1FB0A

Crystal structure of thioredoxin m from spinach chloroplast (reduced form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN M
publication title Crystal structures of two functionally different thioredoxins in spinach chloroplasts.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Electron transport
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fb0A00
5COHA 10GSA 3VFIA 2B1KA 2VAFA 1ZYQB 3SBCA 2OE0A 2BMXA 4Q5NA 3QD9A 2QSIA 1JZWA 4V1Ag 2WZ9A 2HSHA 4KSMA 5KN1A 3GN3A 5HR0A 5GZZB 1QUWA 3QOUA 1A0FA 1EZKA 3RPPA 2DLXA 1YJ6A 2EC4A 1XW6A 5AN1A 2LJRA 5A4VA 2HZFA 3D4TA 1TXXA 2B3SA 4KCEA 1PX7A 1MD4A 4EF0A 4H86A 1H4OA 2OACA 3OR5A 1EP7A 2AJQB 1EGOA 3GSSA 18GSA 2MYGA 2DIYA 2O89A 5INYA 3FKFA 3TJBA 4E8HA 2LQQA 1A2MA 1AC1A 1GRXA 3TJKA 2BJXA 1A23A 1A2JA 3H1NA 4AJ7A 6GSVA 4GWRA 1EV4A 2EIQA 1ILOA 3Q74A 3EYTA 1K3YA 3NOFA 1ON4A 1GUMA 1UN2A 1ZL9A 3HA9A 3D5JA 5IMZA 3HY2A 3G7YA 3IK9A 3E3EA 1F2EA 3CYNA 4XS1A 1XOBA 3NIVA 4ML1A 1PMTA 4KDUA 1X5EA 3PINA 1OC3A 2HI7A 2KP1A 4DSSB 2YP6A 3FYGA 4ZL7A 3EU3A 3DWVA 2OA7A 3KH7A 3FZ5A 2DJ2A 1EP8A 1F3AA 1YKAA 2VL2A 4GSTA 1SK0A 4BA7A 1V98A 4OFMA 4PGTA 2IWTA 2K6VA 6GSWA 4Q5RA 4D73B 1XWBA 1ZGNA 3VWUA 4NPBA 5HFGA 2H30A 1TTZA 3TCOA 2RUFA 3W8JA 5J9BA 3GURA 3GRXA 2FHEA 3GMFA 3CRTA 2VD1A 3HXSA 5KN2A 3F8UA 4ZBAA 5IMVA 1M2AA 5D8IA 3DIEA 2B5XA 3LSZA 2H01A 1SYRA 3UBKA 2JADA 3GH9A 1QMVA 1JFUA 3ME8A 2VM1A 4FYBA 2HLSA 3G7IA 5F0GA 4PNFA 3TUEA 4L5OA 5AGYA 1JZRA 3KZQA 5DVBA 3L9SA 3KGKA 4KE3A 3D22A 4YQVA 1XZOA 4TW5A 4N11A 1UC7A 2HE3A 4TR3A 4I2UA 2LEGA 1BX9A 3F9UA 5ECMB 1F3BA 1PKWA 1UA5A 1U3AA 3WT1A 1Y6EA 1GNWA 4E8EA 4MJBA 1XIYA 5IMDA 1TK8B 1WOUA 5IO2A 3ERGA 2RM6A 2J23A 2CA8A 19GSA 2IMFA 4N10A 3KCMA 4MA9A 4K7IA 3TOTA 4KDXA 3ZMLA 5D9VA 4TXVA 1R7HA 2CZ2A 1GSFA 3E9JB 3D4MA 1GSEA 4N0ZA 1TK5B 4EKZA 1Z6MA 4HS1A 4Z7XA 5DJMA 1R5PA 1N8JA 3D21A 3MSZA 1ZZYA 1BQ7A 4KUNA 3O3TA 3Q18A 3VI7A 1LBKA 1YDKA 4ID0A 2DIZA 4JBBA 4L8EA 3MDKA 1RK4A 1MDKA 5IMAA 1JZOA 4L5LA 2WFCA 1GTIA 4XS6A 3IDVA 3EMXA 5JWRB 4IN0A 3HHVA 4HQZA 1O6JA 4PX1A 5J3RA 2F51A 3VWWA 2TIRA 1B9XC 2YV9A 2H6YA 3KD0A 3J7Yk 2X64A 1Z5YE 1VRSD 4ECBA 1XVWA 1GP1A 1YEXA 2AB6A 2GZZA 3CXGA 3SWLA 1TKDB 2YOIA 2YCDA 3HKRA 3ZZXA 1SKWB 4TR1A 2FUG2 5DJLA 5F07A 3HJMA 3TKRA 4ISDA 4DVCA 1T4YA 2GQKA 3O6TA 2CZ3A 5FWGA 5F06A 4IKHA 1OC9A 2L6CA 1SJIA 3RHCA 3EMPA 1V40A 5GSSA 3W8SA 1OAZA 2PMTA 4WR5A 1OE8A 1O8WA 1R26A 4NAXA 1XVQA 5HFIA 5JCGA 5CAXA 4MDCA 2CX3A 2H0GA 5GSTA 5G1KA 3I9V2 3LORA 4GCIA 2BTOT 1AUCA 3MNGA 4GQCA 4MF6A 2GS3A 4IQAA 5CP1A 1X0RA 4TXOA 2MZCA 1QQ2A 4TN8A 2MMNA 2X8HA 2PBJA 2OE3A 2LRCA 4XS4A 3QR6A 3QAGA 1K3OA 3LG6A 2OBKA 2MMOA 1SYXA 2IFQA 2VLUA 5ECHB 2ZCTA 4BPYA 3RPNA 2L59A 4RI6A 3JCML 5IMFA 4EL1A 2JACA 4F2IA 3HD5A 1DE2A 5EL8A 1TI1A 4YQMA 4OWYA 1A2LA 3LFLA 4KW6A 4YH2A 2VM2A 12GSA 4QQ7A 4IW9A 4EDZA 4EDYA 1TI3A 5D93A 3VK9A 3PH9A 3FR3A 5ECIB 2WB9A 3LGCA 1NHOA 1GSUA 4KGIA 4FIWA 1B9YC 1PA3A 1YF1A 1T7PB 3CSJA 2YZHA 4JZQA 2DMLA 3UMAA 5G5FA 4LL4B 3GFKA 4MABA 1TU8A 3GKMA 5D9WA 2R4VA 5CREA 1K3LA 1DSBA 3VWXA 1T1VA 2H6XA 2HZEA 1AXDA 3UVHA 1V57A 3CTFA 1BYEA 4I6XA 2PVQA 2VL3A 4KB3A 2VCXA 3M9KA 3H8QA 2K18A 5ID2A 4HU7A 1T8EB 2L5LA 3ZFBA 6GSTA 3J7Yb 1QK8A 2IMEA 3HCZA 3GNJA 2DJKA 2R3XA 3TJGA 4YAPA 1K0BA 2FWFA 1IYIA 4ECJA 1PX6A 2L4CA 2CT6A 3MWHA 2R2JA 3DVXA 4IVFA 1HQOA 1K0OA 3LWAA 2PN8A 2H1BA 2NDOA 1O85A 4V2LA 3UARA 2A2SA 4GQFA 1NSWA 4ZB9A 4ACSA 1X9SB 3UAPA 2IL3A 4F03A 2X8GA 1GTAA 3QPMA 4IGJA 1PD21 4MJCA 2TRCP 5H5RA 4TVEA 2H1DA 3WGXA 4NV2A 1DBYA 4J56E 3KTBA 5CNWA 5B8BA 4KAEA 4GF0A 2P5RA 4X43A 1JZDA 3I69A 4Q5QA 2DJJA 2HFDA 2VOCA 2J9HA 1VF2A 22GSA 1ZYEA 4WXTA 1WMJA 1XW5A 3H93A 1S3DA 2AUVA 4MF7A 1XFLA 3BOAA 4AJ8A 3RDWA 3HVSA 5B7CA 3GX8A 1TRUA 3ED3A 4BWSA 2V6KA 3LEFA 1K0MA 2HRFA 2DJ1A 5A5KA 3IHQA 1K0CA 1M0UA 1Q98A 1SJZA 1AIUA 4XCSA 3AY8A 4TR0A 3TJFA 2MMAA 2XPDA 1GSDA 2C3TA 3F4SA 2GZYA 3GYKA 4WR4A 5EVOA 4CHSA 4I5QA 2D2ZA 3FZ4A 4RI7A 3IE3A 3HVXA 4POLA 3FZ9A 1TJDA 1FO5A 4GXZA 3TB2A 3IPZA 1FB0A 3O76A 3DEXA 2E0QA 2QKEA 3FW2A 3QAWA 4ZIJA 8GSSA 2LKUA 3HDCA 1G6YA 1USBA 2FGXA 3WGDA 2H71A 4K0NA 1E6BA 4TR1B 3KMOA 4MPFA 2H0HA 4JRRA 4MP4A 2OBIA 5KN3A 1OC9B 1PQNA 1Q4JA 2N5BA 4MJAA 5EY6A 2LRTA 4NHZA 2H8LA 4JR6A 2FWEA 1Z7PA 4XRDA 1KTEA 1O8XA 3ZMKA 2O7KA 2ZUPA 1VGLA 2NTOA 4DEJA 2I81A 2HSYA 3VLNA 1TRSA 3QFBC 2VCVA 4J57E 4TXOB 4ZBBA 3VI5A 4YQUA 4EO3A 5ECPB 2CVBA 4X1UA 4XS4B 5AISA 2GQLA 2R37A 5J4UA 2M46A 5JWQB 1SKSB 2A2RA 2IFQB 1OVNA 5JCUA 3GA4A 2DBCA 4F0CA 3GKKA 1MTCA 1GSYA 3PGTA 4NWYA 1GLQA 3WD6A 3TRXA 1OE7A 1JHBA 3CMIA 2JZTA 4ZB6A 4JR4A 2OKAA 2E7PA 1DE1A 2HNLA 3L9UA 2M72A 2JL4A 4WF4A 2C1YA 2PERA 5A4WA 2PWJA 2WCIA 1WJKA 2C8UA 3TJJA 3IAS2 2H76A 3F3QA 1T00A 2QGVA 2IJYA 4V1Ap 1SKRB 3QDNA 2PVOC 3NZNA 4TRXA 5J41A 1OKDA 2R6KA 2ON5A 4O5RA 1NM3A 4FYCA 4IJ3A 2VL2C 3Q6OA 1I9DA 2H74A 2NBSA 4HJMA 3D0ZA 3KIJA 3L0HA 2F3MA 4XTSA 4MZCA 1TK0B 5E59A 4MH2A 2VD0A 1F9MA 2B6MA 11GSA 2PGTA 2IMKA 1XCCA 3TKSC 1PL2A 4K1FA 3VPQA 3IR4A 3ZVJD 1MDJA 2H6ZA 5F8BA 2HZEB 1ML6A 1NW2A 2IMDA 3D6IA 2LSTA 2H72A 2L6DA 2LJAA 3WGEA 3Q19A 3TOUA 1M2BA 1Z6NA 1YEPA 3R2QA 1N2AA 4LMWA 2MBTA 5ID2B 3US3A 5HR1A 1RQMA 2GT6A 17GSA 1W89A 1SL0B 1CQGA 3I43A 3IXRA 2ES7A 4K8MA 3FR9A 2WRTA 4MCUA 3M0FA 2NPBA 3E0UA 4EE0A 2A4VA 3ZLPA 1C72A 1SD9A 5D9XA 4PNGA 2KLXA 4L0UA 2O85A 2F9SA 1YKCA 3C8EA 1J0FA 2LNSA 4ZL9A 2C4JA 1G6WA 3ZREA 2AAWA 2H75A 2LTKA 1M2DA 3UIWA 2LQOA 3GL3A 2GSSA 4POBA 2N5AA 2XBIA 2WS2A 2C3QA 1GNEA 3MAKA 4IELA 5ECLB 2JZRA 1QFNA 4WBRD 1TU7A 1O73A 2DSAA 3C71A 2B1LA 1GULA 3IAM2 3DRNA 3VPTA 4O92A 1HD2A 2K8SA 5DQYA 3L9VA 20GSA 2P0GA 1XWGA 3GIXA 5D9TA 4F0BA 1AQWA 2G0FA 4HZ4A 5FT3A 2LJKA 1K0NA 3C1SA 5GAPD 4MH3A 5IOXA 4V2NA 2WGRA 3QFAC 3DMLA 1FB6A 2HRNA 3KM6A 4HOJA 3APQA 4ZXGA 3DVWA 1XWKA 1GSSA 4FH8A 1ERTA 1KEBA 2H19A 2FD3A 3M3MA 1LJRA 4EC0A 1LU4A 1PGTA 3P2AA 2JSZA 5IPGA 1O7UA 1FW1A 4GLTA 1WIKA 4KX4A 1Y25A 1S3CA 3ZTLA 4PURA 2MBSA 4V2MA 3APOA 1VF4A 1XPVA 5A4UA 4PUAA 2V1MA 5ECQB 5ECOB 3UJ1A 4ML6A 2H0IA 3CSHA 5CRHA 1K0DA 2AHEA 2IN3A 4AGSA 1ACVA 5DAKA 4BVYA 1JLWA 4ZBDA 3G9BA 3F6DA 3F0IA 2FLSA 2YJ7A 1PKZA 3S9FA 4AJ6A 3HJPA 4WETA 3EVIA 4IP1A 2FY6A 4L0WA 3KMNA 2FA8A 4RQXA 2H1GA 2VCZA 1B4PA 5DBQA 4FYUA 5AIVA 1FHEA 3CBUA 3K8NA 4XRAA 5ENUA 1VF1A 5LCZA 3F4TA 3A2WA 4N0VA 5DALA 1G7OA 2B5EA 2GZPA 3WT2A 1YY7A 3KP9A 1ABAA 2GSQA 2MMZA 2WDUA 1OYJA 3GV1A 5L71A 5GAND 3ZITA 4PXOA 1R4WA 3BCIA 4K9ZA 4ZB8A 2L4QA 2O8VB 3GL5A 1M99A 2ZNMA 2Z9SA 2YWIA 1A8YA 1GUHA 3M8NA 1A0RP 3IBHA 4HJ2A 4OCFA 2WJUA 2V2GA 5LNKe 4WF5A 1BAYA 1W4VA 1SK2A 1NHYA 3P90A 2DJ0A 5IO0A 1GL8A 4GSNA 2AV4A 5AIXA 2HT9A 5FHIA 14GSA 2RUEA 3TKQA 3QCPA 2VIMA 5HQPA 4MPGA 2XC2A 3DXBA 2VLTA 2FNOA 3IRAA 3TKPA 2VUPA 3ME7A 2CQ9A 1PRXA 5ABRA 1BEDA 2LRNA 4K6XA 6GSYA 1FVKA 4HDEA 2E2GA 2NVLA 2OJLA 4BWQA 1TRVA 4NXIA 4O32A 1B8XA 3CRUA 1THOA 2C0DA 3M1GA 1XW9A 2XHFA 1MD3A 4G19A 4ULXA 1GTBA 3HYPA 5ELGA 1AQVA 1WPIA 4XIHA 5B6MA 6GSSA 2VLVA 1J9BA 2HYXA 4OO5A 3GH6A 2JU5A 3FRCA 2PUKC 2YV7A 3ZFLA 2O87A 1PN9A 3C73A 2C0FA 4KDYA 3BCKA 1ZOFA 3EINA 1GH2A 3GX0A 1HNAA 2OADA 2GSTA 1V2AA 4YAVA 1X5DA 2H1AA 5D73A 4GRFA 3N5OA 1F37A 1MEKA 1F6MC 1J08A 1JLVA 4JU5A 4MK3A 3LYPA 2EIOA 2XPEA 5CYYA 5IPHA 2CV4A 1PSQA 2JSYA 2PPTA 3VWVA 1M9BA 1SD8A 4I8BA 5IOWA 1ZCPA 1EWXA 4MZWA 1A8LA 2YWOA 2P31A 2YNXA 1TDIA 2C0EA 3EC3A 4KH7A 1PL1A 2KUCA 1U6TA 1XOAA 2IMIA 3LJRA 4WEYA 1Z3EA 2H66A 4GTUA 1TRWA 4G10A 5IQYA 2RLIA 3F4RA 2F8FA 4I97A 13GSA 3FZAA 5HR2A 2K9FA 4I2TA 3C7MA 2IPAA 1WRYA 2CAQA 2GT5A 5G30A 4OO4A 6GSXA 2YANA 4TKYA 2I3YA 1EEJA 1YQ1A 3A5WA 2HXKA 1XWAA 2YN1A 3UVTA 1B4QA 4ZILA 3GTUA 2X8CA 3GKXA 5F05A 4HI7A 4HU9A 1FG4A 16GSA 2YWMA 4G9HA 3APSA 3GUSA 4MMMA 3BJ5A 5CO3A 2TRXA 2AYTA 4X0XA 1THXA 3U6VA 5B8AA 2X99A 2IIYA 1M7TA 1X5CA 1GTUA 3TKSA 4Q5FA 2LS5A 3EWLA 1IYHA 5G2ZA 1Z9HA 3DD3A 2V41A 1S3AA 2I1UA 5H5QA 1ZMAA 1CQHA 2CX4A 3FY7A 4MLYA 1HNCA 3ZRDA 3ZVJA 2DC5A 4GSSA 2REMA 3P8WA 4AF2A 4IQ1A 2P5QA 4HQSA 4WKWA 5G5EA 3UL3A 4QL9A 4N30A 3LXZA 1EEMA 3PR8A 1OC8A 1YF0A 4BL7A 2YWNA 2DJ3A 2E2MA 4HUAA 3KH9A 4DSQA 3C1RA 3TRQA 4G2EA 4IJIA 1SU9A 1EV9A 4BVXA 2CAIA 1BJXA 2GSRA 5CRDA 3HVVA 4XHMA 3BBYA 5IM9A 5DAKB 4OMVA 3IC4A 1MDIA 1WE0A 3VURA 3WYWA 3KJYA 3A2VA 2B7JA 2DMMA 5G31A 1FAAA 3N9JA 5J9CA 3H4KA 5JCWA 4JEDA 3V1WA 5DDLA 3CTGA 2VL9A 1T4ZA 4DSRA 3KXOA 1DUGA 3L78A 4F82A 2RM5A 4JE1A 1XXUA 3ZL5A 5LD0A 2L5OA 5IIZA 4K7NA 5DALB 2JZSA 4IBPA 1V9WA 1GUKA 3HZ8A 5ELAA 2I9HA 4LA1A 2KOKA 1SJ6A 3M9JA 4HZ2A 2VCQA 2VO4A 3QMXA 4IP6A 2V32A 2FCHA 5ECNB 5HFKA 9GSSA 1ST9A 4PUFC 2F8AA 1EGRA 3EU4A 4O7HA 2N5FA 2M80A 5CRGA 3RHBA 4DSSA 3KP8A 3IV4A 1RW1A 1KNGA 1GLPA 2GDRA 2GQMA 2V6OA 4KNDA 1X9MB 5EPFA 3DGQA 4KA0A 2EIRA 1SK1A 3ZYWA 7GSSA 1EOHA 5IMCA 4D73A 1WP0A 2LV3A 2K8VA 1QGVA 5HR3A 4POMA 1U3IA 2C0GA 1XWCA 2LNTA 3GKNA 4KSOA 1SL1B 2YZUA 3FEUA 4OFNA 2YPMA 3GSTA 3RBTA 4NHWA 3U5RE 1GSQA 2QC7A 1QXHA 1U88A 3F6FA 5DQSA 2FA4A 2I4AA 5ECKB 4PQIA 4IS0A 3H79A 1FOVA 3F3RA 5D96A 1UVZA 1G0TA 1BG5A 1OKTA 3ZIVA 5ECSA 4OFTA 4ILFA 4HEA2 2CVDA 5E4WA 3IOSA 1A24A 1R5AA 1WWJA 3BD2A 4RUVA 4EXJA 1ERUA 4ECCA 1G7EA 5ECRB 5JWOB 1ERVA 2OE1A 4LLRA 2GTUA 1SENA 1I5GA 4OD7A 2B7KA 2LUSA 4RQRA 6GSUA 3UEMA 3UBLA 1B48A 4ZL8A 2B5YA 1Z7RA 5CRWA 1EOGA 4LMVA 1FVJA 4J2FA 2GGTA 4TOPA 5H5SA 3EURA 4NMUA 4PQHA 1HNBA 2H73A 1H75A 2R5GA 1AW9A 3KTLA 3EE2A 5KEJA 3FK8A 4ECIA 4POKA 4MZBA 1URMA 1U87A 1AAZA 3RAZA 4EVMA 1TW9A 2KHPA 5C00A 2WULA 2FWGA 3HJOA 3DYRA 2G2QA 2C80A 2CVKA 1E2YA 3G7JA 4K2DA 3LXTA 1SL2B 5DCGA 1TP9A 4OCEA 3LQ7A 4FO5A 1GWCA 2H70A 2ON7A 3L4NA 4CW9A 3QAVA 4LL1B 4TR4A 4IHUA 1V58A 3TRPA 3IK7A 4PQ1A 2XBQA 4MJEA 3GTUB 4P3YB 1XBSA 3ZIJA 3F63A 4K0GA 1T3BA 4K7OA 5G1LA 3LYKA 1X9WB 2L57A 1VF3A 1HYUA 3UOMA 3A3TA 1O81A 5J5NA 2RIIA 2ALBA 1M9AA 1AQXA 3IA1A 3DKSA 3FR6A 1TOFA 3I6AA 4KCAA 4NV5A 4MF5A 5DCHA 4WBJA 3TDGA 3KEBA 2VCTA 3FHKA 2C3NA 4CDOA 2YJHA 2GVPA 2VCWA 2FWHA 3CSIA 5B6NA 3P7XA 5KN0A 3A2XA 3GHAA 2KP2A 3ERWA 3TGZA 1K0AA 3ISOA 3TKSE 2GLRA 3W6GA 5C04A 4QL7A 4EUYA 1ERWA 4F9ZA 1YZXA 1KBNA 3ERFA 2PU9C 3HZ4A
