 3IKWA 4I3GA 3ZMNA 5A6YA 4QGLA 3BCWA 4K7JA 2A75A 4FPHA 1KITA 2P3JA 3K3NA 4K1ZA 1CR7A 3RI9A 3FLPA 1POV1 5DG2A 4R52A 2VU9A 1ZBE3 2Z2SB 4QX5A 3UKTA 3LCPA 4E8DA 1QF3A 2JDZA 5DPNA 3ZXAC 5C8CB 3UNPA 1RIRA 3JD72 3LFMA 5LBEA 3ATGA 4C1WA 2WS91 1F31A 3NJZA 3POJA 3W21A 2AC1A 5ABJA 2ZACA 1W8ZA 3B9CA 3ELNA 5FQ0A 3E6DA 2NPIA 5LA1A 3AM2A 1AJOA 2ID4A 4JGZA 2RDQA 1RUOA 2BGPA 3Q8EA 3UGFA 4CCKA 5J1XA 3H50A 3RPQA 2E6VA 3ZXLA 1RYYA 5APAA 4MXVA 3JZVA 4MHRA 3SCFA 3VBSB 2VTXA 2MNGA 4OI0A 5H9PA 1W0OA 2J1AA 4KWUA 2SBAA 4N9IA 4XMAA 2W0XA 5BYNA 4OMDA 3IDEA 2ETEA 2EICA 4AR2A 4YG0A 2WNUB 2DFCA 4J1XA 3OEAA 5EHDA 2WFF3 4PLOA 1O4ZA 1VBB1 4HPKB 2D5HA 5IFTA 4ZY9A 5JZGA 2RS13 4AI1A 1M4WA 1NLQA 3TB0A 3AJZA 1GR3A 2HYKA 3ZDSA 4W8JA 2ZTNA 4A6OA 4AI9A 3WNOA 2ZEWA 2XGXA 4B1LA 3CJIB 1JZ4A 1IPSA 3F2ZA 1GANA 1Q8SA 3KHCA 2TEPA 1ZRCA 2DURA 1PO23 4B29A 5A6XA 3RRDA 1R091 1JYNA 3OUJA 5F5AA 3ZN6B 2V5YA 5C5UA 4YVWA 3H42B 2XJVA 3MICA 4CDXA 4IQPA 1W2NA 2WL1A 3MIBA 1AR93 1F5FA 3PTYA 3RYRA 2VTFA 1F9KA 4JTNA 2ZX2A 4JQTA 5BUVA 2D3PA 1YXWA 3J7MA 3KWVA 4P9GA 4JHTA 2OVUA 2XH6A 5ANNA 2CWSA 2ZBJA 5E1RA 3TN93 1KDKA 1D2SA 3LZZA 3SCHA 1V6NA 4P9IA 3VZJA 5A6QA 2G1MA 3VKNA 4OMCA 3L2HA 2ZJCA 1Q43A 1PK6B 4M0NA 5EP9A 5LA0A 2J42A 1F5JA 1R1ZA 4CPBA 1PIV1 1PNGA 1QH7A 3Q9OA 2UURA 4XFIA 1DGWA 2YMZA 5CU1A 1XYPA 4XZPA 5F7UA 4BQ2A 1ODMA 1MQTC 1NE6A 1OUSA 2ZABA 5IAXA 1H6YA 1L7RA 4JV4A 5C9AB 3MW3A 1EYBA 4CXXA 2KM2A 1WA6X 1J3PA 3DYPA 2W95A 4ES8A 1NA1A 1PNFA 1WKYA 1LHVA 1XNDA 3KQ4B 2Y6JA 1LOFA 1W28A 3RFRA 1IHMA 3R4SA 3ZXFA 4IV1C 1TEIA 3SH4A 3KT4A 3NNMA 4MUVA 5FRAA 2QNKA 1JU4A 4S2GA 4YG6A 4CCCA 2D44A 1W8WA 4QWNA 4PJYA 4CCJA 4JVAA 3K48A 3NAPC 1PZ8A 3VKMA 2GU9A 3ZFEB 4KWKA 5FZ6A 1R082 1EUUA 1HRI2 5C3QA 2YC2A 3I3MA 4EWEA 1BJQA 1J84A 1VE0A 4LNVA 1FPN3 2VBPA 3Q8CA 3NSTA 2RMU2 5CNAA 2G9ZA 1PMJX 4XF3A 4IEOA 5A7QA 1D4VB 3ST7A 3ZFEA 1WWYA 3FX3A 2ZPXA 3T2PA 3WSOA 2UY9A 4C0HA 5L7OC 2BRTA 1K5JA 3KGLA 3ZIXA 1RUG3 2OPWA 3AMPA 1XE0A 1YFWA 4LLFA 2QQNA 4CDQA 1LHWA 1UKRA 3ORJA 1FT9A 1LHUA 1AX1A 4XFCA 2XJRA 2Q8EA 2VW0A 3EMRA 3OUHA 4YW1A 3NO8A 2JXAA 3LD8A 1A8MA 4A4AA 4HVRA 2Z69A 4R9DA 2WNOA 3TEXA 1JZ5A 3ILNA 2ZZQA 2VOTA 1XBFA 4RS5A 3AJYA 1PM4A 1PGL2 1O8PA 1VBD3 1G9CA 2RR12 4DFSA 1KS4A 3MF9A 2VULA 1WW7A 5C3PA 4WZFA 5FLIA 1VBB3 1SEFA 2LROA 4NIDA 1OF4A 3CF6E 1QJX1 4BK5A 4HKWA 2B8MA 1UL9A 3VDAA 3WDYA 3T0BA 4FTBA 2ILMA 5EYXA 5FZGA 5KHJA 3O1UA 1ZBA3 2V72A 5DZEA 3E6BA 2RR13 2VMIA 2DUPA 2E7QA 3ILFA 4LORA 5FMOL 1DHKB 4OI1A 1W8UA 3KT7A 3MPBA 5HCBA 4CXYA 3ZSEA 4XDPA 1E57A 2EXHA 2BWAA 2GNTA 3OYWB 4LUMA 4DXTA 3VD4A 3VZMA 2RDSA 4HN1A 4QX2A 4YW4A 4JQRA 1VALA 1C8M2 2JWPA 3ACHA 3IB3A 5T55A 1QNWA 4IESA 3UESA 5FBJA 1RITA 1UIKA 2E53A 3ZSLA 4P5YA 1P8JA 3P3NA 2DWRA 4R8HA 4QQ2A 2A71A 3DECA 2CYFA 5F2WA 4CDUA 2E7TA 3SKJE 4ZKTB 1VMJA 2ZHMA 5ACA3 2QDNA 3A4UA 3JB4C 5JCTA 5JZGC 4XPVA 1O3SA 1WW5A 4L8QA 2JKBA 3I2HA 