1FAYA

Winged bean acidic lectin complexed with methyl-alpha-d-galactose (monoclinic form)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
236
structure length
236
Chain Sequence
b'ETQSFNFDHFEENSKELNLQRQASIKSNGVLELTKLTKNGVPVWKSTGRALYAEPIKIWDSTTGNVASFETRFSFNITQPYAYPEPADGLTFFMVPPNSPQGEDGGNLGVFKPPEGDNAFAVEFDTFQNTWDPQVPHIGIDVNSIVSSKTLHFQLENGGVANVVIKYDSPTKILNVVLAFHSVGTVYTLSNIVDLKQEFPNSEWVNVGLSATTGYQKNAVETHEIISWSFTSSLQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC LECTIN
molecule tags Sugar binding protein
publication title Carbohydrate specificity and salt-bridge mediated conformational change in acidic winged bean agglutinin.
pubmed doi rcsb
total genus 44
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fayA00
3D5OA 3NV1A 2P3IA 5EXOA 4HANA 4FOQA 1YO8A 1BKZA 2FHRA 3OYWB 1GBGA 5IK5A 4XJ9A 2R1DA 4XOGA 4MYEA 4XXPA 3ZXLA 1FV3A 4FPJA 1LOFC 4YW1A 1W6MB 4FQZA 1C4RA 2D6KA 5GZEA 1JOJA 1V00A 3VKMA 1W6PA 1W6MA 4YFZA 2VH9A 2VY0A 2PHFA 4CRQA 1KRIA 4M01A 2GALA 1LOAA 1URXA 5DZFA 3N7LA 4W65A 1AJKA 1DZQA 3NV3A 4JRAA 4FOVA 4YZ3A 4ISQA 3R4SA 1H9PA 3WVJA 1LEMA 1LU1A 5GLTA 3FLRA 1LJ7A 1QKQA 5JDBA 4LBOA 3APBA 4YGBA 5T5JA 1S0EA 3HR9A 3RRDA 4AGVA 2UU8A 2I2SA 4P9XA 2CY6A 3MPPG 2GMMA 4K21A 5T5OA 3ZXFA 2PELA 1GANA 3JU9A 3M1HA 4LBQA 5L73A 1ONAA 1N1TA 3A4UA 3AZVA 5IK8A 1G9FA 1VALA 4Y1VA 1Y7BA 2NMNA 3PVOA 1DFQA 3M3QA 2NN8A 5F5QA 3WOGA 3SITA 1Q8OA 4CZSA 1V6LA 2AYHA 4PQ9A 4LBMA 1SLBA 2A3WA 4Y24A 4HL0A 2W39A 1ZA4A 2ZBJA 1LGNA 2EIGA 1QOOA 3ZXKA 4NO4A 2DUPA 3ZPYA 1WW7A 3M3CA 2NM1A 3UJOA 2PHWA 5DUWA 2YZ4A 4GKYA 1DQ4A 2R1BA 1X50A 4M3CA 2ZZJA 1Q8VA 2R49A 1SBDA 5JOZA 1YRZA 1QNYA 1W6QB 4FPOB 1LOCA 1QOSA 1WW6A 5HCFA 1FAYA 1Q8SA 2DTWA 5E88A 1S0GA 1V6NA 1DYKA 1A3KA 1UMZA 4R9DA 1LHUA 3N36A 1GZCA 4YZ4A 4ATEA 1F31A 1DGLA 2P2KA 1TEIA 3AYAA 5LK5A 3KM5A 3A0KA 3V64A 1QOTA 3IPVB 2V5YA 2W52A 3W58A 2GNTA 1W6NA 2DV9A 3FUQA 4YW2A 5GJ6A 3V0AB 4BLJA 1MVEA 2LTNA 1CPMA 3H0OA 3TAYA 1VAVA 1LGBA 3ZXEA 5GZFA 3AP4A 2DVFA 1SLCA 3I4IA 2WQZC 2PHTA 1PZ7A 1G86A 1UL9A 3D6EA 2Q5TA 2VUAA 3OBTA 4FPEA 1AX0A 1Q8QA 2R0FA 2DTYA 3LCPA 4I30A 1YI7A 3WDWA 2WJSA 1SFYA 2A6VA 2R0HA 3ZSKA 2AR6A 4R9BA 2YXSA 1IKPA 1ULGA 4LBQB 4C1XA 2R16A 3ZSJA 2A5ZA 2CTVA 4Y22B 5KXBA 4UW4A 4BMBA 1G9AA 4U2AA 4FPCA 4BPZA 3Q9OA 5AVAA 1I1EA 4Y26A 5DXDA 2AREA 3A0NA 3D4KA 4UW3A 2ZABA 1NLSA 2P37A 5CA6A 3IKWA 4GWNA 5H9QA 4LBNA 4M00A 5CB7A 3VV1A 1DIWA 2DVDA 4Q26A 2NMOA 3MW3A 5SV8A 1MS5A 3TB0A 2HYKA 1DBNA 1O4YA 3WUDA 3SLIA 4AYUA 2A6WA 2DURA 2GMEA 1WD3A 1UZYA 2G4IA 3V0BB 1GNHA 1LCLA 1IKQA 1IS4A 3SISA 1GZWB 1JXNA 4P9WA 1CQ9A 1DQ0A 5GLUA 4K1ZA 3R05A 1GZWA 2TEPA 5GLWA 4ZKTB 4FPLA 2VW0A 3AZXA 2ZMLA 3FLPA 5GZGA 1AXKA 1H9WA 2EF6A 1V6KA 1N1SA 3W59A 1WBLA 2JJ6A 4XIOA 2WKKA 2WT2A 2ZHKA 2ZMNA 3M3OA 1QU0A 1DHKB 4YG0A 1MZ5A 3U4XA 2H0BA 3N3HA 3AYDA 1DQ6A 1JYCA 3N7MA 1FNZA 3LSDA 5T5LA 4YGDA 4F83A 5JLVA 1O4ZA 2A75A 3CNAA 3FLTA 2W68A 3T1MA 1WD4A 2D6LX 3AP5A 3NV2A 4BMEA 3AYEA 1G9CA 4AVSA 4BQ1A 4WVVA 1G7YA 2DWRA 1G9DA 2UWCA 2OUJA 3RQ0A 3WHTA 2SLIA 2ZGLA 2P3JA 2C9AA 4Y20A 1N3PA 4FOYA 2ZAAA 1ULCA 3WDVA 1UZZA 4SLIA 4BOWA 4XYXA 2UURA 2JECA 3AZZA 3AZWA 3OY8A 1KJRA 5JOWA 4UW6A 1AVBA 1GICA 1S0DA 3ILNA 1LOEA 1SBFA 3OGGA 3OY8B 2YMZA 3AX4A 2PHUA 5JVVA 1A78A 1J1TA 1HKDA 4H55A 5T54A 3USUB 1YYNA 5EYYA 4AVTA 2SBAA 1B09A 1CN1A 2CL2A 3WG1A 4FPYA 4XTMA 2A3YA 1SLLA 2ZHNA 3OPZA 3AJYA 3B01A 2NZ9A 1AJOA 1LULA 1D0HA 1ULFA 3AXEA 3ZXJA 2D3RA 4GA9A 1FV2A 4Y1YA 2E53A 3BOPA 3UJQA 2DU0A 1LTEA 4P9YA 1KQRA 2GNDA 4ASMB 1BYHA 1N1YA 5JOYA 1SACA 2Z42A 1G9BA 3O0VA 5EWSA 3VKLA 2D7FA 1AXYA 1V6JA 2A6ZA 2DVBA 2E7QA 2XB6C 4ISRA 4YZ5A 1HLCA 1VLNA 3VUOA 4GXLA 4DS0A 4KBBA 2JE9A 3L2YA 2B7YA 2A6YA 4XHXA 4M3CB 1LHNA 5DUVA 5DUUA 4AVVA 5DZEA 3BODA 3RMXA 4FPHA 5IT6A 4YW3A 4Q8KA 2ZGQA 4XJZA 3OBRA 4PCRA 1OQ1A 3ASIA 2AENA 3AYCA 4OZXA 3WCRA 1UX6A 1SLAA 4TZDA 5JMCA 1LOGA 1LHWA 1OFSA 4U36A 1SCRA 2OVUA 2WT0A 3ZYPA 2OUHA 2ZGPA 2ZGTA 2WSUA 2EXJA 4YG6A 2ZMKA 1JHNA 1F9KA 1HQLA 2EXHA 4Q1RA 4YGEA 2BQPA 1LU2A 4WZFA 3WDUA 1VIWB 1SLTA 1S0FA 2YY1A 1N3QA 3IPVA 4XXAA 2JDZA 2EALA 1W6NB 2D3PA 4YFWA 1WLWA 3WDXA 1WLCA 3IM0A 4RA0A 3WG2A 1C57A 1DQ2A 2NP0A 5DZGA 1IS3A 3GALA 1ENQA 3OYWA 4YLZA 3PVNA 4PBOA 4PBPA 4YZ1A 4XHBA 3O0XA 4XJ8A 4RL7A 3ZVXA 2D44A 2ZHLA 1F5FA 5DG2A 4FPKA 4GALA 3N7KA 2EXKA 2YV8A 2OW4A 1N47A 1DQ1A 1ULEA 1SCSA 1GV9A 2P34A 3AP7A 4XILA 4AGGA 2ZKNA 4YW4A 3VKFC 1RINA 1AX1A 5IK4A 2A3XA 3SNMA 3DUIA 2D6OX 5GZDA 3V0AA 4FP3A 1CIWA 4XJUA 3WDYA 1IS6A 3B3QE 3T2TA 4FPGA 1BJQA 2GNMA 1V6MA 3POWA 3ENRA 2DU1A 2A6XA 2GN3A 4Y1ZA 3WDTA 4M3CE 3LSEA 1KITA 3ILFA 2AGSA 1CPNA 1LOBA 2ZACA 1QMJA 1W6PB 1WUVA 3POYA 1VAMA 1UN1A 1WW5A 2ZGUA 5H9PA 1CESA 4AGRA 4YM0A 1GNZA 2DUOA 1LHVA 2UWAA 1MVQA 3NV4A 4XDQA 2WNEA 5GM0A 4XE9A 3BIWE 1CVNA 4JCKA 1LOFA 4YG3A 1S1AA 1FATA 3HMYA 4Q1PA 5GLZA 1W6QA 5E8AA 1NXD1 3WNXA 3ZSMA 1MS8A 3UL2A 1BQPA 1JBCA 1UAIA 1MS1A 2UWBA 3RMYA 4Q8LA 3B9CA 3VKNA 3V0BA 3B00A 2VU9A 1N1VA 1LENA 4YM3A 2PHXA 1C1FA 1QF3A 1GZ9A 1APNA 1KDMA 1LEDA 4NOTA 5IK7A 5FRAA 1Q56A 5F9TA 3BTAA 3KQRA 4PF5A 3UK9A 1YIFA 4IQPA 2P3KA 2NYYA 1I3HA 1HDKA 1QNWA 4AWDA 3IN9A 3AXDA 