chains in the Genus database with same CATH superfamily
5COHA 4BL7B 10GSA 3VFIA 2B1KA 2VAFA 1ZYQB 1ZYNA 3SBCA 2OE0A 2BMXA 4Q5NA 3QD9A 2QSIA 1JZWA 4V1Ag 2WZ9A 2HSHA 4KSMA 5KN1A 3GN3A 5HR0A 5GZZB 4BVXB 1QUWA 3QOUA 1A0FA 1EZKA 3RPPA 2DLXA 1YJ6A 2EC4A 1XW6A 5AN1A 2LJRA 5A4VA 2HZFA 3D4TA 1TXXA 2B3SA 4KCEA 1PX7A 1MD4A 4EF0A 4H86A 1H4OA 2OACA 3OR5A 1EP7A 2AJQB 1EGOA 3GSSA 18GSA 2MYGA 2DIYA 2O89A 5INYA 3FKFA 3TJBA 4E8HA 2LQQA 1A2MA 1AC1A 1GRXA 3TJKA 2BJXA 1A23A 1A2JA 3H1NA 4AJ7A 6GSVA 4GWRA 1EV4A 2EIQA 1ILOA 3Q74A 3EYTA 1K3YA 3NOFA 1ON4A 1GUMA 1UN2A 1ZL9A 3HA9A 3D5JA 5IMZA 3HY2A 3G7YA 3IK9A 3E3EA 1F2EA 3CYNA 4XS1A 1XOBA 3NIVA 4ML1A 1PMTA 4KDUA 1X5EA 3PINA 1OC3A 2HI7A 2KP1A 4DSSB 2YP6A 3FYGA 4ZL7A 3EU3A 3DWVA 2OA7A 3KH7A 3FZ5A 2DJ2A 1EP8A 1F3AA 1YKAA 2VL2A 4GSTA 1SK0A 4BA7A 1V98A 4OFMA 4PGTA 2IWTA 2K6VA 6GSWA 4Q5RA 4D73B 1XWBA 1ZGNA 3VWUA 4NPBA 5HFGA 2H30A 1TTZA 3TCOA 2RUFA 3W8JA 5J9BA 3GURA 3GRXA 2FHEA 3GMFA 3CRTA 2VD1A 3HXSA 5KN2A 3F8UA 4ZBAA 5IMVA 4YKGA 1M2AA 5D8IA 3DIEA 1FOHA 2B5XA 3LSZA 2H01A 1SYRA 3UBKA 3LW9A 2JADA 3GH9A 1QMVA 1JFUA 3ME8A 2VM1A 4FYBA 2HLSA 3G7IA 5F0GA 4PNFA 3TUEA 4L5OA 5AGYA 1JZRA 3KZQA 5DVBA 3L9SA 3KGKA 4KE3A 3D22A 4YQVA 1XZOA 4TW5A 4N11A 3EPTA 1UC7A 2HE3A 4TR3A 4I2UA 2LEGA 1BX9A 3F9UA 5ECMB 1F3BA 1PKWA 1UA5A 1U3AA 3WT1A 1Y6EA 1GNWA 4E8EA 4MJBA 1XIYA 5IMDA 1TK8B 1WOUA 5IO2A 3ERGA 2RM6A 2J23A 2CA8A 19GSA 2IMFA 4N10A 3KCMA 4MA9A 4K7IA 3TOTA 4KDXA 3ZMLA 5D9VA 4TXVA 1R7HA 2CZ2A 1GSFA 3E9JB 3D4MA 1GSEA 4N0ZA 1TK5B 4EKZA 1Z6MA 4HS1A 4Z7XA 5DJMA 1R5PA 1N8JA 3D21A 3MSZA 1ZZYA 1BQ7A 4KUNA 3O3TA 3Q18A 3VI7A 1LBKA 1YDKA 4ID0A 4PTSA 2DIZA 4JBBA 4L8EA 3MDKA 1RK4A 1MDKA 5IMAA 1JZOA 4L5LA 2WFCA 1GTIA 4XS6A 3IDVA 3EMXA 5JWRB 4IN0A 3HHVA 4HQZA 1O6JA 4PX1A 5J3RA 2F51A 3VWWA 2TIRA 1B9XC 2YV9A 2H6YA 3KD0A 3J7Yk 2X64A 1Z5YE 1VRSD 4ECBA 1XVWA 1GP1A 1YEXA 2AB6A 2GZZA 3CXGA 3SWLA 1TKDB 2YOIA 2YCDA 3HKRA 3ZZXA 1SKWB 4TR1A 2FUG2 5DJLA 5F07A 3HJMA 3TKRA 4K5SA 4ISDA 4DVCA 1T4YA 2GQKA 3O6TA 2CZ3A 5FWGA 5F06A 4IKHA 1OC9A 2L6CA 1SJIA 3RHCA 3EMPA 1V40A 5GSSA 3W8SA 1OAZA 2PMTA 4WR5A 1OE8A 1O8WA 1R26A 4NAXA 1XVQA 5HFIA 5JCGA 5CAXA 4MDCA 2CX3A 2H0GA 5GSTA 5G1KA 3I9V2 3LORA 4GCIA 2BTOT 1AUCA 3MNGA 4GQCA 4MF6A 2GS3A 4IQAA 5CP1A 1X0RA 4TXOA 2MZCA 1QQ2A 4TN8A 2MMNA 2X8HA 2PBJA 2OE3A 2LRCA 4XS4A 3QR6A 3QAGA 1K3OA 3LG6A 2OBKA 2MMOA 1SYXA 2IFQA 2VLUA 5ECHB 2ZCTA 5KOXA 4BPYA 3RPNA 2L59A 4RI6A 3JCML 5IMFA 4EL1A 2JACA 4F2IA 3HVNA 3HD5A 1DE2A 5EL8A 1TI1A 4YQMA 4OWYA 1A2LA 3LFLA 4KW6A 4YH2A 2VM2A 12GSA 4QQ7A 4IW9A 4EDZA 4EDYA 1TI3A 5D93A 3VK9A 3PH9A 3FR3A 5ECIB 2WB9A 3LGCA 1NHOA 1GSUA 4KGIA 4FIWA 1B9YC 1PA3A 1YF1A 1T7PB 3CSJA 2YZHA 4JZQA 2QA2A 2DMLA 3UMAA 5G5FA 4LL4B 3GFKA 4MABA 1TU8A 3GKMA 5D9WA 4G0LA 2R4VA 5CREA 1K3LA 1DSBA 3VWXA 1T1VA 2H6XA 2HZEA 1AXDA 3UVHA 1V57A 4EIQA 3CTFA 1BYEA 4I6XA 2PVQA 2VL3A 4KB3A 2VCXA 3M9KA 3H8QA 2K18A 5ID2A 1M3JA 4HU7A 1T8EB 2L5LA 5BMUA 3ZFBA 6GSTA 3J7Yb 1QK8A 2IMEA 3HCZA 3GNJA 2DJKA 2R3XA 3TJGA 4YAPA 1K0BA 2FWFA 1IYIA 4ECJA 1PX6A 2L4CA 2CT6A 3MWHA 2R2JA 3DVXA 4IVFA 1HQOA 1K0OA 3LWAA 2PN8A 2H1BA 2NDOA 1O85A 4V2LA 3UARA 2A2SA 4GQFA 1NSWA 4ZB9A 4ACSA 1X9SB 3UAPA 2IL3A 4F03A 2X8GA 1GTAA 3QPMA 4IGJA 1PD21 4MJCA 2TRCP 5H5RA 4TVEA 4EIPA 2H1DA 3WGXA 4NV2A 2A4HA 1DBYA 4J56E 3KTBA 5CNWA 5B8BA 4KAEA 4GF0A 2P5RA 4X43A 1JZDA 3I69A 4Q5QA 2DJJA 2HFDA 2VOCA 2J9HA 1VF2A 22GSA 1ZYEA 4WXTA 1WMJA 1XW5A 3H93A 1S3DA 2AUVA 4MF7A 1XFLA 3BOAA 4AJ8A 3RDWA 3HVSA 5B7CA 3GX8A 1TRUA 3ED3A 4BWSA 2V6KA 3LEFA 1K0MA 2HRFA 2DJ1A 5A5KA 3IHQA 1K0CA 1M0UA 1Q98A 1SJZA 1AIUA 4XCSA 3AY8A 4TR0A 3TJFA 2MMAA 2XPDA 1GSDA 4G0IA 2C3TA 3F4SA 2GZYA 3GYKA 4WR4A 5EVOA 4CHSA 4I5QA 2D2ZA 3FZ4A 4RI7A 3IE3A 3HVXA 4POLA 3FZ9A 1TJDA 4YKFA 1FO5A 4GXZA 3TB2A 3IPZA 1FB0A 3O76A 3DEXA 2E0QA 2QKEA 3FW2A 3QAWA 4ZIJA 8GSSA 2LKUA 4CY8A 3HDCA 1G6YA 1USBA 2FGXA 3WGDA 5BRTA 2H71A 4K0NA 1E6BA 4TR1B 3KMOA 2R0GA 4MPFA 2H0HA 4JRRA 4MP4A 2OBIA 5KN3A 1OC9B 1PQNA 1Q4JA 4K2XA 2N5BA 4MJAA 5EY6A 2LRTA 4NHZA 2H8LA 4JR6A 2FWEA 1Z7PA 4XRDA 1KTEA 1O8XA 3ZMKA 2O7KA 2ZUPA 1VGLA 2NTOA 4DEJA 2I81A 2HSYA 3VLNA 1TRSA 3R3EA 3QFBC 2VCVA 2QA1A 4J57E 4TXOB 4ZBBA 3VI5A 4YQUA 4EO3A 5ECPB 2CVBA 4X1UA 4XS4B 5AISA 2DKIA 2GQLA 2R37A 5J4UA 2M46A 5JWQB 1SKSB 2A2RA 2IFQB 1OVNA 5JCUA 3GA4A 2DBCA 4F0CA 3GKKA 1MTCA 1GSYA 3PGTA 4NWYA 1GLQA 3WD6A 3TRXA 1OE7A 1JHBA 3CMIA 2JZTA 4ZB6A 4JR4A 2OKAA 2E7PA 1DE1A 2HNLA 3L9UA 2M72A 2JL4A 4WF4A 2C1YA 2PERA 5A4WA 2PWJA 2WCIA 1WJKA 2C8UA 3TJJA 3IAS2 2H76A 3F3QA 1T00A 2QGVA 2IJYA 4V1Ap 1SKRB 3QDNA 2PVOC 3NZNA 4TRXA 5J41A 1OKDA 2R6KA 2ON5A 4O5RA 1NM3A 4FYCA 4IJ3A 2VL2C 3Q6OA 1I9DA 2H74A 2NBSA 4HJMA 1ZYPA 3D0ZA 3KIJA 3L0HA 2F3MA 4XTSA 4MZCA 1TK0B 5E59A 4MH2A 2VD0A 1F9MA 2B6MA 11GSA 2PGTA 2IMKA 1XCCA 3TKSC 1PL2A 4K1FA 3VPQA 3IR4A 3ZVJD 1MDJA 2H6ZA 5F8BA 2HZEB 1ML6A 1NW2A 2IMDA 3D6IA 2LSTA 2H72A 2L6DA 2LJAA 3WGEA 3Q19A 3TOUA 1M2BA 1Z6NA 1YEPA 3R2QA 1N2AA 4LMWA 2MBTA 5ID2B 3US3A 5HR1A 1RQMA 2GT6A 17GSA 1W89A 1SL0B 1CQGA 3I43A 3IXRA 2ES7A 4K8MA 3FR9A 2WRTA 4MCUA 3M0FA 2NPBA 3E0UA 4EE0A 2A4VA 3ZLPA 1C72A 1SD9A 5D9XA 3MYDA 4PNGA 2KLXA 4L0UA 2O85A 2F9SA 1YKCA 3C8EA 1J0FA 2LNSA 4ZL9A 2C4JA 1G6WA 2UZ8A 3ZREA 2AAWA 2H75A 2LTKA 1M2DA 3UIWA 2LQOA 3GL3A 2GSSA 4POBA 2N5AA 4K5RA 2XBIA 2WS2A 2C3QA 1GNEA 3MAKA 4IELA 5ECLB 2JZRA 1QFNA 4WBRD 1TU7A 1O73A 2DSAA 3C71A 4ICYA 2B1LA 1GULA 3IAM2 3DRNA 3VPTA 4USSA 3A5IA 4O92A 1HD2A 2K8SA 5DQYA 3L9VA 20GSA 2P0GA 1XWGA 3GIXA 5D9TA 4F0BA 1AQWA 2G0FA 4HZ4A 5FT3A 2LJKA 1K0NA 3C1SA 4A5PA 5GAPD 4MH3A 5IOXA 4V2NA 2WGRA 3QFAC 2R0PA 3DMLA 1FB6A 2HRNA 3KM6A 4HOJA 3APQA 4ZXGA 3DVWA 1XWKA 1GSSA 4FH8A 1ERTA 1KEBA 2H19A 2FD3A 3M3MA 1LJRA 4EC0A 1LU4A 1PGTA 3P2AA 2A2PA 2JSZA 5IPGA 1O7UA 1FW1A 4GLTA 1WIKA 4KX4A 1Y25A 1S3CA 3ZTLA 4PURA 2MBSA 4V2MA 3APOA 1VF4A 1XPVA 5A4UA 4PUAA 2V1MA 5ECQB 5ECOB 3UJ1A 4ML6A 2H0IA 3CSHA 5CRHA 5KOWA 1K0DA 2AHEA 2IN3A 4AGSA 1ACVA 5DAKA 4BVYA 1JLWA 4ZBDA 3G9BA 4O5QA 3F6DA 3F0IA 2FLSA 2YJ7A 1PKZA 3S9FA 4AJ6A 3HJPA 4WETA 3EVIA 4IP1A 2FY6A 4L0WA 3KMNA 2FA8A 4RQXA 2H1GA 2VCZA 1B4PA 5DBQA 4FYUA 5AIVA 1FHEA 3CBUA 4KF9A 3K8NA 4XRAA 5ENUA 1VF1A 5LCZA 3F4TA 3A2WA 2X4AA 4N0VA 5DALA 1G7OA 2B5EA 2GZPA 3WT2A 1YY7A 3KP9A 1ABAA 2GSQA 2MMZA 2WDUA 1OYJA 3GV1A 5L71A 5GAND 3ZITA 4PXOA 1R4WA 3BCIA 4K9ZA 4ZB8A 2L4QA 2O8VB 3GL5A 1M99A 2ZNMA 2Z9SA 2YWIA 1A8YA 1GUHA 3M8NA 1A0RP 3IBHA 4HJ2A 4OCFA 2WJUA 2V2GA 5LNKe 4WF5A 1BAYA 1W4VA 1SK2A 1NHYA 3P90A 2DJ0A 5IO0A 1GL8A 4GSNA 2AV4A 5AIXA 2HT9A 5FHIA 14GSA 2RUEA 3TKQA 3QCPA 2VIMA 5HQPA 4MPGA 2XC2A 3DXBA 2VLTA 2FNOA 3IRAA 3TKPA 2VUPA 3ME7A 2CQ9A 1PRXA 5ABRA 1BEDA 2LRNA 4K6XA 6GSYA 1FVKA 4HDEA 2E2GA 2NVLA 2OJLA 4BWQA 1TRVA 4NXIA 4O32A 1B8XA 3CRUA 1THOA 2X49A 2C0DA 3M1GA 1XW9A 2XHFA 1MD3A 4G19A 4ULXA 1GTBA 3HYPA 5ELGA 3IHGA 1AQVA 1WPIA 4XIHA 5B6MA 6GSSA 2VLVA 1J9BA 2HYXA 4OO5A 3GH6A 2JU5A 3FRCA 2PUKC 2YV7A 3ZFLA 2O87A 1PN9A 3C73A 2C0FA 4KDYA 3BCKA 1ZOFA 2HRKA 3EINA 1GH2A 3GX0A 1HNAA 2OADA 2GSTA 1V2AA 4YAVA 1X5DA 2H1AA 5D73A 4GRFA 3N5OA 1F37A 1MEKA 1F6MC 1J08A 1JLVA 4JU5A 4MK3A 3LYPA 2EIOA 2XPEA 5CYYA 5IPHA 2CV4A 1PSQA 2JSYA 2PPTA 3VWVA 1M9BA 1SD8A 4I8BA 5IOWA 1ZCPA 1EWXA 4MZWA 1A8LA 2YWOA 2P31A 2YNXA 1TDIA 2C0EA 3EC3A 4CY6A 4KH7A 1PL1A 2KUCA 1U6TA 1XOAA 2IMIA 3LJRA 4WEYA 1Z3EA 2H66A 4GTUA 1TRWA 4G10A 5IQYA 2RLIA 3F4RA 2F8FA 4I97A 1PFOA 13GSA 3FZAA 5HR2A 2K9FA 4O5UA 4I2TA 3C7MA 2IPAA 1WRYA 2CAQA 2GT5A 5G30A 4OO4A 6GSXA 2YANA 4G0KA 4TKYA 2I3YA 1EEJA 1YQ1A 3A5WA 2HXKA 1XWAA 2YN1A 3UVTA 1B4QA 4ZILA 3GTUA 2X8CA 3GKXA 3FMWA 5F05A 4HI7A 4HU9A 1FG4A 16GSA 2YWMA 4G9HA 3APSA 3GUSA 4MMMA 3BJ5A 5CO3A 2TRXA 2AYTA 4X0XA 1THXA 3U6VA 5B8AA 2X99A 2IIYA 1M7TA 1X5CA 1GTUA 3TKSA 4Q5FA 2HRAA 2LS5A 3EWLA 1IYHA 5G2ZA 1Z9HA 3DD3A 2V41A 1S3AA 2I1UA 5H5QA 1ZMAA 1CQHA 3MIXA 2CX4A 1PN0A 3FY7A 4MLYA 1HNCA 2DKHA 3ZRDA 3ZVJA 2DC5A 4GSSA 2REMA 3P8WA 4AF2A 4IQ1A 2P5QA 4HQSA 4WKWA 5G5EA 3UL3A 4QL9A 4N30A 3LXZA 1EEMA 3PR8A 1OC8A 1YF0A 4BL7A 2YWNA 2DJ3A 2E2MA 4HUAA 3PPUA 2HSMA 3KH9A 4DSQA 3C1RA 3TRQA 4Z2RA 4G2EA 4IJIA 1SU9A 1EV9A 4BVXA 2CAIA 1BJXA 2GSRA 5CRDA 3HVVA 4XHMA 3BBYA 5IM9A 5DAKB 4BVYB 4OMVA 3IC4A 1MDIA 1WE0A 3VURA 3WYWA 3KJYA 3A2VA 2B7JA 2DMMA 5G31A 4Z2TA 1FAAA 3N9JA 5J9CA 3H4KA 5JCWA 4JEDA 1M3IA 3V1WA 5DDLA 3CTGA 2VL9A 1T4ZA 4DSRA 3KXOA 1DUGA 3IC8A 3L78A 4F82A 2RM5A 4JE1A 1XXUA 3ZL5A 5LD0A 2L5OA 5IIZA 4K7NA 5DALB 2JZSA 4IBPA 1V9WA 1GUKA 3HZ8A 4BIKA 5ELAA 2I9HA 4LA1A 2KOKA 1SJ6A 3M9JA 4HZ2A 2VCQA 2VO4A 3QMXA 4IP6A 2V32A 2FCHA 5ECNB 5HFKA 9GSSA 1ST9A 4PUFC 2F8AA 1EGRA 3EU4A 4O7HA 2N5FA 2M80A 5CRGA 3RHBA 4DSSA 3KP8A 3IV4A 1S3RA 1RW1A 1KNGA 1GLPA 2GDRA 2GQMA 2V6OA 4KNDA 1X9MB 5EPFA 3DGQA 4FQUA 4KA0A 2EIRA 1SK1A 3ZYWA 7GSSA 1EOHA 5IMCA 4D73A 1WP0A 2LV3A 2K8VA 1QGVA 5HR3A 4POMA 1U3IA 2C0GA 1XWCA 2LNTA 3GKNA 4KSOA 1SL1B 2YZUA 3FEUA 4OFNA 2YPMA 3GSTA 3RBTA 4NHWA 3U5RE 1GSQA 2QC7A 1QXHA 1U88A 3F6FA 5DQSA 2FA4A 2I4AA 5ECKB 4PQIA 4IS0A 3H79A 1XG8A 1FOVA 3F3RA 5D96A 1UVZA 1G0TA 1BG5A 1OKTA 3ZIVA 5ECSA 4OFTA 4ILFA 4HEA2 2CVDA 5E4WA 3IOSA 1A24A 1R5AA 1WWJA 3BD2A 4RUVA 4EXJA 1ERUA 4ECCA 1G7EA 5ECRB 5JWOB 1ERVA 2OE1A 4LLRA 2GTUA 1SENA 1I5GA 4OD7A 2B7KA 2LUSA 4RQRA 6GSUA 3UEMA 3UBLA 1B48A 4ZL8A 2B5YA 1Z7RA 5CRWA 1EOGA 4LMVA 1FVJA 4J2FA 2GGTA 4TOPA 5H5SA 3EURA 4NMUA 4PQHA 1HNBA 2H73A 1H75A 2R5GA 1AW9A 3KTLA 3EE2A 5KEJA 3FK8A 4ECIA 4POKA 4MZBA 1URMA 1U87A 1AAZA 3RAZA 4EVMA 1TW9A 2KHPA 5C00A 2WULA 2FWGA 3HJOA 4HSCX 3DYRA 2G2QA 2C80A 2CVKA 1E2YA 3G7JA 4K2DA 3LXTA 1SL2B 5DCGA 1TP9A 4OCEA 3LQ7A 4FO5A 1GWCA 2H70A 2ON7A 3L4NA 4CW9A 3QAVA 4LL1B 4TR4A 4IHUA 1V58A 3TRPA 3IK7A 4PQ1A 4X4JA 2XBQA 4MJEA 3GTUB 4P3YB 1XBSA 3CQFA 3ZIJA 3F63A 4K0GA 1T3BA 4K7OA 5G1LA 3LYKA 2R0CA 1X9WB 2L57A 1VF3A 1HYUA 3UOMA 3A3TA 1O81A 5J5NA 2RIIA 2ALBA 1M9AA 1AQXA 3IA1A 3DKSA 3FR6A 1TOFA 3I6AA 4KCAA 4NV5A 4MNNA 4MF5A 5DCHA 4WBJA 3TDGA 3KEBA 2VCTA 3FHKA 2C3NA 4CDOA 2YJHA 2GVPA 2VCWA 2FWHA 3CSIA 5B6NA 3P7XA 5KN0A 3A2XA 3GHAA 2KP2A 3ERWA 3TGZA 1K0AA 3ISOA 3TKSE 2GLRA 3W6GA 5C04A 4Z2UA 4QL7A 4EUYA 1ERWA 4F9ZA 1YZXA 1KBNA 3ERFA 2PU9C 3HZ4A