3AFKA 2HWF2 3S7EA 1VLNA 1FPN2 2VAUA 4PIYA 3T09A 3WF0A 4FPLA 3H8RA 4G9SB 1HRI3 2XBO1 4GXLA 4LLOA 1RUE3 3KM5A 4AQTA 4LA2A 4XUTA 5FP9A 4BK4A 1LAJA 1CX4A 2CAVA 3UL2A 5GM0A 4KU8A 4Z1VA 2ZX0A 1DGLA 3OGGA 2HJIA 2R16A 4YARA 2DFBA 4V2VA 5D8AA 1BQPA 1GNHA 2H0BA 2HWC3 4XJ8A 2X8KA 1AYN2 1PVC3 1EAH2 4M3CA 3VB9A 1UW8A 2UWBA 3AP6A 4QT6A 4O7XA 2RG4A 4AHYA 4ARXA 1IGOA 2WWJA 3OY8B 1VBA3 3GZAA 4NIHA 2PHTA 1H8VA 3IBMA 3W58A 2ZA9A 2P17A 3WG3A 3O1VA 2YBPA 4IERA 5C7GA 1B35B 2Q8CA 4LK7A 5F5IA 4DXZA 4LO7A 1O5UA 1LNSA 1E5IA 2YU1A 2GN3A 1SLBA 5L7OA 4QHBA 1NA1B 1MQTB 3LEGA 4BXFA 4QQLA 4FI9A 3I2IA 2WT0A 4OUSA 4KL1A 4AVVA 4CUAA 4CEYC 3HT1A 1BMV2 2CY6A 3J7HA 4LHLA 4AHXA 1HN0A 1G86A 3I3QA 3K51A 2VVDA 3WDUA 5BY5A 3CDZB 4BLIA 2R32A 3ZSMA 2VUCA 2PFWA 4XFBA 3LB9A 2X5IB 4E4ZA 5DAQA 4BB3A 2VCBA 4LITA 3T0DA 2YG0A 1APNA 4A3ZA 4CTEA 1CQ9A 4GWNA 3D8CA 4MXWB 5CEHA 1OF3A 1JZ8A 4CEWB 1XXNA 1ND2C 5FZOB 2DVFA 4AEMA 2ZMNA 1N47A 2Y64A 4XFAA 5CIRA 3POGA 1X8MA 3KB5A 4LE3A 2VPVA 3CJXA 5A7WA 2XUMA 3T08A 4NPMA 4NHKA 2JG8C 1POQA 5IVEA 4A2UA 4AVAA 1RMU1 1NOVA 4XUPA 4ASKA 4QU2A 1YQ5A 1CJDA 2R0HA 4XJZA 1RUF1 1GBGA 1CESA 2ADDA 1R092 4Q4Y1 3IZOA 3WLUA 4XIOA 1PO22 3C8XA 4KBBA 4SBVA 3RYKA 1L7QA 2R7EB 4CDWB 2R1BA 3KSCA 3R4UA 5EZWA 1KJRA 5KHHA 1XJAA 3ON7A 4JGZC 1JI6A 1UZZA 2XJQA 4N53B 4AEDC 5C33A 5C8CA 2WA3A 4MVTA 3HIFA 1UX7A 2QE3A 2VMGA 1AR61 2QQKA 4CEWC 3ZO0B 2WRAA 1AYN3 1S55A 2PHFA 2WBKA 2C26A 2Y33A 2VQTA 4IGPA 3WCSA 4WM7A 3U37A 5FYSA 1FX5A 1Q8VA 2K9ZA 4K8FA 1OURA 5FYVA 4XMIA 3DPRB 4QXCA 5JPNB 3VBRA 2HWD2 4RFT0 4LO8A 3HNYM 5FP7A 1IOAA 1J3RA 2IZWA 4IDZA 4FFGA 4E2QA 1S0CA 3KD4A 2VZSA 1MACA 3UETA 5IVCA 4E8CA 1O3QA 3LPFA 4IV3B 1OC1A 3S7IA 3PIGA 4M4RA 4MOAA 2O14A 5JAXA 3KV9A 2KA3A 3H1WA 2XJUA 3JUUA 5LA9A 2WS92 5J96B 1HN1A 1YUDA 4CDQC 1DF0A 4S2DA 1UQXA 1K3IA 5LA2A 3OBRA 1K5MA 1W9WA 3AP7A 3HN3A 4Z2AA 2D3SA 2K2SA 4UF0B 3ZM8A 4D7YA 3MW2A 1Y4WA 1LOBA 4YWAA 1J3QA 4XHBA 1NYWA 2VXJA 1DQ5A 2BGCA 1QJEA 1YQCA 3U07A 1QJY2 4OLLA 4MH0E 3DPRC 4QKNA 1RUJ3 4QPGB 4AEJA 5CZKA 3ZN5A 1STMA 3ZN6A 2HWE3 1QJZA 4F83A 1JUHA 4FFHA 3WNNA 1AR83 1D4M1 2R49A 1QEXA 5FZ3A 3WDWA 3O0VA 1EV12 2D43A 4RR3A 1VBD2 4D7TA 5EV7A 2NYYA 1ULDA 4EYUA 2WNVC 1DQ1A 2CGPA 4LBQB 3WUDA 4Q27A 2NM1A 3I4IA 4PIXA 2F17A 3MO4A 3WNPA 5T50A 2RJKA 1Z7S1 1NX9A 3PNAA 4XYXA 1B35A 3C7OA 3UJQA 2A5ZA 3ACGA 2ZEZA 2E31A 1Z78A 2PELA 3ILRA 1SBDA 2WA4A 4Q4V2 3SEEA 2I07B 4DS0A 5A1LA 2B39A 4XDOA 1PK6C 2VZVA 1YFXA 1VAVA 3ES4A 2O1QA 2WAAA 3I2GA 5FYCA 2HYXA 1QOSA 2EAAA 4IL7A 1YO8A 4XAEA 5D1IA 4K40A 4BIOA 3SEPA 1AX2A 2RJ2A 5FZAA 5JR2A 1S0DA 1DP0A 1Y7BA 3KVAA 3OD4A 4RL7A 1GMMA 2FZ1A 2ZGOA 5A3NA 2ZHLA 3AKPA 3NAPA 4Y20B 4LT5A 1XU1A 3WQ1A 3AK0A 4XE9A 1H2KA 4LTAA 4DEVA 4PI0A 4BDVB 3TBDA 3V0AA 2R073 4QX8A 4FT8A 2R062 3MGUA 1GWLA 3PVBB 1HX6A 2RMU3 3SNMA 1X36A 4LBKA 4LKFA 3J26N 5LASA 1ENSA 1HJFA 4AI2A 3AVSA 4X8NA 4NHLA 5DAVA 3GHNA 4ZU5A 