1CONA 4M3CF 1S0JA 3OJBA 3NWKA 3O5SA 5H9SA 2DUQA 1W0OA 3M2MA 5JOXA 4P14A 4Q27A 4R9CA 5HCBA 3WG3A 2EXIA 5DG1A 2CWSA 5H9RA 1GYKA 5E89A 2A7AA 1MS4A 5T55A 1S0IA 1V6IA 4FVVA 3R4UA 4FQ4A 4BM8A 4WV8A 1ZM1A 1IS5A 1CR7A 1MR5A 2DVGA 2EAKA 3IMNA 2ERFA 4Y1UA 2VW2A 1GSLA 1AX2A 2DVAA 1WBFA 4LBJA 4YM2A 1G8WA 2ARXA 3WG4A 1PZ8A 3POSA 1IOAA 5BYNA 1DQ5A 4XTPA 1DYPA 1S0BA 1HQWA 1V6OA 4JC1A 1GKBA 1QDCA 4DPNA 1QGLA 1MS0A 1H30A 3QLQA 1U0AA 2ZGRA 4UW5A 3M3EA 1KJLA 1XQNA 2ZGOA 2GMPA 2KM2A 1FYUA 1Z0HA 2PHRA 5CAZA 4Y22A 4Y1XA 3B69A 3C2UA 5CBLA 3N35A 2DYCA 3I8TA 3GNEA 3INAA 1YXWA 5CNAA 2ARBA 2E7TA 1PZ9A 5KXEA 4DRVA 3PMEA 1C1LA 2VW1A 4R9AA 4XMAA 2ZGKA 3V65A 2VXRA 3RG0A 1W0PA 4TYSA 3WV6A 1LESA 2W08A 3VKOA 4FOWA 3DGTA 1WLDA 4K20A 3RS6A 5T52A 1JUIA 1JN2P 2A70A 2C5DA 3MEPA 4XIKA 3PJQA 4XMIA 3RSJA 5GALA 1MS3A 4ATFA 4YZ2A 1UKGA 3T1LA 1A8DA 1OKQA 1FX5A 1ENSA 3MW2A 2D43A 3SH4A 4FP2A 2A71A 4DRRA 3WUCA 1SLIA 2GNBA 4DQAA 5KXDA 2ES3A 2FMDA 5KXCA 1QDOA 3HN1A 4Y20B 2GN7A 3AK0A 1MZ6A 3FFZA 1AF9A 4ITCA 1FNYA 3FBYA 3QCWA 5IUQA 4BLIA 3O0WA 4FPFA 2D3SA 1D2SA 2ZA9A 3USUA 4L8QA 1MS9A 2D6PA 4GKXA 1JYIA 5EYXA 4DFSA 1R1ZA 2YROA 3ATGA 3ILRA 2AH2A 1MACA 4WVWA 4LBLA 4YW5A 5T5PA 3WLUA 3N7JA 1LHOA 4GWMA 4ZXKA 4LBQD 4XBLA 2D6MA 2ZGSA 1UPSA 1AXZA 4K1YA 2CWMA 1CJPA 1W6OA 3AP6A 1EPWA 1N3OA 1S0CA 2RHPA 3AFKA 3FUOA 3MW4A 2JE7A 4Q2FA 4XJWA 2GDFA 2XG3A 2JKBA 1JW6A 2D6NA 1BZWA 1KDKA 2ENRA 2CYFA 2WT1A 2WSVA 2ZGNA 1GLHA 3AZYA 4LBKA 4XJAA 3JUUA 1LODA 1RITA 1LECA 3O12A 3ZSLA 4XZPA 3WHUA 3SH3A 2ZGMA 2JD4A 4XBQA 3WZ1A 1Z78A 1WCSA 5HCAA 2CNAA 5T50A 1LGCA 3AJZA 1BXHA 1ENRA 2WLQA 4YGCA 1SBEA 1AZDA 1ULDA 4XBNA 2AUYA 2LALA 2ZHMA 3PVEA 3WCSA 4CTEA 1W6OB 1WW4A 5FREA 4D69A 3SH5A 2V73A 1Q8PA 5GZCA 3AP9A 1DLLA 4YM1A 2E51A 1RIRA 3ZYRA 4C1WA 5GLVA 5DUXA 2E6VA 4Z8BA
chains in the Genus database with same CATH superfamily
2VBBA 4KH9A 1X8MA 4HANA 2ZJCA 3FBMA 3NL1A 4N8MA 3FFQA 3WW2A 2HWE2 1BBT1 1VBA1 3E6DA 3VZMA 1T2XA 3SEPA 4BK4A 5ACA2 4L99A 2VQ0A 3KV5A 3FL7A 4XXPA 3ZXLA 1FV3A 2VTXJ 1D4M1 4TTGA 5FZOB 1C4RA 5FAXA 3HVDA 5GZEA 1OUXA 3MLLA 4G4FA 1MQTA 5E6HA 3OOXA 4GMP0 3S5AA 3ACFA 3VDDC 2PXJA 1W05A 4XDPA 4NROA 3I97A 3ZMNA 4C8DA 2ZKLA 4I2OA 4EZ4A 2GALA 5JXHA 2G9GA 1WMEA 5DZFA 5K8SA 5FPVA 5HXVA 4AAXA 2X29A 3C7GA 4JDNA 2O14A 5CISA 4IESA 4IE7A 4XF0A 1H9PA 2QCSB 5AFBA 1J3RA 1JHJA 1LU1A 3FLRA 4NHYA 3ME2A 1HB4A 3U10A 4HT1T 2VPVA 1S0EA 2WBKA 2W2IA 3HR9A 4G9SB 4Q4W1 4O65A 3MPPG 3SHRA 2JXAA 4DNYA 3EHKA 5T5OA 4XF1A 3ZYBA 4RQPC 1U5IA 4QMAA 5FYMA 3UKNA 2CDOA 2V4VA 1VALA 2BUKA 4AQ6A 1W2UA 3PVOA 1OSGA 1R082 3B7MA 2CU5A 4XFGA 2E26A 1KEXA 5CFDC 4X8PA 2RVAA 2AYHA 1HRI1 2YGLA 3UV9A 1SLBA 3WX5A 2VZSA 2FDHA 3GJBA 1LGNA 2EIGA 4N9HA 3ZM8A 3ZXKA 4AXOA 3ZPYA 2DUPA 4E2GA 1WW7A 4EYUA 2C4XA 1QWRA 5KHHA 1DQ4A 2YPJA 3PTYA 4M3CA 1EAH3 1ULPA 1NE6A 2R49A 1AR63 1SBDA 2ZZJA 3ITQA 2HWB3 3V56A 1W6QB 3GCXA 4FPOB 5FZ4A 1HRV1 1QOSA 3I54A 1NAEA 1RUC2 2R7EB 1VBD1 2DTWA 3NMBA 4S2DA 1QJZA 5IVFA 1FXZA 1COV1 1SFPA 4HPKB 4LA3A 1LHUA 4OI1A 3W20A 3N36A 1GZCA 2EVXA 4HMZA 1GP6A 4L0PA 4A7ZA 3BTZA 4ATEA 4QX0A 1DGLA 1TE1B 4LA2A 2DBIA 3PLQA 1HB3A 3GF6A 3JD73 5BUVA 3O1UA 3V64A 4MADA 3IPVB 5JIAA 1K12A 3T4VA 3NAPA 3FHIB 2VVFA 5F1RA 2Y6JA 4CCMA 4FAHA 1XE7A 1UY0A 3TRSB 2I74A 1DGWX 1GNYA 3ZXEA 3AP4A 1W2TA 1BMV1 4Q4Y3 2FDIA 4LE4A 2XL7A 1BCXA 1Z7S1 4FXKB 4I30A 2R0FA 4HXCA 2DTYA 3WDWA 1W8UA 1YI7A 2WJSA 2WS93 5FLJA 3H8XA 4FFFA 3OEAA 3MDPA 1ULGA 4I0WB 3KHCA 2IFWA 4YVWA 2CTVA 5KXBA 4KWKA 2XR4A 3OBAA 4U2AA 1RUG1 4XW3A 2VUCA 4Y26A 1RUJ3 4JQTA 1DGRA 1VJ2A 4ASLA 3T4HB 1JU3A 1AR61 3IKWA 4GWNA 2R071 2RS33 4AAPA 2XBO1 4BA6A 3MW3A 4D6SA 1UYZA 3H42B 4XUQA 1UU5A 3VHNA 4LOTA 1XC6A 2XBO2 3WUDA 2X53S 4AQTA 5FPUA 1E5HA 1J83A 5IW0A 2VCCA 2DURA 5C8CB 3R0RA 1OF3A 5LA2A 3ZO0B 4HG6B 1GNHA 1LCLA 1IKQA 3WF3A 1FMD3 2B9VA 3AB0A 3MO4A 1XE8A 5EIYB 2D98A 5K0UB 4P9WA 1SPPA 1CQ9A 4K1ZA 3PUSA 2P4EA 2WA3A 5FMOL 3ZXAC 2TEPA 3NJVA 1VMFA 3ZKYA 4W6XA 5ABJB 3FLPA 1AR73 1AXKA 1O6UA 2IWGB 2V4AA 3ABZA 1WBLA 2JJ6A 2YFUA 1JYTA 3NNJA 2IFRA 3AYDA 1JYCA 3N7MA 4JGZA 4NRQA 3S5QA 5JLVA 2A75A 3CNAA 3FLTA 4LIVA 2ORZA 4BMEA 3AP5A 2LW8A 1W8HA 4AVSA 4WVVA 4K8FA 3I59A 1YHFA 2DWRA 2OUJA 1HB2A 4LTAA 4B29A 2CHHA 3CZUA 4L92A 4PLMA 5LY2A 1HQNA 3ZX7A 4CEWA 1POQA 1UU4A 2C9AA 4K6BA 4FOYA 2VZTA 2YC2A 5BNOB 3HEIA 2Y64A 4Q0VA 1UZZA 4WVMA 4LHKA 5FIXA 5JPNB 4XYXA 1LAJA 1W2NA 3AZZA 1YJKA 2G9FA 1HJGA 4WVMB 1KJRA 2VVDA 4UW6A 4CSWA 3OGGA 1LOEA 2GP5A 3AX4A 3E5QA 2XL9A 3VB9A 2GSYA 4KGQA 1HRV2 4H55A 2Q1MA 4N43A 1YYNA 4OULA 5EYYA 5FZ3A 3N9LA 1NCQC 4WM7C 1CN1A 2X5IB 1DG6A 3WG1A 2JB4A 2XH6A 4K7JA 3BI3A 2ZHNA 1ALYA 2AEYA 2VMHA 5FYIA 3ZFEC 2NQYA 5IVJA 1PO23 1VBC2 1L3JA 3WSOA 1LB2A 3AXEA 4NIDA 1ULFA 1A6CA 3CQOA 3MLKA 3ACLA 5FY4A 4GA9A 1HJFA 4QKBA 1RUH2 3D0SA 1WKYA 4P5YA 3S30A 3NRUA 4BQ4A 5BNPC 1LTEA 2PFWA 4P9YA 1PGL2 4LK7A 4EWEA 1BBT3 1VBA3 4OLLA 1BYHA 1N1YA 4OHXA 2Z42A 2WRAA 3DKQA 2DVBA 2E7QA 1UCXA 5D8AA 5J3UA 1HLCA 2XMLA 4ZU5A 4QKFA 4I01A 1VLNA 2P17A 4W4ZA 4DS0A 4FAGA 2XGXA 2GC2A 3KV9A 4KBBA 2B7YA 2C9KA 2ILMA 1FOD2 3KB5A 2JIGA 4MGTA 5A1LA 2VNGA 3BODA 3HD8B 3OD0A 3IZOA 3VBUC 1OQ1A 3ASIA 1CD3G 