chains in the Genus database with same CATH topology
5COHA 4BL7B 10GSA 3VFIA 2B1KA 2VAFA 1ZYQB 1ZYNA 3SBCA 2OE0A 2BMXA 4Q5NA 3QD9A 2QSIA 1JZWA 4V1Ag 2WZ9A 2HSHA 4KSMA 5KN1A 3GN3A 5HR0A 5GZZB 4BVXB 1QUWA 3QOUA 1A0FA 1EZKA 3RPPA 2DLXA 1YJ6A 2EC4A 1XW6A 5AN1A 2LJRA 5A4VA 2HZFA 3D4TA 1TXXA 2B3SA 4KCEA 1PX7A 1MD4A 4EF0A 4H86A 1H4OA 2OACA 3OR5A 1EP7A 2AJQB 1EGOA 3GSSA 18GSA 2MYGA 2DIYA 2O89A 5INYA 3FKFA 3TJBA 4E8HA 2LQQA 1A2MA 1AC1A 1GRXA 3TJKA 2BJXA 1A23A 1A2JA 3H1NA 4AJ7A 6GSVA 4GWRA 1EV4A 2EIQA 1ILOA 3Q74A 3EYTA 1K3YA 3NOFA 1ON4A 1GUMA 1UN2A 1ZL9A 3HA9A 3D5JA 5IMZA 3HY2A 3G7YA 3IK9A 3E3EA 1F2EA 3CYNA 4XS1A 1XOBA 3NIVA 4ML1A 1PMTA 4KDUA 1X5EA 3PINA 1OC3A 2HI7A 2KP1A 4DSSB 2YP6A 3FYGA 4ZL7A 3EU3A 3DWVA 2OA7A 3KH7A 3FZ5A 2DJ2A 1EP8A 1F3AA 1YKAA 2VL2A 4GSTA 1SK0A 4BA7A 1V98A 4OFMA 4PGTA 2IWTA 2K6VA 6GSWA 4Q5RA 4D73B 1XWBA 1ZGNA 3VWUA 4NPBA 5HFGA 2H30A 1TTZA 3TCOA 2RUFA 3W8JA 5J9BA 3GURA 3GRXA 2FHEA 3GMFA 3CRTA 2VD1A 3HXSA 5KN2A 3F8UA 4ZBAA 5IMVA 4YKGA 1M2AA 5D8IA 3DIEA 1FOHA 2B5XA 3LSZA 2H01A 1SYRA 3UBKA 3LW9A 2JADA 3GH9A 1QMVA 1JFUA 3ME8A 2VM1A 4FYBA 2HLSA 3G7IA 5F0GA 4PNFA 3TUEA 4L5OA 5AGYA 1JZRA 3KZQA 5DVBA 3L9SA 3KGKA 4KE3A 3D22A 4YQVA 1XZOA 4TW5A 4N11A 3EPTA 1UC7A 2HE3A 4TR3A 4I2UA 2LEGA 1BX9A 3F9UA 5ECMB 1F3BA 1PKWA 1UA5A 1U3AA 3WT1A 1Y6EA 1GNWA 4E8EA 4MJBA 1XIYA 5IMDA 1TK8B 1WOUA 5IO2A 3ERGA 2RM6A 2J23A 2CA8A 19GSA 2IMFA 4N10A 3KCMA 4MA9A 4K7IA 3TOTA 4KDXA 3ZMLA 5D9VA 4TXVA 1R7HA 2CZ2A 1GSFA 3E9JB 3D4MA 1GSEA 4N0ZA 1TK5B 4EKZA 1Z6MA 4HS1A 4Z7XA 5DJMA 1R5PA 1N8JA 3D21A 3MSZA 1ZZYA 1BQ7A 4KUNA 3O3TA 3Q18A 3VI7A 1LBKA 1YDKA 4ID0A 4PTSA 2DIZA 4JBBA 4L8EA 3MDKA 1RK4A 1MDKA 5IMAA 1JZOA 4L5LA 2WFCA 1GTIA 4XS6A 3IDVA 3EMXA 5JWRB 4IN0A 3HHVA 4HQZA 1O6JA 4PX1A 5J3RA 2F51A 3VWWA 2TIRA 1B9XC 2YV9A 2H6YA 3KD0A 3J7Yk 2X64A 1Z5YE 1VRSD 4ECBA 1XVWA 1GP1A 1YEXA 2AB6A 2GZZA 3CXGA 3SWLA 1TKDB 2YOIA 2YCDA 3HKRA 3ZZXA 1SKWB 4TR1A 2FUG2 5DJLA 5F07A 3HJMA 3TKRA 4K5SA 4ISDA 4DVCA 1T4YA 2GQKA 3O6TA 2CZ3A 5FWGA 5F06A 4IKHA 1OC9A 2L6CA 1SJIA 3RHCA 3EMPA 1V40A 5GSSA 3W8SA 1OAZA 2PMTA 4WR5A 1OE8A 1O8WA 1R26A 4NAXA 1XVQA 5HFIA 5JCGA 5CAXA 4MDCA 2CX3A 2H0GA 5GSTA 5G1KA 3I9V2 3LORA 4GCIA 2BTOT 1AUCA 3MNGA 4GQCA 4MF6A 2GS3A 4IQAA 5CP1A 1X0RA 4TXOA 2MZCA 1QQ2A 4TN8A 2MMNA 2X8HA 2PBJA 2OE3A 2LRCA 4XS4A 3QR6A 3QAGA 1K3OA 3LG6A 2OBKA 2MMOA 1SYXA 2IFQA 2VLUA 5ECHB 2ZCTA 5KOXA 4BPYA 3RPNA 2L59A 4RI6A 3JCML 5IMFA 4EL1A 2JACA 4F2IA 3HD5A 1DE2A 5EL8A 1TI1A 4YQMA 4OWYA 1A2LA 3LFLA 4KW6A 4YH2A 2VM2A 12GSA 4QQ7A 4IW9A 4EDZA 4EDYA 1TI3A 5D93A 3VK9A 3PH9A 3FR3A 5ECIB 2WB9A 3LGCA 1NHOA 1GSUA 4KGIA 4FIWA 1B9YC 1PA3A 1YF1A 1T7PB 3CSJA 2YZHA 4JZQA 2QA2A 2DMLA 3UMAA 5G5FA 4LL4B 3GFKA 4MABA 1TU8A 3GKMA 5D9WA 4G0LA 2R4VA 5CREA 1K3LA 1DSBA 3VWXA 1T1VA 2H6XA 2HZEA 1AXDA 3UVHA 1V57A 4EIQA 3CTFA 1BYEA 4I6XA 2PVQA 2VL3A 4KB3A 2VCXA 3M9KA 3H8QA 2K18A 5ID2A 4HU7A 1T8EB 2L5LA 5BMUA 3ZFBA 6GSTA 3J7Yb 1QK8A 2IMEA 3HCZA 3GNJA 2DJKA 2R3XA 3TJGA 4YAPA 1K0BA 2FWFA 1IYIA 4ECJA 1PX6A 2L4CA 2CT6A 3MWHA 2R2JA 3DVXA 4IVFA 1HQOA 1K0OA 3LWAA 2PN8A 2H1BA 2NDOA 1O85A 4V2LA 3UARA 2A2SA 4GQFA 1NSWA 4ZB9A 4ACSA 1X9SB 3UAPA 2IL3A 4F03A 2X8GA 1GTAA 3QPMA 4IGJA 1PD21 4MJCA 2TRCP 5H5RA 4TVEA 4EIPA 2H1DA 3WGXA 4NV2A 2A4HA 1DBYA 4J56E 3KTBA 5CNWA 5B8BA 4KAEA 4GF0A 2P5RA 4X43A 1JZDA 3I69A 4Q5QA 2DJJA 2HFDA 2VOCA 2J9HA 1VF2A 22GSA 1ZYEA 4WXTA 1WMJA 1XW5A 3H93A 1S3DA 2AUVA 4MF7A 1XFLA 3BOAA 4AJ8A 3RDWA 3HVSA 5B7CA 3GX8A 1TRUA 3ED3A 4BWSA 2V6KA 3LEFA 1K0MA 2HRFA 2DJ1A 5A5KA 3IHQA 1K0CA 1M0UA 1Q98A 1SJZA 1AIUA 4XCSA 3AY8A 4TR0A 3TJFA 2MMAA 2XPDA 1GSDA 4G0IA 2C3TA 3F4SA 2GZYA 3GYKA 4WR4A 5EVOA 4CHSA 4I5QA 2D2ZA 3FZ4A 4RI7A 3IE3A 3HVXA 4POLA 3FZ9A 1TJDA 4YKFA 1FO5A 4GXZA 3TB2A 3IPZA 1FB0A 3O76A 3DEXA 2E0QA 2QKEA 3FW2A 3QAWA 4ZIJA 8GSSA 2LKUA 4CY8A 3HDCA 1G6YA 1USBA 2FGXA 3WGDA 5BRTA 2H71A 4K0NA 1E6BA 4TR1B 3KMOA 2R0GA 4MPFA 2H0HA 4JRRA 4MP4A 2OBIA 5KN3A 1OC9B 1PQNA 1Q4JA 4K2XA 2N5BA 4MJAA 5EY6A 2LRTA 4NHZA 2H8LA 4JR6A 2FWEA 1Z7PA 4XRDA 1KTEA 1O8XA 3ZMKA 2O7KA 2ZUPA 1VGLA 2NTOA 4DEJA 2I81A 2HSYA 3VLNA 1TRSA 3R3EA 3QFBC 2VCVA 2QA1A 4J57E 4TXOB 4ZBBA 3VI5A 4YQUA 4EO3A 5ECPB 2CVBA 4X1UA 4XS4B 5AISA 2DKIA 2GQLA 2R37A 5J4UA 2M46A 5JWQB 1SKSB 2A2RA 2IFQB 1OVNA 5JCUA 3GA4A 2DBCA 4F0CA 3GKKA 1MTCA 1GSYA 3PGTA 4NWYA 1GLQA 3WD6A 3TRXA 1OE7A 1JHBA 3CMIA 2JZTA 4ZB6A 4JR4A 2OKAA 2E7PA 1DE1A 2HNLA 3L9UA 2M72A 2JL4A 4WF4A 2C1YA 2PERA 5A4WA 2PWJA 2WCIA 1WJKA 2C8UA 3TJJA 3IAS2 2H76A 3F3QA 1T00A 2QGVA 2IJYA 4V1Ap 1SKRB 3QDNA 2PVOC 3NZNA 4TRXA 5J41A 1OKDA 2R6KA 2ON5A 4O5RA 1NM3A 4FYCA 4IJ3A 2VL2C 3Q6OA 1I9DA 2H74A 2NBSA 4HJMA 1ZYPA 3D0ZA 3KIJA 3L0HA 2F3MA 4XTSA 4MZCA 1TK0B 5E59A 4MH2A 2VD0A 1F9MA 2B6MA 11GSA 2PGTA 2IMKA 1XCCA 3TKSC 1PL2A 4K1FA 3VPQA 3IR4A 3ZVJD 1MDJA 2H6ZA 5F8BA 2HZEB 1ML6A 1NW2A 2IMDA 3D6IA 2LSTA 2H72A 2L6DA 2LJAA 3WGEA 3Q19A 3TOUA 1M2BA 1Z6NA 1YEPA 3R2QA 1N2AA 4LMWA 2MBTA 5ID2B 3US3A 5HR1A 1RQMA 2GT6A 17GSA 1W89A 1SL0B 1CQGA 3I43A 3IXRA 2ES7A 4K8MA 3FR9A 2WRTA 4MCUA 3M0FA 2NPBA 3E0UA 4EE0A 2A4VA 3ZLPA 1C72A 1SD9A 5D9XA 3MYDA 4PNGA 2KLXA 4L0UA 2O85A 2F9SA 1YKCA 3C8EA 1J0FA 2LNSA 4ZL9A 2C4JA 1G6WA 2UZ8A 3ZREA 2AAWA 2H75A 2LTKA 1M2DA 3UIWA 2LQOA 3GL3A 2GSSA 4POBA 2N5AA 4K5RA 2XBIA 2WS2A 2C3QA 1GNEA 3MAKA 4IELA 5ECLB 2JZRA 1QFNA 4WBRD 1TU7A 1O73A 2DSAA 3C71A 4ICYA 2B1LA 1GULA 3IAM2 3DRNA 3VPTA 4USSA 3A5IA 4O92A 1HD2A 2K8SA 5DQYA 3L9VA 20GSA 2P0GA 1XWGA 3GIXA 5D9TA 4F0BA 1AQWA 2G0FA 4HZ4A 5FT3A 2LJKA 1K0NA 3C1SA 4A5PA 5GAPD 4MH3A 5IOXA 4V2NA 2WGRA 3QFAC 2R0PA 3DMLA 1FB6A 2HRNA 3KM6A 4HOJA 3APQA 4ZXGA 3DVWA 1XWKA 1GSSA 4FH8A 1ERTA 1KEBA 2H19A 2FD3A 3M3MA 1LJRA 4EC0A 1LU4A 1PGTA 3P2AA 2A2PA 2JSZA 5IPGA 1O7UA 1FW1A 4GLTA 1WIKA 4KX4A 1Y25A 1S3CA 3ZTLA 4PURA 2MBSA 4V2MA 3APOA 1VF4A 1XPVA 5A4UA 4PUAA 2V1MA 5ECQB 5ECOB 3UJ1A 4ML6A 2H0IA 3CSHA 5CRHA 5KOWA 1K0DA 2AHEA 2IN3A 4AGSA 1ACVA 5DAKA 4BVYA 1JLWA 4ZBDA 3G9BA 4O5QA 3F6DA 3F0IA 2FLSA 2YJ7A 1PKZA 3S9FA 4AJ6A 3HJPA 4WETA 3EVIA 4IP1A 2FY6A 4L0WA 3KMNA 2FA8A 4RQXA 2H1GA 2VCZA 1B4PA 5DBQA 4FYUA 5AIVA 1FHEA 3CBUA 4KF9A 3K8NA 4XRAA 5ENUA 1VF1A 5LCZA 3F4TA 3A2WA 2X4AA 4N0VA 5DALA 1G7OA 2B5EA 2GZPA 3WT2A 1YY7A 3KP9A 1ABAA 2GSQA 2MMZA 2WDUA 1OYJA 3GV1A 5L71A 5GAND 3ZITA 4PXOA 1R4WA 3BCIA 4K9ZA 4ZB8A 2L4QA 2O8VB 3GL5A 1M99A 2ZNMA 2Z9SA 2YWIA 1A8YA 1GUHA 3M8NA 1A0RP 3IBHA 4HJ2A 4OCFA 2WJUA 2V2GA 5LNKe 4WF5A 1BAYA 1W4VA 1SK2A 1NHYA 3P90A 2DJ0A 5IO0A 1GL8A 4GSNA 2AV4A 5AIXA 2HT9A 5FHIA 14GSA 2RUEA 3TKQA 3QCPA 2VIMA 5HQPA 4MPGA 2XC2A 3DXBA 2VLTA 2FNOA 3IRAA 3TKPA 2VUPA 3ME7A 2CQ9A 1PRXA 5ABRA 1BEDA 2LRNA 4K6XA 6GSYA 1FVKA 4HDEA 2E2GA 2NVLA 2OJLA 4BWQA 1TRVA 4NXIA 4O32A 1B8XA 3CRUA 1THOA 2X49A 2C0DA 3M1GA 1XW9A 2XHFA 1MD3A 4G19A 4ULXA 1GTBA 3HYPA 5ELGA 3IHGA 1AQVA 1WPIA 4XIHA 5B6MA 6GSSA 2VLVA 1J9BA 2HYXA 4OO5A 3GH6A 2JU5A 3FRCA 2PUKC 2YV7A 3ZFLA 2O87A 1PN9A 3C73A 2C0FA 4KDYA 3BCKA 1ZOFA 2HRKA 3EINA 1GH2A 3GX0A 1HNAA 2OADA 2GSTA 1V2AA 4YAVA 1X5DA 2H1AA 5D73A 4GRFA 3N5OA 1F37A 1MEKA 1F6MC 1J08A 1JLVA 4JU5A 4MK3A 3LYPA 2EIOA 2XPEA 5CYYA 5IPHA 2CV4A 1PSQA 2JSYA 2PPTA 3VWVA 1M9BA 1SD8A 4I8BA 5IOWA 1ZCPA 1EWXA 4MZWA 1A8LA 2YWOA 2P31A 2YNXA 1TDIA 2C0EA 3EC3A 4CY6A 4KH7A 1PL1A 2KUCA 1U6TA 1XOAA 2IMIA 3LJRA 4WEYA 1Z3EA 2H66A 4GTUA 1TRWA 4G10A 5IQYA 2RLIA 3F4RA 2F8FA 4I97A 13GSA 3FZAA 5HR2A 2K9FA 4O5UA 4I2TA 3C7MA 2IPAA 1WRYA 2CAQA 2GT5A 5G30A 4OO4A 6GSXA 2YANA 4G0KA 4TKYA 2I3YA 1EEJA 1YQ1A 3A5WA 2HXKA 1XWAA 2YN1A 3UVTA 1B4QA 4ZILA 3GTUA 2X8CA 3GKXA 3FMWA 5F05A 4HI7A 4HU9A 1FG4A 16GSA 2YWMA 4G9HA 3APSA 3GUSA 4MMMA 3BJ5A 5CO3A 2TRXA 2AYTA 4X0XA 1THXA 3U6VA 5B8AA 2X99A 2IIYA 1M7TA 1X5CA 1GTUA 3TKSA 4Q5FA 2HRAA 2LS5A 3EWLA 1IYHA 5G2ZA 1Z9HA 3DD3A 2V41A 1S3AA 2I1UA 5H5QA 1ZMAA 1CQHA 3MIXA 2CX4A 1PN0A 3FY7A 4MLYA 1HNCA 2DKHA 3ZRDA 3ZVJA 2DC5A 4GSSA 2REMA 3P8WA 4AF2A 4IQ1A 2P5QA 4HQSA 4WKWA 5G5EA 3UL3A 4QL9A 4N30A 3LXZA 1EEMA 3PR8A 1OC8A 