4JKKA 1CWPA 1NCQB 2VZ1A 4NMIA 3RQ0A 3WXPA 1YQ8A 1W99A 1WW6A 2YFZA 1W6QA 3Q8FA 1XNAA 4GMP3 4ORFA 5A6ZA 1WCDJ 1Q3EA 1Y9GA 1I3HA 3D4KA 3PHMA 3QBQA 3GNEA 5JOZA 2W5FA 2A6YA 2JEMA 5J48A 2EF6A 1YC61 1AL22 3G6JB 2RM23 2E33A 5BNNB 1FI2A 1VJ2A 2D5FA 1ULEA 3BN6A 3MV11 2VW2A 4FOYA 4YNIA 1ALYA 2ES3A 1OOPC 3SMHA 3UT0A 2CTVA 3C7EA 3NAPB 4OHZA 3IN9A 5FWEA 1UN1A 5EJ1B 4YG3A 5GALA 4IW3A 2Y6GA 5I0UA 2OKXA 4AL9A 5FJKA 1ST8A 2W47A 4YM2A 3JXSA 3N7KA 3U11A 4FFFA 2V09A 2XLGA 3WZ1A 3PJQA 4O61A 4DIQA 1RGSA 4PCRA 4Q0QA 2XVKA 1DYPA 2E63A 4HBNA 1O5LA 2EIEA 2OX0A 1GSLA 4NO4A 2I45A 4KBZA 2UU8A 4V1PA 2CAUA 1C3HA 4X8PA 3CBNA 3MFCA 3DN7A 5FYIA 3TOJA 4ASMB 1XNCA 1TZOA 1TME1 1YCIA 3S30A 2ARXA 5C3SA 3AL6A 3D5OA 1PMIA 3KLSA 3WF2A 4GULA 3ZXJA 2ZX3A 1BVVA 3JCIA 3NWKA 2ZGMA 5LWBA 2HBUA 3CZJA 4I3PA 4I2OA 3NQHA 5HXMA 2DU1A 4KGQA 2R063 3K4ZA 3MIFA 3S5QA 1NXD1 1G8WA 2A7AA 1GQHA 2G4IA 4UFHA 3OOXA 2FDJA 3MBWA 2BDRA 3RYPA 5IK5A 3VHRA 4HVOA 2J1EA 1LODA 4XZUG 4QQHA 1NT0A 1O91A 4GALA 3J9SA 3NNLA 4MLOA 3ACIA 2DUQA 4KQ7A 3VGIA 1UY3A 5JIAA 2XR4A 3E5QA 4IEQA 3V65A 1L7LA 2VUAA 3AP4A 3C7HA 4N53C 1RUH1 3WVJA 4HSLA 3WHTA 1S2EA 1OFNA 4F8AA 2TNFA 4MX3A 2VCCA 5DABA 4L97A 1BLZA 1AR82 1CAUA 3PVNA 3FWEA 3AMQA 3O1TA 1W90A 3AKRA 3WQ0A 5FPBA 1ULPA 2GMEA 1CAVA 1AR62 3D82A 2FMYA 1ND2B 1E5RA 1PO11 4OQ9A 1JZ3A 4WV8A 1WLWA 5FYTA 2QQWA 5FO7B 5LY1A 3LWCA 2VECA 4XURA 3MF6A 5FKBA 4XILA 1OLME 1YIFA 4CP0A 3V64A 1ND2A 1R1A2 4RR3B 2Y6HA 5K0UA 4Y20A 3VHPA 2XQXA 2X29A 5SV8A 1W0PA 1MVQA 4QKBA 3POEA 3FLRA 1V00A 4W50A 5D8AC 1YJLA 5EQUA 4UXAA 1WCUA 3VBUB 1QOTA 3C7FA 4CXWA 5FZ4A 1OOPA 1W2TA 4CCEA 5A7OA 3MFAA 4BQ1A 1AYM2 3DUIA 5J98B 1E5SA 1LR5A 4QM8A 4HZFA 3WG2A 5JOXA 4GMP0 4Q0PA 2WS93 5I0DA 3O1OA 2L9LA 3WEZA 2YHJA 2P2KA 1GZWB 5FZBA 3TNQA 2JDHA 4J1WA 5T5OA 1MZFA 2CL2A 2B7YA 1PX3A 2OIIA 2YGLA 4WVVA 5CG8A 1C57A 1DIWA 2D97A 2JG9A 2YV8A 1NCRC 2DBNA 2YFUA 3N7MA 3WNLA 2VMFA 4BPZA 1VBC1 4FPEA 4BQXA 5F1RA 1QY4A 4URAA 1UIJA 5AFBA 4EQVA 2YBKA 1UF2C 4LE4A 1TQ5A 1VBE1 4UI9L 2JG9B 2R1DA 4CCNA 1PVC1 1UX6A 4MHUA 4YW3A 2XPJA 3NV2A 4XCAA 3K4DA 4NIGA 5FK8A 4ZPIA 5DN2A 2IXIA 4INDA 5KWRA 4HXCA 2RS32 2ZMLA 2B9UA 4MGYE 3LA7A 3ZKYA 3ZPOA 3I2OA 1UMIA 1ASJ2 3TRSB 4AEDB 1HRV2 2CNAA 5LBFA 4XEZA 1OQEA 4R4ZA 1A8DA 5L36A 3B02A 2VBBA 1J83A 5LATA 2DVAA 5IT6A 1B35C 2XJTA 3U14A 2BNMA 1GOHA 1VB4A 3K46A 4C91A 1FOD2 4CU9A 1AXKA 3N9LA 1KRIA 2WO3A 1UWWA 1W03A 2JIGA 3UKVA 4LIVA 3WW2A 5FPVA 3THCA 1UY0A 1NQJA 1RUD3 4HANA 4AFAA 3URFA 2VQAA 1PO21 1AR71 1UCXA 4QM9A 1O3RA 1I9RA 2ZZJA 1LESA 1V0AA 4LOSA 4RQPB 4CCLA 2AUYA 3VBHC 3HD8B 5GKAC 3O1SA 3K77A 4RA0A 1WUVA 4D94A 2FCUA 3H7JA 2F6BA 4YZ2A 1ZNPA 2JE8A 3R0RA 5FDBA 4U36A 3DYMA 1CAWB 1DCSA 1GFF2 3NJVA 4IEPA 3LKJA 4LHKA 1Q5OA 2HWF3 3OTFA 2ZOEB 2Q1FA 3AXDA 2NQYA 4LBLA 2DF7A 4OCTA 2J22A 3HQUA 2P1BA 1ONAA 4DMIA 1W9SA 1XNBA 3E1F1 2PLV3 4Y1UA 3POWA 4Z8BA 1OKOA 3UGHA 4FAHA 