4QXKA 2GAUA 3NAPC 4AHWA 1W8TA 5FZOA 1VRBA 2B4KA 5FZKA 3VD5A 2RMU3 1LOGA 5JUVA 5L7OB 1UWWA 2WINB 3ZYPA 1EV11 5C3QA 4CU6A 2ZGPA 4UWDA 4YG6A 1JZ2A 2HLEA 4QB2A 3ES4A 5A7SA 1JHNA 4YGEA 1OUSA 2WYFA 5HV0A 1XYNA 2VGDA 1W99A 3ETQA 4XACA 1VIWB 3D8CA 4OMCA 3IPVA 4YFWA 5D8AB 3VD7A 2YC4A 1RUG3 1W6NB 2VBDA 3P1IA 4RA0A 3MUY1 4D7SA 3WG2A 4AFBA 1QJU3 4YVWC 3H1MA 2G1MA 3WQ7A 2R072 2CAVA 4MXWA 4D7YA 4XHBA 4ZZ8A 2Y8KA 4RL7A 2HYXA 5F6LB 2QTWB 4QPWA 4B8EA 2FDGA 2P3YA 1V70A 3DYMA 3OPWA 1UMHA 1LR5A 2P34A 4HLTA 1OVPA 3AP7A 4HVOA 2K2SA 2ZEXA 2ZKNA 4TN7A 4AGGA 2BNNA 1AX1A 5IK4A 2A3XA 5IVCA 1GOGA 2D6OX 2WFF2 1J1LA 2WUHA 4FP3A 1JZ5A 3J7MA 2VQUA 4NAMA 4OUSA 1W9WA 4FPGA 3RYPA 3T2TA 3K4DA 5FR3A 1RUI1 2WQ8A 2EICA 1V6MA 2GH2A 1COV3 4E9KA 5FOBB 1BK1A 1DGWA 1PX3A 3LSEA 4JTOA 4MV2A 4Z1VA 4Q4V1 4COUA 3ILFA 5KBFA 2ZACA 1QMJA 1W6PB 1WUVA 1PVC2 3F2ZA 3HBKA 4O9EA 2WZR2 2C26A 1HV1A 2XXZA 4JRLA 1SPPB 1GNZA 1YFUA 2O0OA 1RUE3 5DAQA 1I5ZA 1VBE1 1LHVA 3NV4A 4NHXA 2HWB2 3T3YA 3NNMA 3WNKA 4PT6A 2G9ZA 4D0QA 1M4WA 1W06A 5FZMA 5CFCB 1CVNA 1EUTA 1S1AA 3FHQA 4Q1PA 4NIIA 5E8AA 1D0GA 1NXD1 2JEMA 5G04L 3ZSMA 1IPKA 1JBCA 1Z7S2 2W1UA 2VMCA 2RJLA 2WO1A 2XPJA 3C7HA 4YM3A 4BXSV 3ETPA 1EV12 5FZ0A 4J6GA 5KHIA 1GZ9A 5JCTA 1OH3A 5KC5A 1O3RA 4BU2A 1APNA 5FYUA 1IG0A 1R081 4N43C 3O1VA 4CDXC 5A32B 3ZN6B 5FRAA 5IK7A 4FFGA 3BTAA 4PF5A 3UK9A 5F9TA 5LEJA 1JMUB 4AI0A 2NYYA 2GC1A 5CG9A 1HDKA 1W03A 2XUEA 4Z82A 3TOJA 5C8WA 1OQDA 2WNUA 3OJBA 1POV3 4QD2A 5H9SA 1QJX2 1MEC1 4Q27A 5HCBA 3WG3A 2EXIA 4D8MA 5FYCA 5H9RA 5KHJA 4BQYA 3BU7A 4FTSA 4WM8A 3EMRA 5AC92 3KSCA 3B5LB 5JR7B 5FQ0A 4TSVA 4CXYA 1S0IA 3DPRC 4FVVA 5L9VA 3GZAA 4FQ4A 1K42A 1CR7A 5I8SA 3IMNA 3PNAA 4FCAA 3DPRA 3P3PA 4YM2A 2DFCA 1WBFA 1G8WA 2ARXA 2WIIB 1JUHA 3I2HA 3WNLA 3VBRB 1IOAA 3EYPA 4XTPA 2VO5A 3I7DA 2QQWA 3WEZA 1CX4A 3VZLA 1OXCA 3NNFA 3ZDSA 3R6SA 5LA1A 1Y9QA 3MLJA 4QPGC 3MIDA 1PVXA 1MZFA 1D4M3 2QVSB 1FT9A 1QJX1 4FI9A 4RGAA 2HWE1 5BNOC 1YWKA 4HK8A 3DXUA 1XQNA 3NNLA 3WP6A 4IGPA 3MI8A 4A6SA 4DB5A 4QB6A 3OUJA 4NVPA 2Y6GA 4IV1A 1RUNA 5CYYA 2PHRA 1VMHA 2ZX1A 4MX3A 5L7OA 3N35A 3VBSA 2HBTA 3RZGA 2DYCA 3J26N 1J3PA 4ZZ5A 4N7IA 2CGPA 5L7OC 2E7TA 4D6RA 1BEV3 2VW1A 2D5FA 3O1TA 4YNIA 4URAA 3RG0A 3RZKA 4TYSA 1PMHX 3VKOA 4IDZA 3JQWA 3RS6A 1JZ3A 3MIHA 2A70A 2C5DA 3MEPA 4XIKA 3PJQA 3JCIA 1B35B 2OQ6A 2BW8A 2VBPA 1NCRA 4FSJA 3GZTB 2FCUA 4HSLA 1WMXA 2A71A 1B35A 2Z79A 1SLIA 2GNBA 1EPZA 3AKTA 4HONA 3WUCA 5C3RA 1PO11 5JXIA 4S2HA 2YB7A 2ZOEB 3AK0A 2JENA 3HQXA 1RL3A 5FZEA 4RR3B 4URTA 5FPAA 5I0TA 4HVRA 1X82A 5KWRA 4FTBA 3UYJA 2R042 1OLMA 2J7MA 5CKMA 1D2SA 1S2KA 3AVSA 2JG9A 4L8QA 4RGKA 2D6PA 2B39A 2YU2A 2IVIB 2XJTA 3ATGA 2WS92 4AOCA 3I2JA 2AH2A 1MACA 2RR12 4YW5A 1YFWA 4DUWA 1NQJA 5IYYA 2ADEA 2RS53 4ZXKA 2VZQA 2D6MA 4IE0A 3I49A 5LCWL 1H8VA 2LM3A 2UYBA 4CCCA 5K0UC 3ZLIA 4IV3A 1SG3A 3D82A 4NIAA 2Y6LA 3AFKA 3MW4A 5JXGA 4CCKA 1AR93 4XJWA 1UU6A 2XG3A 2WA4A 5BNQA 3LEKA 2XJUA 1KDKA 3PJYA 1PK6A 1OH4A 5FP8A 3VL9A 3RJRA 2YGMA 4MH0E 2LROA 3UKVA 4IEVA 3WP3A 4EWDA 1R091 3TN93 1Z78A 1WCSA 2QKDA 3WNMA 3TEWA 1LNSA 1RXFA 4PIXA 4MVTA 5T50A 2YC0A 4JHZA 3NW4A 4XETA 2LALA 3WCSA 4IE4A 4M4PA 1WW4A 2JDHA 4XFAA 2R062 2VTXA 4L2NA 5JSRA 1RUI3 3PUIA 3C8XA 2E51A 4COZA 5L19A 3ELNA 2PAEA 5FZGA 4E4DX 3AFGA 2FZ1A 3A7QA 2E6VA 4Z8BA 3CZJA 3RGBA 1FPN1 1UD1A 2D5HA 2P3IA 3PURA 4HETA 4FOQA 2BGOA 5F3CA 1YO8A 1BKZA 2FHRA 4QX7A 1O59A 4JGYB 3IAQA 4E2QA 1NKGA 3LKJA 2R1DA 4KG8A 4MYEA 5BY5A 1LOFC 4YW1A 2OZ6A 1W6MB 2D6KA 1JOPA 4NPRA 1BVVA 1VBE3 1ND2C 4RQPB 2HWE3 1NOVA 2IXKA 4MXWB 4RYDA 3WQBA 2XHKA 1W6PA 1ZZ7A 4I0BA 3DN7A 2E32A 3VHOA 2VH9A 4CUAA 2PHFA 1KRIA 2WO2A 2Y33A 2XJQA 4CDQA 2OPWA 3PMSA 4WZCA 1AJKA 2KXLA 4JRAA 3HNYM 3RJ2X 4YZ3A 1TVGA 3R4SA 4KGGA 5D8AC 1LEMA 4EN9B 3CKHA 5GLTA 1QKQA 1ZRDA 5DMYA 4IEUA 3APBA 1GZTA 3EB7A 4LBOA 1PVC3 4K40A 2WZR3 2UU8A 3CF6E 2JDUA 2W0XA 3QD6A 4ZU4A 3VD3A 5A3WA 1YEWA 1YQ6A 2I07B 2PELA 3VBUA 3GXUA 1IZ3A 3VDBA 3K4AA 5IK8A 5C9AA 1QJY3 5FXVA 1SDDB 2P5BA 1Y7BA 3FX3A 2NMNA 4HOOA 5FP3A 2VXJA 5C9AC 1ND3C 4GD4A 1JZ6A 5FXWA 1V6LA 4NUBA 2WZ8A 1OD3A 3KMHA 2A3WA 4P08A 2W39A 1ZA4A 3K51A 2B45X 2BBAA 1QEXA 3AMNA 4QT6A 2I45A 5DUWA 3FHAA 4IEOA 5FYYA 5JWPA 1X50A 4OUEA 5DPNA 4P02B 3JB8A 5F3GA 1NA1A 4OVEA 3MF6A 1LOCA 1TNRA 2QQUA 2K0GA 1FAYA 4QQHA 2JE8A 1UOGA 3FZ3A 2VMEA 3SISA 3WY6A 1A3KA 2G19A 4LKFA 2JDNA 2FDJA 3I3EA 3MYXA 1OLRA 4PJYA 5A3PA 1IHMA 2YDEA 2P2KA 2RDNA 4QPIC 4RS5C 5F2SA 3W58A 4AFMA 5K4LA 2BYVE 3MF9A 3BCWA 3MUZ1 3MPBA 3J8F3 3O1PA 2QQOA 3DV8A 3ZIXA 5A1AA 3FUQA 3H3LA 2LRPA 4BLJA 3TAYA 3H0OA 1LGBA 2VZUA 3KCCA 1SLCA 2WQZC 3OBTA 1G86A 1UL9A 1QJY1 4HN0A 3POBA 4INDA 1AR92 4IV3C 4AI8A 4JHTA 2Q8CA 1QHDA 3N9NA 4I3GA 3ZSKA 1SQ4A 2AR6A 2ZZQA 4R9BA 2YXSA 1C5HA 4Q4V2 1ZA7A 1US3A 4QU1A 4Z07A 4LBQB 3FWEA 4AI9A 4C1XA 2A5ZA 4BIFA 1L7QA 1G9AA 2RM22 5A7WB 5EFUA 4QXBA 3HNBM 3RI8A 1AL21 4FPCA 4A6OA 4BMBA 5J09A 3Q9OA 4AHZA 1V9U2 4LUKA 2QDNA 3CJIC 3D4KA 2VOTA 2XLGA 3A22A 1GFF2 5IVYA 4QM8A 2QNKA 4KQ7A 3VD9A 1CAVB 2MEV3 3AVRA 3PL0A 4M0HA 4M00A 4UF0A 4XABA 5D2AA 3VDCA 4B1MA 4AEDC 2YG0A 5SV8A 1MS5A 1DBNA 1O91A 1TMF2 1LKNA 1RGSA 4AYUA 4QKDA 2VOKA 1WA6X 1UZYA 