1YF0A 4BL7A 2YWNA 2DJ3A 2E2MA 4HUAA 3PPUA 2HSMA 3KH9A 4DSQA 3C1RA 3TRQA 4Z2RA 4G2EA 4IJIA 1SU9A 1EV9A 4BVXA 2CAIA 1BJXA 2GSRA 5CRDA 3HVVA 4XHMA 3BBYA 5IM9A 5DAKB 4BVYB 4OMVA 3IC4A 1MDIA 1WE0A 3VURA 3WYWA 3KJYA 3A2VA 2B7JA 2DMMA 5G31A 4Z2TA 1FAAA 3N9JA 5J9CA 3H4KA 5JCWA 4JEDA 3V1WA 5DDLA 3CTGA 2VL9A 1T4ZA 4DSRA 3KXOA 1DUGA 3IC8A 3L78A 4F82A 2RM5A 4JE1A 1XXUA 3ZL5A 5LD0A 2L5OA 5IIZA 4K7NA 5DALB 2JZSA 4IBPA 1V9WA 1GUKA 3HZ8A 5ELAA 2I9HA 4LA1A 2KOKA 1SJ6A 3M9JA 4HZ2A 2VCQA 2VO4A 3QMXA 4IP6A 2V32A 2FCHA 5ECNB 5HFKA 9GSSA 1ST9A 4PUFC 2F8AA 1EGRA 3EU4A 4O7HA 2N5FA 2M80A 5CRGA 3RHBA 4DSSA 3KP8A 3IV4A 1RW1A 1KNGA 1GLPA 2GDRA 2GQMA 2V6OA 4KNDA 1X9MB 5EPFA 3DGQA 4FQUA 4KA0A 2EIRA 1SK1A 3ZYWA 7GSSA 1EOHA 5IMCA 4D73A 1WP0A 2LV3A 2K8VA 1QGVA 5HR3A 4POMA 1U3IA 2C0GA 1XWCA 2LNTA 3GKNA 4KSOA 1SL1B 2YZUA 3FEUA 4OFNA 2YPMA 3GSTA 3RBTA 4NHWA 3U5RE 1GSQA 2QC7A 1QXHA 1U88A 3F6FA 5DQSA 2FA4A 2I4AA 5ECKB 4PQIA 4IS0A 3H79A 1FOVA 3F3RA 5D96A 1UVZA 1G0TA 1BG5A 1OKTA 3ZIVA 5ECSA 4OFTA 4ILFA 4HEA2 2CVDA 5E4WA 3IOSA 1A24A 1R5AA 1WWJA 3BD2A 4RUVA 4EXJA 1ERUA 4ECCA 1G7EA 5ECRB 5JWOB 1ERVA 2OE1A 4LLRA 2GTUA 1SENA 1I5GA 4OD7A 2B7KA 2LUSA 4RQRA 6GSUA 3UEMA 3UBLA 1B48A 4ZL8A 2B5YA 1Z7RA 5CRWA 1EOGA 4LMVA 1FVJA 4J2FA 2GGTA 4TOPA 5H5SA 3EURA 4NMUA 4PQHA 1HNBA 2H73A 1H75A 2R5GA 1AW9A 3KTLA 3EE2A 5KEJA 3FK8A 4ECIA 4POKA 4MZBA 1URMA 1U87A 1AAZA 3RAZA 4EVMA 1TW9A 2KHPA 5C00A 2WULA 2FWGA 3HJOA 3DYRA 2G2QA 2C80A 2CVKA 1E2YA 3G7JA 4K2DA 3LXTA 1SL2B 5DCGA 1TP9A 4OCEA 3LQ7A 4FO5A 1GWCA 2H70A 2ON7A 3L4NA 4CW9A 3QAVA 4LL1B 4TR4A 4IHUA 1V58A 3TRPA 3IK7A 4PQ1A 4X4JA 2XBQA 4MJEA 3GTUB 4P3YB 1XBSA 3ZIJA 3F63A 4K0GA 1T3BA 4K7OA 5G1LA 3LYKA 2R0CA 1X9WB 2L57A 1VF3A 1HYUA 3UOMA 3A3TA 1O81A 5J5NA 2RIIA 2ALBA 1M9AA 1AQXA 3IA1A 3DKSA 3FR6A 1TOFA 3I6AA 4KCAA 4NV5A 4MNNA 4MF5A 5DCHA 4WBJA 3TDGA 3KEBA 2VCTA 3FHKA 2C3NA 4CDOA 2YJHA 2GVPA 2VCWA 2FWHA 3CSIA 5B6NA 3P7XA 5KN0A 3A2XA 3GHAA 2KP2A 3ERWA 3TGZA 1K0AA 3ISOA 3TKSE 2GLRA 3W6GA 5C04A 4Z2UA 4QL7A 4EUYA 1ERWA 4F9ZA 1YZXA 1KBNA 3ERFA 2PU9C 3HZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COH A;  10GS A;  3VFI A;  2B1K A;  2VAF A;  1ZYQ B;  3SBC A;  2OE0 A;  2BMX A;  4Q5N A;  3QD9 A;  2QSI A;  1JZW A;  4V1A g;  2WZ9 A;  2HSH A;  4KSM A;  5KN1 A;  3GN3 A;  5HR0 A;  5GZZ B;  1QUW A;  3QOU A;  1A0F A;  1EZK A;  3RPP A;  2DLX A;  1YJ6 A;  2EC4 A;  1XW6 A;  5AN1 A;  2LJR A;  5A4V A;  2HZF A;  3D4T A;  1TXX A;  2B3S A;  4KCE A;  1PX7 A;  1MD4 A;  4EF0 A;  4H86 A;  1H4O A;  2OAC A;  3OR5 A;  1EP7 A;  2AJQ B;  1EGO A;  3GSS A;  18GS A;  2MYG A;  2DIY A;  2O89 A;  5INY A;  3FKF A;  3TJB A;  4E8H A;  2LQQ A;  1A2M A;  1AC1 A;  1GRX A;  3TJK A;  2BJX A;  1A23 A;  1A2J A;  3H1N A;  4AJ7 A;  6GSV A;  4GWR A;  1EV4 A;  2EIQ A;  1ILO A;  3Q74 A;  3EYT A;  1K3Y A;  3NOF A;  1ON4 A;  1GUM A;  1UN2 A;  1ZL9 A;  3HA9 A;  3D5J A;  5IMZ A;  3HY2 A;  3G7Y A;  3IK9 A;  3E3E A;  1F2E A;  3CYN A;  4XS1 A;  1XOB A;  3NIV A;  4ML1 A;  1PMT A;  4KDU A;  1X5E A;  3PIN A;  1OC3 A;  2HI7 A;  2KP1 A;  4DSS B;  2YP6 A;  3FYG A;  4ZL7 A;  3EU3 A;  3DWV A;  2OA7 A;  3KH7 A;  3FZ5 A;  2DJ2 A;  1EP8 A;  1F3A A;  1YKA A;  2VL2 A;  4GST A;  1SK0 A;  4BA7 A;  1V98 A;  4OFM A;  4PGT A;  2IWT A;  2K6V A;  6GSW A;  4Q5R A;  4D73 B;  1XWB A;  1ZGN A;  3VWU A;  4NPB A;  5HFG A;  2H30 A;  1TTZ A;  3TCO A;  2RUF A;  3W8J A;  5J9B A;  3GUR A;  3GRX A;  2FHE A;  3GMF A;  3CRT A;  2VD1 A;  3HXS A;  5KN2 A;  3F8U A;  4ZBA A;  5IMV A;  1M2A A;  5D8I A;  3DIE A;  2B5X A;  3LSZ A;  2H01 A;  1SYR A;  3UBK A;  2JAD A;  3GH9 A;  1QMV A;  1JFU A;  3ME8 A;  2VM1 A;  4FYB A;  2HLS A;  3G7I A;  5F0G A;  4PNF A;  3TUE A;  4L5O A;  5AGY A;  1JZR A;  3KZQ A;  5DVB A;  3L9S A;  3KGK A;  4KE3 A;  3D22 A;  4YQV A;  1XZO A;  4TW5 A;  4N11 A;  1UC7 A;  2HE3 A;  4TR3 A;  4I2U A;  2LEG A;  1BX9 A;  3F9U A;  5ECM B;  1F3B A;  1PKW A;  1UA5 A;  1U3A A;  3WT1 A;  1Y6E A;  1GNW A;  4E8E A;  4MJB A;  1XIY A;  5IMD A;  1TK8 B;  1WOU A;  5IO2 A;  3ERG A;  2RM6 A;  2J23 A;  2CA8 A;  19GS A;  2IMF A;  4N10 A;  3KCM A;  4MA9 A;  4K7I A;  3TOT A;  4KDX A;  3ZML A;  5D9V A;  4TXV A;  1R7H A;  2CZ2 A;  1GSF A;  3E9J B;  3D4M A;  1GSE A;  4N0Z A;  1TK5 B;  4EKZ A;  1Z6M A;  4HS1 A;  4Z7X A;  5DJM A;  1R5P A;  1N8J A;  3D21 A;  3MSZ A;  1ZZY A;  1BQ7 A;  4KUN A;  3O3T A;  3Q18 A;  3VI7 A;  1LBK A;  1YDK A;  4ID0 A;  2DIZ A;  4JBB A;  4L8E A;  3MDK A;  1RK4 A;  1MDK A;  5IMA A;  1JZO A;  4L5L A;  2WFC A;  1GTI A;  4XS6 A;  3IDV A;  3EMX A;  5JWR B;  4IN0 A;  3HHV A;  4HQZ A;  1O6J A;  4PX1 A;  5J3R A;  2F51 A;  3VWW A;  2TIR A;  1B9X C;  2YV9 A;  2H6Y A;  3KD0 A;  3J7Y k;  2X64 A;  1Z5Y E;  1VRS D;  4ECB A;  1XVW A;  1GP1 A;  1YEX A;  2AB6 A;  2GZZ A;  3CXG A;  3SWL A;  1TKD B;  2YOI A;  2YCD A;  3HKR A;  3ZZX A;  1SKW B;  4TR1 A;  2FUG 2;  5DJL A;  5F07 A;  3HJM A;  3TKR A;  4ISD A;  4DVC A;  1T4Y A;  2GQK A;  3O6T A;  2CZ3 A;  5FWG A;  5F06 A;  4IKH A;  1OC9 A;  2L6C A;  1SJI A;  3RHC A;  3EMP A;  1V40 A;  5GSS A;  3W8S A;  1OAZ A;  2PMT A;  4WR5 A;  1OE8 A;  1O8W A;  1R26 A;  4NAX A;  1XVQ A;  5HFI A;  5JCG A;  5CAX A;  4MDC A;  2CX3 A;  2H0G A;  5GST A;  5G1K A;  3I9V 2;  3LOR A;  4GCI A;  2BTO T;  1AUC A;  3MNG A;  4GQC A;  4MF6 A;  2GS3 A;  4IQA A;  5CP1 A;  1X0R A;  4TXO A;  2MZC A;  1QQ2 A;  4TN8 A;  2MMN A;  2X8H A;  2PBJ A;  2OE3 A;  2LRC A;  4XS4 A;  3QR6 A;  3QAG A;  1K3O A;  3LG6 A;  2OBK A;  2MMO A;  1SYX A;  2IFQ A;  2VLU A;  5ECH B;  2ZCT A;  4BPY A;  3RPN A;  2L59 A;  4RI6 A;  3JCM L;  5IMF A;  4EL1 A;  2JAC A;  4F2I A;  3HD5 A;  1DE2 A;  5EL8 A;  1TI1 A;  4YQM A;  4OWY A;  1A2L A;  3LFL A;  4KW6 A;  4YH2 A;  2VM2 A;  12GS A;  4QQ7 A;  4IW9 A;  4EDZ A;  4EDY A;  1TI3 A;  5D93 A;  3VK9 A;  3PH9 A;  3FR3 A;  5ECI B;  2WB9 A;  3LGC A;  1NHO A;  1GSU A;  4KGI A;  4FIW A;  1B9Y C;  1PA3 A;  1YF1 A;  1T7P B;  3CSJ A;  2YZH A;  4JZQ A;  2DML A;  3UMA A;  5G5F A;  4LL4 B;  3GFK A;  4MAB A;  1TU8 A;  3GKM A;  5D9W A;  2R4V A;  5CRE A;  1K3L A;  1DSB A;  3VWX A;  1T1V A;  2H6X A;  2HZE A;  1AXD A;  3UVH A;  1V57 A;  3CTF A;  1BYE A;  4I6X A;  2PVQ A;  2VL3 A;  4KB3 A;  2VCX A;  3M9K A;  3H8Q A;  2K18 A;  5ID2 A;  4HU7 A;  1T8E B;  2L5L A;  3ZFB A;  6GST A;  3J7Y b;  1QK8 A;  2IME A;  3HCZ A;  3GNJ A;  2DJK A;  2R3X A;  3TJG A;  4YAP A;  1K0B A;  2FWF A;  1IYI A;  4ECJ A;  1PX6 A;  2L4C A;  2CT6 A;  3MWH A;  2R2J A;  3DVX A;  4IVF A;  1HQO A;  1K0O A;  3LWA A;  2PN8 A;  2H1B A;  2NDO A;  1O85 A;  4V2L A;  3UAR A;  2A2S A;  4GQF A;  1NSW A;  4ZB9 A;  4ACS A;  1X9S B;  3UAP A;  2IL3 A;  4F03 A;  2X8G A;  1GTA A;  3QPM A;  4IGJ A;  1PD2 1;  4MJC A;  2TRC P;  5H5R A;  4TVE A;  2H1D A;  3WGX A;  4NV2 A;  1DBY A;  4J56 E;  3KTB A;  5CNW A;  5B8B A;  4KAE A;  4GF0 A;  2P5R A;  4X43 A;  1JZD A;  3I69 A;  4Q5Q A;  2DJJ A;  2HFD A;  2VOC A;  2J9H A;  1VF2 A;  22GS A;  1ZYE A;  4WXT A;  1WMJ A;  1XW5 A;  3H93 A;  1S3D A;  2AUV A;  4MF7 A;  1XFL A;  3BOA A;  4AJ8 A;  3RDW A;  3HVS A;  5B7C A;  3GX8 A;  1TRU A;  3ED3 A;  4BWS A;  2V6K A;  3LEF A;  1K0M A;  2HRF A;  2DJ1 A;  5A5K A;  3IHQ A;  1K0C A;  1M0U A;  1Q98 A;  1SJZ A;  1AIU A;  4XCS A;  3AY8 A;  4TR0 A;  3TJF A;  2MMA A;  2XPD A;  1GSD A;  2C3T A;  3F4S A;  2GZY A;  3GYK A;  4WR4 A;  5EVO A;  4CHS A;  4I5Q A;  2D2Z A;  3FZ4 A;  4RI7 A;  3IE3 A;  3HVX A;  4POL A;  3FZ9 A;  1TJD A;  1FO5 A;  4GXZ A;  3TB2 A;  3IPZ A;  1FB0 A;  3O76 A;  3DEX A;  2E0Q A;  2QKE A;  3FW2 A;  3QAW A;  4ZIJ A;  8GSS A;  2LKU A;  3HDC A;  1G6Y A;  1USB A;  2FGX A;  3WGD A;  2H71 A;  4K0N A;  1E6B A;  4TR1 B;  3KMO A;  4MPF A;  2H0H A;  4JRR A;  4MP4 A;  2OBI A;  5KN3 A;  1OC9 B;  1PQN A;  1Q4J A;  2N5B A;  4MJA A;  5EY6 A;  2LRT A;  4NHZ A;  2H8L A;  4JR6 A;  2FWE A;  1Z7P A;  4XRD A;  1KTE A;  1O8X A;  3ZMK A;  2O7K A;  2ZUP A;  1VGL A;  2NTO A;  4DEJ A;  2I81 A;  2HSY A;  3VLN A;  1TRS A;  3QFB C;  2VCV A;  4J57 E;  4TXO B;  4ZBB A;  3VI5 A;  4YQU A;  4EO3 A;  5ECP B;  2CVB A;  4X1U A;  4XS4 B;  5AIS A;  2GQL A;  2R37 A;  5J4U A;  2M46 A;  5JWQ B;  1SKS B;  2A2R A;  2IFQ B;  1OVN A;  5JCU A;  3GA4 A;  2DBC A;  4F0C A;  3GKK A;  1MTC A;  1GSY A;  3PGT A;  4NWY A;  1GLQ A;  3WD6 A;  3TRX A;  1OE7 A;  1JHB A;  3CMI A;  2JZT A;  4ZB6 A;  4JR4 A;  2OKA A;  2E7P A;  1DE1 A;  2HNL A;  3L9U A;  2M72 A;  2JL4 A;  4WF4 A;  2C1Y A;  2PER A;  5A4W A;  2PWJ A;  2WCI A;  1WJK A;  2C8U A;  3TJJ A;  3IAS 2;  2H76 A;  3F3Q A;  1T00 A;  2QGV A;  2IJY A;  4V1A p;  1SKR B;  3QDN A;  2PVO C;  3NZN A;  4TRX A;  5J41 A;  1OKD A;  2R6K A;  2ON5 A;  4O5R A;  1NM3 A;  4FYC A;  4IJ3 A;  2VL2 C;  3Q6O A;  1I9D A;  2H74 A;  2NBS A;  4HJM A;  3D0Z A;  3KIJ A;  3L0H A;  2F3M A;  4XTS A;  4MZC A;  1TK0 B;  5E59 A;  4MH2 A;  2VD0 A;  1F9M A;  2B6M A;  11GS A;  2PGT A;  2IMK A;  1XCC A;  3TKS C;  1PL2 A;  4K1F A;  3VPQ A;  3IR4 A;  3ZVJ D;  1MDJ A;  2H6Z A;  5F8B A;  2HZE B;  1ML6 A;  1NW2 A;  2IMD A;  3D6I A;  2LST A;  2H72 A;  2L6D A;  2LJA A;  3WGE A;  3Q19 A;  3TOU A;  1M2B A;  1Z6N A;  1YEP A;  3R2Q A;  1N2A A;  4LMW A;  2MBT A;  5ID2 B;  3US3 A;  5HR1 A;  1RQM A;  2GT6 A;  17GS A;  1W89 A;  1SL0 B;  1CQG A;  3I43 A;  3IXR A;  2ES7 A;  