1FBNA

Crystal structure of a fibrillarin homologue from methanococcus jannaschii, a hyperthermophile, at 1.6 a
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
230
structure length
230
Chain Sequence
MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a fibrillarin homologue from Methanococcus jannaschii, a hyperthermophile, at 1.6 A resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ribosome
molecule keywords MJ FIBRILLARIN HOMOLOGUE
total genus 65
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 1999-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1fbnA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1fbnA02
3CCFA 2R3KA 5HEZA 4ER6A 4CKCA 2VWIA 4J97A 3LXKA 4QP9A 2HW6A 2HOGA 4FTKA 2FPOA 3KQOA 4A7CA 2WMSA 2ZVAA 4NCTC 3PUPA 4ZP5A 4HGYA 3GRVA 2VTMA 5HBHA 2WA2A 2ITVA 3F9NA 3O0GA 1YDTE 3U9CA 4QT1A 4YJSA 5M56A 5BNJA 2OFUA 3V5WA 2WQOA 2YM3A 4GSBA 4A4XA 3HNGA 2ZLBA 1WCCA 2H6DA 3BHTA 2ONZA 1R0EA 2YQZA 3ULIA 2ITUA 4RJ5A 4YNEA 4FSTA 3I5ZA 4JQ8A 3P86A 4FTRA 5CU6A 2AVNA 4GOLD 4P90A 3OOMA 3BHHA 3QAME 3BWCA 3SMQA 3E8NA 5B0XA 2YA9A 3GIWA 4ATNA 3N4VA 3G15A 3L8VA 3LCOA 5DRBA 5F2KA 3ZLYA 5C03A 2DYLA 3UNZA 2RIOA 4ZJIA 3M4XA 4QQKA 3TIYA 4D0WA 4V0RA 3ORIA 4L68A 4L67A 4O83A 4BDKA 3R7IA 2B0QA 4NKAA 4U40A 5I9YA 1SZMA 1R0PA 1S9IA 2QKWB 1SUIA 4ALUA 2VWYA 4Y85A 1FPUA 3FL5A 2EB3A 3DK6A 3V5LA 5M4CA 3HA7A 3DZOA 3NUNA 3QCQA 3R7EA 4E2YA 2V22A 5HI2A 2VWBA 3MSSA 4YURA 5E8TA 3IO7A 5CF5A 1KOAA 4FIJA 2X6DA 2JKOA 3TOSA 3RZBA 5U4XA 3M11A 3TNHA 1CTPE 4GJ2A 4IHPA 4LRKA 1IA9A 5I9UA 1OL5A 4XP0A 3QZIA 2A19B 3PXFA 3M1SA 2WEIA 3QYWA 2XK3A 3OXIA 3ZCLA 3MPMA 2WD1A 1X19A 5IQHA 4QMMA 3DMHA 5KZ0A 4OTIA 2C47A 4WT6A 2IH5A 4GG5A 2O0UA 4KD1A 4FTOA 2ZBRA 4DEIA 5J7HA 4MKCA 4HYHA 4O0VA 5DT3A 5LMBA 2AC5A 1JG2A 2XK7A 1Q0TA 3E7VA 3KGAA 3TQSA 2GQGA 1XH7A 4YJRA 3MTLA 4PL5A 3KK8A 4PQNA 3FUWA 2QHMA 2XKEA 4M7IA 3OZSA 2W4JA 3RMFA 4CKJA 4XG4A 3OE4A 5E4HA 1PMEA 1WBNA 3IS5A 3NX8A 4OUCA 3PA4A 4ITJA 2QU6A 4YTIA 1IASA 5EM5A 3E8SA 3R9RA 3DOGA 3EQRA 3HCBA 3BGQA 4YLJA 2OKCA 4WOVA 1Q5KA 3LBYA 2R3LA 2QKRA 3BRBA 5BPYA 3MTFA 4XCXA 3QD0A 2PZRA 2XM8A 4UWYA 3V6RA 4TXCA 4X6QC 4Z16A 3OD6X 3OU6A 4ZK5A 4IKPA 5IKMA 2E9OA 3ATSA 4FV2A 3UBTA 3VS1A 5HBEA 4E70A 2WQEA 4U7TB 3PXQA 4A4OA 3TT0A 2P2IA 2QOHA 4NFMA 3FEGA 3BV2A 3V3VA 4CT2A 4JJRA 1XH9A 4EHVA 2PV0A 4LWOA 1O9UA 3CJGA 2ZZMA 3VUHA 1BHJA 4HVDA 4W8EA 1R6AA 2QOOA 5M55A 4F9AA 1NW6A 2BR5A 1DUSA 5EG5A 4YMHA 3SQQA 3BCEA 4LOQA 3BU6A 4W4WA 5CEKA 5L8KA 4DCGA 3FXXA 3BBTB 3GFEA 4UB7A 5E8ZA 4X61A 3MW1A 4C03A 4CMOA 4DFYA 3RM7A 5L3AA 4EQZA 3K5UA 1YI4A 4ZS4A 3HVKA 4BCHA 2YEXA 2F4JA 2XIXA 3CSVA 4NJDA 1FBNA 2HMYB 3ENMA 3C13A 1W83A 4MAOA 3CTJA 1ZARA 4FKLA 3RHKA 4D58A 5IA0A 5IZFA 5ETFA 3UDBA 4KIGA 2B78A 5HVKA 4HGLA 1OMWA 3BYUA 3VC2A 1STCE 2VP3A 2W99B 1XH8A 4MTAA 3UMXA 3DK3A 4KVZA 4ER5A 4QTUB 3MWUA 3KXZA 3RM6A 2PLWA 3MI9A 4GIHA 2WEVA 4HVGA 3A7EA 3ZOSA 1YZ3A 3QTQA 4RWIA 1XDSA 4UY9A 1H1DA 2WB8A 2R5TA 5DGZA 5LVLA 5C9CA 4QQTA 1NW3A 5BVDA 4LWPA 5KS2A 3DTWA 2Z60A 2GA9A 3Q96A 5BP7A 2YAKA 3O17A 2OLCA 5DVRA 4BVUA 5E8VA 5ICCA 4F6SA 2YACA 2WMVA 4R7IA 1M6EX 3BIZA 4HH4A 5EMMA 1GNGA 3QRKA 4CTJA 3HMPA 1AQJA 5KE0A 2NP7A 4PYQA 3ODYX 4J8MA 4QYYA 2HWOA 4KA3A 4RJ3A 5AV1A 3W2SA 3OZRA 2JEDA 1HCLA 3L1SA 3CS9A 4JLCA 5M57A 2J4ZA 4MX9A 3V8WA 2H11A 3CD3A 4TWNA 4XG7A 4KSQA 5A3XA 3L9LA 1XCJA 3LJ1A 3DAJA 3PYYA 4RX8A 3OP5A 4K8AA 5E1BA 5IH3A 5L6WL 5T64A 4RTRA 5CVEA 1K9AA 4KKGA 3I1AA 4ENYA 2A14A 4FV1A 2P33A 2KULA 3W16A 2OH4A 1NE2A 3DLSA 3LJ0A 2XYNA 3KF4A 3BE2A 4JQEA 4XV3A 2KW5A 3VVHA 4EWHA 4L7FA 5DG5A 4DEBA 3MQ2A 4RX9A 5DA3A 5AFVA 1FINA 3ZSHA 2LD4A 4QTCA 4J7BA 5FRIA 5HD7A 2XVDA 5CM2Z 5E9QA 5FWAA 3P2IA 4MNEB 2UW4A 2RG5A 4YHFA 3P9NA 3EFWA 1NA7A 5E7RA 4DTAA 5CEQA 4CKRA 2C6TA 2N47A 2YTZA 5EDPA 3GT8A 3IGGA 3KCFA 3FYJX 2ETMA 2VWUA 4KKHA 3HCEA 1WY7A 1QPJA 3NYOA 1GZNA 3F7ZA 2HENA 4C33A 3JVSA 3W2OA 3FI4A 2AOUB 2I7CA 3ELUA 3HRBA 5LVPA 3QX2A 5EHOA 4CV9A 2PWLA 5CEMA 3L9MA 3ORLA 5KMLA 4GK3A 2K4MA 3EVBA 3LDGA 1H07A 1NW1A 2VX3A 4EOPA 3F5PA 5FEDA 1XXLA 5EYKA 3LFFA 5AP3A 4LUEA 4G6OA 2OF4A 1W82A 3FAAA 1ZZ2A 5HIKA 4FX3A 4TNDA 4YZBA 2PVCA 3FLSA 4FTNA 3LLAA 3JY9A 4XS2A 4HNFA 4EJNA 2HTEA 1XJDA 4K6ZA 5HIIA 3TV6A 5CCXA 5FBOA 3UIUA 2OO8X 3F3TA 4QYGA 3LPMA 2YCSA 1UV5A 2FH9A 3E7OA 4BIBA 3WZKA 5T6BA 3TKAA 3V6SA 5M07A 3HEGA 3Q4UA 5CY3A 4WNOA 1XH4A 3GXLA 3ELJA 4CVAA 4LV8A 4EVIA 3FPJA 1M17A 1ZMVA 2FYTA 3AC1A 4U3ZA 2FRXA 3M6VA 5K8VA 1CKIA 4NTSA 2C5YA 3QRTA 