1GU3A 4K3UA 4KWJA 5CEHA 1AR83 2K46A 4XQDA 1Y43B 4AQSA 3PUAA 4PLNA 1C8M3 3HT2A 3MHZA 2MEV1 4RHV3 3VDAA 1IG3A 4AEDB 5GLWA 4HKOA 4FPLA 2BERA 5GZGA 2EF6A 2WZPP 4XIOA 2ATFA 1FI2A 3SC7X 2J1SA 2ZHKA 4A2UA 1I5PA 1DHKB 1QU0A 2RDSA 4QQPA 2H0BA 4YG0A 1Z7S3 3WF1A 1DQ6A 1O4ZA 5HCHA 2F6BA 5B4XA 4BQ1A 1QH7A 1G7YA 3Q8BA 5FZFA 3VBFC 2UWCA 4HBNA 4S2FA 3WHTA 2SLIA 2JDAA 4WM7A 5JI9A 3LOBA 2XUMA 4XVHA 5FZ9A 4COVA 1ULCA 2HWF3 3WDVA 1AYM1 3ZYFA 4MG2A 1IGOA 2IZWA 4P9IA 4Q5OA 2UURA 1H8TA 2JECA 3OY8A 4QU2A 2RR13 3TWIA 3BVCA 3VBFB 2WN2A 1AVBA 5ACA1 1S0DA 1X7NA 4QQ2A 1UOJA 2VZ3A 1A78A 1J1TA 4P00B 2VULA 3T09A 1YQCA 2SBAA 5FYSA 2D40A 3T2PA 1J58A 4YRDA 1YFYA 5A7QA 3VBUB 1H6YA 3AJYA 3B01A 2JKXA 4YARA 3LF7A 5FK8A 4J1WA 5C3PA 5I0RA 5I8TA 4Y1YA 2W47A 4AR2A 1TME3 1XXNA 1NA1C 3KQ4B 1HB1A 4JX0A 4UBHA 4LHLA 3O0VA 1AXYA 5IATA 2XHNA 4UXAA 4ISRA 3POFA 2OQ7A 1WWYA 1NCRC 1GQPA 5FWJA 2LUWA 5JZGB 3CIHA 3VUOA 3L2YA 1XJAA 1BBT2 1GOFA 1VBA2 2A6YA 4HZFA 5DUVA 5DUUA 5DZEA 1JZ4A 5FLIA 1EP0A 3HBZA 1SDWA 3OBRA 4PCRA 3DEMA 3FE5A 1B35C 1UX6A 3VD4A 3QH7A 4TZDA 3X29B 4U36A 2QUOA 2OVUA 2WT0A 4QX5A 2OUHA 1VB4A 4Y5Z0 2VMFA 4Q1RA 2BQPA 1GUIA 1UMIA 1UXXX 3P5BA 1SLTA 4XXAA 4MGIE 1D2QA 2D3PA 1UXZA 3GZEA 4LITA 5T3NA 3VN4A 5DAWA 4JDMA 2YFZA 3IB3A 1DQ2A 1H4GA 4LO7A 5DZGA 1U5YA 4D94A 1XPWA 2V72A 1IS3A 3GALA 3OYWA 1UOFA 1ZYBA 4YSFA 1XBFA 1DYOA 2ETEA 2XKOA 3O0XA 3ORJA 4XJ8A 5BNNA 3AKSA 3KHBA 3ZVXA 2BGCA 4ASKA 5J48A 3TEYA 2VUJA 2EXKA 1ZREA 1QJFA 2HH9A 1UIJA 1N47A 1DQ1A 5C70A 1PIV2 1MQTC 4XILA 5FMCA 1W3XA 4BYYA 4DZGA 3RYRA 2VOWA 1W8WA 5ERLA 3GDBA 5FY8A 1KFXL 1QY4A 1JH5A 5KC6A 3V0AA 2ET7A 1NZIA 3VBRA 4XJUA 3B3QE 2OA2A 3I2DA 2AZ5A 3PDQA 4Z2WA 3VHPA 5JI7A 1NUKA 4A42A 2GN3A 2RE9A 2WFF3 5A80A 1E57A 4LR4A 1JYXA 1E5RA 2ADDA 4BWOA 4MGYE 1H2LA 3WD5A 1PO13 2AGSA 1CPNA 3HOBA 4IEYA 3RDIA 2HWD3 2PAKA 1WW5A 1COV2 3LDRA 4MOAA 4LHSA 4CXWA 1BK0A 1CESA 5C9AB 1AYN3 1TZOA 2OIIA 1ASJ2 3MFAA 4AGRA 5FUIA 1Y3TA 4AFAA 1FPN2 4XQWA 1PGW1 5GM0A 3WF0A 3KWVA 4LO8A 4IW3A 1RMU2 4NR1A 5A7NA 1LOFA 5GLZA 3UT0A 4CXXA 2WNVC 4GMP3 5B4NA 2F4LA 3B93A 3O1SA 1MS8A 4ZY9A 1Y9GA 4Q8LA 1J84A 1W90A 2W94A 3MV01 1GWMA 5FJHA 4CCLA 1ZZBA 4GB33 3FN9A 1RVF2 2VCAA 1WCDJ 1RUC1 1D4VB 4DUXA 4CDUB 5IFPA 3I2GA 1KDMA 1LEDA 4GH4A 1UY4A 4UYBA 2DBNA 3RPQA 2JIJA 3C7EA 4AHXA 3KQRA 3MFCA 4LQRA 4AWDA 4B7KA 1F15A 3NWKA 3O5SA 2DUQA 2PN5A 3M2MA 4Q4V3 4P14A 4R9CA 4EV0A 1WGPA 1OA4A 1VAKA 2BOIA 2J1AA 4JKLA 4LO5B 3THTA 4UI9L 3S7IA 1JOBA 2AACA 2A7AA 3M8LA 3Q8CA 1W9FA 4AVBA 2WYSA 2XVKA 3H9AA 3R4UA 1C3HA 3LZZA 4BQ2A 4WBBA 4JVAA 2EAKA 3E6CC 1OT5A 2ERFA 2ZCWA 2VW2A 1GSLA 5FBZA 3K3OA 4QGLA 5BYNA 3OGSA 1MEC3 1DQ5A 4GMP1 1JYWA 1DYPA 1WA4A 5DDJ1 1HQWA 1V6OA 4JC1A 3RZLA 2E33A 3BB6A 3H8RA 4DPNA 1QGLA 2B46X 5F3IA 4AG4A 1MS0A 1XE0A 4XUPA 3HIFA 1PMJX 2ZGRA 4S2GA 3M3EA 1C8M2 1ZBA1 4Q0PA 4RHV2 1PMIA 2WAAA 4OMDA 4C0HA 1NX9A 1UO9A 5A3MA 1Z0HA 1X9PA 1D4M2 2WWUA 3NQHA 4KU8A 2XLFA 3VBHB 5CBLA 4B4PA 2OXBA 2QBXA 2W92A 3I8TA 4I3PA 4IETA 3W5NA 1YXWA 2VAUA 1S4CA 3N9OA 1AL22 2ARBA 5CNAA 5LBFA 3ZYJB 5HXMA 5K9YA 5L9BA 5KXEA 3B02A 3PMEA 3KS7A 5D21A 1C1LA 3VL8A 5FBJA 3CJIB 1SMVA 2ZGKA 4XMAA 1UZVA 1WCQA 3WNNA 4CDWC 2EAAA 4N9IA 4NMIA 2IC1A 4XEZA 2OZJA 1RXGA 4NRPA 4Y33A 3DGTA 1AR91 3TNQA 4C90A 2PTMA 4XCAA 1JUIA 1ZZCA 2WNOA 4IEQA 3E5UA 4TXWA 4XMIA 3RSJA 4BZ4A 5HV4A 5G05L 3MICA 5GALA 1DU3D 4YZ2A 4OHWA 1A8DA 4MZUA 1FX5A 5HPOA 1ZRFA 3I3BA 4NN0A 3SH4A 2VZRA 1HRI3 1NLQA 1CAXA 4GJZA 3DYOA 2FMDA 5CFDB 1O5UA 3MIFA 3LGRA 1QDOA 4CEWC 1OF4A 3C7OA 2GN7A 2JX9A 1MZ6A 2WO3A 3KF3A 4WM7B 5IWFA 3VZOA 1PO12 4ITCA 3URFA 3FBYA 4BLIA 3CJIA 4P5HA 3O0WA 2VNRA 1I9RA 2RS11 1AR81 1EAH1 3H1YA 4IE6A 1RUE1 3CBNA 1H8TB 2CDPA 1RUD1 3BGAA 2VC9A 3U14A 5I0DA 2BNMA 1QXPA 4HKLA 1JYIA 1NY71 1RJ7A 2BGPA 2YROA 4MGQA 1FPN3 1QXJA 1WLTA 4LNVA 5T5PA 5A6XA 2R043 1CWPA 5A3LA 2VECA 3UGHA 3O1MA 4GWMA 5E1RA 3ZFEB 5AC91 3HAGA 5L36A 4IL7A 3KF5A 3POGA 4Q0QA 3HPNA 1AXZA 3ZFEA 3LIGA 3OPTA 1CJPA 3E1F1 1W6OA 4OI2A 3RYKA 3FC0A 3ZXGA 4BQXA 1N3OA 4CYDA 1JU4A 5FYHA 3H7JA 3FUOA 3NJZA 1YI9A 3MBWA 4XQ4A 3LIHA 4UFLA 4LJHA 2WT1A 2CYFA 1ZBE1 4LBKA 2ZGNA 3T0DA 4N43B 4QKNA 3ZSLA 1RITA 3O12A 4GH4C 3VGIA 1L7LA 3WZ1A 5A6YA 5IVEA 1CAWB 2Q1ZB 4QAWA 3WQ1A 3IT8A 1W28A 3AJZA 3DF0A 2Z69A 3VBOA 1ENRA 2WLQA 4QPYA 1AZDA 4XZUG 5FJKA 5BXXA 3SMHA 1S2EA 4XBNA 2TBVA 2VUDA 2JG8C 1W6OB 4Q0UA 4Q4Y2 1YNAA 3K77A 3P6BA 3SH5A 2BWAA 4D69A 2Y26A 3KVAA 1C8NA 2XDVA 1CAXB 4OZOA 1ZBE3 5CFDA 4DUVA 5BNOA 2DCJA 5FP9A 4C1WA 5CFCC 5DUXA 2ZEWA 4N53A 2HEVF 4JQRA 4Y4RA 1OFNA 2BWCA 2VE1A 1O3QA 5F7UA 2IUWA 1O3TA 3KCXA 1PGW2 5LEKA 1O7FA 5IK5A 1OVSA 4XOGA 1MEC2 1PIV3 4MHRA 1XSQA 5A6ZA 2NLRA 5D1IA 4O9GA 2R6QA 4FQZA 4I09A 2CGOA 3HQUA 4XF3A 5J7MA 3HT1A 2HWF2 2D97A 1WMFA 1ZBA3 2XLAA 4XFBA 3VKMA 2WFPA 1BLZA 2WC2A 4GIQA 4Y5TA 5F6KA 2NPIA 3DKWA 2AC1A 4EZHA 4YFZA 2VY0A 5FYZA 1Q3EA 2Z4FA 3E5XA 3CMGA 4W65A 1EYBA 4BXFA 4TLGA 3NV3A 1Y4WA 3CL1A 5LATA 1FMD2 3AMMA 3WVJA 3LB9A 1XNCA 3W21A 2H6CA 2WDBA 5JDBA 4YGBA 4YW7A 3IBMA 5T5JA 5LA0A 2WQ4A 4RS5A 3CU7A 4NHKA 2I2SA 2VNOA 4Q4X3 5A7PA 1YLLA 2VD7A 4IE5A 1GANA 3JU9A 5FLHA 2Q8EA 3H8UA 3M1HA 4UFJA 5JXJA 2VNVA 1CIYA 