4K8M A;  3FR9 A;  2WRT A;  4MCU A;  3M0F A;  2NPB A;  3E0U A;  4EE0 A;  2A4V A;  3ZLP A;  1C72 A;  1SD9 A;  5D9X A;  4PNG A;  2KLX A;  4L0U A;  2O85 A;  2F9S A;  1YKC A;  3C8E A;  1J0F A;  2LNS A;  4ZL9 A;  2C4J A;  1G6W A;  3ZRE A;  2AAW A;  2H75 A;  2LTK A;  1M2D A;  3UIW A;  2LQO A;  3GL3 A;  2GSS A;  4POB A;  2N5A A;  2XBI A;  2WS2 A;  2C3Q A;  1GNE A;  3MAK A;  4IEL A;  5ECL B;  2JZR A;  1QFN A;  4WBR D;  1TU7 A;  1O73 A;  2DSA A;  3C71 A;  2B1L A;  1GUL A;  3IAM 2;  3DRN A;  3VPT A;  4O92 A;  1HD2 A;  2K8S A;  5DQY A;  3L9V A;  20GS A;  2P0G A;  1XWG A;  3GIX A;  5D9T A;  4F0B A;  1AQW A;  2G0F A;  4HZ4 A;  5FT3 A;  2LJK A;  1K0N A;  3C1S A;  5GAP D;  4MH3 A;  5IOX A;  4V2N A;  2WGR A;  3QFA C;  3DML A;  1FB6 A;  2HRN A;  3KM6 A;  4HOJ A;  3APQ A;  4ZXG A;  3DVW A;  1XWK A;  1GSS A;  4FH8 A;  1ERT A;  1KEB A;  2H19 A;  2FD3 A;  3M3M A;  1LJR A;  4EC0 A;  1LU4 A;  1PGT A;  3P2A A;  2JSZ A;  5IPG A;  1O7U A;  1FW1 A;  4GLT A;  1WIK A;  4KX4 A;  1Y25 A;  1S3C A;  3ZTL A;  4PUR A;  2MBS A;  4V2M A;  3APO A;  1VF4 A;  1XPV A;  5A4U A;  4PUA A;  2V1M A;  5ECQ B;  5ECO B;  3UJ1 A;  4ML6 A;  2H0I A;  3CSH A;  5CRH A;  1K0D A;  2AHE A;  2IN3 A;  4AGS A;  1ACV A;  5DAK A;  4BVY A;  1JLW A;  4ZBD A;  3G9B A;  3F6D A;  3F0I A;  2FLS A;  2YJ7 A;  1PKZ A;  3S9F A;  4AJ6 A;  3HJP A;  4WET A;  3EVI A;  4IP1 A;  2FY6 A;  4L0W A;  3KMN A;  2FA8 A;  4RQX A;  2H1G A;  2VCZ A;  1B4P A;  5DBQ A;  4FYU A;  5AIV A;  1FHE A;  3CBU A;  3K8N A;  4XRA A;  5ENU A;  1VF1 A;  5LCZ A;  3F4T A;  3A2W A;  4N0V A;  5DAL A;  1G7O A;  2B5E A;  2GZP A;  3WT2 A;  1YY7 A;  3KP9 A;  1ABA A;  2GSQ A;  2MMZ A;  2WDU A;  1OYJ A;  3GV1 A;  5L71 A;  5GAN D;  3ZIT A;  4PXO A;  1R4W A;  3BCI A;  4K9Z A;  4ZB8 A;  2L4Q A;  2O8V B;  3GL5 A;  1M99 A;  2ZNM A;  2Z9S A;  2YWI A;  1A8Y A;  1GUH A;  3M8N A;  1A0R P;  3IBH A;  4HJ2 A;  4OCF A;  2WJU A;  2V2G A;  5LNK e;  4WF5 A;  1BAY A;  1W4V A;  1SK2 A;  1NHY A;  3P90 A;  2DJ0 A;  5IO0 A;  1GL8 A;  4GSN A;  2AV4 A;  5AIX A;  2HT9 A;  5FHI A;  14GS A;  2RUE A;  3TKQ A;  3QCP A;  2VIM A;  5HQP A;  4MPG A;  2XC2 A;  3DXB A;  2VLT A;  2FNO A;  3IRA A;  3TKP A;  2VUP A;  3ME7 A;  2CQ9 A;  1PRX A;  5ABR A;  1BED A;  2LRN A;  4K6X A;  6GSY A;  1FVK A;  4HDE A;  2E2G A;  2NVL A;  2OJL A;  4BWQ A;  1TRV A;  4NXI A;  4O32 A;  1B8X A;  3CRU A;  1THO A;  2C0D A;  3M1G A;  1XW9 A;  2XHF A;  1MD3 A;  4G19 A;  4ULX A;  1GTB A;  3HYP A;  5ELG A;  1AQV A;  1WPI A;  4XIH A;  5B6M A;  6GSS A;  2VLV A;  1J9B A;  2HYX A;  4OO5 A;  3GH6 A;  2JU5 A;  3FRC A;  2PUK C;  2YV7 A;  3ZFL A;  2O87 A;  1PN9 A;  3C73 A;  2C0F A;  4KDY A;  3BCK A;  1ZOF A;  3EIN A;  1GH2 A;  3GX0 A;  1HNA A;  2OAD A;  2GST A;  1V2A A;  4YAV A;  1X5D A;  2H1A A;  5D73 A;  4GRF A;  3N5O A;  1F37 A;  1MEK A;  1F6M C;  1J08 A;  1JLV A;  4JU5 A;  4MK3 A;  3LYP A;  2EIO A;  2XPE A;  5CYY A;  5IPH A;  2CV4 A;  1PSQ A;  2JSY A;  2PPT A;  3VWV A;  1M9B A;  1SD8 A;  4I8B A;  5IOW A;  1ZCP A;  1EWX A;  4MZW A;  1A8L A;  2YWO A;  2P31 A;  2YNX A;  1TDI A;  2C0E A;  3EC3 A;  4KH7 A;  1PL1 A;  2KUC A;  1U6T A;  1XOA A;  2IMI A;  3LJR A;  4WEY A;  1Z3E A;  2H66 A;  4GTU A;  1TRW A;  4G10 A;  5IQY A;  2RLI A;  3F4R A;  2F8F A;  4I97 A;  13GS A;  3FZA A;  5HR2 A;  2K9F A;  4I2T A;  3C7M A;  2IPA A;  1WRY A;  2CAQ A;  2GT5 A;  5G30 A;  4OO4 A;  6GSX A;  2YAN A;  4TKY A;  2I3Y A;  1EEJ A;  1YQ1 A;  3A5W A;  2HXK A;  1XWA A;  2YN1 A;  3UVT A;  1B4Q A;  4ZIL A;  3GTU A;  2X8C A;  3GKX A;  5F05 A;  4HI7 A;  4HU9 A;  1FG4 A;  16GS A;  2YWM A;  4G9H A;  3APS A;  3GUS A;  4MMM A;  3BJ5 A;  5CO3 A;  2TRX A;  2AYT A;  4X0X A;  1THX A;  3U6V A;  5B8A A;  2X99 A;  2IIY A;  1M7T A;  1X5C A;  1GTU A;  3TKS A;  4Q5F A;  2LS5 A;  3EWL A;  1IYH A;  5G2Z A;  1Z9H A;  3DD3 A;  2V41 A;  1S3A A;  2I1U A;  5H5Q A;  1ZMA A;  1CQH A;  2CX4 A;  3FY7 A;  4MLY A;  1HNC A;  3ZRD A;  3ZVJ A;  2DC5 A;  4GSS A;  2REM A;  3P8W A;  4AF2 A;  4IQ1 A;  2P5Q A;  4HQS A;  4WKW A;  5G5E A;  3UL3 A;  4QL9 A;  4N30 A;  3LXZ A;  1EEM A;  3PR8 A;  1OC8 A;  1YF0 A;  4BL7 A;  2YWN A;  2DJ3 A;  2E2M A;  4HUA A;  3KH9 A;  4DSQ A;  3C1R A;  3TRQ A;  4G2E A;  4IJI A;  1SU9 A;  1EV9 A;  4BVX A;  2CAI A;  1BJX A;  2GSR A;  5CRD A;  3HVV A;  4XHM A;  3BBY A;  5IM9 A;  5DAK B;  4OMV A;  3IC4 A;  1MDI A;  1WE0 A;  3VUR A;  3WYW A;  3KJY A;  3A2V A;  2B7J A;  2DMM A;  5G31 A;  1FAA A;  3N9J A;  5J9C A;  3H4K A;  5JCW A;  4JED A;  3V1W A;  5DDL A;  3CTG A;  2VL9 A;  1T4Z A;  4DSR A;  3KXO A;  1DUG A;  3L78 A;  4F82 A;  2RM5 A;  4JE1 A;  1XXU A;  3ZL5 A;  5LD0 A;  2L5O A;  5IIZ A;  4K7N A;  5DAL B;  2JZS A;  4IBP A;  1V9W A;  1GUK A;  3HZ8 A;  5ELA A;  2I9H A;  4LA1 A;  2KOK A;  1SJ6 A;  3M9J A;  4HZ2 A;  2VCQ A;  2VO4 A;  3QMX A;  4IP6 A;  2V32 A;  2FCH A;  5ECN B;  5HFK A;  9GSS A;  1ST9 A;  4PUF C;  2F8A A;  1EGR A;  3EU4 A;  4O7H A;  2N5F A;  2M80 A;  5CRG A;  3RHB A;  4DSS A;  3KP8 A;  3IV4 A;  1RW1 A;  1KNG A;  1GLP A;  2GDR A;  2GQM A;  2V6O A;  4KND A;  1X9M B;  5EPF A;  3DGQ A;  4KA0 A;  2EIR A;  1SK1 A;  3ZYW A;  7GSS A;  1EOH A;  5IMC A;  4D73 A;  1WP0 A;  2LV3 A;  2K8V A;  1QGV A;  5HR3 A;  4POM A;  1U3I A;  2C0G A;  1XWC A;  2LNT A;  3GKN A;  4KSO A;  1SL1 B;  2YZU A;  3FEU A;  4OFN A;  2YPM A;  3GST A;  3RBT A;  4NHW A;  3U5R E;  1GSQ A;  2QC7 A;  1QXH A;  1U88 A;  3F6F A;  5DQS A;  2FA4 A;  2I4A A;  5ECK B;  4PQI A;  4IS0 A;  3H79 A;  1FOV A;  3F3R A;  5D96 A;  1UVZ A;  1G0T A;  1BG5 A;  1OKT A;  3ZIV A;  5ECS A;  4OFT A;  4ILF A;  4HEA 2;  2CVD A;  5E4W A;  3IOS A;  1A24 A;  1R5A A;  1WWJ A;  3BD2 A;  4RUV A;  4EXJ A;  1ERU A;  4ECC A;  1G7E A;  5ECR B;  5JWO B;  1ERV A;  2OE1 A;  4LLR A;  2GTU A;  1SEN A;  1I5G A;  4OD7 A;  2B7K A;  2LUS A;  4RQR A;  6GSU A;  3UEM A;  3UBL A;  1B48 A;  4ZL8 A;  2B5Y A;  1Z7R A;  5CRW A;  1EOG A;  4LMV A;  1FVJ A;  4J2F A;  2GGT A;  4TOP A;  5H5S A;  3EUR A;  4NMU A;  4PQH A;  1HNB A;  2H73 A;  1H75 A;  2R5G A;  1AW9 A;  3KTL A;  3EE2 A;  5KEJ A;  3FK8 A;  4ECI A;  4POK A;  4MZB A;  1URM A;  1U87 A;  1AAZ A;  3RAZ A;  4EVM A;  1TW9 A;  2KHP A;  5C00 A;  2WUL A;  2FWG A;  3HJO A;  3DYR A;  2G2Q A;  2C80 A;  2CVK A;  1E2Y A;  3G7J A;  4K2D A;  3LXT A;  1SL2 B;  5DCG A;  1TP9 A;  4OCE A;  3LQ7 A;  4FO5 A;  1GWC A;  2H70 A;  2ON7 A;  3L4N A;  4CW9 A;  3QAV A;  4LL1 B;  4TR4 A;  4IHU A;  1V58 A;  3TRP A;  3IK7 A;  4PQ1 A;  2XBQ A;  4MJE A;  3GTU B;  4P3Y B;  1XBS A;  3ZIJ A;  3F63 A;  4K0G A;  1T3B A;  4K7O A;  5G1L A;  3LYK A;  1X9W B;  2L57 A;  1VF3 A;  1HYU A;  3UOM A;  3A3T A;  1O81 A;  5J5N A;  2RII A;  2ALB A;  1M9A A;  1AQX A;  3IA1 A;  3DKS A;  3FR6 A;  1TOF A;  3I6A A;  4KCA A;  4NV5 A;  4MF5 A;  5DCH A;  4WBJ A;  3TDG A;  3KEB A;  2VCT A;  3FHK A;  2C3N A;  4CDO A;  2YJH A;  2GVP A;  2VCW A;  2FWH A;  3CSI A;  5B6N A;  3P7X A;  5KN0 A;  3A2X A;  3GHA A;  2KP2 A;  3ERW A;  3TGZ A;  1K0A A;  3ISO A;  3TKS E;  2GLR A;  3W6G A;  5C04 A;  4QL7 A;  4EUY A;  1ERW A;  4F9Z A;  1YZX A;  1KBN A;  3ERF A;  2PU9 C;  3HZ4 A; 
#chains in the Genus database with same CATH topology
 5COH A;  4BL7 B;  10GS A;  3VFI A;  2B1K A;  2VAF A;  1ZYQ B;  1ZYN A;  3SBC A;  2OE0 A;  2BMX A;  4Q5N A;  3QD9 A;  2QSI A;  1JZW A;  4V1A g;  2WZ9 A;  2HSH A;  4KSM A;  5KN1 A;  3GN3 A;  5HR0 A;  5GZZ B;  4BVX B;  1QUW A;  3QOU A;  1A0F A;  1EZK A;  3RPP A;  2DLX A;  1YJ6 A;  2EC4 A;  1XW6 A;  5AN1 A;  2LJR A;  5A4V A;  2HZF A;  3D4T A;  1TXX A;  2B3S A;  4KCE A;  1PX7 A;  1MD4 A;  4EF0 A;  4H86 A;  1H4O A;  2OAC A;  3OR5 A;  1EP7 A;  2AJQ B;  1EGO A;  3GSS A;  18GS A;  2MYG A;  2DIY A;  2O89 A;  5INY A;  3FKF A;  3TJB A;  4E8H A;  2LQQ A;  1A2M A;  1AC1 A;  1GRX A;  3TJK A;  2BJX A;  1A23 A;  1A2J A;  3H1N A;  4AJ7 A;  6GSV A;  4GWR A;  1EV4 A;  2EIQ A;  1ILO A;  3Q74 A;  3EYT A;  1K3Y A;  3NOF A;  1ON4 A;  1GUM A;  1UN2 A;  1ZL9 A;  3HA9 A;  3D5J A;  5IMZ A;  3HY2 A;  3G7Y A;  3IK9 A;  3E3E A;  1F2E A;  3CYN A;  4XS1 A;  1XOB A;  3NIV A;  4ML1 A;  1PMT A;  4KDU A;  1X5E A;  3PIN A;  1OC3 A;  2HI7 A;  2KP1 A;  4DSS B;  2YP6 A;  3FYG A;  4ZL7 A;  3EU3 A;  3DWV A;  2OA7 A;  3KH7 A;  3FZ5 A;  2DJ2 A;  1EP8 A;  1F3A A;  1YKA A;  2VL2 A;  4GST A;  1SK0 A;  4BA7 A;  1V98 A;  4OFM A;  4PGT A;  2IWT A;  2K6V A;  6GSW A;  4Q5R A;  4D73 B;  1XWB A;  1ZGN A;  3VWU A;  4NPB A;  5HFG A;  2H30 A;  1TTZ A;  3TCO A;  2RUF A;  3W8J A;  5J9B A;  3GUR A;  3GRX A;  2FHE A;  3GMF A;  3CRT A;  2VD1 A;  3HXS A;  5KN2 A;  3F8U A;  4ZBA A;  5IMV A;  4YKG A;  1M2A A;  5D8I A;  3DIE A;  1FOH A;  2B5X A;  3LSZ A;  2H01 A;  1SYR A;  3UBK A;  3LW9 A;  2JAD A;  3GH9 A;  1QMV A;  1JFU A;  3ME8 A;  2VM1 A;  4FYB A;  2HLS A;  3G7I A;  5F0G A;  4PNF A;  3TUE A;  4L5O A;  5AGY A;  1JZR A;  3KZQ A;  5DVB A;  3L9S A;  3KGK A;  4KE3 A;  3D22 A;  4YQV A;  1XZO A;  4TW5 A;  4N11 A;  3EPT A;  1UC7 A;  2HE3 A;  4TR3 A;  4I2U A;  2LEG A;  1BX9 A;  3F9U A;  5ECM B;  1F3B A;  1PKW A;  1UA5 A;  1U3A A;  3WT1 A;  1Y6E A;  1GNW A;  4E8E A;  4MJB A;  1XIY A;  5IMD A;  1TK8 B;  1WOU A;  5IO2 A;  3ERG A;  2RM6 A;  2J23 A;  2CA8 A;  19GS A;  2IMF A;  4N10 A;  3KCM A;  4MA9 A;  4K7I A;  3TOT A;  4KDX