3KRRA 3ZFMA 1XDUA 4QNAA 4IWNA 1INLA 4GOMD 4N70A 2R3IA 1BYGA 1TQPA 5HESA 3EVDA 2PMNX 5C27A 4QDJA 3ENHA 4BDBA 3D5UA 2J5EA 4GFMA 4BZDA 4EBVA 5LWMA 2EJTA 4HPTE 4QP1A 2VU3A 4RLKA 4RWKA 2ZM1A 3VBXA 4IH8A 3DT1A 3VF8A 3VS0A 4L00A 3IW8A 3C5IA 3R1QA 4U44A 3EZRA 4ANQA 3LAUA 3MPTA 4G3FA 3BX5A 4CGAA 2J0IA 4PDPA 1JG3A 2O63A 4H3PA 3F66A 1KHHA 2UYHA 3ZRMA 3TLJA 5HIJA 4AQCA 5FUTA 4R3RA 3P1AA 3K54A 2XBJA 3Q6UA 5IA5A 2QY6A 3R0QA 1ZOGA 3EIDA 3T9IA 2YITA 3DBCA 5TF9A 5LCJA 4UX9A 2DPMA 1B42A 3BKWA 3QHWA 4OT6A 1NVSA 3EJ1A 2VTIA 2VX0A 5A4QA 3JYAA 3KQMA 3T7SA 5FHRA 3R0TA 4RGJA 4XLIA 2VUWA 1IA8A 3R6TA 4FEWA 3ETAA 4YV2A 3I4BA 2BR1A 3KQQA 2ZIGA 2J51A 2NRYA 4ZSEA 4HG2A 1H0VA 1U59A 4AN3A 4AOIA 2IZSA 2YABA 3IV6A 2JLDA 3JVRA 3M2WA 2QOKA 4FC0A 4PYOA 2GNJA 5E8SA 2R3HA 1R3CA 3LOKA 3B3FA 4H39A 5DR6A 3FHIA 3OWKA 4FKPA 4MD9E 4YPSA 3RPSA 5DLYA 4RTJA 2J7TA 2X7GA 5GHVA 5BXYA 2QURA 1E1VA 3BV3A 4OA8A 5J9LA 5F4NA 2YCQA 3U55A 1Q3DA 5B2LA 4HGTA 3AC8A 3L8PA 4YGAA 2UVXA 2R3OA 3FZ1A 5ANDA 3VF9A 2J6MA 4FTUA 3OMVA 3PVBA 4FZFB 4FNXA 4YUWA 5FQOA 2YAAA 2X2KA 3LXNA 4N4SA 5F2OA 2JFLA 3BT7A 4B4LA 4MCVA 3ZONA 2UZEA 2BTSA 3UOHA 3THSA 3R01A 4ID7A 1F5QA 2C6KA 4R3PA 4Q9ZA 4E4MA 3B8RA 3A26A 4ER3A 3B3GA 3HA6A 2XB7A 2PL0A 4F99A 3CC8A 4C4GA 3TJCA 3B89A 3IQ7A 1JG4A 5K0NA 1JLUE 4FT4A 5E1SA 1GIIA 4PX6A 2Y4IB 2XIRA 3FUVA 2BTRA 2VZ6A 3VUGA 1CDKA 3FMHA 1P39A 2QLUA 2WTKB 4OQEA 4QDKA 4FG7A 4PONA 4FEXA 3NMUF 4FUYA 3SLSA 1PKGA 4AWIA 1R8YA 2VWVA 2C3JA 2JDSA 4NZWB 4ZXTA 3WZDA 3WSTA 4PUZA 5KQSA 4EUTA 4U81A 3ZO4A 3P2EA 2W1FA 4CFWA 2QODA 3QTIA 4MYGA 1VQ1A 5C4LA 2PGXA 2NPQA 3OUNB 4OTRA 3FMLA 4C34A 3BWFA 2GFSA 3GDHA 3V97A 5HE0A 3BI6A 5HLPA 3UVRA 4AW5A 3KQSA 1P4FA 4A9RA 2EXMA 5ETCA 3PX2A 2ZULA 2PVKA 4C37A 5HOQA 3HVJA 4FL3A 4WG3A 5IEVA 3D2KA 3NLBA 2Q0BA 3Q4TA 5DIAA 5BVEA 5J8IA 1PYEA 3D7ZA 3ZYAA 4AG8A 2CKEA 3A7JA 4V0QA 4ASEA 1H00A 3MBLA 1R39A 2PX5A 4NT4A 2O8YA 5EH0A 4PNKA 1HNNA 3HP2A 4FKJA 4FNZA 2J0KA 4DC2A 3OCGA 4H36A 2VAGA 5IQDA 1XBBA 5BMMA 2EB2A 2PBFA 5HBJA 5M5BA 5FDXA 4NUSA 2OWBA 2BIYA 4ZLOA 5A6NA 4FTJA 1MRUA 5D12A 5E92A 4D9TA 1J1CA 2UVYA 2ZIEA 5E2BA 2O57A 3FPGA 2KTYA 5HG7A 2V7AA 4IDTA 5HE2A 2FVDA 4DA4A 5I9ZA 5EZQA 2WTCA 3M42A 4QMZA 4JOAA 1NW5A 2QG7A 2AOWA 1H25A 4MWIA 4Y46A 3P5KA 4FV0A 4P5QA 3TV4A 1L9KA 4PINA 5E1DA 5CI7A 1VBFA 5LARA 1A48A 1H1SA 2NYUA 4DE4A 4GW8A 5AA8A 3VSEA 2WQMA 4E6DA 5JN2A 5LXMA 5I9VA 4EKIA 2QOQA 5JGBA 3Q3BA 4B8LA 3A7IA 3FZTA 2HZNA 2XA4A 5EK7A 1WBPA 3UWPA 1ZRZA 2ZV7A 4W4VA 3R7VA 1F38A 4FOCA 2WMRA 5FHQA 3CPBA 4FT0A 3HV3A 4RIYA 3AC4A 1E9HA 1OECA 4FVQA 3U8WA 4DFNA 2OPBA 3T3VA 3AXSA 2F7XE 4NECA 3OFMA 3Q32A 4EKLA 3U87A 2FUMA 3DNEA 3VS4A 2H9VA 2Y7JA 1P91A 3ZSGA 3IHTA 5DRYA 2YIRA 4A6EA 1LUFA 4G3DA 4YLKA 5C8NA 1XVAA 2PZ5A 3EVGA 1XHAA 4PP7A 4GOND 3QTZA 3TKUA 2IIPA 2BILB 2OIDA 4EOMA 2AN5A 1KYWA 2CCHA 2W17A 4IX6A 3PB3A 2R3QA 4ASDA 2JAMA 4OR5A 3O7LD 3ZLXA 5JSMA 1ZGJA 3QTWA 1GZKA 3MB5A 2UW6A 3ZLWA 3LCSA 2XIZA 2GDOA 3KR1A 4QTTB 3SGCA 3WE4A 4Y73A 1HMYA 5HU3A 4GOOD 3KKVA 5AP6A 1PYXA 3LKMA 3GBZA 3KCKA 3LXPA 2X4FA 3AGLA 3FMDA 2RKUA 1VJYA 4IFGA 1M2RA 4PL3A 3FMJA 5DE2A 3W8LA 5BQ0A 2BM8A 4M38A 4XMOA 1PXPA 4DCEA 3RK7A 2OO3A 5A6OA 3QV2A 4IBMA 5E1MA 5ANIA 3HUCA 4BN1A 1Y6AA 2QO7A 4K9YA 2I62A 3MTEA 3KRJA 5C26A 5JUWA 1YI3A 3Q4ZA 2ORED 2J50A 2WU7A 3FI3A 4PMSA 3E87A 5EHYA 4GVJA 3WF9A 5F94A 4YBJA 5K0CA 3F7WA 1D2CA 3QBNA 2BFYA 4U7ZA 4ANBA 5LQCA 1YXUA 2FSOX 4FTCA 2IGTA 3LQ5A 3G5DA 2P2HA 3UNKA 4R7BA 4RC2A 5CSHA 5FLFA 3QLFA 3EVFA 4FUXA 4PYKA 2YXEA 4D1ZA 3KK9A 3RI1A 1PW2A 3R00A 4ERKA 3LKDA 3S68A 2IO6A 1YFLA 3L9PA 5HTBA 3DXQA 5D1NA 3WYYA 3PWDA 1ZY4A 2G72A 1MJFA 2J2IB 3PJ3A 4GK4A 5CU3A 3UJ9A 3LFQA 3MFUA 4P4CA 2YWPA 3Q7EA 4C04A 2P3OA 5EKOA 2C30A 4D2SA 3KN6A 3GEQA 4TPTA 4KBKA 2XS0A 3EVEA 4JDIA 5C0OE 4C4EA 4QP4A 4RG0A 3U9NA 5JRSA 3EGIA 1FPQA 4M14A 3V5PA 4AT3A 4BHZA 3W32A 3VJNA 4A06A 5B2MA 4YTCA 3NTVA 5J9ZA 1U5QA 5HVJA 5D1JA 3QTRA 1QAOA 2C5OA 2WTDA 3PA5A 2WK1A 4G5PA 5H8GA 1UNHA 2VTJA 4RQKA 3EMGA 4YC6A 3BHYA 2BRGA 3EH9A 1EJ6A 1WG8A 4OTQA 1WZNA 4F0FA 3AJDA 4P7KA 2R0UA 4IAYA 2VWZA 3FYKX 1RW8A 2R3MA 3OG7A 1Y57A 4XUCA 4X2GA 4CLJA 1QAQA 3P9IA 1U46A 5FEEA 1EIZA 3V8SA 5LQAA 3QRIA 4JAJA 5CZHA 2F2CB 5DM4A 2BDFA 5GM1A 4H1MA 5BYYA 3DDQA 4DH3A 2QM3A 3OOGA 2R2PA 2ZB0A 4EH2A 2AZTA 5DXAA 5H2UA 5KMMA 4TTHB 2W5HA 3GU6A 4QQJA 3FRIA 7MHTA 2PVFA 3PDTA 5CEOA 4FEVA 4F70A 1OKVA 2WIPA 3C4WA 1I9GA 4QMTA 2AN4A 3OHTA 4U0IA 3R8VA 2BZKB 3B2WA 4CMUA 3B3JA 5EGSA 3AT3A 4BIEA 4C08A 3SR4A 3PXZA 