1HW5A 1JTZX 4OI4A 1ONAA 1N1TA 2VG9A 1IQAA 3AZVA 4CCJA 5FYTA 4CDXB 4QHZA 1XNAA 1G9FA 1SHWB 1VBE2 1VRH2 1DFQA 2NN8A 1GOHA 2W9XA 3AMQA 3SITA 3H3UA 1F4HA 3NSTA 4COYA 1IQDC 3G6JB 4CEYA 2MPFA 4QDQA 1MZEA 4Y24A 3U78A 2YBPA 1RYYA 4HL0A 4B3NA 4CUGA 2VZPA 4DY3A 2FD8A 3ZN4A 3PU8A 4CEYC 1YQ5A 2ZBJA 3LFIA 4NHLA 1QOOA 2B8MA 5A3OA 4NO4A 3UJOA 4RS5B 2BBVA 4GKYA 4RFRB 1H0BA 5CU1A 1Q8VA 3SCHA 3IDEA 2A1XA 1PO21 3U0ZA 1WW6A 2QQMA 3I2KA 2J42A 5FZBA 5HCFA 4DEVA 3L2HA 5A3UA 2OT7A 1YQ2A 5E88A 5JR2A 1V6NA 2XONA 3ES1A 4GJYA 4PF1A 5I91A 1H2NA 4NE9A 5EPAA 1K5JA 4YZ4A 1GQHA 4NAOA 2VQTA 4NHMA 1F31A 2RS51 4MHUA 3H1WA 1TQ5A 2O8OA 1FMD1 4LORA 3ALQA 3BN6A 1F35A 1QOTA 2C1FA 1S55A 2HWD1 2V5YA 2GNTA 2W52A 1W6NA 3CO2A 3HWJA 3JXSA 3LQCA 1UZ0A 2JDPA 2DV9A 4IEXA 5GJ6A 1W8NA 2LTNA 1CPMA 1VAVA 4QX3A 4EQVA 4IERA 2JDKA 5GZFA 2DVFA 5F8PA 5C5UA 1F4AA 2BOJA 3I4IA 3I2IA 3GHMA 4E8CA 1Q8QA 3RZMA 4RQPA 5CG8A 1SFYA 2A6VA 3GBFA 4XC9A 2HBUA 1BEV1 4DIQA 1UNBA 2V5DA 2PLV3 4EN7B 1AL0G 4XURA 2QDRA 3AC0A 1R1A2 3NJXA 3POJA 4Y22B 5DABA 1Q5OA 4YPJA 3I3DA 4XCBA 4ARXA 5DAXA 3THCA 3VDDB 4D6QA 4EN6B 5FXXA 4MGSA 5AVAA 5A33B 1UY3A 3MIGA 5DXDA 3ZFFA 3PHMA 2WLPA 4CEYB 5CA6A 4E4SA 2BPA2 1RJ8A 4LBNA 4N90A 5CB7A 1TMF1 2B5HA 5FZ8A 1DIWA 4Q26A 2NMOA 3UGGA 1JZ7A 5C4WC 1O4YA 2YHJA 4QPGB 2CSGA 2BP6A 2JB8A 1P8JA 2PAMA 4AQ2A 3PVBB 4JKKA 2XQRA 4W50A 1NQDA 1AL23 2GMEA 2WN3A 2G4IA 3OD4A 4M0NA 2IVJA 1ACCA 3KD4A 3V0BB 1AYN2 1REDA 1QJU2 3QH6A 3THDA 1QXRA 1RVF1 1NXMA 2OX0A 4PDWC 1JXNA 5FO7B 1DQ0A 2GZWA 3RZHA 4A7YA 4A45A 5BNPA 2GH8A 2X10A 3AZXA 3JBG1 1H9WA 1OC1A 3W59A 1N1SA 3CEWA 3K48A 4JGZB 5DAVA 3TNPB 1AYM3 1YIPA 2BJSA 2UY9A 3M3OA 1EAH2 1RMU1 5A7OA 4JKMA 2VZOA 3N3HA 2Z5WA 4BK5A 3LSDA 1V0AA 3RWKX 3BIEA 2W68A 2D6LX 3NV2A 1NCRB 4DMIA 4OQ9A 1RVF3 1OLME 4CP9B 2TNFA 4AVCA 1RC6A 3RFRA 1DF0A 1UIKA 4ZS2A 5I0UA 4LOSA 3UGFA 2P3JA 1GP4A 4XAAA 4BISA 4QQOA 1N3PA 2BEOA 3I59B 4B1LA 2ZAAA 3POEA 2Y34A 3CJXA 3DECA 3LPFA 4YYOA 4CEWB 3ST7A 1CX1A 4SLIA 1RTVA 1NLRA 2O1QA 1AR82 4Q0SA 3KV4A 4ZONA 2XQXA 4CA9A 1OD5A 3AZWA 3H7YA 4V2VA 4DXSA 1AR62 1OURA 4CCOA 2DCZA 3A21A 4LHNA 3USSA 3ZYIB 3BALA 3KLSA 2X5IC 1GICA 3ILNA 1SBFA 3H50A 2YMZA 1GWLA 3EXUA 2PHUA 5JVVA 4O7XA 4CP1A 4E4ZA 2X5IA 5T54A 4AEMA 1RHI1 2JG9C 4CP9A 2CV6A 4B4QA 1B09A 4A3ZA 1VE0A 5CADA 4UBGA 3JD72 4K9SA 4XTMA 3TEZA 3M4FA 1H6XA 1KGYA 2NZ9A 1LULA 4ZXEA 1D0HA 3CLPA 2D3RA 5A7WA 1FV2A 3M70A 4CDWA 5FKBA 2E53A 1RUJ2 1XSRA 5FYVA 3S57A 1KQRA 5EP9A 5J37A 4ASMB 1G9BA 3OGJA 3TEXA 2JDYA 5EWSA 3VKLA 2D7FA 4KMQA 5ABJA 4YZ5A 4CPBD 2HWC3 4Q29A 1PM7A 1NT0A 1KFUL 1A34A 1AUYA 4GXLA 4LIUA 5F37A 2JE9A 2C24A 4M3CB 1LHNA 4AVVA 1PK6C 4CDUC 3RMXA 4FPHA 5IT6A 4YW3A 4Q8KA 4IV1B 4IGQA 4XJZA 1U5XA 2AENA 4OZXA 2IXCA 1SLAA 5FO9B 5FY1A 2ZEYA 4W6YA 4XFHA 1LHWA 3OSDA 3LEGA 4CU8A 1SCRA 4AEDA 4ZPIA 2EXJA 4AW7A 4DXZA 2BRTA 2P1BA 5AC93 4AHYA 1W2AX 2EXHA 2FMYA 4PIZA 3GHNA 2XJSA 4Q4X1 1TME2 3WDUA 3JBG2 4RR3A 2JDZA 1C28A 1WLWA 3WDXA 1R1A3 1PK6B 3IM0A 5C71A 4CE8A 4RR3C 4LT5A 1O8PA 1C57A 1BMV2 1QQP2 2BDRA 2P6HA 4YWAA 4YLZA 2IXIA 3PVNA 1OMIA 1UX7A 4HPKA 4PBOA 1JS9A 4RD7A 4YZ1A 3ZYHA 2WNVA 5EZWA 3GZUC 1F5FA 3ACIA 4XFIA 4ZU7A 4GALA 2QFEA 4KBZA 2DFBA 2DCYA 4I02A 4PQQA 1PGL1 2R061 1ULEA 3MIBA 1E5SA 3Q8FA 5EV7A 3SCFA 5C3SA 4YVWB 1R1A1 3VKFC 2ORXA 3CHXA 3ZXDA 5BV6A 3DUIA 3U07A 1O5LA 5CIRA 2W46A 3VBFA 4CDWB 2PHLA 3WDYA 4CDQC 3SKJE 1HRV3 4BE3A 4IV3B 2ZX4A 4LPLA 3VZJA 1BJQA 1R092 3OEBA 3VBOC 1C5IA 2GNMA 2QJVA 4LKEA 1VBB1 3ENRA 3POWA 3JQXA 3BKZA 4Y1ZA 5F39A 5FQ0B 3VBHC 3WDTA 1W8ZA 3K4ZA 1XYPA 4H14A 2BNOA 5FWEA 5FY5A 1UN1A 3EQEA 2ZGUA 3DXTA 4KG0A 5IVVA 3FJSA 3ZR6A 4QPIB 1ND3B 4WVZA 5AVPA 4YM0A 4NIGA 3RZJA 2IXHA 3J7LA 2J1RA 1VBB3 1XU2A 1ND3A 2UWAA 3GCWA 4QDSA 4QX1A 5CFCA 3ZN6A 1MPXA 4XE9A 5APAA 1VP6A 4JCKA 4MSVA 4YG3A 1OQEA 4JV4A 2C0ZA 2WS91 1Q43A 1NA1B 1PO22 1VBC3 4QPGA 4AEKA 1HV0A 2GC0A 1K5MC 2PQSA 3WNXA 3IDAA 3OGVA 5FDBA 1UAIA 1REEA 1MS1A 2PLV1 2UWBA 3VKNA 2RDRA 3V0BA 4AI3A 1ZRRA 1RUF2 3B00A 2VU9A 5JMOA 4JAAA 3WF2A 5ANQA 1JODA 1T6GC 1N1VA 1GMMA 4IV1C 4X8NA 5FKCA 2RM23 2PHXA 1QF3A 4LEJA 2GC3A 2HWD2 1QH6A 1UPIA 1VR3A 2ZTNA 4OFGA 4EN0A 4BQ5A 4KNCA 3KT4A 2FDKA 1ZX5A 2RS52 5FZ1A 1DP0A 3ZFGB 4YW6A 4CP0A 3T2OA 1IPJA 2P3KA 3MZHA 1I3HA 4AI2A 1PHMA 1QNWA 3ZFFB 3IN9A 2L9LA 2W3JA 1CONA 4ONUA 1KXGA 4C0BA 3ZDVA 5JOXA 1UYPA 4GULA 3ECQA 1OOPC 2CWSA 1XRUA 5CKQA 5C3OA 4D7TA 1GYKA 5JIUA 1C8M1 1UF2C 1ZBA2 5E89A 5FOJB 5JPMB 4AF9A 5FZIA 1MS4A 4ZHNA 5T55A 3O7OA 4FFHA 5ABJC 1AR71 1PM4A 2OPKA 4EJRA 3CDZB 3BPSA 1RUG2 4WV8A 1W8FA 1IS5A 1MR5A 2DVGA 2VQAA 1M06G 3SEEA 3J4UH 3ON7A 1AX2A 3AMPA 2YUEA 1PZ8A 4YVSA 3POSA 4JZRA 4OCTA 1E5IA 2PYTA 5FPLA 2VZVA 1GKBA 4YVSC 1RUOA 1RHI2 2R32A 4FFIA 5FY0A 3QACA 4AZZA 5C7GA 1RUI2 3UESA 1H30A 1WCUA 1U0AA 2JICA 2RG4A 5DQ0A 4H7MA 1GQGA 2PQQA 3U37A 4UW5A 2HWF1 5LZ6A 2J1EA 2ZGOA 2Y60A 4HFSA 4B4RA 2GMPA 5B2GB 1FYUA 1REFA 4CU9A 5CKNA 5CAZA 1UYYA 4LXLA 4Y1XA 1HX6A 1J59A 3PUHA 4GWJA 3DCQA 3GNEA 1BHGA 5F5IA 2KR2A 2EIEA 5K0UA 5F32A 4BCUA 4NJ4A 2R063 4DRVA 2H6BA 4H3WA 5C33A 4JGZC 2BTVC 3V65A 1R64A 5A32A 2VXRA 1YFXA 3NKGA 1W0PA 4PIYA 3WV6A 1OA2A 2WO7A 2JG9B 4GWIA 5A3TA 