A;  3ZML A;  5D9V A;  4TXV A;  1R7H A;  2CZ2 A;  1GSF A;  3E9J B;  3D4M A;  1GSE A;  4N0Z A;  1TK5 B;  4EKZ A;  1Z6M A;  4HS1 A;  4Z7X A;  5DJM A;  1R5P A;  1N8J A;  3D21 A;  3MSZ A;  1ZZY A;  1BQ7 A;  4KUN A;  3O3T A;  3Q18 A;  3VI7 A;  1LBK A;  1YDK A;  4ID0 A;  4PTS A;  2DIZ A;  4JBB A;  4L8E A;  3MDK A;  1RK4 A;  1MDK A;  5IMA A;  1JZO A;  4L5L A;  2WFC A;  1GTI A;  4XS6 A;  3IDV A;  3EMX A;  5JWR B;  4IN0 A;  3HHV A;  4HQZ A;  1O6J A;  4PX1 A;  5J3R A;  2F51 A;  3VWW A;  2TIR A;  1B9X C;  2YV9 A;  2H6Y A;  3KD0 A;  3J7Y k;  2X64 A;  1Z5Y E;  1VRS D;  4ECB A;  1XVW A;  1GP1 A;  1YEX A;  2AB6 A;  2GZZ A;  3CXG A;  3SWL A;  1TKD B;  2YOI A;  2YCD A;  3HKR A;  3ZZX A;  1SKW B;  4TR1 A;  2FUG 2;  5DJL A;  5F07 A;  3HJM A;  3TKR A;  4K5S A;  4ISD A;  4DVC A;  1T4Y A;  2GQK A;  3O6T A;  2CZ3 A;  5FWG A;  5F06 A;  4IKH A;  1OC9 A;  2L6C A;  1SJI A;  3RHC A;  3EMP A;  1V40 A;  5GSS A;  3W8S A;  1OAZ A;  2PMT A;  4WR5 A;  1OE8 A;  1O8W A;  1R26 A;  4NAX A;  1XVQ A;  5HFI A;  5JCG A;  5CAX A;  4MDC A;  2CX3 A;  2H0G A;  5GST A;  5G1K A;  3I9V 2;  3LOR A;  4GCI A;  2BTO T;  1AUC A;  3MNG A;  4GQC A;  4MF6 A;  2GS3 A;  4IQA A;  5CP1 A;  1X0R A;  4TXO A;  2MZC A;  1QQ2 A;  4TN8 A;  2MMN A;  2X8H A;  2PBJ A;  2OE3 A;  2LRC A;  4XS4 A;  3QR6 A;  3QAG A;  1K3O A;  3LG6 A;  2OBK A;  2MMO A;  1SYX A;  2IFQ A;  2VLU A;  5ECH B;  2ZCT A;  5KOX A;  4BPY A;  3RPN A;  2L59 A;  4RI6 A;  3JCM L;  5IMF A;  4EL1 A;  2JAC A;  4F2I A;  3HVN A;  3HD5 A;  1DE2 A;  5EL8 A;  1TI1 A;  4YQM A;  4OWY A;  1A2L A;  3LFL A;  4KW6 A;  4YH2 A;  2VM2 A;  12GS A;  4QQ7 A;  4IW9 A;  4EDZ A;  4EDY A;  1TI3 A;  5D93 A;  3VK9 A;  3PH9 A;  3FR3 A;  5ECI B;  2WB9 A;  3LGC A;  1NHO A;  1GSU A;  4KGI A;  4FIW A;  1B9Y C;  1PA3 A;  1YF1 A;  1T7P B;  3CSJ A;  2YZH A;  4JZQ A;  2QA2 A;  2DML A;  3UMA A;  5G5F A;  4LL4 B;  3GFK A;  4MAB A;  1TU8 A;  3GKM A;  5D9W A;  4G0L A;  2R4V A;  5CRE A;  1K3L A;  1DSB A;  3VWX A;  1T1V A;  2H6X A;  2HZE A;  1AXD A;  3UVH A;  1V57 A;  4EIQ A;  3CTF A;  1BYE A;  4I6X A;  2PVQ A;  2VL3 A;  4KB3 A;  2VCX A;  3M9K A;  3H8Q A;  2K18 A;  5ID2 A;  1M3J A;  4HU7 A;  1T8E B;  2L5L A;  5BMU A;  3ZFB A;  6GST A;  3J7Y b;  1QK8 A;  2IME A;  3HCZ A;  3GNJ A;  2DJK A;  2R3X A;  3TJG A;  4YAP A;  1K0B A;  2FWF A;  1IYI A;  4ECJ A;  1PX6 A;  2L4C A;  2CT6 A;  3MWH A;  2R2J A;  3DVX A;  4IVF A;  1HQO A;  1K0O A;  3LWA A;  2PN8 A;  2H1B A;  2NDO A;  1O85 A;  4V2L A;  3UAR A;  2A2S A;  4GQF A;  1NSW A;  4ZB9 A;  4ACS A;  1X9S B;  3UAP A;  2IL3 A;  4F03 A;  2X8G A;  1GTA A;  3QPM A;  4IGJ A;  1PD2 1;  4MJC A;  2TRC P;  5H5R A;  4TVE A;  4EIP A;  2H1D A;  3WGX A;  4NV2 A;  2A4H A;  1DBY A;  4J56 E;  3KTB A;  5CNW A;  5B8B A;  4KAE A;  4GF0 A;  2P5R A;  4X43 A;  1JZD A;  3I69 A;  4Q5Q A;  2DJJ A;  2HFD A;  2VOC A;  2J9H A;  1VF2 A;  22GS A;  1ZYE A;  4WXT A;  1WMJ A;  1XW5 A;  3H93 A;  1S3D A;  2AUV A;  4MF7 A;  1XFL A;  3BOA A;  4AJ8 A;  3RDW A;  3HVS A;  5B7C A;  3GX8 A;  1TRU A;  3ED3 A;  4BWS A;  2V6K A;  3LEF A;  1K0M A;  2HRF A;  2DJ1 A;  5A5K A;  3IHQ A;  1K0C A;  1M0U A;  1Q98 A;  1SJZ A;  1AIU A;  4XCS A;  3AY8 A;  4TR0 A;  3TJF A;  2MMA A;  2XPD A;  1GSD A;  4G0I A;  2C3T A;  3F4S A;  2GZY A;  3GYK A;  4WR4 A;  5EVO A;  4CHS A;  4I5Q A;  2D2Z A;  3FZ4 A;  4RI7 A;  3IE3 A;  3HVX A;  4POL A;  3FZ9 A;  1TJD A;  4YKF A;  1FO5 A;  4GXZ A;  3TB2 A;  3IPZ A;  1FB0 A;  3O76 A;  3DEX A;  2E0Q A;  2QKE A;  3FW2 A;  3QAW A;  4ZIJ A;  8GSS A;  2LKU A;  4CY8 A;  3HDC A;  1G6Y A;  1USB A;  2FGX A;  3WGD A;  5BRT A;  2H71 A;  4K0N A;  1E6B A;  4TR1 B;  3KMO A;  2R0G A;  4MPF A;  2H0H A;  4JRR A;  4MP4 A;  2OBI A;  5KN3 A;  1OC9 B;  1PQN A;  1Q4J A;  4K2X A;  2N5B A;  4MJA A;  5EY6 A;  2LRT A;  4NHZ A;  2H8L A;  4JR6 A;  2FWE A;  1Z7P A;  4XRD A;  1KTE A;  1O8X A;  3ZMK A;  2O7K A;  2ZUP A;  1VGL A;  2NTO A;  4DEJ A;  2I81 A;  2HSY A;  3VLN A;  1TRS A;  3R3E A;  3QFB C;  2VCV A;  2QA1 A;  4J57 E;  4TXO B;  4ZBB A;  3VI5 A;  4YQU A;  4EO3 A;  5ECP B;  2CVB A;  4X1U A;  4XS4 B;  5AIS A;  2DKI A;  2GQL A;  2R37 A;  5J4U A;  2M46 A;  5JWQ B;  1SKS B;  2A2R A;  2IFQ B;  1OVN A;  5JCU A;  3GA4 A;  2DBC A;  4F0C A;  3GKK A;  1MTC A;  1GSY A;  3PGT A;  4NWY A;  1GLQ A;  3WD6 A;  3TRX A;  1OE7 A;  1JHB A;  3CMI A;  2JZT A;  4ZB6 A;  4JR4 A;  2OKA A;  2E7P A;  1DE1 A;  2HNL A;  3L9U A;  2M72 A;  2JL4 A;  4WF4 A;  2C1Y A;  2PER A;  5A4W A;  2PWJ A;  2WCI A;  1WJK A;  2C8U A;  3TJJ A;  3IAS 2;  2H76 A;  3F3Q A;  1T00 A;  2QGV A;  2IJY A;  4V1A p;  1SKR B;  3QDN A;  2PVO C;  3NZN A;  4TRX A;  5J41 A;  1OKD A;  2R6K A;  2ON5 A;  4O5R A;  1NM3 A;  4FYC A;  4IJ3 A;  2VL2 C;  3Q6O A;  1I9D A;  2H74 A;  2NBS A;  4HJM A;  1ZYP A;  3D0Z A;  3KIJ A;  3L0H A;  2F3M A;  4XTS A;  4MZC A;  1TK0 B;  5E59 A;  4MH2 A;  2VD0 A;  1F9M A;  2B6M A;  11GS A;  2PGT A;  2IMK A;  1XCC A;  3TKS C;  1PL2 A;  4K1F A;  3VPQ A;  3IR4 A;  3ZVJ D;  1MDJ A;  2H6Z A;  5F8B A;  2HZE B;  1ML6 A;  1NW2 A;  2IMD A;  3D6I A;  2LST A;  2H72 A;  2L6D A;  2LJA A;  3WGE A;  3Q19 A;  3TOU A;  1M2B A;  1Z6N A;  1YEP A;  3R2Q A;  1N2A A;  4LMW A;  2MBT A;  5ID2 B;  3US3 A;  5HR1 A;  1RQM A;  2GT6 A;  17GS A;  1W89 A;  1SL0 B;  1CQG A;  3I43 A;  3IXR A;  2ES7 A;  4K8M A;  3FR9 A;  2WRT A;  4MCU A;  3M0F A;  2NPB A;  3E0U A;  4EE0 A;  2A4V A;  3ZLP A;  1C72 A;  1SD9 A;  5D9X A;  3MYD A;  4PNG A;  2KLX A;  4L0U A;  2O85 A;  2F9S A;  1YKC A;  3C8E A;  1J0F A;  2LNS A;  4ZL9 A;  2C4J A;  1G6W A;  2UZ8 A;  3ZRE A;  2AAW A;  2H75 A;  2LTK A;  1M2D A;  3UIW A;  2LQO A;  3GL3 A;  2GSS A;  4POB A;  2N5A A;  4K5R A;  2XBI A;  2WS2 A;  2C3Q A;  1GNE A;  3MAK A;  4IEL A;  5ECL B;  2JZR A;  1QFN A;  4WBR D;  1TU7 A;  1O73 A;  2DSA A;  3C71 A;  4ICY A;  2B1L A;  1GUL A;  3IAM 2;  3DRN A;  3VPT A;  4USS A;  3A5I A;  4O92 A;  1HD2 A;  2K8S A;  5DQY A;  3L9V A;  20GS A;  2P0G A;  1XWG A;  3GIX A;  5D9T A;  4F0B A;  1AQW A;  2G0F A;  4HZ4 A;  5FT3 A;  2LJK A;  1K0N A;  3C1S A;  4A5P A;  5GAP D;  4MH3 A;  5IOX A;  4V2N A;  2WGR A;  3QFA C;  2R0P A;  3DML A;  1FB6 A;  2HRN A;  3KM6 A;  4HOJ A;  3APQ A;  4ZXG A;  3DVW A;  1XWK A;  1GSS A;  4FH8 A;  1ERT A;  1KEB A;  2H19 A;  2FD3 A;  3M3M A;  1LJR A;  4EC0 A;  1LU4 A;  1PGT A;  3P2A A;  2A2P A;  2JSZ A;  5IPG A;  1O7U A;  1FW1 A;  4GLT A;  1WIK A;  4KX4 A;  1Y25 A;  1S3C A;  3ZTL A;  4PUR A;  2MBS A;  4V2M A;  3APO A;  1VF4 A;  1XPV A;  5A4U A;  4PUA A;  2V1M A;  5ECQ B;  5ECO B;  3UJ1 A;  4ML6 A;  2H0I A;  3CSH A;  5CRH A;  5KOW A;  1K0D A;  2AHE A;  2IN3 A;  4AGS A;  1ACV A;  5DAK A;  4BVY A;  1JLW A;  4ZBD A;  3G9B A;  4O5Q A;  3F6D A;  3F0I A;  2FLS A;  2YJ7 A;  1PKZ A;  3S9F A;  4AJ6 A;  3HJP A;  4WET A;  3EVI A;  4IP1 A;  2FY6 A;  4L0W A;  3KMN A;  2FA8 A;  4RQX A;  2H1G A;  2VCZ A;  1B4P A;  5DBQ A;  4FYU A;  5AIV A;  1FHE A;  3CBU A;  4KF9 A;  3K8N A;  4XRA A;  5ENU A;  1VF1 A;  5LCZ A;  3F4T A;  3A2W A;  2X4A A;  4N0V A;  5DAL A;  1G7O A;  2B5E A;  2GZP A;  3WT2 A;  1YY7 A;  3KP9 A;  1ABA A;  2GSQ A;  2MMZ A;  2WDU A;  1OYJ A;  3GV1 A;  5L71 A;  5GAN D;  3ZIT A;  4PXO A;  1R4W A;  3BCI A;  4K9Z A;  4ZB8 A;  2L4Q A;  2O8V B;  3GL5 A;  1M99 A;  2ZNM A;  2Z9S A;  2YWI A;  1A8Y A;  1GUH A;  3M8N A;  1A0R P;  3IBH A;  4HJ2 A;  4OCF A;  2WJU A;  2V2G A;  5LNK e;  4WF5 A;  1BAY A;  1W4V A;  1SK2 A;  1NHY A;  3P90 A;  2DJ0 A;  5IO0 A;  1GL8 A;  4GSN A;  2AV4 A;  5AIX A;  2HT9 A;  5FHI A;  14GS A;  2RUE A;  3TKQ A;  3QCP A;  2VIM A;  5HQP A;  4MPG A;  2XC2 A;  3DXB A;  2VLT A;  2FNO A;  3IRA A;  3TKP A;  2VUP A;  3ME7 A;  2CQ9 A;  1PRX A;  5ABR A;  1BED A;  2LRN A;  4K6X A;  6GSY A;  1FVK A;  4HDE A;  2E2G A;  2NVL A;  2OJL A;  4BWQ A;  1TRV A;  4NXI A;  4O32 A;  1B8X A;  3CRU A;  1THO A;  2X49 A;  2C0D A;  3M1G A;  1XW9 A;  2XHF A;  1MD3 A;  4G19 A;  4ULX A;  1GTB A;  3HYP A;  5ELG A;  3IHG A;  1AQV A;  1WPI A;  4XIH A;  5B6M A;  6GSS A;  2VLV A;  1J9B A;  2HYX A;  4OO5 A;  3GH6 A;  2JU5 A;  3FRC A;  2PUK C;  2YV7 A;  3ZFL A;  2O87 A;  1PN9 A;  3C73 A;  2C0F A;  4KDY A;  3BCK A;  1ZOF A;  2HRK A;  3EIN A;  1GH2 A;  3GX0 A;  1HNA A;  2OAD A;  2GST A;  1V2A A;  4YAV A;  1X5D A;  2H1A A;  5D73 A;  4GRF A;  3N5O A;  1F37 A;  1MEK A;  1F6M C;  1J08 A;  1JLV A;  4JU5 A;  4MK3 A;  3LYP A;  2EIO A;  2XPE A;  5CYY A;  5IPH A;  2CV4 A;  1PSQ A;  2JSY A;  2PPT A;  3VWV A;  1M9B A;  1SD8 A;  4I8B A;  5IOW A;  1ZCP A;  1EWX A;  4MZW A;  1A8L A;  2YWO A;  2P31 A;  2YNX A;  1TDI A;  2C0E A;  3EC3 A;  4CY6 A;  4KH7 A;  1PL1 A;  2KUC A;  1U6T A;  1XOA A;  2IMI A;  3LJR A;  4WEY A;  1Z3E A;  2H66 A;  4GTU A;  1TRW A;  4G10 A;  5IQY A;  2RLI A;  3F4R A;  2F8F A;  4I97 A;  1PFO A;  13GS A;  3FZA A;  5HR2 A;  2K9F A;  4O5U A;  4I2T A;  3C7M A;  2IPA A;  1WRY A;  2CAQ A;  2GT5 A;  5G30 A;  4OO4 A;  6GSX A;  2YAN A;  4G0K A;  4TKY A;  2I3Y A;  1EEJ A;  1YQ1 A;  3A5W A;  2HXK A;  1XWA A;  2YN1 A;  3UVT A;  1B4Q A;  4ZIL A;  3GTU A;  2X8C A;  3GKX A;  3FMW A;  5F05 A;  4HI7 A;  4HU9 A;  1FG4 A;  16GS A;  2YWM A;  4G9H A;  3APS A;  3GUS A;  4MMM A;  3BJ5 A;  5CO3 A;  2TRX A;  2AYT A;  4X0X A;  1THX A;  3U6V A;  5B8A A;  2X99 A;  2IIY A;  