5A3MA 5HCHA 5BNPA 3N36A 3OB8A 4Q8LA 5FZHA 2AEYA 2P6CA 2OA2A 4LBOA 4QMAA 1BBT3 1BHGA 4TWTA 5ABJB 2Z4FA 1WBFA 5EJ3A 2IFRA 4ZU7A 1OH3A 2XL9A 3J7NA 4XBNA 4DY3A 4IUGA 5F37A 4A41A 1AF9A 4EZHA 3BKZA 1REEA 1SLAA 4MO3M 1H2MA 4N43B 4QU1A 5K9YA 1H9WA 1U5IA 4E2SA 5G05L 3VUOA 1GZCA 3N9MA 4JKLA 5FYZA 1D0HA 1W06A 2A6WA 2TUNA 3FE5A 4E9KA 2ZGQA 4FPOB 4EE2A 3P3PA 3BIEA 2B5HA 3VKLA 4AQ2A 4CA9A 4UFIA 1GQPA 2A6ZA 4PF1A 1W05A 3T30A 1IQAA 1QXPA 2RS51 1VRH3 2VZOA 3FJSA 3ZFEC 4K21A 2A3WA 5L9BA 2ET7A 2AH2A 4BOWA 1XPWA 1UO9A 3NW4A 2ZMKA 1QH6A 5IJRA 3V56A 2O0OA 3B93A 4AI3A 1LHOA 1UXZA 3EO6A 4O9EA 1RUI1 5JZGB 4OHYA 1DBNA 3ZKUA 4K20A 2V73A 3POFA 4ISQA 4XFHA 4BH9A 4HVQA 4XF1A 5LZ6A 1JYXA 1FATA 4RFRB 1C1FA 2EIBA 2W87A 3BALA 4M4PA 4CEYB 1W6QB 2PAMA 1H1MA 4OI2A 1MEC2 1LGCA 3M8LA 4XBLA 3N9PA 3LOIA 3BTAA 4DNYA 1W2UA 2GC1A 3KVBA 3WW3A 5CA6A 5FOBB 3I2JA 3O5SA 3M3QA 1EUTA 2V4AA 4N43A 5FZIA 1S0JA 3GCWA 5FO8B 5E88A 1S0GA 3D6EA 4QGNA 5GZEA 3T1LA 1Z7S3 1ZM1A 3ALQA 1Z7S2 4MXWA 1BK1A 1G9AA 2JB4A 3HN1A 2ZXQA 4LK6A 3ZX7A 2BW8A 3ROUA 3B69A 5KXDA 4GB32 3QCWA 2W94A 1GOGA 2PAKA 3AZWA 3GZUC 4OUMA 2D6KA 4QB1A 1W6MB 4HETA 5IATA 1X50A 2A6XA 2DCYA 1R083 2RE9A 4Q2FA 3EHKA 2C9KA 1RUJ1 4FFIA 4WVMB 4WVWA 1LEDA 4YVWC 1DZQA 4LBMA 4YZ4A 5ERLA 1IG0A 4CCMA 3U0ZA 2D98A 4IEWA 2VZQA 1SCRA 1S2BA 2WO1A 2QJVA 3NJYA 2WT2A 1NLSA 4R9BA 4CRQA 3H9AA 2PYTA 4Y22B 4I0BA 4PIZA 2AEZA 3KT1A 2FCTA 3VN4A 2VW1A 3LPGA 1RXGA 4HG6B 2Z79A 2WNUA 1H1IA 1DGRN 3M3OA 2P5BA 4Y22A 2Q8DA 2WYFA 4DPNA 3JBG1 2E26A 1BEV2 1OA4A 4FPYA 3SXWA 2OQ6A 3AKQA 3LEMA 3TAYA 3LE0A 5C3RA 2OPKA 3KCCA 1UY2A 5C4WB 2BPA2 3LDKA 5B4NA 5F3IA 2GDFA 3KV4A 4A7ZA 5DUUA 2XONA 4GH4B 4IV3A 1HB4A 2KR2A 1N3PA 5HV4A 4YM1A 4JCKA 3TEYA 2OUJA 2WLPA 3IMNA 2DCZA 3PUQA 3V0BB 1YQ2A 1GU3A 3PDQA 3FUOA 2PHRA 4X6RB 3N4MA 2J1UA 4RN5A 3WF1A 1BYHA 2A3YA 1FXZA 2VMCA 5K0UC 3TEZA 1PIV3 3IWZA 3OCPA 4QPYA 3VBRB 4QQPA 3AKSA 2H6CA 4CDWC 4COVA 4Y5Z0 1LOFC 4NIAA 1PGSA 2YROA 4IEUA 2HEWF 1J1LA 1HB1A 2C4XA 1RJ8A 1ZZ8A 2IFWA 2V5DA 3HT2A 1MS8A 4DOUA 1YJKA 4NHYA 2YB7A 3LSEA 4RGGA 1HJGA 3ES1A 2DDUA 5ACA1 3CMGA 5DAPA 2X53S 3H3ZA 2PQSA 1LECA 4YLZA 3WP3A 1WZXA 2BVVA 2CHHA 1K12A 3LDBA 4Q26A 1HV1A 1XOYA 5FYMA 1LCLA 5C4WC 5LBBA 1V6LA 1TME3 1YYNA 3SLIA 2Y8KA 4EWAA 4CP9B 1GOFA 2PHWA 4PF5A 4XABA 1BBT1 2RS12 2IWGB 4UF0A 1NCRA 4PT6A 4HLTA 4QX7A 2JKXA 3MV01 5FYBA 3RI8A 4TLFA 3VZOA 2E32A 1JXNA 1ZBE1 3OY8A 4DY5A 2XHNA 3KGZA 4IEZA 1PVC2 1GZ9A 3I8TA 2HKXA 3EJKA 1ASJ3 2GH2A 5FBZA 1TME2 4DRRA 5F3EA 1L3JA 2WIIB 3SCGA 1U12A 1F2NA 4NPLA 4PBPA 3AVRA 5DMYA 5T3NA 1ZA7A 1LOAA 3L9JT 5F6LB 1NY71 1OT5A 3QD6A 4HONA 3OPTA 1OSGA 3LA2A 3BTZA 1VRH1 4L2NA 2HWC1 3FMGA 4N7IA 4CUBA 4FQ4A 4NRMA 1GV9A 1QQP2 2VR4A 3DEMA 3TN91 2A3XA 1F4HA 1PO12 4CPBD 1JOBA 5J09A 2C1FA 2XUEA 1RVF2 2JG8B 2VQ0A 5FY7A 5IW0A 3RMXA 2AGSA 4P9XA 4YGBA 3LEKA 4GAZA 1ZA4A 5BV6A 1BEV3 3CKHA 3U10A 2WZR3 3J8F2 