4ZLYA 5IQGA 3UG2A 4HOKA 5HFJA 4FL1A 3LCDA 3UP2A 1N7IA 4CRLA 2SRCA 4JDJA 2A2AA 3GFWA 4O82A 3BELA 4C36A 3QKMA 4QTEA 1X1DA 4E6AA 3ZC6A 4A9UA 1BOOA 4OBWA 3PVCA 3TUCA 3ACJA 3HEMA 4C62A 1PXIA 2FHPA 1YF3A 2WELA 4G17A 4RJ8A 3WOWA 4DITA 2Z6UA 3HMMA 3G8BA 2CNUA 3T0IA 3HV5A 3FXZA 3G90X 4IZYA 2GFCA 3VBVA 2C7RA 1OKZA 1L3IA 2ZWVA 3F82A 4EOJA 4QP2A 3W55A 3NVMB 4V0GB 4RTNA 4NKSA 3VQUA 3ZUTA 3ERCA 3W2RA 3V8VA 2JBOA 3PRFA 3R28A 3R8LA 3RNIA 2V7OA 3R9OA 3LKZA 2O64A 4YJOA 5FA5A 1DL5A 1Q61A 4U42A 1JQ3A 4G3EA 4HZRA 4DFZE 1J7LA 5E8UA 5BX0A 5CAOA 3MVLA 4BCGA 5A4EA 3AY0A 5FP6A 1Q99A 3ORMA 5GJDA 5LMAA 5AUWA 3FQEA 1ZZLA 5M4IA 3ZC5A 3QQHA 4N57A 4BP1A 3DTNA 1GOLA 2HYYA 4RZWA 1QCFA 3DJ6A 1H0WA 3R73A 2Y1WA 3EGEA 3G2OA 3V51A 4L7SA 3TXOA 4Y83A 2YM8A 3CIKA 4DM3A 3IOPA 3NAXA 4ACHA 4AUAA 2JH8A 4M67A 4OLIA 4USEA 5BUIA 4QPSA 4FTAA 4RJ6A 2ETRA 5CVDA 4EK5A 3M70A 3PVUA 1IXKA 4UALA 1MP8A 1IRKA 4I3ZA 3DLIA 5HO8A 4DMGA 4MIKA 3CTHA 3PVWA 4FGBA 3RP9A 1PHKA 5EM6A 2R64A 3PJ2A 3JWIA 4FL2A 4NL0A 5LVNA 5BW5A 1OPJA 2ZAZA 3RK9A 4HRAA 2W9FB 4LRJA 4PCLA 5IH6A 2P8JA 2C3LA 3B5IA 4D4SA 4L42A 3E23A 2W1DA 4I22A 4GUBA 4P58A 3RAIA 5G6VA 4F08A 4M12A 2O5KA 1H28A 3C7QA 3C0GA 4FNYA 5AX3A 3VC4A 1R78A 4RVDA 4KWCA 4GYGA 4NFNA 1XH6A 4OTFA 4CRSA 3MCZA 4Z2YA 4YUYA 3IKAA 2ZZKA 3ELYA 3NYXA 4NW5A 5DEYA 1BL7A 5CU4A 4ZSGA 4RVKA 3GCVA 3IW7A 5DNRA 3SD0A 3W2PA 3U54A 3A4TA 2W1EA 1REKA 3AT4A 3LVPA 4RQVA 5EYDA 4JBPA 4EOKA 3P79A 2GB4A 5D7AA 4E33A 1OPKA 1ND4A 3PFHA 4GU9A 4XRJA 2YIYA 2EXCX 3VULA 3PSDA 2JHCA 4JIKA 4DAWA 4PMPA 1SVGA 4IQ6A 3NUAA 3LHJA 3I9FA 3PS9A 3MH1A 2YM7A 3FQSA 4TNBA 3KA0A 5CTPA 2XM9A 5E9EA 3TFWA 2BRNA 5KYGA 3ODZX 5M4FA 2W5BA 3ER9A 3GVUA 3FWQA 4J96A 3BE9A 4R1VA 3I53A 4GUEA 3QA0A 2ZCJA 2I0VA 1WAKA 3AC3A 3AMBA 3EB0A 3NUXA 4ZTQA 3AOXA 4BF2A 1GZ8A 1H24A 2BH2A 4QQNA 1Q8ZA 3G6GA 5CAVA 4DF3A 1ZXEA 2J5FA 2VN9A 3DBDA 4PF4A 3R2BA 5IQIA 3S2PA 4DTKA 3OCJA 4R8RA 2J0JA 4YPDA 2Q0NA 4R5YA 4RFZA 2PSQA 3AD4A 4C4HA 1YWRA 4HVIA 1NT2A 4I21A 4IWQA 2VZ9A 5K09A 3BQCA 1YXXA 3GENA 3BWBA 2GTNA 2HWKA 5DM0A 3AD6A 3JR1A 1RI2A 2F7EE 4FSWA 3PXRA 3QGYA 3PSBA 3TACA 2BROA 5D10A 3GC9A 3C4CA 2C69A 4Y5HA 4BLUA 2UYCA 4YTHA 3OY3A 4A07A 2CSNA 4FT5A 3LPBA 3DCVA 3G88A 2X9FA 2XKFA 2JDVA 3PIXA 4U6RA 3IEIA 2PK9A 2W9ZB 2OU7A 3OXTA 3Q5IA 4HPUE 5HCYA 4JVGA 2ZB1A 3UOJA 1RI1A 2QYOA 4IFCA 2YDKA 5C8KA 2G70A 2E9NA 2XIYA 3Q6WA 2OBJA 3MH0A 2VTTA 4ZY6A 1FOTA 1CKJA 2ITYA 1O54A 4G1WA 3WF6A 5AIRA 4EHZA 2VDUE 1W0XC 4MD8E 4TRLA 4F86A 3D9VA 4XEYA 4A9YA 4PIMA 4CTKA 2IW9A 3D2IA 2ZIFA 2HY81 4YJQA 3JWJA 5HD4A 4AA4A 2GMXA 3A25A 3TRKA 2PUIA 2PULA 4FZDB 3HUBA 4EH5A 1N7JA 2ZBPA 3LX6A 3ZFXA 5JGDA 3FZOA 1OPLA 4BCPA 1LR4A 2P40A 5CNOA 4D5KA 4Z9LA 3MFRA 3OZTA 2VDWA 3DOUA 1JSXA 5AP5A 3H9OA 4FT2A 3UG1A 3PSCA 1ZQ9A 4YC3A 5CALA 4NK9A 3TKIA 3COMA 4EK8A 5H8BA 4CWAA 5IA2A 1IM8A 3FZPA 1Q0SA 4AXAA 3BBWA 2Y8OA 3HV6A 3D5XA 3EN9A 4OTHA 3VN9A 4AOJA 5KBQA 4O0WA 1XJ5A 3UGCA 1Q8TA 4L52A 2NXJA 2WTKC 2QLQA 3HRCA 5L8JA 3R9NA 4I5HA 3T8OA 2P3QA 1APME 1W98A 4TY1A 4CSVA 5CZIA 2PZPA 4IB3A 5DT4A 3CKWA 3EKKA 5DN3A 2PX2A 3ME5A 4ENXA 3KPUA 4C4AA 4CXAA 2ZM3A 4FIHA 4MK0A 4CT1A 4MHTA 3ZBXA 4IAFA 4BBMA 4O91A 2OY0A 3AG9A 1Y91A 2QVSE 3KQTA 5CSXA 5EI2A 1GY3A 2XKCA 3DBQA 5IQAA 5E9JA 2YCFA 1WBWA 5K0FA 3DLCA 1RQQA 2IVSA 2PVHA 1NVQA 3LMHA 3WZUA 4AOTA 2CMGA 3CBLA 2XBMA 2QOCA 2VTRA 4L7VA 5LWNA 3DZQA 1J1BA 4IB1A 4O7TA 4DG2E 3G2MA 4GFOA 2C6MA 4AZFA 3TZ8A 3HKOA 4M69B 2GPHA 2GNGA 1G55A 1FVTA 3P0MA 2UYQA 3B2TA 1H1PA 4PMMA 2GNHA 5GJFA 2ESRA 1ZWSA 4R5SA 3QZGA 3NDMA 3KXGA 4L44A 3TV7A 2G15A 2QI8A 5DWRA 2GLUA 4WHZA 3IECA 1G3NA 3SG9A 4GVAA 4MVFA 5LVOA 2BR3A 2XK6A 3NNXA 4M68A 3O71A 4GKIA 2UYOA 3DQXA 4F1OA 1ZGAA 4TYHB 4XG3A 1SG9A 2GSFA 5FA8A 3R7UA 2G71A 2B4SB 2OJFE 3QUPA 4AA0A 4FNWA 2HIWA 5AP1A 3R9DA 1TW2A 3ALOA 5DI1A 3OU2A 5E1OA 5DHJA 5J5SA 5M09A 4OQDA 5AAEA 4G3GA 1H27A 1AQ1A 3UOLA 5H8EA 1CM8A 3SXSA 3KU2A 3UO6A 4C02A 2XYRA 3RODA 2CN8A 2EJUA 4N6YA 1Z3CA 2C3KA 3A61A 4B7TA 4DGNA 2BAJA 5LQJA 2W1IA 3QA8A 2CJMA 2YERA 4BB4A 4BCQA 2JG3A 1NKVA 1OVEA 4II5A 2CMWA 2VTHA 10MHA 5AUXA 1NVRA 4XLVA 2H1RA 1ZOHA 2GNIA 5K0GA 3C4EA 4ZS0A 3EN5A 2J90A 3M6XA 1ORHA 3SXRA 1G60A 4YBKA 5A54A 1M2PA 1UU8A 3FPMA 4Z7GA 2GS6A 5H9BA 2JGZA 3ORXA 2AR0A 5P8WA 4J53A 2PWYA 3ZRKA 4FYOA 4USFA 2J9MA 1KV2A 1Y8YA 2PXCA 2B25A 4C3PA 1CSNA 4J98A 5EIWA 4EC9A 1H1WA 3R22A 4GT4A 2C6EA 4EYJA 4PYJA 3GI3A 3KXMA 4FICA 3FL4A 2BKZA 3UJCA 4CCBA 4K18A 2GHLA 5ICEA 1RJEA 4APCA 1T43A 4QOXA 4G56A 2JD5A 3HM2A 2VS1A 