3W9AA 4K20A 2X05A 2J1TA 1CJDA 1JN2P 2FZ2A 2P6CA 2QZ2A 4AI1A 2CGNA 1H4HA 2ARCA 3PIGA 1DLCA 3K75B 1R093 3KZ4C 3MW2A 5FFOC 3TN91 2D43A 4DRRA 2E31A 4HKWA 1HXS3 1DZTA 3O14A 4MO3M 2ES3A 2XVGA 4GH4B 1U5ZA 4ARYA 5KXCA 3KT1A 5C4WB 3FFZA 1AF9A 1TG7A 4F7ZA 3LEMA 4BB3A 5C4WA 2JDMA 3ZFFC 1EUUA 1WCKA 1ZZ6A 2W91A 4R4XA 3OTFA 4E2SA 1QJX3 3USUA 2ZA9A 5C6CA 4B7EA 3N4MA 1MS9A 4GKXA 5EYXA 1XYOA 1R1ZA 2Y38A 4J25A 4MGKE 5FP7A 4D3WA 1OI6A 1VBB2 2BFUS 5BPXA 2WNVB 3ILRA 4F8AA 1J3QA 4WVWA 4LBLA 3IDBB 3WLUA 4CCNA 4E4HA 1SEFA 2ZGSA 1UPSA 4PDWA 5IFTA 3VBSC 3ZSEA 4UFIA 2CWMA 5DAPA 5I8YA 1HRI2 1K5MB 1RUF3 1JI6A 1W04A 3AP6A 4FT8A 4PDWB 4AE2A 4NIHA 1S0CA 2W5FA 4IEWA 3S6PA 2RHPA 2Y6KA 3T0BA 2JE7A 2RJKA 2JKBA 1JW6A 2X8KA 1BZWA 5JAXA 5LASA 2DDUA 2XOMA 1DDLA 3AZYA 1QQP1 4MUVA 3JUUA 1ZRIA 2DCTA 3LD8A 4HSJA 4XZPA 2J22A 3SH3A 3J9SA 2JD4A 4NPMA 4XBQA 2CNAA 1O3SA 1LGCA 4KI5M 4YGCA 4Q4W3 4NPLA 4RSUA 5F2WA 2VMDA 1G6NA 4BQ3A 1ULDA 1NE4A 1NZCA 2ZHMA 4CTEA 5A6QA 2VZ1A 5FREA 1W8OA 3M7AA 1OLQA 2V73A 1Q8PA 2R30A 3AP9A 1DLLA 4YM1A 3KV6A 1RUD3 1RIRA 1QQP3 4LKSA 4QHBA 5CVRA 5IAVA 2CAUA 3R4DB 3PUQA 4XAEA 1U12A 4Z2AA 3OCPA 3OUIA 3D5OA 2IXLA 3NV1A 3OGRA 5FPXA 5EXOA 4EWAA 5JZGA 3OYWB 4XDOA 1GBGA 3WW3A 1US2A 4FO9A 4XJ9A 1KD7A 4KU7A 5F5AA 1W9SA 5TSWA 5IAXA 5J1XA 5JZGC 3AKPA 4O61A 3BYWA 4QGNA 4MXVA 5EJZB 3ACGA 1H2MA 4FPJA 1FOD3 2FQPA 1W9YA 3B94A 4RHV1 1JOJA 1RUF1 1V00A 4QXHA 1W6MA 3C3VA 1VBD3 2Q8OA 2EA7A 3ZFGA 4CRQA 4M01A 4QPIA 1LOAA 1URXA 3N7LA 3DPRB 4QWNA 3PIJA 1RMU3 4DY5A 1DZQA 5DDJ2 3JZVA 3NVCA 4FOVA 4ISQA 4CDQB 3MV11 1LJ7A 4G3YC 3VBRC 1FOD1 1O8SA 3L9JT 4WM8B 4W8JA 5FY9A 5FXZA 3RRDA 4AGVA 1RUC3 4P9XA 2CY6A 3I3MA 2W95A 4P9GA 2GMMA 5F3EA 4K21A 5GKAC 3GBWA 4RN5A 3ZXFA 2VCBA 4NRMA 2XWJB 4IEPA 4LBQA 5L73A 3A4UA 3I3QA 5FO8B 1YCIA 1POV0 2A73B 2BVBA 3A23A 4Y1VA 2WABA 3LPGA 3M3QA 1ST8A 3B9IA 5F5QA 4OHZA 3D3AA 3WOGA 1SZBA 1Q8OA 2DCKA 3VBSB 4CZSA 2BVVA 3NKTA 1K45A 1XOYA 4PQ9A 2Q30A 4LBMA 4OQ8A 5IJRA 2HWC2 5LBEA 3DL3A 3BTXA 4ES9A 3LEIA 4QB1A 3M3CA 5FY7A 2NM1A 3H8OA 2PHWA 5FUPA 2YZ4A 5A1FA 4E8DA 2R1BA 2HKXA 3IIAA 3UETA 4RGGA 5JOZA 1YRZA 1QNYA 3MGUA 5FZ6A 2HEYF 3U1XA 3WP5A 3N9MA 1Q8SA 4IXLA 5FZCA 2VOXA 1S0GA 4CUBA 1DYKA 1RUH1 3T2QA 3W5MA 1UMZA 1YUDA 3IDCB 1VPHA 4Q4Y1 4R9DA 1YJLA 2MNGA 4CCEA 2MHFA 1ASJ1 4HK9A 3KGLA 1XNBA 5JSOA 4FBFA 1TEIA 2VJXA 3AYAA 3KM5A 4P9JA 5LK5A 1VRH3 3A0KA 3LWCA 2HWC1 4K8RB 4MLOA 1UZWA 4NWWA 1OKOA 3BTYA 3LA3A 3Q8EA 4YW2A 3V0AB 1MVEA 3WXPA 2BZDA 1W9TA 4WM8C 3GM8A 1PNFA 1UY2A 5A3NA 4JGYC 4IUGA 3PU3A 2PHTA 1PZ7A 3D6EA 4FPEA 2Q5TA 2VUAA 1AX0A 3WNPA 3LCPA 3HQRA 2RV9A 2QQNA 1VBC1 2R0HA 1X9TA 2YBKA 4N7UA 2Z2SB 4R52A 1IKPA 1ODMA 2R16A 3ZSJA 1ZZ8A 4UW4A 4TLFA 2AEZA 2RS32 3RNSA 1K5MA 2WAOA 4LLOA 1I1EA 5K7PA 1H8TC 4UF0B 1LRHA 2AREA 3A0NA 4I0AA 4UW3A 2ZABA 1NLSA 2P37A 5H9QA 2HWB1 3F95A 1VMJA 4QQLA 3VV1A 2OYZA 2DVDA 5LRRA 3H3ZA 3ZR5A 4OHYA 1RUD2 3TB0A 2HYKA 1STMA 3SLIA 4NWVA 2WZEA 2Q8DA 4GZ9A 1QJY2 2A6WA 4X6QB 1AR72 1WD3A 3G7DA 3KT7A 3O1RA 1IS4A 3JD71 4QM9A 5FZLA 1VRH1 5L9RA 1GZWB 1RUJ1 1W3VA 2B9UA 2FCVA 1ZVFA 3E97A 4ES8A 5GLUA 3R05A 5E16A 1W0NA 1GZWA 4CP2A 4ZKTB 2VW0A 2V09A 2ZMLA 3TYJA 3P3NA 1V6KA 2FCTA 2EIDA 4CCDA 2WKKA 2WT2A 3RZZA 2ZMNA 1TME1 3JB4C 2WFF1 2R041 3U4XA 1MZ5A 4CUCA 5T5LA 4XPVA 1FNZA 4F83A 1HXS2 1UQXA 4YGDA 4BPZA 4Z92B 3T1MA 1G9CA 1WD4A 1JYNA 1GP5A 3AYEA 5DDJ3 1I6XA 3J7NA 3WR0A 5ACA3 3LE0A 3FMGA 1G9DA 4OI0A 3RQ0A 4A4AA 2WZR1 1YC61 2LS6A 2ZGLA 4OUMA 3T30A 4ORFA 4P9LA 4Y20A 2QQPA 4PHZA 3I2OA 3NNGA 2VCMA 4DXTA 2J1VA 4BOWA 3J8F2 4DINB 3IWZA 3WQ0A 4J1XA 3OG2A 1XNTA 3EJKA 3EBRA 4BIOA 5JOWA 1Y9MA 3OY8B 5F5CA 3ACHA 3QBQA 1HKDA 3LDBA 3USUB 4KL1A 4AVTA 4JDOA 2CL2A 2Q0AA 2QQJA 4FPYA 3THPA 5A70A 2A3YA 3N9PA 5BNNC 1SLLA 2VTFA 3OPZA 3KVBA 2K9ZA 2XKPA 1CAUA 1AJOA 1TNFA 3ZXJA 5I0SA 4Y5SA 3VDDA 4AFDA 1OPMA 1KS4A 3BOPA 3UJQA 2DU0A 3K3NA 2GNDA 3NJYA 4GB32 1PNGA 4LKDA 4QXCA 1BVP1 1ASJ3 1POV1 1RHI3 1IPSA 1SACA 1W39A 3TBDA 3VZNA 5JOYA 2XB6C 1V6JA 2A6ZA 4LULA 4QX2A 5DN2A 1GWKA 5LW9A 3UNPA 4Q4W2 1VB2A 5FZAA 2RMU2 4XUNA 3K46A 2W1WA 2Q4SA 4XHXA 5HI0A 4UFMA 3VBOB 4AVAA 1X36A 4XF4A 3WNOA 3OUHA 2ZGQA 3OB8A 1CAUB 3AYCA 5FP4A 1QJU1 5FV3A 3RWNA 3WCRA 4M4RA 5IVBA 5ISLA 5JMCA 4DOUA 2IXJA 1JYVA 1OFSA 1ZNPA 3ZMOA 4H2AA 2MEV2 2ZGTA 2WSUA 3MIEA 3BUCA 3IMMA 4TWTA 2J1UA 2ZMKA 1F9KA 1HQLA 2JG8A 5FTTC 4E27A 3I2FA 5EQUA 1HIXA 1LU2A 1GR3A 4WZFA 4DO0A 4EROA 2YY1A 1S0FA 5KXDA 1N3QA 1NCQA 5FYBA 2EALA 1H1AA 2C6SA 3AL6A 5LBBA 1WLCA 3U11A 4N53C 1H2KA 4HVQA 4Q4X2 3AM2A 5LY1A 4RFT0 3IIIA 2WNUB 2NP0A 4OYUA 2RMU1 3BOWA 4COWA 1ENQA 1DCSA 5LRSA 4ZS3A 1ND2A 1KS5A 4PBPA 2FDFA 3TN92 1ODNA 3LFMA 2D44A 2ZHLA 5DG2A 5ANNA 4FPKA 2YPDA 3N7KA 2XJPA 2OW4A 2YV8A 4GQ7A 5AFEA 1SCSA 1GV9A 2BV4A 2PA7A 2PHDA 2QE3A 2JG8B 2Y6FA 3KCYA 4YW4A 1RINA 1X8EA 2ET1A 2ZXQA 4KWLA 4Y3OA 3AMHA 3SNMA 4N53B 5GZDA 2W87A 4L9BA 4MGZE 3ZN5A 3ZYGA 4YVSB 5I93A 1CIWA 3ZIWA 1IS6A 3QOPA 4A41A 3WF4A 2GP3A 5J98B 3M3IA 4UOJA 3OBZA 2Y0OA 3JBG3 1OBNA 4XUOA 5EJ3A 2DU1A 3S7EA 2A6XA 1NY72 2Y0IA 3VHRA 1ZZ9A 1A8MA 4M3CE 1HXS1 1KITA 4A44A 1EV13 4Y4YA 1LOBA 2RJ2A 3POYA 2YBSA 1CAWA 3KGZA 1UW8A 1VAMA 1PIV1 2VM9A 