4Q4W2 1JZ2A 4CP9A 5FWJA 4UFKA 1OPMA 2DYCA 1QDOA 1W9TA 3FUQA 5C8WA 2JG9C 1DLCA 2ET1A 3LIHA 1RUD2 4NHXA 1AYM3 1GP4A 5A32A 2WO7A 3CO2A 2DCJA 1Y3TA 3UK9A 2CGOA 3S57A 1GP5A 2CDPA 3I3BA 1QDCA 4FPCA 2F4LA 1H0BA 1CPNA 5LBCA 4QAWA 2JD4A 5C5TA 5T54A 5K7PA 1FAYA 1Y9QA 3IDBB 1JHJA 1O59A 4GWIA 1HW5A 3AB0A 3CLPA 4Q4Y3 1UOJA 5F6KA 1BVP1 2RV9A 2OT7A 4IEVA 2D3RA 5FYUA 5FZ7A 5A3UA 1H2LA 2XMLA 2RDRA 4UT5A 3IIIA 1GP6A 4UFMA 5F8PA 3RZHA 5T5LA 2UWCA 4LHNA 4BQWA 4Q4X1 4D69A 1OLRA 4XUOA 5L9VA 5C71A 1NUKA 2R072 1NA1C 1MS4A 3OPZA 4IETA 4XIKA 1R1A1 2LS6A 4NROA 4ZU4A 1SZBA 4PLMA 5CFDA 1PZ9A 1X82A 2GC3A 2BUKA 5F9TA 4EV0A 3O1RA 4W6WA 4EN9B 1AR72 4DUVA 1COV2 4AAPA 5LRRA 4BISA 2VUJA 4J6GA 1AJKA 2XDVA 4RGKA 5AVPA 4RQPA 1RUE2 4OHXA 4RHV1 2XKOA 1AYM1 4WZCA 4E2GA 3BYWA 5IVVA 4NAMA 4DO0A 1G6NA 3DXUA 4COUA 3OBTA 2DTWA 2YYOA 4NOTA 5BNNA 2WABA 4Q0UA 3CEWA 3JD71 2WNUC 3MI8A 1NE4A 1CPMA 2GP3A 3FHIB 1NQDA 4GQ7A 4PBOA 5GLZA 4C1XA 1XYOA 4QDQA 1H8TA 1AX0A 2AENA 2ZS6B 2FHRA 4QGMA 3WUCA 2GZWA 1DGRA 5C9AC 2JDNA 1UZ0A 1LOCA 2N7GA 2W08A 3B00A 3CIHA 4RS5B 4Y33A 3SH3A 1C8M3 4RR3C 3IMMA 3WT3A 1W2AX 2DVGA 3NNJA 5F2SA 1CIWA 4JRAA 3RZZA 1HIXA 4QPIA 5I0RA 2G19A 3BTYA 5CFDB 4EZ4A 3I2DA 1IKPA 1UNBA 3BIWE 4EROA 1CAXA 1YNAA 4FPFA 4FPKA 2B45X 5IWFA 2GC0A 3ZPYA 3W5MA 3GYDA 2OS2A 1C5HA 1VBD1 3BTXA 1U5XA 5JOWA 1ASJ1 1MS9A 1DQ4A 2OXBA 3NKTA 2AR6A 4LA3A 2CDOA 1JMUB 5DZFA 3OGRA 4Z82A 3SKVA 2VM9A 1QKQA 1AHSA 2DCTA 2YC4A 4IEYA 4NVPA 4GB31 5I0SA 1XE8A 4XTMA 1RUF3 3VKFC 3HNBM 5FOJB 3HQRA 3O12A 3WW4A 4G3YC 1HXS1 2LM3A 1FOD1 5I8TA 1RUI2 4M01A 1QNYA 3B7MA 5FKCA 3A23A 5ANQA 1KXGA 4FSJA 3S0MA 5J3UA 3VBOB 3O7OA 4PQQA 1OMIA 2QUOA 4D0QA 2PN5A 1JYIA 2H6BA 2K0GA 1LULA 5F32A 4HKLA 3VD5A 5KBFA 3ZYFA 4CSWA 5E16A 1UMZA 3RZKA 4NWWA 3NKGA 4PDWB 4UW5A 1ZZCA 2IXKA 5IUQA 4J25A 3PVOA 4AFMA 4IGOA 5H9RA 2VOVA 1PO13 1SPPA 3ZSKA 1XU2A 2QCSB 4QXKA 1SFYA 3NMBA 1XC6A 4NRQA 2R043 2C0ZA 2PHUA 4LPLA 5FXVA 3RGBA 4AI8A 1QJU3 1QXRA 5HI0A 1QJU2 1PGL1 3CJIA 2FDKA 4XQ4A 2HWB1 3KHBA 3USUA 5JR7B 3WW1A 3WDXA 2YBSA 4PI2A 1V6OA 1AVBA 5JXIA 4GD4A 3N9QA 2ORZA 1C28A 2XL7A 2P4EA 1W6PA 4Y1XA 4BJ0A 1POV3 2X5IA 1DQ6A 4YZ5A 4HKOA 4N43C 4FO9A 2XKPA 3GBGA 1WLDA 1UZVA 5FP4A 1ZBA1 1SHWB 3AZVA 4RQPC 1B09A 1YLLA 5DDJ1 1YRZA 5CFCC 5AC92 2EXIA 2WO2A 4LHSA 1QOOA 1C8M1 1V6JA 3HJRA 5FZOA 2XVGA 1O6UA 1XSRA 1HDKA 2EVXA 4K6BA 5B2GB 1TNFA 1GWMA 2G9FA 1NAEA 3IIAA 4TN7A 3MIDA 1QU0A 3SH5A 2XBO3 3QOPA 4WM8C 5EFUA 2VVFA 4X6QB 4NR1A 1RHI1 1OD5A 2IXLA 2WQZC 3CU7A 2W1SA 5H9QA 3V0AB 2XWBB 4XJWA 3OGJA 4OQ8A 5HPOA 3RVHA 2IVJA 2J7MA 4N8MA 2QDRA 5FYYA 1SQ4A 2QVSB 3ZLIA 5JLVA 3I49A 3PTRB 4WVMA 2BVBA 5I8SA 4BA6A 3GF6A 2JD9A 2VOXA 3RDIA 2ZGPA 1RUC3 5CVRA 4Q8KA 3A21A 3KCXA 2AREA 4JDNA 4TTGA 2VGDA 3VBRC 4M0HA 4EWDA 4QDSA 3I3EA 1T6BX 4KU7A 4WBBA 1DQ2A 1DZTA 4Y4YA 1TNRA 2BGOA 2W1WA 3P6BA 5IFPA 4MYEA 5A7NA 2VCMA 3AKTA 1WD3A 2D6OX 4BE3A 3GZEA 