2ONLA 3VW6A 2WMUA 3OW3A 3MIYA 5FTOA 3KRXA 5AUTA 1IAHA 3KQ7A 4FKQA 4JX3A 4O0XA 3G9LX 3S3IA 3TL8A 4DN5A 3EQFA 4BY9E 3R24A 4XUFA 4GUAA 3C6MA 3A2CA 4J1RA 3G8AA 3JXWA 4M97A 4W4YA 3VHEA 2BKKA 1NW7A 4R77A 4BCIA 1YVJA 5IA1A 1U4DA 2GCDA 4LUDA 4YJUA 3BEGA 4F9CA 5CSPA 5IQFA 3EMDA 5DTQA 4FK6A 2ZJWA 3VS3A 1JTFA 2VO7A 5AM7A 3KF7A 3UJGA 1X1AA 3REPA 2QR8A 4IAAA 3KKZA 3LFNA 2XNEA 4RX1A 3PZEA 4O2PA 3CLYA 2ZMCA 4FTIA 5KMNA 1XBAA 1BLXA 5DX8A 3E64A 2JIUA 4KNBA 3BGPA 4L01A 3RAWA 3UQFA 3HP5A 1NBHA 4DCMA 3GCPA 3QZHA 3THBA 3ORTA 3EGVA 3D7TA 3FPQA 4BTMA 3CGOA 3MH3A 5AA9A 3ANQA 1H1RA 4ZTNA 3R7OA 2E5WA 2OJJA 5M53A 3OROA 3LM0A 2IWIA 1BMKA 1XWSA 3PG3A 4UXLA 4FEUA 2HY0A 3WE8A 4AF3A 4P5ZA 3DK7A 5IDPA 3MCTA 5HE1A 2ONLC 3EEOA 4H1JA 4BTKA 3V8TA 5EQJB 4R3CA 2R3JA 1NBIA 1KPGA 1AGWA 4ZZNA 2JAVA 2BRMA 4BI0A 2WO6A 3Q87B 3F2RA 4KW7A 5FTWA 3EL8A 2X0GA 4YHJA 4E6QA 2AVDA 2ADMA 2QCSA 4F64A 5CVFA 4ZJVA 2IVTA 3F5UA 1Z5MA 3PLSA 4EH7A 5BUEA 2FK7A 1MQBA 3KPYA 5DTRA 3SSMA 3L8XA 1MQ4A 2BALA 4DEHA 2OW3A 1LPUA 4C2WA 4LQMA 3MVMA 5DSXA 1G8SA 2ZTHA 3OU7A 3VUMA 2IDKA 2AC3A 3VRYA 4DZRA 3CJFA 1PMVA 4FZVA 3VBYA 3UJ7A 4F7JA 1FGKA 4AA5A 1JSVA 1UU7A 2NP6A 3PTGA 1YHVA 4RC4A 3AC2A 2P3LA 2XK9A 3GP0A 2WZJA 4BICA 3FTEA 3AC5A 3EFLA 3EOCA 3PJ1A 2AOXA 1YRPA 3P23A 1B38A 1OL1A 3DMFA 4L3JA 4EOOA 5I5ZA 4JT3A 2I40A 5JFXA 3BWMA 3FMNA 3P7CA 3WIGA 1DAWA 2WFYA 2YZLA 5I0BA 2IBSA 2G8NA 2FO0A 4TYEA 3SRVB 4DG3E 4FR4A 3EYGA 3HCFA 5IA3A 2BHEA 4V05A 5CUQA 3VS6A 4RX5A 4E5BA 3TNPC 1QZZA 1M0EA 2PY6A 3QQFA 2HZIA 4KBCA 4YV0A 3C50A 4BHNA 2BZIB 3W33A 4FTLA 1I44A 2XNOA 1KPHA 1YOLA 4F6WA 2ITWA 5EW3A 3UJ8A 2QNJA 1MUOA 3GU5A 4C35A 3ZXZA 2YVLA 5HGIA 3G9NA 4ZSJA 4ASZA 3VC1A 4IANA 4ERWA 5K0LA 3SM3A 3DY7A 4ISCA 4QMXA 3E88A 3I0OA 2IPXA 4DFUA 3TCPA 4GH2A 3LE6A 4S30A 5JZNA 4OA5A 3COHA 3IDBA 5FG8A 1WVYA 2NP8A 4NJ3A 2HXQA 3UYSA 4DH5A 5A4LA 4NTTA 2ZV8A 3HP7A 2QU5A 1W84A 3AMAA 2VO6A 1LEZA 4Q5EA 5HIDA 4Y30A 5ETIA 1JNKA 5LVMA 1FMKA 2VX1A 3TZ7A 4DFLA 1BL6A 5DR2A 5LCKA 1DI8A 5FM3A 2GS9A 2VWWA 4N6ZA 1SVHA 4R6VA 4HZSA 3CVOA 1ZMUA 2R3RA 2C68A 3C0IA 1KP9A 1KXZA 2JFMA 4FSQA 2VNWA 1JTEA 5EYMA 4EOIA 5JQ8A 2YM4A 5L2WA 3DKFA 4WNMA 2UW0A 4ZAUA 4J71A 2GHGA 1UKHA 2OZAB 4FSRA 1KYZA 2IDJA 5IMXA 4IX5A 4JG6A 4EH8A 2P7IA 3KVXA 2CKOA 4ANSA 3UPZA 2WTVA 1KOBA 1YHWA 2PMLX 1ERKA 2OGVA 4O6LA 3QC4A 3LQ8A 4F7SA 4ZEGA 3DXZA 3D94A 5ANEA 5A46A 4J99A 4K77A 3PE1A 5EMKA 1P14A 3ZDUA 3RKBA 4QMWA 2IW8A 3W10A 2FSLX 5IUGA 3OUKA 2CMHA 1I09A 5HICA 3TR6A 2RG6A 4ITIA 4ER0A 4O84A 4B8MA 3V5JA 3DH0A 4QP3A 2C5XA 1ZLTA 5IH4A 5T6KA 3LCUA 2ITNA 5IISA 4NM7A 4LMUA 2ZV2A 4TN6A 2HNKA 2W05A 1MRVA 2QOFA 4KWPA 3EN4A 1Q62A 4QVGA 4WUNA 3N4UA 2CN5A 5FEQA 4LMNA 4BDCA 2EUFB 3QOXA 5LSAA 3GCSA 4DH1A 2ZZNA 3NCZA 4OW8A 2PJDA 1YXTA 4CTBA 2ZOQA 3JWGA 4R6WA 3R71A 5AX9A 2UW5A 3FZSA 2WQBA 1URWA 4BCFA 2UVZA 1DCTA 2OBFA 4AZSA 3RALA 3TDWA 4F9YA 3LBFA 4TWPA 4E8AA 4QP6A 3RCDA 1BI8A 3SDJA 1KE9A 5L2SA 3EFJA 4U5JA 1QYRA 2EFJA 4WG4A 3R8PA 4O2ZA 4IJ9A 4RWLA 3HAVA 2RFNA 3FY2A 4RFYA 2OZOA 2YCRA 4AGDA 5IEXA 1QPCA 3I7CA 5C9ZA 3NW7A 4I93A 3VBWA 4N0SA 1F0QA 3QD3A 4AAAA 4R8SA 5EVJA 2PXXA 1FQ1B 2YFXA 3Q53A 2Z7LA 3HX4A 1Z9XA 1BC5A 3BZ3A 2E2BA 4WKQA 1P5EA 5KMOA 5FDPA 1PMNA 3KRWA 4PL4A 4O96A 5T3QA 3LLTA 4C58A 3WF7A 4YO4A 5FXQA 2O06A 3HCCA 2XNNA 3C9WA 1QMZA 3O96A 4FE2A 1PXLA 5EI8A 3GC7A 1VEBA 4RVFA 5JFSA 2I0EA 5AMNA 5BVWA 4D28A 4FI1A 2BAKA 4AZVA 3BEAA 3FYDA 3KR9A 2CLXA 4IV0A 4FSDA 4GS6A 3OTUA 3C1XA 3TN8A 2X2MA 2W4OA 2JIVA 3F3ZA 4BDEA 2B3TA 4AW2A 3T3UA 4Q5HA 1FVRA 2C7OA 5GWXA 4WG5A 2HZ4A 4E30A 4I5PA 4QMUA 4HGZA 2R3PA 2O2UA 4X2NA 1VPTA 3UNJA 2E9PA 3THRA 2I9KA 4YZMA 4IZ7A 3A4OX 3TUBA 2OK1A 4E2XA 3TTIA 2OXYA 5IH5A 2W1CA 2NNWB 1UWHA 4GYIA 4O7WA 4U9AA 4UZHA 5BMSA 2QHNA 3QRJA 2UW3A 3FY0A 4ACGA 3FZRA 5KMJA 2F9GA 2R9SA 4I4EA 4K1BA 4DA5A 3G5LA 3OPNA 5CQUA 3PIZA 1OBDA 3QKKA 2PE2A 3TKHA 4BIDA 4BP3A 2PE0A 2WOUA 3SAYA 2OFVA 5TKDA 4GT3A 2EWAA 2WGJA 3ZO2A 2HR1A 4EI4A 3NNVA 3QHRA 4QMOA 1HCKA 3SHEA 3SOCA 2Y1XA 3VIDA 1OIYA 2HAKA 3MA6A 4FTTA 3I64A 2EVAA 3GC8A 3T7TA 4I4FA 3UFBA 1MRYA 3MS9A 5CT7A 4EL9A 3EQIA 4D1SA 4E5WA 4YJTA 2Z8CA 3D15A 4GV1A 4AUKA 5DRDA 4OX9Y 5J95A 3DAEA 4IAZA 2OKRA 2C0IA 4RBLA 3MY5A 2J0LA 3QXPA 4PCAA 1CMKE 2HZ0A 2WA1A 4MD7E 4AX8A 3FYCA 4UBAA 5H3QA 4HYIA 2V5QA 5ICFA 3QCYA 2XJ0A 2YUIA 2QOBA 3TM0A 4L9IA 1GAGA 1ZYDA 5L2IA 3P8ZA 4XUEA 4QTAA 3LGAA 4I41A 3ZUVA 4GJ3A 5CU0A 4G6NA 3EKNA 4KRDA 4S34A 2UZ4A 3DLZA 3DPKA 1UVRA 4BZNA 5HO7A 3NUPA 3KC3A 5ANKA 4QNYA 3KHKA 3T7RA 