1M7T A;  1X5C A;  1GTU A;  3TKS A;  4Q5F A;  2HRA A;  2LS5 A;  3EWL A;  1IYH A;  5G2Z A;  1Z9H A;  3DD3 A;  2V41 A;  1S3A A;  2I1U A;  5H5Q A;  1ZMA A;  1CQH A;  3MIX A;  2CX4 A;  1PN0 A;  3FY7 A;  4MLY A;  1HNC A;  2DKH A;  3ZRD A;  3ZVJ A;  2DC5 A;  4GSS A;  2REM A;  3P8W A;  4AF2 A;  4IQ1 A;  2P5Q A;  4HQS A;  4WKW A;  5G5E A;  3UL3 A;  4QL9 A;  4N30 A;  3LXZ A;  1EEM A;  3PR8 A;  1OC8 A;  1YF0 A;  4BL7 A;  2YWN A;  2DJ3 A;  2E2M A;  4HUA A;  3PPU A;  2HSM A;  3KH9 A;  4DSQ A;  3C1R A;  3TRQ A;  4Z2R A;  4G2E A;  4IJI A;  1SU9 A;  1EV9 A;  4BVX A;  2CAI A;  1BJX A;  2GSR A;  5CRD A;  3HVV A;  4XHM A;  3BBY A;  5IM9 A;  5DAK B;  4BVY B;  4OMV A;  3IC4 A;  1MDI A;  1WE0 A;  3VUR A;  3WYW A;  3KJY A;  3A2V A;  2B7J A;  2DMM A;  5G31 A;  4Z2T A;  1FAA A;  3N9J A;  5J9C A;  3H4K A;  5JCW A;  4JED A;  1M3I A;  3V1W A;  5DDL A;  3CTG A;  2VL9 A;  1T4Z A;  4DSR A;  3KXO A;  1DUG A;  3IC8 A;  3L78 A;  4F82 A;  2RM5 A;  4JE1 A;  1XXU A;  3ZL5 A;  5LD0 A;  2L5O A;  5IIZ A;  4K7N A;  5DAL B;  2JZS A;  4IBP A;  1V9W A;  1GUK A;  3HZ8 A;  4BIK A;  5ELA A;  2I9H A;  4LA1 A;  2KOK A;  1SJ6 A;  3M9J A;  4HZ2 A;  2VCQ A;  2VO4 A;  3QMX A;  4IP6 A;  2V32 A;  2FCH A;  5ECN B;  5HFK A;  9GSS A;  1ST9 A;  4PUF C;  2F8A A;  1EGR A;  3EU4 A;  4O7H A;  2N5F A;  2M80 A;  5CRG A;  3RHB A;  4DSS A;  3KP8 A;  3IV4 A;  1S3R A;  1RW1 A;  1KNG A;  1GLP A;  2GDR A;  2GQM A;  2V6O A;  4KND A;  1X9M B;  5EPF A;  3DGQ A;  4FQU A;  4KA0 A;  2EIR A;  1SK1 A;  3ZYW A;  7GSS A;  1EOH A;  5IMC A;  4D73 A;  1WP0 A;  2LV3 A;  2K8V A;  1QGV A;  5HR3 A;  4POM A;  1U3I A;  2C0G A;  1XWC A;  2LNT A;  3GKN A;  4KSO A;  1SL1 B;  2YZU A;  3FEU A;  4OFN A;  2YPM A;  3GST A;  3RBT A;  4NHW A;  3U5R E;  1GSQ A;  2QC7 A;  1QXH A;  1U88 A;  3F6F A;  5DQS A;  2FA4 A;  2I4A A;  5ECK B;  4PQI A;  4IS0 A;  3H79 A;  1XG8 A;  1FOV A;  3F3R A;  5D96 A;  1UVZ A;  1G0T A;  1BG5 A;  1OKT A;  3ZIV A;  5ECS A;  4OFT A;  4ILF A;  4HEA 2;  2CVD A;  5E4W A;  3IOS A;  1A24 A;  1R5A A;  1WWJ A;  3BD2 A;  4RUV A;  4EXJ A;  1ERU A;  4ECC A;  1G7E A;  5ECR B;  5JWO B;  1ERV A;  2OE1 A;  4LLR A;  2GTU A;  1SEN A;  1I5G A;  4OD7 A;  2B7K A;  2LUS A;  4RQR A;  6GSU A;  3UEM A;  3UBL A;  1B48 A;  4ZL8 A;  2B5Y A;  1Z7R A;  5CRW A;  1EOG A;  4LMV A;  1FVJ A;  4J2F A;  2GGT A;  4TOP A;  5H5S A;  3EUR A;  4NMU A;  4PQH A;  1HNB A;  2H73 A;  1H75 A;  2R5G A;  1AW9 A;  3KTL A;  3EE2 A;  5KEJ A;  3FK8 A;  4ECI A;  4POK A;  4MZB A;  1URM A;  1U87 A;  1AAZ A;  3RAZ A;  4EVM A;  1TW9 A;  2KHP A;  5C00 A;  2WUL A;  2FWG A;  3HJO A;  4HSC X;  3DYR A;  2G2Q A;  2C80 A;  2CVK A;  1E2Y A;  3G7J A;  4K2D A;  3LXT A;  1SL2 B;  5DCG A;  1TP9 A;  4OCE A;  3LQ7 A;  4FO5 A;  1GWC A;  2H70 A;  2ON7 A;  3L4N A;  4CW9 A;  3QAV A;  4LL1 B;  4TR4 A;  4IHU A;  1V58 A;  3TRP A;  3IK7 A;  4PQ1 A;  4X4J A;  2XBQ A;  4MJE A;  3GTU B;  4P3Y B;  1XBS A;  3CQF A;  3ZIJ A;  3F63 A;  4K0G A;  1T3B A;  4K7O A;  5G1L A;  3LYK A;  2R0C A;  1X9W B;  2L57 A;  1VF3 A;  1HYU A;  3UOM A;  3A3T A;  1O81 A;  5J5N A;  2RII A;  2ALB A;  1M9A A;  1AQX A;  3IA1 A;  3DKS A;  3FR6 A;  1TOF A;  3I6A A;  4KCA A;  4NV5 A;  4MNN A;  4MF5 A;  5DCH A;  4WBJ A;  3TDG A;  3KEB A;  2VCT A;  3FHK A;  2C3N A;  4CDO A;  2YJH A;  2GVP A;  2VCW A;  2FWH A;  3CSI A;  5B6N A;  3P7X A;  5KN0 A;  3A2X A;  3GHA A;  2KP2 A;  3ERW A;  3TGZ A;  1K0A A;  3ISO A;  3TKS E;  2GLR A;  3W6G A;  5C04 A;  4Z2U A;  4QL7 A;  4EUY A;  1ERW A;  4F9Z A;  1YZX A;  1KBN A;  3ERF A;  2PU9 C;  3HZ4 A; 
#chains in the Genus database with same CATH homology
 5COH A;  4BL7 B;  10GS A;  3VFI A;  2B1K A;  2VAF A;  1ZYQ B;  1ZYN A;  3SBC A;  2OE0 A;  2BMX A;  4Q5N A;  3QD9 A;  2QSI A;  1JZW A;  4V1A g;  2WZ9 A;  2HSH A;  4KSM A;  5KN1 A;  3GN3 A;  5HR0 A;  5GZZ B;  4BVX B;  1QUW A;  3QOU A;  1A0F A;  1EZK A;  3RPP A;  2DLX A;  1YJ6 A;  2EC4 A;  1XW6 A;  5AN1 A;  2LJR A;  5A4V A;  2HZF A;  3D4T A;  1TXX A;  2B3S A;  4KCE A;  1PX7 A;  1MD4 A;  4EF0 A;  4H86 A;  1H4O A;  2OAC A;  3OR5 A;  1EP7 A;  2AJQ B;  1EGO A;  3GSS A;  18GS A;  2MYG A;  2DIY A;  2O89 A;  5INY A;  3FKF A;  3TJB A;  4E8H A;  2LQQ A;  1A2M A;  1AC1 A;  1GRX A;  3TJK A;  2BJX A;  1A23 A;  1A2J A;  3H1N A;  4AJ7 A;  6GSV A;  4GWR A;  1EV4 A;  2EIQ A;  1ILO A;  3Q74 A;  3EYT A;  1K3Y A;  3NOF A;  1ON4 A;  1GUM A;  1UN2 A;  1ZL9 A;  3HA9 A;  3D5J A;  5IMZ A;  3HY2 A;  3G7Y A;  3IK9 A;  3E3E A;  1F2E A;  3CYN A;  4XS1 A;  1XOB A;  3NIV A;  4ML1 A;  1PMT A;  4KDU A;  1X5E A;  3PIN A;  1OC3 A;  2HI7 A;  2KP1 A;  4DSS B;  2YP6 A;  3FYG A;  4ZL7 A;  3EU3 A;  3DWV A;  2OA7 A;  3KH7 A;  3FZ5 A;  2DJ2 A;  1EP8 A;  1F3A A;  1YKA A;  2VL2 A;  4GST A;  1SK0 A;  4BA7 A;  1V98 A;  4OFM A;  4PGT A;  2IWT A;  2K6V A;  6GSW A;  4Q5R A;  4D73 B;  1XWB A;  1ZGN A;  3VWU A;  4NPB A;  5HFG A;  2H30 A;  1TTZ A;  3TCO A;  2RUF A;  3W8J A;  5J9B A;  3GUR A;  3GRX A;  2FHE A;  3GMF A;  3CRT A;  2VD1 A;  3HXS A;  5KN2 A;  3F8U A;  4ZBA A;  5IMV A;  4YKG A;  1M2A A;  5D8I A;  3DIE A;  1FOH A;  2B5X A;  3LSZ A;  2H01 A;  1SYR A;  3UBK A;  3LW9 A;  2JAD A;  3GH9 A;  1QMV A;  1JFU A;  3ME8 A;  2VM1 A;  4FYB A;  2HLS A;  3G7I A;  5F0G A;  4PNF A;  3TUE A;  4L5O A;  5AGY A;  1JZR A;  3KZQ A;  5DVB A;  3L9S A;  3KGK A;  4KE3 A;  3D22 A;  4YQV A;  1XZO A;  4TW5 A;  4N11 A;  3EPT A;  1UC7 A;  2HE3 A;  4TR3 A;  4I2U A;  2LEG A;  1BX9 A;  3F9U A;  5ECM B;  1F3B A;  1PKW A;  1UA5 A;  1U3A A;  3WT1 A;  1Y6E A;  1GNW A;  4E8E A;  4MJB A;  1XIY A;  5IMD A;  1TK8 B;  1WOU A;  5IO2 A;  3ERG A;  2RM6 A;  2J23 A;  2CA8 A;  19GS A;  2IMF A;  4N10 A;  3KCM A;  4MA9 A;  4K7I A;  3TOT A;  4KDX A;  3ZML A;  5D9V A;  4TXV A;  1R7H A;  2CZ2 A;  1GSF A;  3E9J B;  3D4M A;  1GSE A;  4N0Z A;  1TK5 B;  4EKZ A;  1Z6M A;  4HS1 A;  4Z7X A;  5DJM A;  1R5P A;  1N8J A;  3D21 A;  3MSZ A;  1ZZY A;  1BQ7 A;  4KUN A;  3O3T A;  3Q18 A;  3VI7 A;  1LBK A;  1YDK A;  4ID0 A;  4PTS A;  2DIZ A;  4JBB A;  4L8E A;  3MDK A;  1RK4 A;  1MDK A;  5IMA A;  1JZO A;  4L5L A;  2WFC A;  1GTI A;  4XS6 A;  3IDV A;  3EMX A;  5JWR B;  4IN0 A;  3HHV A;  4HQZ A;  1O6J A;  4PX1 A;  5J3R A;  2F51 A;  3VWW A;  2TIR A;  1B9X C;  2YV9 A;  2H6Y A;  3KD0 A;  3J7Y k;  2X64 A;  1Z5Y E;  1VRS D;  4ECB A;  1XVW A;  1GP1 A;  1YEX A;  2AB6 A;  2GZZ A;  3CXG A;  3SWL A;  1TKD B;  2YOI A;  2YCD A;  3HKR A;  3ZZX A;  1SKW B;  4TR1 A;  2FUG 2;  5DJL A;  5F07 A;  3HJM A;  3TKR A;  4K5S A;  4ISD A;  4DVC A;  1T4Y A;  2GQK A;  3O6T A;  2CZ3 A;  5FWG A;  5F06 A;  4IKH A;  1OC9 A;  2L6C A;  1SJI A;  3RHC A;  3EMP A;  1V40 A;  5GSS A;  3W8S A;  1OAZ A;  2PMT A;  4WR5 A;  1OE8 A;  1O8W A;  1R26 A;  4NAX A;  1XVQ A;  5HFI A;  5JCG A;  5CAX A;  4MDC A;  2CX3 A;  2H0G A;  5GST A;  5G1K A;  3I9V 2;  3LOR A;  4GCI A;  2BTO T;  1AUC A;  3MNG A;  4GQC A;  4MF6 A;  2GS3 A;  4IQA A;  5CP1 A;  1X0R A;  4TXO A;  2MZC A;  1QQ2 A;  4TN8 A;  2MMN A;  2X8H A;  2PBJ A;  2OE3 A;  2LRC A;  4XS4 A;  3QR6 A;  3QAG A;  1K3O A;  3LG6 A;  2OBK A;  2MMO A;  1SYX A;  2IFQ A;  2VLU A;  5ECH B;  2ZCT A;  5KOX A;  4BPY A;  3RPN A;  2L59 A;  4RI6 A;  3JCM L;  5IMF A;  4EL1 A;  2JAC A;  4F2I A;  3HD5 A;  1DE2 A;  5EL8 A;  1TI1 A;  4YQM A;  4OWY A;  1A2L A;  3LFL A;  4KW6 A;  4YH2 A;  2VM2 A;  12GS A;  4QQ7 A;  4IW9 A;  4EDZ A;  4EDY A;  1TI3 A;  5D93 A;  3VK9 A;  3PH9 A;  3FR3 A;  5ECI B;  2WB9 A;  3LGC A;  1NHO A;  1GSU A;  4KGI A;  4FIW A;  1B9Y C;  1PA3 A;  1YF1 A;  1T7P B;  3CSJ A;  2YZH A;  4JZQ A;  2QA2 A;  2DML A;  3UMA A;  5G5F A;  4LL4 B;  3GFK A;  4MAB A;  1TU8 A;  3GKM A;  5D9W A;  4G0L A;  2R4V A;  5CRE A;  1K3L A;  1DSB A;  3VWX A;  1T1V A;  2H6X A;  2HZE A;  1AXD A;  3UVH A;  1V57 A;  4EIQ A;  3CTF A;  1BYE A;  4I6X A;  2PVQ A;  2VL3 A;  4KB3 A;  2VCX A;  3M9K A;  3H8Q A;  2K18 A;  5ID2 A;  4HU7 A;  1T8E B;  2L5L A;  5BMU A;  3ZFB A;  6GST A;  3J7Y b;  1QK8 A;  2IME A;  3HCZ A;  3GNJ A;  2DJK A;  2R3X A;  3TJG A;  4YAP A;  1K0B A;  2FWF A;  1IYI A;  4ECJ A;  1PX6 A;  2L4C A;  2CT6 A;  3MWH A;  2R2J A;  3DVX A;  4IVF A;  1HQO A;  1K0O A;  3LWA A;  2PN8 A;  2H1B A;  2NDO A;  1O85 A;  4V2L A;  3UAR A;  2A2S A;  4GQF A;  1NSW A;  4ZB9 A;  4ACS A;  1X9S B;  3UAP A;  2IL3 A;  4F03 A;  2X8G A;  1GTA A;  3QPM A;  4IGJ A;  1PD2 1;  4MJC A;  2TRC P;  5H5R A;  4TVE A;  4EIP A;  2H1D A;  3WGX A;  4NV2 A;  2A4H A;  1DBY A;  4J56 E;  3KTB A;  5CNW A;  5B8B A;  4KAE A;  4GF0 A;  2P5R A;  4X43 A;  1JZD A;  3I69 A;  4Q5Q A;  2DJJ A;  2HFD A;  2VOC A;  2J9H A;  1VF2 A;  22GS A;  1ZYE A;  4WXT A;  1WMJ A;  1XW5 A;  3H93 A;  1S3D A;  2AUV A;  4MF7 A;  1XFL A;  3BOA A;  4AJ8 A;  3RDW A;  3HVS A;  5B7C A;  3GX8 A;  1TRU A;  3ED3 A;  4BWS A;  2V6K A;  3LEF A;  1K0M A;  2HRF A;  2DJ1 A;  5A5K A;  3IHQ A;  1K0C A;  1M0U A;  1Q98 A;  1SJZ A;  1AIU A;  4XCS A;  3AY8 A;  4TR0 A;  3TJF A;  2MMA A;  2XPD A;  1GSD A;  4G0I A;  2C3T A;  3F4S A;  2GZY A;  3GYK A;  4WR4 A;  5EVO A;  4CHS A;  4I5Q A;  2D2Z A;  3FZ4 A;  4RI7 A;  3IE3 A;  3HVX A;  4POL A;  3FZ9 A;  1TJD A;  4YKF A;  1FO5 A;  4GXZ A;  3TB2 A;  3IPZ A;  1FB0 A;  3O76 A;  3DEX A;  2E0Q A;  2QKE A;  3FW2 A;  3QAW A;  4ZIJ A;  8GSS A;  2LKU A;  4CY8 A;  