4BQ3A 4XCBA 3H8XA 1HQLA 2LALA 1DZRA 5DZGA 4AFCA 1SLIA 2W3JA 2RR11 5F39A 1KQRA 2SLIA 3THDA 5FPUA 5EIYB 1GZTA 5JOYA 4BIFA 4HK9A 5HV0A 2YPJA 2FBEA 5F5CA 5GLTA 4QB6A 4BQ4A 5FXWA 3NV1A 1H1AA 3R05A 4GH4C 4RS5C 4YW5A 4XQDA 4URTA 2HWD3 3VD9A 2W1UA 4D7SA 3KV5A 2OYZA 5ISLA 2RM21 1V6IA 1W04A 4XW3A 2VJXA 2W9XA 2BBAA 4JKMA 2R041 4ZS3A 4I0AA 4LKEA 2YXSA 4MGTA 4MGQA 1UOGA 4B7KA 2WZ8A 3W20A 4B4QA 3N3HA 3ZN4A 4WM7B 4I09A 3M70A 3O0XA 5EWSA 1PMHX 4GB33 4S2HA 5ACA2 2WSVA 4IE6A 2DV9A 1US2A 3ZFFC 3WNMA 4ASLA 2Q5TA 1W8HA 1MEC3 1PX4A 2DVDA 2QZ3A 3FFQA 2PHXA 2KXLA 4AFBA 1BXHA 4R9AA 3VKOA 1QIQA 3OUIA 4DZGA 1COV3 1IS5A 1YFUA 4NPRA 1O4YA 1VBA1 1A78A 3VBOC 1OFSA 3WP4A 1ZBE2 1PK6A 2V4VA 2H0VA 4H3WA 1R093 1KDMA 3ETPA 3FFZA 1KS5A 1SBFA 5FMCA 4BQ5A 1WCSA 2I74A 5GJ6A 1BKZA 2A73B 4KI5M 1WCKA 3BPSA 5F3CA 1HLCA 1V6KA 5FMBA 1HKDA 1SCSA 4CDUB 1V9U3 2FCVA
chains in the Genus database with same CATH topology
1WBLA 1CAWA 2DVBA 2EIGA 4LBJA 1VRH2 2C9AA 4XOGA 4AVTA 1HQWA 1C5IA 4I01A 2FZ2A 4FTEA 1U0AA 4Q4X2 4XJUA 2Y0IA 1PVXA 4BCUA 2RS33 1W6OB 3LGRA 3ZSJA 2Y26A 2DUOA 1OKQA 4K1YA 4KWLA 4AK3A 2WNVA 2XB6C 1QJY1 3BODA 1Q8OA 2YY1A 4IXLA 2ZHNA 2D6PA 2ZX4A 5AVAA 1NY72 3RS6A 1LGBA 4FPGA 1EV11 4LBNA 1GYKA 4O9GA 1C4RA 4K9SA 1PZ7A 1Q8QA 3AFGA 3N7LA 1QGLA 1VBE3 1HRV1 5I8YA 5JMCA 3PJYA 5BNOC 1QMJA 3BU7A 4WVZA 4DRVA 4BWOA 1UU4A 3RNSA 5TSWA 3J8F1 4Q4W1 1A3KA 3VL9A 2IXHA 2VG9A 4YGCA 4M3CE 2JICA 1W6OA 1S2KA 3AX4A 3ZYPA 1HV0A 1LU1A 1S1AA 4TYSA 2ERFA 4XF4A 4CYDA 3VDDC 4P14A 1NCQA 1UD1A 1JUIA 1LJ7A 4B7EA 2VNRA 4L9BA 4IV1B 4XBQA 4Z07A 1V70A 3EQEA 1AUYA 5CG9A 2R061 1DQ0A 4YW2A 1EAH3 4Q4V3 4OULA 3THPA 3PMEA 3W9AA 4GKYA 4L92A 3N7JA 1CN1A 1NLRA 5J7MA 1GICA 4Y24A 1JN2P 3EXUA 5KXBA 1GQGA 1PIV2 5FCCA 4RHV3 1POV0 2FMDA 4JGYB 4H7LA 1FYUA 4OI4A 4XFGA 5K8SA 1DYKA 3WX5A 4AI0A 1M06G 5DG1A 3ENRA 3VV1A 5DUWA 4Z2WA 4CDXC 2HWD1 1ZBA2 3H0OA 4ONUA 3WY6A 5CFCB 4QPGA 2WQ4A 1JYCA 4XDQA 5CFDC 4KNCA 5CBLA 1FMD3 1WLTA 2PA7A 4OFGA 4QQOA 2GNBA 3TWIA 1DU3D 4I30A 3SHRA 2NMNA 5F5QA 5JDBA 4DQAA 3AYDA 3M2MA 3M3CA 4M3CB 5FO9B 1H8TC 1FMD2 1REDA 1YIPA 2YZ4A 4YSFA 1YHFA 1WLCA 1QJY3 3MPPG 5JSOA 1S0FA 1ND3A 4JRLA 4LO4B 1OA3A 4Q1RA 4ATEA 4D3WA 4QD2A 2JENA 3B3QE 4LO5B 2OZ6A 2WC2A 3POYA 2NP0A 4GMP1 2G9GA 4FCAA 5E8AA 3JQWA 2XBO2 4Q1PA 1AXYA 5FREA 2D6MA 3OD0A 2WFPA 4NN0A 1X33A 4XXAA 5DUXA 3AYCA 3VBFB 3O0WA 3B5LB 5BNQA 1DDLA 5JI9A 2JE9A 3JU9A 1FV3A 3A0NA 2ZGSA 3M1HA 1IPKA 1KFUL 2BNOA 3QH7A 1MZ5A 1H2NA 4XXPA 1ZZ6A 4WM8B 4AEKA 4G4FA 4YFWA 2OZJA 3UV9A 2BFUL 2YUEA 1KJLA 3FZ3A 2ZGTA 1VAMA 1Z0HA 2Z5WA 1OHFA 1BMV1 4EN6B 3DGTA 3SISA 3AZYA 4P9WA 1SFNA 2WLQA 3ZYIB 2Q0AA 4FXGB 5I0TA 1FNYA 1LRHA 4RGAA 1OPOA 2E51A 1KD7A 5KC5A 2HWB2 4CP2A 5BNPC 3R4DB 3LOBA 4GA9A 2O8QA 4EJRA 2HWF1 5AFEA 2DU0A 3UJOA 5IK7A 4Y1ZA 4AYUA 4IEXA 4YVSC 2ZGKA 4I02A 4DB5A 2PHLA 1Q56A 5I0SA 4XQWA 2GN7A 1VP6A 2RM22 4QPGC 4E4DX 4A3XA 