2YM5A 4RVGA 5HIEA 3VS2A 4PP9A 3H0YA 3UC4A 4AU8A 4XV1A 4IM2A 3ACKA 3CQWA 3H0ZA 3NZ0A 3SOAA 4ALWA 3IOKA 4EK3A 5A9UA 2JHAA 4WBBB 5CEIA 1OUKA 3O23A 4GF5A 1Q8UA 5HE3A 4LFIA 4I0TA 4IMYA 2CGXA 5LR6A 2DULA 4F4PA 1E1XA 4O7YA 4Z7HA 3U6IA 3P2KA 1ZMWA 2B9IA 1VYZA 3AXWA 3MVHA 2JJQA 4XYFA 4TZRA 3RK5A 3QQGA 4L43A 2OIQA 5IG1A 4HTFB 2C6IA 2CGUA 3IG7A 4FP9A 9MHTA 5D1HA 2X7OA 3OS3A 3R04A 3ELDA 1Y8GA 4EH3A 3IW5A 4O27B 1G38A 3MJ2A 2ITQA 4I6BA 4C4IA 5T68A 1A9UA 4MWZA 3BQRA 4AT5A 3W2QA 5GIOE 5K03A 4I24A 5DPVA 4AP7A 4BYJA 1W7HA 3KQYA 4MF1A 4YNOA 1WMKA 2DQ7X 4O6EA 3IONA 4QPNA 3D83A 4KS7A 2B9HA 5EEGA 3SXJA 2ZFUA 4UEUA 5E8XA 1WVWA 3FMEA 4YSMA 2VTLA 2VTSA 2J0MB 2HCKA 4LOOA 1YI6A 1YHSA 2XP2A 3L9NA 3QWKA 3UZPA 3BYMA 5FWDA 1SMHA 4RJ4A 3KMUA 5L8LA 5M51A 2QONA 2WTWA 1V0OA 4H3BA 2ONYA 4EK9A 4AN2A 2YR0A 4OTDA 4QQ5A 3MTIA 3O8UA 1H26A 5J1WA 1UKIA 2IN6A 3QD4A 1IAJA 4P7EA 2YIQA 4C38A 4H58A 4EBWA 3QUDA 3VBTA 3EQGA 3OVVA 3EQCA 4MXCA 3ALNA 3IPHA 5J87A 4CZTA 1YKRA 3EZVA 3KMWA 4X21A 5E2AA 5HILA 2BRHA 3LZBA 3U4UA 3ZBFA 5BVKA 5AUUA 4F85A 4IADA 1QL6A 3UJDA 3PJ8A 5CQWA 1H1QA 4MWHA 4BTFA 1JKTA 4J8NA 4EJ7A 2RFEA 4XCUA 3UPXA 3UTOA 2B9EA 5HU9A 3UYTA 4FT3A 3CJTA 2RL5A 5C1QB 1OR8A 2NXNA 4KRGA 3E7PA 4EMSA 1ZG3A 4V04A 4FKRA 4X41A 2WHBA 3E92A 4QYFA 1WBVA 4DGGA 5JFVA 5M44A 3AQVA 4BDIA 2CKDA 4O81A 2YJSA 4FK3A 3TNWA 1PJZA 5HNIX 1SQFA 1J3HA 4O21A 4PYNA 5K0BA 3UIMA 1OL7A 5GJGA 2VTQA 4P7JA 1XBCA 3BKBA 4LM5A 3BGVA 3ELWA 4O7RA 2CKQA 2W5AA 4ZTHA 1PXMA 2JDTA 3EQHA 5FM2A 3WF8A 4C3FA 3FJQE 3ZH8A 5DBXA 4CTCA 4PRJA 2DWBA 4AT4A 4CFUA 4JBOA 2JITA 1KPIA 3FUUA 4GG7A 4BI1A 3WF5A 3O8TA 3G33A 1PXKA 3QUEA 4HNIA 2R3FA 3PP0A 3A7DA 3PE2A 4WD5A 3MERA 4TWOA 5DR9A 3NWEA 3C4ZA 3SW7A 3QCXA 3R9XB 5AUZA 4IC7A 2PSSA 4BDGA 4YZNA 3O31A 3NNWA 4XOYA 2HV9A 2XNMA 4UYNA 2C6DA 3MH2A 5JFWA 3FPHA 3A62A 1TVOA 3MYGA 3NUSA 4U80A 3R8MA 4FKVA 4F0GA 4KIPA 4QMNA 5M4UA 5DTMA 3KPVA 3UC3A 4E32A 3DJ7A 3C4FA 5EIFA 5AP0A 1Q8YA 3RWPA 2O0LA 2V74B 5GM2A 1EJ0A 3SV0A 1YWVA 3E3PA 4KB8A 2YIWA 5HQ0A 3REOA 3POZA 3MDYA 4LV5A 4EORA 3G51A 3OF0A 1H08A 3F3UA 1FVVA 4CZUA 4FZAB 4BTJA 4CFMA 4EZ7A 3D2LA 3OFKA 4P7GA 3NW5A 4OBXA 1TPYA 3D5WA 3UO4A 3HMIA 5EEHA 2C6LA 1WBSA 2B1PA 2WMTA 3I0QA 3I79A 4PTEA 3LW0A 5H02A 4I0RA 2RGPA 3P08A 4O0UA 4YP8A 3RAKA 2XVMA 4F65A 2H34A 5CVUA 3C0KA 3C5UA 3DNDA 2UUEA 4IZAA 3VUIA 3A4PA 4BLVA 5CCBA 1KUTA 3C4XA 3DTCA 3G6HA 2XYVA 3GGDA 5ERGB 3SSOA 4HYSA 4YUXA 3CQEA 2V0DA 3KREA 4GCJA 3MA3A 1JOWB 3RVGA 2PVMA 4DTBA 3ROYA 4AE9A 4BKJA 3RW9A 2BIKB 3UQGA 1H4LA 3HA5A 2W1GA 3DXPA 4ORKA 2BAQA 2IG7A 3VS5A 5D41A 3OE5A 2OG8A 2UZWE 4AFJA 4E1ZA 4FG8A 3Q9WA 4BGHA 4ZY4A 3FI8A 3HV4A 2C4GA 1PJKA 2C3IB 4IDVA 3C3YA 4QO9A 5EOVA 3LFCA 4QRCA 5KCVA 3NDIA 2X9EA 3FLNC 4DFBA 3KXNA 3ITZA 2Y0AA 1GIJA 1VR2A 3IGOA 2DUVA 5FQNA 2FGIA 3DGKA 2PY3A 2GNFA 5CX9A 5D11A 4WRSA 4XG2A 3OWLA 4QTDA 5K3YA 5KZIA 3Q52A 4E93A 3NJRA 4RTMA 2O65A 3GQLA 4C4FA 3MB6A 2XK8A 3OT3A 4JG7A 3DJ5A 1U54A 3GJYA 3GRRA 3HVIA 3K6RA 2YDIA 3EQPA 1H01A 3PPZA 5IUHA 4RTOA 4IEBA 4JDKA 4RSRA 5E91A 3KXXA 4FS8A 4CQEA 2G1PA 4RVHA 4FIEA 4RWZA 2BRBA 1RJGA 2FSTX 3Q60A 4PDOA 4PYLA 2I1MA 3AD5A 3ET7A 5F20A 4ZSAA 1KWPA 3HCDA 3TPZA 4DCAA 4EOLA 3RTPA 2XEYA 3MGYA 4XRLA 5DM1A 3FHRA 1WBTA 3DU8A 2B9FA 1RI4A 4GBED 2Z6AA 3VRZA 4EHGA 4UN0C 3BGIA 4B17A 3WZEA 3WYXA 1JKKA 2B9JA 4JR7A 3HCAA 4ZTLA 5EOLA 4FODA 5EKNA 2RF9A 2PZYA 3FSFA 3ZSIA 3KQVA 5K01A 2ZSUA 4GEOA 1ZOEA 3ZEPA 4JL9A 2LAVA 3ZO3A 1JSZA 2QOLA 4EKGA 1YB2A 3OEFX 3GCQA 1ZHFA 5HLWA 4BBFA 3JWHA 4IM3A 3CPCA 4P2KA 4MHAA 3SX0A 1P4OA 3A8WA 2AN3A 5AAGA 3JUHA 3BKXA 4C7TA 2Z7QA 5EW8A 4RV9A 2WXVA 2YHVA 4M84A 1XKKA 3Q2MA 4FKUA 3W18A 2JHPA 4DG0E 1VP9A 4QMSA 3KFAA 2C1AA 4PDYA 4JXFA 5DT0A 4EQUA 3T9TA 4O22A 2EX4A 4G9CA 4O7SA 3FI2A 4OBQA 1YWNA 4PGGA 2JBPA 4NWMA 4Y5QA 3VNTA 3NIZA 3FV8A 4X7QA 3ZO1A 2OZVA 4YSJA 3VQHA 5CVHA 3FBVA 4KIFA 5CVVA 4ZTBA 2G9XA 1R1WA 2BDWA 1AV6A 1YOJA 4A6DA 2VRXA 1SYKA 3SVVA 1KIAA 5FUBA 3MFSA 3FLQA 4ITHA 3Q04A 4R05A 2WMQA 4FOBA 4IVAA 3IW6A 1OL2A 1CKPA 1WFCA 4QP7A 4DLIA 5ANJA 4B6LA 3HECA 4WA9A 1VP3A 2I6LA 4BRXA 3SRVA 4E73A 3I6UA 4EKKA 2B54A 3ATTA 5EMLA 3E8CA 2PVLA 2GH1A 3HLLA 1OUYA 4B99A 1UA2A 2A0CX 4IAIA 3OEZA 2AOTA 3OCBA 1M6YA 2GNLA 3EQBA 3SG8A 1XH5A 3EHAA 2QRVB 4GC9A 3BHVA 3GO4A 2QO9A 1Q41A 2HWPA 1EG2A 3UA4A 4UOEA 3EN6A 4IVCA 4LRMA 3KQPA 2CWWA 4YMJA 3ZS5A 1PMUA 3RCJA 4C3RA 3PA3A 4DGLC 3PFGA 3LIJA 3FLYA 3QTUA 5IU2A 4WXHA 1U5RA 2H8HA 2ITTA 3NRMA 2YM6A 2OJIA 2VGOA 1OIRA 2OICA 2AYPA 3A8XA 3GNLA 2R7IA 1L8TA 