3HDC A;  1G6Y A;  1USB A;  2FGX A;  3WGD A;  5BRT A;  2H71 A;  4K0N A;  1E6B A;  4TR1 B;  3KMO A;  2R0G A;  4MPF A;  2H0H A;  4JRR A;  4MP4 A;  2OBI A;  5KN3 A;  1OC9 B;  1PQN A;  1Q4J A;  4K2X A;  2N5B A;  4MJA A;  5EY6 A;  2LRT A;  4NHZ A;  2H8L A;  4JR6 A;  2FWE A;  1Z7P A;  4XRD A;  1KTE A;  1O8X A;  3ZMK A;  2O7K A;  2ZUP A;  1VGL A;  2NTO A;  4DEJ A;  2I81 A;  2HSY A;  3VLN A;  1TRS A;  3R3E A;  3QFB C;  2VCV A;  2QA1 A;  4J57 E;  4TXO B;  4ZBB A;  3VI5 A;  4YQU A;  4EO3 A;  5ECP B;  2CVB A;  4X1U A;  4XS4 B;  5AIS A;  2DKI A;  2GQL A;  2R37 A;  5J4U A;  2M46 A;  5JWQ B;  1SKS B;  2A2R A;  2IFQ B;  1OVN A;  5JCU A;  3GA4 A;  2DBC A;  4F0C A;  3GKK A;  1MTC A;  1GSY A;  3PGT A;  4NWY A;  1GLQ A;  3WD6 A;  3TRX A;  1OE7 A;  1JHB A;  3CMI A;  2JZT A;  4ZB6 A;  4JR4 A;  2OKA A;  2E7P A;  1DE1 A;  2HNL A;  3L9U A;  2M72 A;  2JL4 A;  4WF4 A;  2C1Y A;  2PER A;  5A4W A;  2PWJ A;  2WCI A;  1WJK A;  2C8U A;  3TJJ A;  3IAS 2;  2H76 A;  3F3Q A;  1T00 A;  2QGV A;  2IJY A;  4V1A p;  1SKR B;  3QDN A;  2PVO C;  3NZN A;  4TRX A;  5J41 A;  1OKD A;  2R6K A;  2ON5 A;  4O5R A;  1NM3 A;  4FYC A;  4IJ3 A;  2VL2 C;  3Q6O A;  1I9D A;  2H74 A;  2NBS A;  4HJM A;  1ZYP A;  3D0Z A;  3KIJ A;  3L0H A;  2F3M A;  4XTS A;  4MZC A;  1TK0 B;  5E59 A;  4MH2 A;  2VD0 A;  1F9M A;  2B6M A;  11GS A;  2PGT A;  2IMK A;  1XCC A;  3TKS C;  1PL2 A;  4K1F A;  3VPQ A;  3IR4 A;  3ZVJ D;  1MDJ A;  2H6Z A;  5F8B A;  2HZE B;  1ML6 A;  1NW2 A;  2IMD A;  3D6I A;  2LST A;  2H72 A;  2L6D A;  2LJA A;  3WGE A;  3Q19 A;  3TOU A;  1M2B A;  1Z6N A;  1YEP A;  3R2Q A;  1N2A A;  4LMW A;  2MBT A;  5ID2 B;  3US3 A;  5HR1 A;  1RQM A;  2GT6 A;  17GS A;  1W89 A;  1SL0 B;  1CQG A;  3I43 A;  3IXR A;  2ES7 A;  4K8M A;  3FR9 A;  2WRT A;  4MCU A;  3M0F A;  2NPB A;  3E0U A;  4EE0 A;  2A4V A;  3ZLP A;  1C72 A;  1SD9 A;  5D9X A;  3MYD A;  4PNG A;  2KLX A;  4L0U A;  2O85 A;  2F9S A;  1YKC A;  3C8E A;  1J0F A;  2LNS A;  4ZL9 A;  2C4J A;  1G6W A;  2UZ8 A;  3ZRE A;  2AAW A;  2H75 A;  2LTK A;  1M2D A;  3UIW A;  2LQO A;  3GL3 A;  2GSS A;  4POB A;  2N5A A;  4K5R A;  2XBI A;  2WS2 A;  2C3Q A;  1GNE A;  3MAK A;  4IEL A;  5ECL B;  2JZR A;  1QFN A;  4WBR D;  1TU7 A;  1O73 A;  2DSA A;  3C71 A;  4ICY A;  2B1L A;  1GUL A;  3IAM 2;  3DRN A;  3VPT A;  4USS A;  3A5I A;  4O92 A;  1HD2 A;  2K8S A;  5DQY A;  3L9V A;  20GS A;  2P0G A;  1XWG A;  3GIX A;  5D9T A;  4F0B A;  1AQW A;  2G0F A;  4HZ4 A;  5FT3 A;  2LJK A;  1K0N A;  3C1S A;  4A5P A;  5GAP D;  4MH3 A;  5IOX A;  4V2N A;  2WGR A;  3QFA C;  2R0P A;  3DML A;  1FB6 A;  2HRN A;  3KM6 A;  4HOJ A;  3APQ A;  4ZXG A;  3DVW A;  1XWK A;  1GSS A;  4FH8 A;  1ERT A;  1KEB A;  2H19 A;  2FD3 A;  3M3M A;  1LJR A;  4EC0 A;  1LU4 A;  1PGT A;  3P2A A;  2A2P A;  2JSZ A;  5IPG A;  1O7U A;  1FW1 A;  4GLT A;  1WIK A;  4KX4 A;  1Y25 A;  1S3C A;  3ZTL A;  4PUR A;  2MBS A;  4V2M A;  3APO A;  1VF4 A;  1XPV A;  5A4U A;  4PUA A;  2V1M A;  5ECQ B;  5ECO B;  3UJ1 A;  4ML6 A;  2H0I A;  3CSH A;  5CRH A;  5KOW A;  1K0D A;  2AHE A;  2IN3 A;  4AGS A;  1ACV A;  5DAK A;  4BVY A;  1JLW A;  4ZBD A;  3G9B A;  4O5Q A;  3F6D A;  3F0I A;  2FLS A;  2YJ7 A;  1PKZ A;  3S9F A;  4AJ6 A;  3HJP A;  4WET A;  3EVI A;  4IP1 A;  2FY6 A;  4L0W A;  3KMN A;  2FA8 A;  4RQX A;  2H1G A;  2VCZ A;  1B4P A;  5DBQ A;  4FYU A;  5AIV A;  1FHE A;  3CBU A;  4KF9 A;  3K8N A;  4XRA A;  5ENU A;  1VF1 A;  5LCZ A;  3F4T A;  3A2W A;  2X4A A;  4N0V A;  5DAL A;  1G7O A;  2B5E A;  2GZP A;  3WT2 A;  1YY7 A;  3KP9 A;  1ABA A;  2GSQ A;  2MMZ A;  2WDU A;  1OYJ A;  3GV1 A;  5L71 A;  5GAN D;  3ZIT A;  4PXO A;  1R4W A;  3BCI A;  4K9Z A;  4ZB8 A;  2L4Q A;  2O8V B;  3GL5 A;  1M99 A;  2ZNM A;  2Z9S A;  2YWI A;  1A8Y A;  1GUH A;  3M8N A;  1A0R P;  3IBH A;  4HJ2 A;  4OCF A;  2WJU A;  2V2G A;  5LNK e;  4WF5 A;  1BAY A;  1W4V A;  1SK2 A;  1NHY A;  3P90 A;  2DJ0 A;  5IO0 A;  1GL8 A;  4GSN A;  2AV4 A;  5AIX A;  2HT9 A;  5FHI A;  14GS A;  2RUE A;  3TKQ A;  3QCP A;  2VIM A;  5HQP A;  4MPG A;  2XC2 A;  3DXB A;  2VLT A;  2FNO A;  3IRA A;  3TKP A;  2VUP A;  3ME7 A;  2CQ9 A;  1PRX A;  5ABR A;  1BED A;  2LRN A;  4K6X A;  6GSY A;  1FVK A;  4HDE A;  2E2G A;  2NVL A;  2OJL A;  4BWQ A;  1TRV A;  4NXI A;  4O32 A;  1B8X A;  3CRU A;  1THO A;  2X49 A;  2C0D A;  3M1G A;  1XW9 A;  2XHF A;  1MD3 A;  4G19 A;  4ULX A;  1GTB A;  3HYP A;  5ELG A;  3IHG A;  1AQV A;  1WPI A;  4XIH A;  5B6M A;  6GSS A;  2VLV A;  1J9B A;  2HYX A;  4OO5 A;  3GH6 A;  2JU5 A;  3FRC A;  2PUK C;  2YV7 A;  3ZFL A;  2O87 A;  1PN9 A;  3C73 A;  2C0F A;  4KDY A;  3BCK A;  1ZOF A;  2HRK A;  3EIN A;  1GH2 A;  3GX0 A;  1HNA A;  2OAD A;  2GST A;  1V2A A;  4YAV A;  1X5D A;  2H1A A;  5D73 A;  4GRF A;  3N5O A;  1F37 A;  1MEK A;  1F6M C;  1J08 A;  1JLV A;  4JU5 A;  4MK3 A;  3LYP A;  2EIO A;  2XPE A;  5CYY A;  5IPH A;  2CV4 A;  1PSQ A;  2JSY A;  2PPT A;  3VWV A;  1M9B A;  1SD8 A;  4I8B A;  5IOW A;  1ZCP A;  1EWX A;  4MZW A;  1A8L A;  2YWO A;  2P31 A;  2YNX A;  1TDI A;  2C0E A;  3EC3 A;  4CY6 A;  4KH7 A;  1PL1 A;  2KUC A;  1U6T A;  1XOA A;  2IMI A;  3LJR A;  4WEY A;  1Z3E A;  2H66 A;  4GTU A;  1TRW A;  4G10 A;  5IQY A;  2RLI A;  3F4R A;  2F8F A;  4I97 A;  13GS A;  3FZA A;  5HR2 A;  2K9F A;  4O5U A;  4I2T A;  3C7M A;  2IPA A;  1WRY A;  2CAQ A;  2GT5 A;  5G30 A;  4OO4 A;  6GSX A;  2YAN A;  4G0K A;  4TKY A;  2I3Y A;  1EEJ A;  1YQ1 A;  3A5W A;  2HXK A;  1XWA A;  2YN1 A;  3UVT A;  1B4Q A;  4ZIL A;  3GTU A;  2X8C A;  3GKX A;  3FMW A;  5F05 A;  4HI7 A;  4HU9 A;  1FG4 A;  16GS A;  2YWM A;  4G9H A;  3APS A;  3GUS A;  4MMM A;  3BJ5 A;  5CO3 A;  2TRX A;  2AYT A;  4X0X A;  1THX A;  3U6V A;  5B8A A;  2X99 A;  2IIY A;  1M7T A;  1X5C A;  1GTU A;  3TKS A;  4Q5F A;  2HRA A;  2LS5 A;  3EWL A;  1IYH A;  5G2Z A;  1Z9H A;  3DD3 A;  2V41 A;  1S3A A;  2I1U A;  5H5Q A;  1ZMA A;  1CQH A;  3MIX A;  2CX4 A;  1PN0 A;  3FY7 A;  4MLY A;  1HNC A;  2DKH A;  3ZRD A;  3ZVJ A;  2DC5 A;  4GSS A;  2REM A;  3P8W A;  4AF2 A;  4IQ1 A;  2P5Q A;  4HQS A;  4WKW A;  5G5E A;  3UL3 A;  4QL9 A;  4N30 A;  3LXZ A;  1EEM A;  3PR8 A;  1OC8 A;  1YF0 A;  4BL7 A;  2YWN A;  2DJ3 A;  2E2M A;  4HUA A;  3PPU A;  2HSM A;  3KH9 A;  4DSQ A;  3C1R A;  3TRQ A;  4Z2R A;  4G2E A;  4IJI A;  1SU9 A;  1EV9 A;  4BVX A;  2CAI A;  1BJX A;  2GSR A;  5CRD A;  3HVV A;  4XHM A;  3BBY A;  5IM9 A;  5DAK B;  4BVY B;  4OMV A;  3IC4 A;  1MDI A;  1WE0 A;  3VUR A;  3WYW A;  3KJY A;  3A2V A;  2B7J A;  2DMM A;  5G31 A;  4Z2T A;  1FAA A;  3N9J A;  5J9C A;  3H4K A;  5JCW A;  4JED A;  3V1W A;  5DDL A;  3CTG A;  2VL9 A;  1T4Z A;  4DSR A;  3KXO A;  1DUG A;  3IC8 A;  3L78 A;  4F82 A;  2RM5 A;  4JE1 A;  1XXU A;  3ZL5 A;  5LD0 A;  2L5O A;  5IIZ A;  4K7N A;  5DAL B;  2JZS A;  4IBP A;  1V9W A;  1GUK A;  3HZ8 A;  5ELA A;  2I9H A;  4LA1 A;  2KOK A;  1SJ6 A;  3M9J A;  4HZ2 A;  2VCQ A;  2VO4 A;  3QMX A;  4IP6 A;  2V32 A;  2FCH A;  5ECN B;  5HFK A;  9GSS A;  1ST9 A;  4PUF C;  2F8A A;  1EGR A;  3EU4 A;  4O7H A;  2N5F A;  2M80 A;  5CRG A;  3RHB A;  4DSS A;  3KP8 A;  3IV4 A;  1RW1 A;  1KNG A;  1GLP A;  2GDR A;  2GQM A;  2V6O A;  4KND A;  1X9M B;  5EPF A;  3DGQ A;  4FQU A;  4KA0 A;  2EIR A;  1SK1 A;  3ZYW A;  7GSS A;  1EOH A;  5IMC A;  4D73 A;  1WP0 A;  2LV3 A;  2K8V A;  1QGV A;  5HR3 A;  4POM A;  1U3I A;  2C0G A;  1XWC A;  2LNT A;  3GKN A;  4KSO A;  1SL1 B;  2YZU A;  3FEU A;  4OFN A;  2YPM A;  3GST A;  3RBT A;  4NHW A;  3U5R E;  1GSQ A;  2QC7 A;  1QXH A;  1U88 A;  3F6F A;  5DQS A;  2FA4 A;  2I4A A;  5ECK B;  4PQI A;  4IS0 A;  3H79 A;  1FOV A;  3F3R A;  5D96 A;  1UVZ A;  1G0T A;  1BG5 A;  1OKT A;  3ZIV A;  5ECS A;  4OFT A;  4ILF A;  4HEA 2;  2CVD A;  5E4W A;  3IOS A;  1A24 A;  1R5A A;  1WWJ A;  3BD2 A;  4RUV A;  4EXJ A;  1ERU A;  4ECC A;  1G7E A;  5ECR B;  5JWO B;  1ERV A;  2OE1 A;  4LLR A;  2GTU A;  1SEN A;  1I5G A;  4OD7 A;  2B7K A;  2LUS A;  4RQR A;  6GSU A;  3UEM A;  3UBL A;  1B48 A;  4ZL8 A;  2B5Y A;  1Z7R A;  5CRW A;  1EOG A;  4LMV A;  1FVJ A;  4J2F A;  2GGT A;  4TOP A;  5H5S A;  3EUR A;  4NMU A;  4PQH A;  1HNB A;  2H73 A;  1H75 A;  2R5G A;  1AW9 A;  3KTL A;  3EE2 A;  5KEJ A;  3FK8 A;  4ECI A;  4POK A;  4MZB A;  1URM A;  1U87 A;  1AAZ A;  3RAZ A;  4EVM A;  1TW9 A;  2KHP A;  5C00 A;  2WUL A;  2FWG A;  3HJO A;  3DYR A;  2G2Q A;  2C80 A;  2CVK A;  1E2Y A;  3G7J A;  4K2D A;  3LXT A;  1SL2 B;  5DCG A;  1TP9 A;  4OCE A;  3LQ7 A;  4FO5 A;  1GWC A;  2H70 A;  2ON7 A;  3L4N A;  4CW9 A;  3QAV A;  4LL1 B;  4TR4 A;  4IHU A;  1V58 A;  3TRP A;  3IK7 A;  4PQ1 A;  4X4J A;  2XBQ A;  4MJE A;  3GTU B;  4P3Y B;  1XBS A;  3ZIJ A;  3F63 A;  4K0G A;  1T3B A;  4K7O A;  5G1L A;  3LYK A;  2R0C A;  1X9W B;  2L57 A;  1VF3 A;  1HYU A;  3UOM A;  3A3T A;  1O81 A;  5J5N A;  2RII A;  2ALB A;  1M9A A;  1AQX A;  3IA1 A;  3DKS A;  3FR6 A;  1TOF A;  3I6A A;  4KCA A;  4NV5 A;  4MNN A;  4MF5 A;  5DCH A;  4WBJ A;  3TDG A;  3KEB A;  2VCT A;  3FHK A;  2C3N A;  4CDO A;  2YJH A;  2GVP A;  2VCW A;  2FWH A;  3CSI A;  5B6N A;  3P7X A;  5KN0 A;  3A2X A;  3GHA A;  2KP2 A;  3ERW A;  3TGZ A;  1K0A A;  3ISO A;  3TKS E;  2GLR A;  3W6G A;  5C04 A;  4Z2U A;  4QL7 A;  4EUY A;  1ERW A;  4F9Z A;  1YZX A;  1KBN A;  3ERF A;  2PU9 C;  3HZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...