5CFCA 3VL8A 4GH4A 1RTVA 1QQP3 1CGPA 1RUI3 3GZTB 4HFSA 1FOD3 3KZ4C 4FXKB 2NN8A 3MLJA 2WNVB 1JTZX 2CWMA 2FQPA 2PTMA 4WM7C 2JE7A 3ZYGA 3LA3A 1G9FA 1GKBA 5FQ0B 5HCFA 1RUC1 5GZDA 1UAIA 5J37A 3WG4A 2VXRA 1F8VA 1YI9A 3BPZA 1ND3B 2Y0OA 1VBA2 2D40A 5I91A 1OLQA 5GZFA 4FP3A 2PAEA 2D7FA 1IS3A 4FTSA 5JWPA 3IDCB 1ULGA 3GBFA 2DCKA 4JAAA 3SITA 5DXDA 3H1MA 3ME2A 3UKNA 2Q8OA 4JGZB 3AYAA 3INAA 2A70A 1AYN1 4W6XA 2VVEA 3THTA 5H9SA 1PGW2 2WFF2 3MIGA 1BZWA 1H4GA 2JG8A 3GALA 1A6CA 3ZYRA 1HXS3 4XTPA 1CAVB 2VOWA 4FPJA 2MEV2 3IM0A 1SLCA 1VBC3 1MVEA 1VBC2 4FOVA 3WP5A 1NCQC 2BQPA 2R30A 2PLV1 1AR92 1RUNA 4CEYA 1RL3A 1FV2A 3VDDB 4CZSA 1RUF2 1JOJA 4UW6A 5K0UB 2GNDA 3ZVXA 1J59A 4COYA 3WINE 3X29B 4AQSA 3VHNA 4CEWA 5KXEA 2W39A 2D93A 3I54A 3OJBA 2W68A 1OOPB 1EV13 3POSA 4XHXA 2EA7A 2P3IA 5HBAA 1YI7A 2JX9A 2W52A 4AGRA 1UZYA 1VBB2 1YWKA 3VZKA 5EXOA 1WD4A 5LEKA 2Y38A 2RS53 1ZZBA 3FC0A 1W39A 1EP0A 2ATFA 2QKDA 1SLTA 2WJSA 4HT1T 5L7OB 1N3QA 4FP2A 1RC6A 1ZRRA 4Q4Y2 5LK7B 3ASIA 1QHDA 3ZFGB 1XE7A 1OQDA 1NG0A 1W6PB 1LHNA 1JHNA 2PHDA 2E7AA 3RWNA 4ZXKA 4GWMA 4XJ9A 1OQ1A 4LBQA 1G7YA 3S6PA 4RHV2 3H8UA 1MS3A 3KS7A 5CAZA 1IKQA 4YARA 4JTOA 4N7UA 1SLLA 2VNGA 5C4WA 5A32B 3QACA 5AC93 1MR5A 2WWSA 4QPIC 4GKXA 3WDTA 5KC6A 2MEV3 2GH8A 1RUG2 3NV3A 2P34A 4CDQB 4BHPA 1IS4A 3E6CC 5IK8A 2IC1A 4JGYC 4META 1MZ6A 1S0BA 4AWDA 1C1LA 4YRDA 1H4HA 4COZA 1MEC1 4C90A 2YDEA 3EBRA 1J58A 1CONA 5SV5A 1D4M2 3T2TA 2AZ5A 4A7YA 3AMHA 3I7DA 4L99A 5JI7A 2EXJA 5BNOB 3NV4A 4JDMA 2EALA 1NZCA 2HWE1 2XLFA 4Z92B 2GSYA 1K5MC 4MZUA 4UW4A 1VR3A 2RMU1 4HK8A 1ZYBA 1RUH3 3D0SA 4AQ6A 1ULFA 3TYJA 1RJ7A 1AZDA 1RVF3 3VDDA 4R9CA 4YYOA 4EN8B 3AP9A 3MW4A 4Q4X3 4YVWB 3OYWA 3LSDA 4AEDA 2ENRA 3IT8A 2GMMA 2RJLA 1EPWA 1FNZA 3DPRA 2TBVA 4OHVA 2HWB3 1QWRA 3WDVA 1RB8G 5GLWA 4HPKA 1QJU1 5BNPB 2WKKA 1XNKA 3HWJA 5FTTC 1N1TA 4Q4V1 4AVSA 4H14A 2VNOA 3HR9A 5LRSA 4B4RA 5LK5A 3GHMA 2BYVE 4XF0A 2XJSA 4KH9A 1Q8PA 3DF0A 5J36A 1W6NA 1YFYA 3W59A 3RG0A 3RJ2X 5KHKA 4P5HA 3AXEA 5T5PA 4C0BA 1AR63 4N9HA 2ZGLA 4FAGA 1ZZ7A 2I2SA 5AC91 4P9JA 1VIWB 1T6GC 1GLHA 5BNNC 3N35A 3H1YA 3C3VA 1AXZA 4ATFA 5GZCA 1N1SA 1HQNA 3E5UA 3HMYA 1SMVA 4FBFA 1VAKA 3WG1A 5DUVA 5EYYA 5C9AA 1TE1B 1ZZ9A 2Q30A 3I59A 1LEMA 4MGZE 3FBMA 2PQQA 5CB7A 2YC0A 1Y43B 1BCXA 4YM0A 1MZEA 2BWCA 3B94A 3KCYA 4FOQA 3ZFGC 3D0JA 3VBFC 3L2YA 3VBSC 4RD7A 4Q0SA 4NHMA 4YVSA 4ISRA 4F7ZA 4XFFA 4AFDA 1ENRA 3MZHA 2RHPA 1ENXA 4MV2A 2VMHA 1XQNA 3NL1A 1RUC2 1H8TB 2MEV1 2XG3A 1SBEA 2ZGUA 1UPSA 3VHOA 5FLHA 5GLUA 4BYYA 1XRUA 1RUJ2 3WHUA 3MIEA 1ZREA 5ABJC 4N53A 1AR91 2ZHKA 1MS1A 1MS5A 1V9U1 1UPIA 4M00A 1H30A 3AYEA 4FOWA 3WNXA 2OUHA 4N90A 3VBUC 1SACA 4AF9A 4XETA 3FLTA 4UBGA 3AMNA 1TMF2 2UY8A 1PGW1 2WFF1 3MIHA 5A33A 1WGPA 1RMU3 1CD3G 1NXMA 4AE2A 3ZXDA 2WZR2 1QQP1 1XYNA 2JJ6A 2WT1A 2BTVC 1URXA 2ZKLA 3G7DA 2VOKA 3APBA 3H3UA 4HN0A 1DG6A 2DTYA 1K5MB 3TNPB 4COWA 4W65A 4HSJA 4HMZA 