4IB5A 1X8BA 2B55A 3QQUA 5D7VA 3CD8A 3HRFA 3PPKA 4FR0A 3TM4A 3K5VA 4DYMA 5M06A 5LQKA 3QZFA 5HCZA 3W2CA 4DH8A 2ZVJA 2BVAA 3FKOA 4AE6A 3HAMA 3O50A 4M8TA 5KHWA 1NW8A 4E26A 2OB2A 4TT7A 5IPJA 2YWVA 5EQEA 3O4FA 4KDCA 5T67A 3BLQA 4OT5A 3CP9A 4Q2AA 1JVPP 3N9XA 1JAMA 1YZHA 1J7IA 2ZWAA 5CANA 4RC3A 3ID6C 4B0GA 5HZNA 3LCCA 3MHTA 4L3LA 4KDRA 8MHTA 3ORKA 4POOA 3TUDA 3PFQA 4D0XA 3E3BX 4PMTA 2XK4A 3WI6A 5FXSA 4QMQA 2FA2A 2VTNA 4G31A 2OI4X 3FMMA 4ALVA 5FXRA 4WSYA 3B7PA 1JQHA 2BZGA 4C2VA 5HG9A 4JX7A 1WZYA 5BW4A 3UMWA 3BGZA 4JQ7A 4KINA 4MXOA 2A4LA 3OZ6A 4RWJA 3UZUA 1OBGA 1JG1A 4DH7A 5L2TA 5G02A 1BX6A 1YDRE 4ANLA 4M13A 3SW4A 4PTCA 1JWHA 4I23A 4EK6A 2YXDA 3PVGA 3PIYA 4F7LA 2GU8A 4M37A 3ZHPC 5M08A 2IFTA 3H9FA 2WMBA 4YJNA 3BGDA 4RTQA 5KMIA 3GGFA 1A06A 2F57A 2ZDUA 3LFDA 2XIKA 2W0JA 3EQDA 3NGAA 3Q9XA 4GK2A 5HIBA 3TG1A 4EK4A 3U81A 3OCSA 3S0OA 4FV4A 3CY2A 1ZYSA 5EDQA 3EN7A 2ESMA 2DS1A 3PY1A 4NH1A 4OGRA 3HL7A 4ZIMA 4EH6A 5K5XA 4YJPA 1URCA 2ZBQA 5AWMA 4H0NA 3H2BA 5HTCA 4R1YA 1REJA 3PPJA 3FUTA 2XCHA 4DLJA 3NIEA 2PUNA 4O7NA 2Z02A 4L3PA 1FP2A 2WOTA 4Y95A 4PV0A 5IF1A 3BLHA 4X1OA 3CQUA 3UP7A 5E8WA 5AV2A 5I9WA 5AADA 5JMSA 5AV4A 5CIYA 3AGMA 5EKUA 3KULB 3DKCA 4AZEA 1W8CA 4UV0A 2XYQA 3F5XA 3LQ3A 5AM6A 4F7NA 1NXKA 3NYVA 3NS9A 5DEWA 2OXXA 4NM0A 4NIFB 4BDFA 1GZOA 4C61A 4JIAA 3UO5A 5KKRC 5LQNA 5IA4A 2XJ1A 3ZU7A 3M6UA 2Y6MA 3P78A 3E8DA 1UNGA 4UWCA 4MNEA 5BVNA 3ZM9A 4EONA 3TDVA 4AGCA 2GAFA 4V0GA 3DV3A 4QPAA 3Q9YA 2XYUA 4YTFA 3EYHA 3M6WA 4D4VA 3COIA 4HTFA 2CGVA 3ZEWA 4MTLA 4QP8A 4JI9A 2HXLA 4X63A 5ANGA 4BGGA 1OGUA 4ZTMA 4ER7A 2VO0A 2PXAA 3TJDA 1F3MC 2BZHB 4IZ5A 3OTVA 3VS7A 4U43A 4DEDA 4EWQA 1FMOE 2XJ2A 5CAPA 4Y8DA 3EPPA 3FPFA 2R3SA 1WBOA 4DINA 4BCJA 1GJOA 5AAFA 2CNQA 2WU6A 2OZAA 4RIWA 4IE9A 4MQ1A 2CCIA 4O7VA 3SKCA 1OKWA 3ERKA 3KVWA 2WNTA 4CD0A 5HHWA 3BWJA 3CGFA 4FVRA 2H00A 4XG8A 4A9TA 4U7PB 4HVSA 3O7LB 4RIWB 3TWJA 2IP2A 3P9KA 4M7RA 1Q4LA 3H3CA 2PUUA 3R8ZA 4YZDA 3EVAA 4BZOA 3Q2JA 3VW8A 3DFAA 1IY9A 4NYEA 2BPMA 2OJ9A 3LXLA 3RWQA 4NSTA 3MJ1A 4Q9SA 4X2JA 3K3IA 3LCKA 3F2AA 3F6XA 4FKSA 3H4JA 2FSMX 2UZVA 4DEAA 3W1FA 4PGHA 2PX8A 3B8QA 4FYNA 3GXOA 2PKWA 2PWPA 4YUVA 5LQFA 3OC1A 2A27A 3PG1A 5D9HA 3PLAE 5HVYA 5EHGA 5EMJA 5K4JA 3BHUA 3WBLA 4G5JA 4FKGA 4K11A 5EOBA 2Z7SA 3MIAA 3BYSA 4EZ5A 3NCGA 1PF8A 4DEEA 2Y6OA 4MBJA 3LM5A 3EVZA 5CF6A 3LDUA 3I81A 1G5SA 1RI3A 3K3JA 3HV7A 3HVCA 3BLRA 4YZ9A 1VZOA 2W06A 1PY5A 4PTGA 4GMYA 3Q9ZA 5BYLA 4BYIA 4YMGA 2VV9A 3F5GA 3R9HA 3HTXA 4UZDA 1ZYJA 3HYHA 2OIBA 3R8UA 2WQNA 1KE8A 3A99A 4GU6A 5GNKA 1LEWA 2YISA 4YC8A 3PP1A 4FKWA 3RHXA 3U6HA 5E90A 5FULA 3OWPA 4I5MA 5CS6A 2BHHA 4XBUA 5ETAA 5BVFA 3MFTA 5JGAA 4FMQA 4FEQA 5FTGA 2RFDA 1VIDA 3EVCA 3F61A 3M33A 1D2HA 2X8EA 4MXXA 2BCJA 4LYNA 4J95A 4D4RA 1X1CA 2VTPA 3JS2A 4GKHA 3F69A 1XCLA 2XMYA 5HG8A 2OB1A 2HELA 3GRUA 3AWIA 4X3FA 5HLNA 5JK3A 2AOTB 3DMGA 4F6UA 3LCTA 5CEPA 4KABA 3UODA 1YXVA 1Y6BA 5JT2A 1SKMA 4KUJA 3FXWA 4XJ0A 3TM5A 4HCVA 3TZ9A 4C0TA 3CGGA 3CKKA 5KVAA 4E20A 1DM2A 3G2FA 3R1YA 4RVLA 4R78A 3DXNA 1WVXA 4M0ZA 3OFJA 1Q8WA 2G1TA 4QMVA 2LGCA 2ITXA 4IIRA 3JPVA 4IWDA 5J9YA 2PMIA 1YDSE 3VBQA 4FIIA 3ZTXA 4DGMA 3Q5ZA 4EEVA 5KUPA 1O6LA 3LECA 3CR0A 3VJOA 2ERKA 5K4IA 5ACBC 2WMWA 4LG1A 5EZSA 2C0TA 4E2ZA 3QRUA 3BU3A 1MHTA 4QMLA 2ZMDA 3W8QA 5IQBA 2PVNA 4F1MA 5EPEA 3TKYA 3QLGA 4C07A 2H96A 4TW9A 2VNYA 2BDJA 3I58A 3VYWA 1R8XA 3QD2B 3NW6A 2WIHA 4HCTA 4AFEA 3UQCA 4FSNA 4XV9A 2ITZA 2PMOX 3P4KA 2VGPA 1NV9A 2UZDA 1U54B 4O0YA 4E4NA 4AW0A 3F4KA 3OBGA 5DOSA 3QC9A 1JQDA 3C0HA 4AW1A 4ZY5A 3KB7A 5HX6A 5GIPE 4IX3A 4LL0A 1KR5A 2VO3A 2YDJA 3AT2A 3LFBA 3SC1A 5I4NA 1I4WA 5F2NA 5B7VA 4RTKA 4HYUA 2IH2A 3FTFA 4C4JA 3LFSA 4GL9A 3MPAA 2PTKA 3VUDA 2P41A 2JH9A 3OT8A 1TW3A 5FBNC 2GHMA 2G2IA 4FSYA 4L46A 5CENA 3ZZWA 4YHTA 3MN3A 4E5AX 5LQUA 4RVMA 4TKSA 3V01A 3DXYA 3PY3A 4C59A 4RT7A 4XX9A 2OH0E 4X0MA 3G7UA 3CJRA 3E93A 4X3FC 5BYZA 5KMKA 5KQRA 5CD1A 5DPMA 2QOIA 5G1XA 1UIRA 2W7XA 3KEXA 3CTQA 2UZBA 3VHKA 5HKMA 3GC0A 5JKGA 3BUSA 2X2LA 4FV7A 4YUZA 3DUWA 1VLMA 5IQEA 3O8PA 1YQJA 2B7AA 1JKSA 3FLZA 4PY1A 4LGGA 1Y8CA 1SVEA 4AZWA 5CI6A 4UXQA 5CWZA 3QGWA 3ZRLA 1J91A 4RVTA 4CMTA 5AV3A 3CEKA 5ACKA 3PTAA 4XP3A 2CL5A 1UNLA 1AF7A 4IC8A 5EYCA 3ZLSA 4YLLA 5JRQA 5K9IA 5HX8A 4PDSA 1H8FA 1GIHA 4DGOA 1L3BA 1O9HA 4EH4A 1OM1A 3A7FA 4FKOA 3FZGA 4EOQA 2P35A 2ZM4A 2UZOA 2YXLA 5AV0A 4FTQA 3G2QA 2Y4IC 1XO2B 4G16A 1RI5A 3L8DA 5AP4A 1SVUA 3G5TA 3ZXTA 3SX9A 3V04A 3OWJA 5DLSA 3UBDA 2UZTA 4R6XA 4P7FA 3FKNA 4CXMA 4HGSA 2P0CA 