5H9PA 3J8F1 2XJVA 1OOPB 1DZRA 2ZPXA 4AEJA 5M0TA 2RS13 2JD9A 4GB31 2XVLA 2DUOA 2N7GA 1MVQA 4XFFA 4XDQA 2WNEA 2RM21 1YQ8A 3NO8A 4CPBA 3BIWE 2H0VA 4AL9A 2YU1A 4PI0A 1R083 1FATA 3HMYA 4GAZA 1W6QA 3SQOA 4C91A 3WT3A 2O8QA 3UL2A 4CVUA 1BQPA 3RMYA 3B9CA 1PX4A 2PLV2 3WW4A 3RI9A 1EY2A 3LA7A 5KHKA 3GBGA 3O1OA 1LENA 3E6BA 4META 5FZ7A 5FK7A 5FMOS 1C1FA 3IAPA 4V2WA 2ZS6B 3HN3A 1MQTB 5LWBA 4LE3A 4LMFA 5KHGA 2E63A 5CZKA 4CDUA 4HN1A 2RS31 2DF7A 1QIQA 4NOTA 1Q56A 2UYAA 1YIFA 4IQPA 2HEWF 1OPOA 4DXRA 1WMDA 3GJAA 3AXDA 2ZAHA 1OA3A 4M3CF 1S0JA 3C7FA 2QQLA 1W0OA 4LK6A 2F17A 1L7RA 2EIBA 5DG1A 3POIA 1CZSA 3T0AA 1ULOA 1CGPA 4AFCA 1AYN1 1UY1A 1VBD2 4BDVB 4ET7A 1V6IA 5SV5A 3ZPOA 5FZHA 4BM8A 1ZM1A 3VZKA 3WINE 1X33A 4Y1UA 4LLFA 5IHRA 2DVAA 1D7PM 4LBJA 3WG4A 1RUH3 1AYM2 1UOBA 5J36A 3NAPB 3WP4A 1T6BX 3HJRA 1S0BA 2KD7A 4BJ0A 2XWBB 3U4SA 2WR9A 1QDCA 1H1MA 2VOVA 3J7HA 3T08A 2QZ3A 3QLQA 1CAVA 4X6RB 1RB8G 2RDQA 1KJLA 1XNDA 2KM2A 1BEV2 1F5JA 4QGMA 5LBCA 4CDXA 1XNKA 5LB6A 1ENXA 4UAPA 4IEZA 2KA3A 2F4PA 4Y22A 2HJIA 4QDRA 3B69A 3C2UA 4XUTA 5BNPB 2FBEA 2ZX0A 2JWPA 4KWUA 2VL4A 1UKRA 2WNUC 4A7KA 3INAA 3VBHA 1WZXA 1PZ9A 2ZEZA 4H7LA 2BFUL 1XB9A 4PLOA 2E9QA 5FMDA 1ZBE2 4R9AA 1V9U3 2QQKA 4XFCA 1NCQB 2ID4A 2YYOA 5FMBA 4BQWA 4QHOA 5FPZA 1LESA 2W08A 4FOWA 1WLDA 4JGYA 5T52A 4R8HA 4LO6B 4A3XA 3LA2A 3GGLA 5C8CA 1CZVA 1ZRCA 1TMF3 4ATFA 1MS3A 1ND2B 2R073 3SXWA 1UKGA 3T1LA 3ZOIA 1OKQA 5C8CC 1ENSA 2VR4A 4SBVA 3SKVA 4FP2A 5KR7A 1O4TA 2ZX3A 1AHSA 1XU1A 3S0MA 2Y6HA 4DQAA 3BU0A 2VMGA 3WW1A 5JSPA 3AKQA 1H1IA 1V9U1 3HN1A 4Y20B 2QQVA 2W1SA 2ZX2A 1FNYA 2W1QA 3QCWA 5GZCA 5IUQA 3PTRB 3LOIA 2ARAA 3OF1A 4FPFA 5C5TA 4V1PA 1PGSA 4FXGB 5J96B 2D3SA 1QJEA 4BHPA 1K3IA 5FUNA 3Q8AA 1S2BA 2RS12 4DFSA 4L97A 3D0JA 1NG0A 4AK3A 1SFNA 3AL5A 2Q1FA 3SCGA 2VMIA 1DGRN 4OHVA 3N7JA 2OS2A 1LHOA 2VVEA 2QQIA 4LO4B 1HN1A 4LBQD 4XBLA 5FCCA 2WL1A 2PMWB 3BPZA 4K1YA 4PI2A 5FPBA 2WWJA 1OOPA 1CZTA 5A33A 3K2OA 1EPWA 3EO6A 1F2NA 5EJ1B 3ZKUA 5HBAA 1RUE2 2B42B 4Q2FA 2UY8A 2GDFA 5LK7B 4UFKA 2OKXA 2D6NA 3ZFGC 3N9QA 2ENRA 4XJAA 2WSVA 1GLHA 2X09A 1OHFA 4CU7A 1LODA 3ROUA 1LECA 4IGOA 4LUMA 2GU9A 5EHDA 2RR11 2E7AA 4JTNA 3WHUA 3DYPA 2ZGMA 4L11A 4XF9A 1PVC1 5HCAA 1F8VA 4EE2A 4UFHA 1UYXA 3U75A 4BH9A 4EN8B 1BXHA 1NYWA 4W6WA 3LDKA 5BNNB 1HN0A 1SBEA 3AKRA 1W2OA 4UT5A 3GYDA 2AUYA 4F3JA 2WWSA 3PVEA 3UKTA 3VLBB 2XJRA 4R4ZA 2TUNA 3HNMA 5FZDA 4FTEA 3LAGA 5LA9A 1JZ8A 2D93A 3ZYRA 3RVHA 4QX8A 5GLVA 2XBO3 2BU9A 4DEQA
chains in the Genus database with same CATH topology
4KH9A 1X8MA 4HANA 2ZJCA 3FBMA 3NL1A 3FFQA 3WW2A 2HWE2 1BBT1 1VBA1 3E6DA 3VZMA 5ACA2 4L99A 2VQ0A 4XXPA 3ZXLA 1FV3A 1D4M1 1C4RA 5FAXA 5GZEA 3MLLA 4G4FA 1MQTA 4GMP0 3VDDC 4I2OA 3ZMNA 2ZKLA 2GALA 2G9GA 1WMEA 5DZFA 5K8SA 5HXVA 2X29A 4JDNA 4IESA 4XF0A 1H9PA 2QCSB 5AFBA 1J3RA 1LU1A 3FLRA 3ME2A 3U10A 4HT1T 2VPVA 1S0EA 3HR9A 4G9SB 4Q4W1 3SHRA 3MPPG 2JXAA 4DNYA 3EHKA 5T5OA 4XF1A 4RQPC 1U5IA 4QMAA 3UKNA 1VALA 2BUKA 4AQ6A 1W2UA 3PVOA 1OSGA 1R082 3B7MA 4XFGA 5CFDC 4X8PA 2AYHA 1HRI1 2YGLA 3UV9A 1SLBA 3WX5A 1LGNA 2EIGA 4N9HA 3ZXKA 4AXOA 4E2GA 3ZPYA 2DUPA 1WW7A 1QWRA 5KHHA 1DQ4A 2YPJA 3PTYA 4M3CA 1EAH3 2ZZJA 1NE6A 2R49A 1AR63 1SBDA 3V56A 2HWB3 1W6QB 4FPOB 1HRV1 1QOSA 3I54A 1RUC2 4S2DA 1VBD1 2DTWA 1QJZA 1FXZA 1COV1 4HPKB 4LA3A 1LHUA 4OI1A 3N36A 1GZCA 2EVXA 4HMZA 4A7ZA 4ATEA 1DGLA 1TE1B 4LA2A 3PLQA 3JD73 3GF6A 5BUVA 3V64A 3IPVB 5JIAA 3NAPA 3FHIB 2VVFA 5F1RA 4FAHA 1XE7A 3TRSB 2I74A 1DGWX 3ZXEA 3AP4A 1BMV1 4Q4Y3 4LE4A 2XL7A 1BCXA 1Z7S1 4FXKB 4I30A 2R0FA 2DTYA 3WDWA 1YI7A 2WS93 2WJSA 5FLJA 3MDPA 1ULGA 4I0WB 2IFWA 4YVWA 2CTVA 5KXBA 4KWKA 4U2AA 1RUG1 4XW3A 4Y26A 1RUJ3 1DGRA 1VJ2A 4ASLA 1AR61 3IKWA 4GWNA 2R071 2RS33 2XBO1 4BA6A 3MW3A 1UU5A 3VHNA 3WUDA 4AQTA 2XBO2 2X53S 2DURA 5C8CB 3R0RA 3ZO0B 1GNHA 1LCLA 1IKQA 1FMD3 3AB0A 1XE8A 2D98A 5K0UB 4P9WA 1CQ9A 4K1ZA 2WA3A 5FMOL 3ZXAC 2TEPA 5ABJB 4W6XA 3FLPA 1AR73 1AXKA 2IWGB 1WBLA 2JJ6A 2IFRA 3AYDA 1JYCA 3N7MA 4JGZA 5JLVA 2A75A 3CNAA 3FLTA 4BMEA 3AP5A 4AVSA 4WVVA 4K8FA 3I59A 1YHFA 2DWRA 2OUJA 4B29A 4LTAA 4PLMA 3ZX7A 4L92A 1HQNA 4CEWA 1UU4A 2C9AA 4K6BA 4FOYA 5BNOB 4Q0VA 1UZZA 4WVMA 5JPNB 4XYXA 3AZZA 1YJKA 2G9FA 4WVMB 1KJRA 2VVDA 4UW6A 3OGGA 1LOEA 3AX4A 3E5QA 2XL9A 2GSYA 4KGQA 1HRV2 4H55A 2Q1MA 4N43A 1YYNA 4OULA 5EYYA 1NCQC 1CN1A 2X5IB 1DG6A 3WG1A 2XH6A 4K7JA 2ZHNA 1ALYA 3ZFEC 2VMHA 2NQYA 1PO23 1VBC2 1L3JA 1LB2A 3AXEA 1ULFA 1A6CA 3MLKA 3ACLA 4GA9A 1RUH2 3D0SA 3S30A 5BNPC 1LTEA 2PFWA 4P9YA 1PGL2 4EWEA 1BBT3 1VBA3 4OLLA 1BYHA 1N1YA 4OHXA 2Z42A 2DVBA 2E7QA 1UCXA 5D8AA 5J3UA 1HLCA 4ZU5A 4I01A 1VLNA 2P17A 5JWPA 4DS0A 4FAGA 2XGXA 2GC2A 4KBBA 4WM7C 2B7YA 3KB5A 2ILMA 1FOD2 2VNGA 3BODA 3HD8B 3OD0A 3VBUC 1OQ1A 3ASIA 1CD3G 4QXKA 2GAUA 3NAPC 4AHWA 2RMU3 1LOGA 5L7OB 2WINB 3ZYPA 1EV11 2ZGPA 4YG6A 3ES4A 1JHNA 4YGEA 1XYNA 2VGDA 3ETQA 1VIWB 3D8CA 5D8AB 3IPVA 4YFWA 1RUG3 1W6NB 4RA0A 4D7SA 3WG2A 4AFBA 1QJU3 4YVWC 3H1MA 3WQ7A 2R072 2CAVA 4MXWA 4D7YA 4XHBA 4RL7A 5F6LB 4B8EA 1V70A 1LR5A 2P34A 4HLTA 4HVOA 3AP7A 2K2SA 2ZKNA 4AGGA 2BNNA 1AX1A 5IK4A 2A3XA 2D6OX 2WFF2 1J1LA 4FP3A 4OUSA 3RYPA 4FPGA 3T2TA 1RUI1 1V6MA 2GH2A 1COV3 4E9KA 