3USSA 3ZXKA 3RMYA 2BNNA 5BPXA 1DGWX 4E27A 4SLIA 1ZX5A 2UYAA 3VZLA 4B3NA 4U2AA 1RUD1 3AZZA 1O4TA 1U5ZA 1EY2A 2O8OA 1WMEA 2OW4A 1UKGA 1LOGA 5E89A 1RUH2 3HQXA 2EXKA 2F4PA 3MLKA 2QZ2A 3WD5A 3DV8A 1AR81 2R0FA 4DINB 4LBQD 5GLVA 2GAUA 4AG4A 2ZKNA 2XVLA 1H9PA 4QPIB 1I5ZA 4Q29A 3CJIC 2Q4SA 3C2UA 4FQZA 2R071 1BBT2 3AP5A 1ZRDA 4YZ3A 3VZNA 2GC2A 4JC1A 4BZ4A 2CGNA 2PLV2 1QJX3 1VBE2 1REFA 5D8AB 2GNMA 2P37A 2GALA 3M7AA 3OF1A 2JECA 4W6YA 3ZMOA 1AL0G 1COV1 3HBZA 3JQXA 2XLAA 1UU5A 1I1EA 1RUE1 4EN0A 1IPJA 1LOEA 1WW4A 2RS31 5FPZA 5L73A 4MSVA 2ZAHA 3JD73 5T5JA 1CAXB 1PM7A 3MEPA 3TN92 4MGIE 1C8NA 2RS52 3MLLA 4K3UA 1NCRB 1RHI3 1TMF3 1WA4A 2HWE2 4YGDA 4XF9A 5CADA 1W6NB 5FPXA 4PQ9A 2ZCWA 4CP1A 4WM8A 3R6SA 1RUG1 3HAGA 2Q1MA 4MGKE 3E5XA 4B8EA 2BFUS 4LEJA 4A7KA 2XHKA 1G9BA 1W6MA 3A0KA 3WOGA 2HEYF 4AHWA 3DKWA 5C6CA 1G9DA 2BEOA 2P3KA 3PVEA 1R1A3 3JB8A 5FLJA 4PDWC 1PHMA 3VBHB 3ETQA 2LUWA 3I59B 4AGVA 1CVNA 4S2FA 1D0GA 1CAUB 1UU6A 1MQTA 1I6XA 4NWVA 3QH6A 4RSUA 5JSPA 1AR73 4AVBA 1RINA 4Y26A 4TSVA 2AYHA 4KG8A 4YVSB 2WZPP 3WQ7A 2UYBA 3CNAA 4BLJA 4IV1A 2YGMA 2LTNA 1ZVFA 1S0IA 2HEVF 3J4UH 4I0WB 5DDJ2 4OVEA 3E97A 4TZDA 3WCRA 4Y1YA 1X7NA 4IV3C 4YGEA 1LB2A 4P9LA 1KFXL 3BB6A 3ZXEA 2IXJA 4Q0VA 3VBHA 1FMD1 3BOWA 1RHI2 1ULCA 2IXCA 1WMFA 1ENQA 2MHFA 4CDWA 1OI6A 3MDPA 4KWJA 3T1MA 3J8F3 2ZX1A 4Q4W3 2VY0A 4KG0A 1DLLA 1LKNA 1V6MA 4OHWA 3VBOA 5A33B 5JSRA 5KHGA 3V0BA 1AL21 3PMSA 1GNZA 3JBG3 2D6LX 2BBVA 2X5IC 3VBSA 5I93A 1SDWA 2Q1ZB 4JGYA 1EAH1 5KHIA 4UW3A 1S0EA 3DL3A 3B9IA 1R081 1HRI1 2A6VA 3NVCA 2XWJB 3QLQA 4LUKA 1HXS2 4UBHA 1ZRFA 5JVVA 4R4XA 4AXOA 3USUB 1IS6A 3ECQA 4AHZA 3MYXA 1QJX2 3ACLA 2ZGNA 3WR0A 3RJRA 4Y1VA 2WINB 5LEJA 4JDOA 3ZYJB 3BOPA 3PLQA 2WSUA 2C5DA 2R042 2UWAA 3KQRA 1U5YA 2B46X 4PDWA 4PLNA 5T52A 1D2QA 2R6QA 1AL23 3KMHA 3ZFGA 4H7MA 1HRV3 3O14A 3VBFA 1O7FA 5JPMB 3GBWA 2HWC2 2E9QA 1LTEA 3FBYA 2VH9A 3ZXGA 3B01A 4AW7A 1QXJA 5FMOS 1JH5A 2MPFA 1RVF1 2WNEA 1X8EA 5GZGA 5HXVA 3H7YA 4KGGA 1MS0A 2ARBA 4B4PA 1RMU2 3AMMA 1LENA 4OZXA 5IK4A 4LULA 4BMBA 1LGNA 4XJAA 3IPVB 4AVCA 1LU2A 4L11A 2NZ9A 4HL0A 4LO6B 2ZAAA 5FFOC 4LR4A 2CV6A 4BM8A 5KXCA 4F3JA 2QQPA 5L19A 1VB2A 1TMF1 1J1TA 4BMEA 2NMOA 2GMPA 3IPVA 3LAGA 3ZFFB 2Z42A 3M4FA 5HCAA 2NLRA 4H55A 1N1YA 1EPZA 1JBCA 2D6NA 2WZR1 1CJPA 3JBG2 3VBUA 4AGGA 4CDUC 1BEV1 4ES9A 5C8CC 3AZXA 3WV6A 4YM3A 4E4SA 1OA2A 4YZ1A 5FAXA 1DFQA 2ZGRA 1O3TA 2XJPA 3U4XA 3M3EA 5BXXA 2EAKA 4FVVA 4GIQA 1ND3C 2B42B 1IZ3A 4ITCA 3ZFFA 1D4M3 3WP6A 2RS11 3M3IA 1GZWA 1FPN1 2QFEA 5JIUA 1WMDA 1JW6A 3CL1A 4EN7B 1V9U2 4M3CF 5DDJ3 5A3LA 3VLBB 3ZIWA 4P9YA 1N3OA 3IKWA 4I3GA 3ZMNA 4QGLA 3BCWA 4K7JA 2A75A 4FPHA 1KITA 2P3JA 4K1ZA 1CR7A 3RI9A 3FLPA 1POV1 5DG2A 4R52A 2VU9A 1ZBE3 2Z2SB 4QX5A 3UKTA 3LCPA 1QF3A 2JDZA 3ZXAC 5C8CB 1RIRA 3JD72 3ATGA 4C1WA 2WS91 1F31A 3NJZA 5ABJA 2ZACA 3B9CA 3ELNA 5FQ0A 3E6DA 2NPIA 3AM2A 1AJOA 4JGZA 1RUOA 3H50A 3RPQA