3A7HA 4KBAA 1WXWA 2VD5A 3QWJA 2Z6QA 3DXXA 3QALE 3NWBA 2ZW9A 1YUBA 5ITAA 1JKLA 3G89A 1OKYA 4O7ZA 2X7FA 3UOKA 4CFFA 1JQEA 4M15A 4MBLA 1P1CA 3UVQA 2EU9A 3QQKA 3WARA 4DEGA 4ZTRA 4BDDA 5KO1A 2O07A 2C0OA 4F9WA 2AS0A 3FTCA 5E8JA 2UW8A 3COKA 3SSNA 4B9DA 4FT9A 1SNUA 3LMIA 1Z57A 4O0SA 3OY1A 4AGWA 4BC6A 2JDOA 2QRVA 4WRGA 4U97A 1EH4A 1DS5A 1KE7A 3JY0A 3R02A 4I6HA 3A60A 4J52A 4AGUA 5IQCA 3F2NA 1EQAA 4FTMA 4FGRA 4QMYA 2IZUA 3ROCA 4I5CA 4Z55A 3MV5A 2UW7A 3GNIB 4OTWA 4FV5A 4CKBA 2NXEA 5DFPA 4D4YA 4EC8A 3P71T 4RTPA 4RTSA 4F1TA 3GRYA 5TOZA 1FGIA 4MXYA 4DBNA 3U6JA 2HK5A 3D14A 2YIXA 3PJCA 4BCMA 2RFSA 4CG8A 3HA3A 3PWYA 3I5UA 3UJBA 1FJXA 3BPRA 3R6XA 5GP1A 3KR2A 2C7PA 3BYVA 1SQGA 1VL5A 4BI2A 3LHDA 2ZV9A 4FSUA 4LG4A 2Y9QA 3UIBA 4BDJA 5LMKC 4BGQA 4E6CA 2OXDA 5AIKA 3PZHA 2B53A 4IJPA 2UW9A 3FTDA 3OCTA 4FV9A 4JR3A 2WMXA 4F63A 1TQMA 5CT0A 4KIOA 4FV3A 2FB8A 2ERCA 4Z3VA 2OF2A 4O0TA 3PXKA 5EHLA 4WBOA 3NYNA 4W4XA 4ASXA 2F7ZE 4OTGA 2XUUA 4M0YA 3S95A 1L3RE 1QPDA 3ZM4A 3FE3A 4G34A 1BUHA 3E8EA 5CF8A 4BBEA 4RIOA 3KN5A 4D9UA 3BZBA 5A4CA 5K0JA 5DRTA 3CBGA 1IR3A 3DS6A 1X1BA 3U51A 3GWZA 3UJ6A 4JG8A 3EEYA 2QG5A 4MEDA 3GOPA 4NW6A 4D2RA 2CPKE 3AXTA 2PE1A 4CFNA 1O6YA 1ZY5A 2OJGA 2QC6A 4FSMA 4JS8A 4XG6A 3ZFYA 4ZLZA 5J1VA 3DB8A 5EM8A 3N4TA 4Y72A 1KV1A 4HGEA 3HMOA 3ORZA 4GT5A 4S2ZA 3TNIA 5DX0A 5HIMA 3D7TB 3CC6A 3HA8A 4S32A 4ZTSA 5L6OA 2XRUA 1RE8A 4FA2A 2GS7A 2R6ZA 2HW7A 3FC1X 4QQCA 3MY0A 3ZDIA 1UWJA 2CKPA 4MNFA 1JR4A 3KQWA 2ETKA 3RPVA 3P9CA 5F9EA 1Q97A 1UU9A 4S31A 1O9GA 4UYAA 4RFMA 3TNQB 4PYIA 5ICPA 1WS6A 4CKEA 3DBEA 5MHTA 3FQHA 4D5HA 2CLQA 2REIA 2XNBA 5CNNA 2AOUA 4IAKA 4FV8A 4BDAA 4CKIA 3I5NA 2E9VA 4FKIA 2XKDA 4FKTA 3G0EA 4KSPA 1L1EA 3NSZA 5AP2A 4ANMA 1PXNA 3BU5A 4CLIA 2QE6A 5FP5A 3GCZA 3SVZA 3FSKA 4XG9A 2X6EA 2XRWA 4RIXA 3GOKA 3R3HA 3MGGA 4YUQA 2CHLA 3QL8A 5EQPA 3RPYA 4TL0A 3PX3A 4IB0A 1WXXA 3KR0A 2V7EA 3KRLA 4GFGA 4JXJA 4RYLA 4IWOA 4RIXB 3TZMA 3ANXA 4HCUA 4XNEA 4K6MA 4L45A 4AZTA 4GEKA 4IV8A 3CXWA 2Z2WA 4OBPA 4JBVA 1SUSA 2C1BA 5LQRA 3KXHA 1V39A 3FLWA 2P7HA 2I0YA 4YJVA 1M7QA 1G8AA 1I1NA 3QOWA 5HZMA 5ICGA 5EM7A 3ORHA 1VYWA 3NEWA 1YW2A 3O51A 3KU1A 3FKLA 3QFVA 4JDHA 5GOZA 3EL7A 4FVPA 4IVBA 4ZSLA 2X4ZA 5F1ZA 3EWHA 2UZUE 1PXJA 2P4IA 4LI5A 4XH6A 5CU2A 2NRUA 3BWYA 4CEGA 4YV1A 2F49A 5JQ5A 3KMMA 5EW9A 3TEIA 1KE6A 1ATPE 4I1ZA 4RJ7A 1LP4A 4RMZA 4RSSA 3P7AA 4CV8A 1D2GA 3KULA 1R74A 1TKIA 4TYJA 5FQDC 3UJAA 3LDFA 2Y4PA 3ORPA 4IX4A 2BUJA 2I7QA 2GQSA 4KRCA 5EQYA 3TI1A 3HDMA 2IZTA 4DHFA 3BXOA 4Y2HA 2XEZA 5KNJA 2PT9A 1OI9A 1PRYA 1ZAOA 2CDZA 1BKYA 3RPRA 3UZTA 5C1IA 4JNWA 3BYOA 3RJCA 3LL7A 4X3FB 4YU2A 3IDCA 4GRBA 1AD5A 3MY1A 2R3NA 3NW9A 5DSTA 4TYGA 5KHXA 4FV6A 4CNHA 1J7UA 2C7QA 4RA5A 4LOPA 3WIKA 3VAPA 3P7BA 4U41A 3PXYA 1V0PA 3HVHA 4ACCA 4DT8A 2X8IA 2OSCA 3E62A 3MVJA 3Q4CA 3QQJA 2UZNA 4HVHA 4IACA 1M14A 2ITPA 4MQ2A 4G6LA 3ER8A 5CASA 2P3GX 5KX8A 3H30A 3II5A 3QX4A 2EG5A 3KPWA 4FGZA 4QYHA 1PKDA 5AEPA 1JBPE 4CG9A 5C01A 4FZ7A 3R30A 2JC6A 2IVVA 1JSUA 3F3VA 5B2KA 2W96B 4CFXA 1R00A 2YN8A 4X6RA 2W1ZA 4JBQA 2VWXA 4HC4A 3DKGA 4M3QA 4V01A 3UIXA 3VO3A 3CJQA 5EC8A 4YZCA 1IEPA 2WKMA 4QYEA 5CXHA 2Q41A 1K2PA 3N51A 4EYMA 1BI7A 3R21A 2NXCA 4XUDA 4EOSA 3DULA 2FYSA 1SM2A 1OB3A 2X81A 1OIUA 4RIYB 1JSTA 3NVKI 1V1KA 2VTAA 2Z7RA 4KAOA 3RPOA 4K2RA 4EHEA 5GINE 4E4XA 4RX7A 3KL8A 2PZIA 3GU7A 2GQRA 4L8MA 4RPVA 5FTQA 2BR4A 3OXZA 4HSGA 2PPQA 4AN9A 4MH7A 2UV2A 4ZZMA 4H05A 4OBOA 3RINA 2AUHA 2W1HA 4EQCA 3DQWA 2Q83A 5IEYA 1U2ZA 2PU8A 3GU8A 2ZYBA 4IWPA 3UZRA 4EZ3A 2I0HA 4K0YA 4ZMEA 5DH3A 4DT9A 1M52A 2C5NA 4LECA 3RIEA 4R7HA 4XOZA 3E63A 5AP7A 2PUPA 4X3JA 5IUIA 5JH6A 3TMAA 2G01A 2ITOA 1PXOA 3P9JA 4C06A 5TT7A 1SNXA 4A4LA 3H10A 2FCAA 3LMGA 3HZTA 4PWYA 3DFCB 3FDNA 3LSTA 4IVDA 3MAGA 2GTMA 3FPEA 3P97A 2CNVA 3QTSA 4FBXA 4F0IA 3X0DA 4TYIA 5CVJA 2G2FA 4FSZA 4HW7A 2YJRA 5HORA 3ZMMA 2X1NA 4FIGA 5CYIA 5HNGA 5JR3A 2IH4A 2PVJA 2XF0A 3NNUA 3QXOA 3GCUA 4FIFA 4O0RA 5CSWA 5E8YA 3DKOA 2I6GA 3KPJA 4DBXA 5CXZA 2B52A 5CAUA 1N2XA 2AOVA 2YX1A 4EUUA 3QU0A 5K5NA 1Q24A 3TIZA 1NY3A 3UVPA 1P1BA 2R7BA 4GQBA 1S9JA 5EDRA 2PT6A 2YZAA 1UU3A 3L8SA 4QMPA 4FG9A 3QCSA 3QQLA 5A14A 4PYMA 2ZDTA 3GUBA 4UWBA 4U45A 1XDZA 3LJ2A 5AUYA 4WVLA 2F2UA 2XZSA 4I0SA 5AUVA 4F09A 5JEBA 3SXFA 1G6Q1 1OITA 1HOWA 3ZUUA 5L6PA 2PX4A 1QPEA 4I94A 2QO2A 3F88A 1QAMA 2FK8A 4G9RA 2XH5A 4ZOGA 3R7YA 1L3CA 3G2PA 3NAYA 1ZKDA 2XCKA 4G3CA 4TYHA 4H3QA 4O86A 5BUJA 3QYZA 4S33A 1RDQE 3E5AA 4NM5A 5LJJA 5LOHA 1UFKA 1V0BA 2ACXA 3SGLA 1YXSA 4E2WA 