5FOBB 1BK1A 1DGWA 3LSEA 4JTOA 4MV2A 4Z1VA 4Q4V1 4COUA 3ILFA 5KBFA 2ZACA 1QMJA 1W6PB 1WUVA 1PVC2 4O9EA 2WZR2 1HV1A 4JRLA 1GNZA 1YFUA 2O0OA 1RUE3 1I5ZA 1VBE1 1LHVA 3NV4A 2HWB2 1M4WA 5CFCB 1CVNA 1S1AA 4Q1PA 5E8AA 1D0GA 1NXD1 2JEMA 3ZSMA 1IPKA 1JBCA 1Z7S2 2RJLA 2XPJA 4YM3A 1EV12 4J6GA 5KHIA 1GZ9A 5JCTA 5KC5A 1O3RA 1APNA 1R081 4N43C 4CDXC 5A32B 3ZN6B 5FRAA 5IK7A 5F9TA 3BTAA 4PF5A 3UK9A 5LEJA 4AI0A 2NYYA 2GC1A 5CG9A 1HDKA 5C8WA 4Z82A 3TOJA 1OQDA 2WNUA 3OJBA 1POV3 4QD2A 5H9SA 1QJX2 1MEC1 4Q27A 5HCBA 3WG3A 2EXIA 5H9RA 5KHJA 3BU7A 4FTSA 4WM8A 5AC92 3KSCA 3B5LB 5JR7B 5FQ0A 4TSVA 1S0IA 3DPRC 4FVVA 3GZAA 4FQ4A 1CR7A 5I8SA 3IMNA 3PNAA 4FCAA 3DPRA 3P3PA 4YM2A 2DFCA 1WBFA 1G8WA 2ARXA 2WIIB 1JUHA 3VBRB 1IOAA 4XTPA 3I7DA 1CX4A 3VZLA 3ZDSA 3R6SA 1Y9QA 3MLJA 4QPGC 3MIDA 1PVXA 1MZFA 1D4M3 2QVSB 1FT9A 1QJX1 4RGAA 2HWE1 5BNOC 1YWKA 4HK8A 1XQNA 3WP6A 3MI8A 4DB5A 4NVPA 4IV1A 2PHRA 2ZX1A 4MX3A 5L7OA 3N35A 3VBSA 2DYCA 3J26N 1J3PA 4N7IA 2CGPA 5L7OC 2E7TA 1BEV3 2VW1A 2D5FA 4YNIA 3RG0A 4TYSA 3VKOA 3JQWA 3RS6A 3MIHA 2A70A 2C5DA 3MEPA 4XIKA 3PJQA 3JCIA 1B35B 2BW8A 1NCRA 4FSJA 3GZTB 4HSLA 2A71A 1B35A 2Z79A 1SLIA 2GNBA 1EPZA 3AKTA 3WUCA 1PO11 4S2HA 2ZOEB 3AK0A 2JENA 3HQXA 1RL3A 4RR3B 4URTA 5I0TA 4HVRA 1X82A 5KWRA 4FTBA 2R042 1D2SA 1S2KA 2JG9A 4L8QA 2D6PA 2B39A 2XJTA 3ATGA 2WS92 2AH2A 1MACA 2RR12 4YW5A 1YFWA 1NQJA 2RS53 4ZXKA 2D6MA 1H8VA 2LM3A 2UYBA 5K0UC 4IV3A 3D82A 3AFKA 3MW4A 1AR93 4XJWA 1UU6A 2XG3A 2WA4A 5BNQA 2XJUA 1KDKA 3PJYA 1PK6A 3VL9A 3RJRA 2YGMA 4MH0E 3WP3A 3UKVA 4IEVA 4EWDA 1R091 3TN93 1Z78A 1WCSA 2QKDA 4PIXA 4MVTA 5T50A 2YC0A 3NW4A 4XETA 2LALA 3WCSA 1WW4A 4XFAA 2R062 4L2NA 1RUI3 2E51A 4COZA 5L19A 2PAEA 4E4DX 3AFGA 2FZ1A 2E6VA 4Z8BA 1FPN1 1UD1A 2D5HA 2P3IA 4HETA 4FOQA 1YO8A 1BKZA 2FHRA 4JGYB 4E2QA 3LKJA 2R1DA 4KG8A 4MYEA 5BY5A 1LOFC 4YW1A 2OZ6A 1W6MB 2D6KA 4NPRA 1BVVA 1VBE3 1ND2C 4RQPB 2HWE3 1NOVA 2IXKA 4MXWB 2XHKA 1W6PA 1ZZ7A 4I0BA 3DN7A 3VHOA 2VH9A 2PHFA 1KRIA 2XJQA 4CDQA 3PMSA 4WZCA 1AJKA 2KXLA 4JRAA 3RJ2X 4YZ3A 3R4SA 4KGGA 5D8AC 1LEMA 4EN9B 5GLTA 1QKQA 1ZRDA 4IEUA 3APBA 4LBOA 1PVC3 4K40A 2WZR3 2UU8A 3CF6E 2W0XA 3QD6A 4ZU4A 2PELA 2I07B 3VBUA 1IZ3A 5IK8A 5C9AA 1QJY3 1Y7BA 3FX3A 2NMNA 5C9AC 1ND3C 1V6LA 3KMHA 2A3WA 2W39A 1ZA4A 3K51A 2B45X 3AMNA 4QT6A 2I45A 5DUWA 4IEOA 1X50A 3JB8A 1NA1A 4OVEA 3MF6A 1LOCA 1TNRA 2K0GA 1FAYA 4QQHA 3FZ3A 3WY6A 1A3KA 4PJYA 3MYXA 1OLRA 2YDEA 1IHMA 2P2KA 4QPIC 4RS5C 3W58A 4AFMA 2BYVE 3MF9A 3BCWA 3MPBA 3J8F3 3DV8A 3ZIXA 3FUQA 4BLJA 3TAYA 3H0OA 1LGBA 3KCCA 1SLCA 2WQZC 3OBTA 1G86A 1UL9A 1QJY1 4HN0A 4INDA 1AR92 4IV3C 4AI8A 1QHDA 4I3GA 3ZSKA 1SQ4A 2AR6A 2ZZQA 4R9BA 2YXSA 1C5HA 4Q4V2 4Z07A 4LBQB 3FWEA 4C1XA 2A5ZA 4BIFA 1G9AA 2RM22 4BMBA 5EFUA 5J09A 3RI8A 1AL21 4FPCA 3Q9OA 4AHZA 1V9U2 4LUKA 2QDNA 3D4KA 3CJIC 2XLGA 1GFF2 4QM8A 2QNKA 4KQ7A 1CAVB 2MEV3 4M0HA 4M00A 4AEDC 5SV8A 1MS5A 1DBNA 1O91A 1TMF2 1LKNA 1RGSA 4AYUA 2VOKA 1UZYA 4K3UA 4KWJA 1AR83 4XQDA 1Y43B 4AQSA 4PLNA 1C8M3 3HT2A 4RHV3 2MEV1 4AEDB 5GLWA 4HKOA 4FPLA 5GZGA 2EF6A 2WZPP 4XIOA 2ATFA 1FI2A 2ZHKA 4A2UA 1QU0A 1DHKB 4YG0A 4QQPA 2H0BA 1Z7S3 1DQ6A 1O4ZA 2F6BA 4BQ1A 1QH7A 1G7YA 3VBFC 2UWCA 4HBNA 4S2FA 3WHTA 2SLIA 4WM7A 5JI9A 3LOBA 2XUMA 4COVA 1ULCA 2HWF3 3WDVA 1AYM1 1IGOA 2IZWA 4P9IA 2UURA 1H8TA 2JECA 3OY8A 4QU2A 2RR13 3TWIA 3VBFB 1AVBA 5ACA1 1S0DA 1X7NA 4QQ2A 1A78A 1J1TA 2VULA 2SBAA 2D40A 1J58A 4YRDA 1YFYA 3VBUB 3AJYA 3B01A 4YARA 4J1WA 5I0RA 5I8TA 4Y1YA 1TME3 1XXNA 1NA1C 4UBHA 4LHLA 3O0VA 1AXYA 4UXAA 4ISRA 1NCRC 2LUWA 5JZGB 3VUOA 3L2YA 1BBT2 1VBA2 2A6YA 4HZFA 5DUVA 5DUUA 5DZEA 5FLIA 1EP0A 3HBZA 1SDWA 3OBRA 4PCRA 3FE5A 1B35C 1UX6A 4TZDA 3QH7A 3X29B 4U36A 2QUOA 2OVUA 2WT0A 4QX5A 2OUHA 1VB4A 4Y5Z0 4Q1RA 2BQPA 1SLTA 4XXAA 4MGIE 1D2QA 2D3PA 5T3NA 3VN4A 4JDMA 4LO7A 1DQ2A 1H4GA 5DZGA 1U5YA 4D94A 1IS3A 3GALA 3OYWA 1ZYBA 4YSFA 2ETEA 2XKOA 3O0XA 5BNNA 4XJ8A 3AKSA 3ZVXA 5J48A 2BGCA 2VUJA 2EXKA 1ZREA 1UIJA 1N47A 1DQ1A 1PIV2 1MQTC 4XILA 4BYYA 4DZGA 3RYRA 2VOWA 1KFXL 1QY4A 1JH5A 5KC6A 3V0AA 2ET7A 3VBRA 4XJUA 3B3QE 2OA2A 3I2DA 2AZ5A 4Z2WA 3VHPA 5JI7A 2GN3A 2RE9A 2WFF3 1E57A 4LR4A 4BWOA 4MGYE 1H2LA 3WD5A 1PO13 2AGSA 1CPNA 4IEYA 3RDIA 2HWD3 2PAKA 1WW5A 1COV2 1CESA 5C9AB 1AYN3 2OIIA 1ASJ2 3MFAA 4AGRA 1Y3TA 4AFAA 1FPN2 4XQWA 1PGW1 5GM0A 4LO8A 1RMU2 4NR1A 1LOFA 5GLZA 2WNVC 4GMP3 3B93A 1MS8A 4Q8LA 1ZZBA 4GB33 1RVF2 1WCDJ 1RUC1 1D4VB 4CDUB 1KDMA 1LEDA 4GH4A 3RPQA 4AHXA 3KQRA 3MFCA 4AWDA 4B7KA 3NWKA 3O5SA 2DUQA 2PN5A 3M2MA 4Q4V3 4P14A 4R9CA 4EV0A 1WGPA 1OA4A 1VAKA 4LO5B 3THTA 3S7IA 4AVBA 3M8LA 2A7AA 2XVKA 3H9AA 3R4UA 1C3HA 3LZZA 4WBBA 4JVAA 2EAKA 3E6CC 2ERFA 2ZCWA 2VW2A 1GSLA 5FBZA 4QGLA 5BYNA 1MEC3 1DQ5A 4GMP1 1DYPA 1WA4A 5DDJ1 1HQWA 1V6OA 4JC1A 3BB6A 4DPNA 1QGLA 2B46X 4AG4A 1MS0A 3HIFA 2ZGRA 4S2GA 3M3EA 1C8M2 1ZBA1 4Q0PA 4RHV2 1PMIA 4C0HA 5A3MA 1Z0HA 1D4M2 4KU8A 2XLFA 3VBHB 5CBLA 4B4PA 3I8TA 4IETA 4I3PA 1YXWA 5CNAA 1AL22 2ARBA 3ZYJB 5KXEA 5K9YA 3B02A 3PMEA 3KS7A 1C1LA 3VL8A 3CJIB 1SMVA 2ZGKA 4XMAA 4CDWC 2EAAA 4N9IA 2IC1A 4XEZA 2OZJA 3DGTA 1AR91 3TNQA 4C90A 2PTMA 1JUIA 1ZZCA 4IEQA 3E5UA 4XMIA 3RSJA 4BZ4A 3MICA 5GALA 1DU3D 4YZ2A