3NPCA 3R83A 3E05A 2JKMA 3DDPA 3LFAA 2WMAA 2UZLA 4I6QA 4RZVA 3VWAA 3F3WA 4X2KA 3O7WA 3OW4A 4W8DA 4AS0A 5B1SA 2XNPA 4CCUA 2V62A 2A1AB 2JKQA 5I9XA 1O6KA 3HDNA 4NCTA 4D1XA 4D55A 2JDRA 5KKRB 1ORIA 3DA6A 1RJFA 5F95A 3S00A 2QR7A 4ZJJA 4PIPA 1M7NA 2PVYA 4F9BA 4ACMA 3D0EA 4ACDA 2QD9A 5HEKA 4EQMA 5E9WA 3DB6A 5KBRA 4QVKA 3TTJA 2WTJA 1BKXA 3A7GA 4KS8A 4GIIA 3V5TA 3FUPA 1DI9A 3ANRA 3D5VA 3PRIA 3IYLW 3ULZA 4X2FA 3A27A 3LFEA 4O7LA 1B6CB 3MB7A 5FGKA 1KE5A 4XV2A 3IW4A 4BR3A 3AMYA 3GU4A 5CVGA 3U4WA 4ZMFA 4U8ZA 3GRZA 4L6QA 4ARKA 4XP2A 3CCNA 2C5VA 4WNKA 1DAYA 4RTLA 4KKEA 1XTPA 1OIQA 3ORNA 2R0IA 4AACA 4BCKA 1F3LA 2GPYA 2IBTA 4RLLA 4RRVA 3QKLA 5IDNA 3R1NA 5DM2A 3ZZEA 4JRNA 2IW6A 3FC2A 1XR1A 2WAJA 3S4QA 3DBFA 3SA0A 3WZJA 5DYJA 2G2HA 4APPA 1B39A 1UWVA 1T45A 4GC5A 4PNIA 5K0EA 4FT7A 4JRVA 3VUKA 2IVUA 4C05A 5EFQA 5DXJA 2XNGA 4YO6A 4E31A 1YFJA 3C3PA 1KSWA 4E4LA 3IK3A 3I6WA 3K0BA 4M36A 4WO5A 4XHKB 1OZ1A 4FZ6A 3QTXA 3EFKA 2X8DA 4G2FA 3S1HA 1NV8A 2BM9A 5EG3A 2VDVE 4WUAA 3OBJA 3NUUA 3WILA 1AQIA 2X39A 4F84A 1IG1A 2JKKA 2IZRA 4KIQA 5CLPA 3UE4A 3NR9A 3PT9A 5EKXA 1JPAA 2BFXA 3CKXA 3I60A 4BCOA 4X60A 4MBIA 2GS2A 5IMEA 3MESA 4A9SA 3GB2A 5C8MA 4IW0A 1OL6A 2CGWA 5A4TA 3DAKA 1EAMA 1T46A 1FP1D 2E9UA 2WTIA 3D4QA 5HG5A 3FMKA 5BVOA 1RJBA 4WNPA 2F8LA 3UA3A 1K3AA 4DQ0A 4BDHA 3GU3A 4USDA 2PYWA 4I92A 3K2LA 2W4KA 3PY0A 4O29A 3EMBA 3LCVB 3I7BA 2PVRA 4U3YA 4ONAA 2VTOA 5HCXA 1VE3A 2P1DA 4QPPA 5FCDA 4XBRA 4MQ4A 4DFXE 1P2AA 4NU1A 4YR8A 3O2MA 4LGHA 5CSVA 5E8RA 5AJQA 5ANOA 5C4KA 3HNRA 4DKJA 2R4BA 3FRHA 3HMNA 2XBAA 5EHIA 3FUXA 4I6FA 4RA4A 5TO8A 2O05A 4PWNA 2QQ7A 4K33A 1R18A 3NDJA 3R63A 2ERZE 2C6OA 2V55A 1XQZA 4QTBA 4BCNA 4LL5A 4L53A 3IDPA 3C6KA 5FD2A 4MXZA 4E7WA 2OYRA 5HNBA 4NM3A 2B2CA 3DR5A 4TWCA 5E1EA 4WIHA 2BZJA 4PNEA 4CFVA 5FADA 5DX1A 3QF9A 2PHKA 3KY2A 1RJDA 3G0FA 2XVAA 1Q3WA 4U79A 1QANA 1M2QA 3NWWA 1YOMA 1ZYCA 2IJMA 4O38A 3RAHA 4MXAA 5CAQA 2R3GA 5EI6A 3R1SA 2OXTA 2O3PA 5JZJA 5TR6A 2NO3A 5CF4A 4HJOA 5K05A 3H9RA 5LMKA 2BMCA 4ZZOA 3POOA 4BLWA 4JAIA 3HGKA 3C51A 4IM0A 3DP7A 4EH9A 3R2YA 5DWQA 3GQIA 5DT2A 3RGFA 2JIIA 3CY3A 1TQIA 2WPAA 3CE3A 4FSXA 3NUYA 3V5QA 4I20A 2P55A
chains in the Genus database with same CATH superfamily
3F67A 4RZXA 4J97A 3UJHA 2FWJA 4FTKA 2AMYA 4GKBA 4DBLC 3PUPA 3VJKA 3BD6A 4NJMB 4E5SA 3V5WA 4JQ8A 4FILA 3T61A 4JHXA 1ATIA 1XZPA 5C03A 2OFPA 3VKUA 4TV9F 1YVDA 1G59A 4BDKA 5DGTA 2IVFA 2EB3A 4WKCA 4R81A 4P32A 4F7DA 4RA9B 1ZBDA 1O97D 2NPOA 4RZUA 1C1YA 4DPLA 3PRYA 1CTPE 4IHPA 2C7BA 1R4NA 3U3ZA 1O87A 5I48A 1UBTS 4GKAA 4K9KA 5DT3A 3HUEA 1VLVA 2ZRKA 4EUKA 4W4TA 3QEOA 3CVYA 1E9DA 2YH2A 2XNKA 4DXDA 2A1TS 1GEEA 2ZUDA 3F8WA 3TVTA 1FRQA 1JDBC 5AJZA 1Q5KA 3E22B 1FMCA 3E6AA 4DLZA 1X7ZA 3LT4A 4A4DA 4DG8A 1D03A 3A4LA 3IPLA 1F2TA 1W4ZA 1JVBA 4ITUA 1GPWB 2QOHA 2ZYTX 1VI6A 1VJ1A 4LJ5A 4ESHA 3FI0A 4F9AA 1IWOA 4IPTA 3I8OA 3C15C 1ONOA 3W0QA 1YH3A 2H3EA 3ADKA 2D1SA 4MAOA 2QN2A 2ZPTX 4B3MB 2W99B 1SIBE 1E5DA 3MWUA 3EVTA 1YZ3A 2GYVA 3CLTC 2B0CA 3Q96A 3CRMA 3L18A 4Y9DA 4UBJA 5IC5A 3ODYX 5FTWA 2O3SA 1M1NA 2Q4BA 3CS9A 2CHVA 2A14A 3DLHA 4DE5A 4XV3A 3I5MA 5IDVA 4IGFA 5JH7A 3ZE7A 4REOA 3P9NA 4DTAA 1XPRA 2QTRA 4I1YA 3HCEA 4FHGA 2DH5A 1TL7C 3IP6A 2HW8A 3FAAA 2XUJA 4R9UC 2W71A 3LLAA 3JY9A 3QEBZ 3DO5A 4BIBA 2XIQA 1S02A 3PR1A 3GXLA 1RDFA 4WY8A 5EPOA 3WLTA 4U2FA 2NVOA 4LJ8A 5B7PA 4O5AA 1KRXA 3VS0A 5CA0B 3LAUA 1JG3A 3IOBA 3TLJA 2DECA 2ZKLA 4E1AA 2YITA 3IPXA 3TTSA 2HIGA 3WYCA 5FPSA 3IAXA 4RGJA 5ENZA 2VUWA 2J51A 2OZKA 4AN3A 4AOIA 4OFXA 3B3FA 1DMRA 5DLYA 4FKPA 3UQYS 3T1YB 4EA7A 5GHVA 2Q49A 3A6PC 3FB1A 4CUKA 2QTWB 5ANDA 5BWMA 3ZW8A 4FTUA 521PA 3U3OA 2YAAA 3O95A 3GCWA 2JFLA 1UJ4A 2P2LA 3EQ8A 3ZONA 4BJ6A 3BCHA 1J0XO 3RSLA 5H82A 4ZYVA 3KOOA 2Y4IB 5IC6A 3S29A 4QDZA 3W2HA 2QLUA 3WYBA 3BERA 3P2EA 4IEIA 4XVCA 2RK3A 4UHBA 3HJCA 1QP4A 4OTRA 3BTOA 3BI6A 1U0EA 1P4FA 4C37A 2I3AA 3HYRA 5KTPA 5H9WA 1LSSA 4OI1A 1VHTA 1F17A 3W5HA 3OCGA 3DTTA 1XBBA 5CB0A 4HNAB 2BIYA 2G83A 1DTWB 2YBDA 4BFZA 5I9ZA 4YRPA 4BQPA 3T52A 1NW5A 3ZZUA 1H25A 1WD5A 3P5KA 1GTRA 2FE1A 1LH0A 3FVQA 4ZTUB 4Y6PA 5AA8A 4E6DA 4RVNA 5LXMA 3PYLA 1BEUB 3S1AA 1YQ9A 5I7UA 3QLJA 3GMTA 2WF5A 5C9ZA 1CRZA 1JQJC 3HJFA 3QEMA 2CMDA 4A5SA 2H9VA 1XVAA 4FMDF 3AHEA 4MULA 3TKUA 2BILB 4GYKA 5DYNA 4ASDA 1YOVB 1GZKA 3SC4A 1EIWA 2I3ZA 4TXJA 1PYXA 2WWTA 4WJLA 3FMJA 3QV2A 3IMKA 1XNHA 2YJTD 3Q4ZA 2ORED 1M72A 2HJRA 3ESRA 4YRNA 3SYTA 4U7ZA 4Q4DA 4FTCA 3JQ7B 3VQTA 3QLFA 3WGMA 2QRLA 2P4EA 1YFLA 3JAWB 3WYYA 2G72A 4BNXA 3TUJC 2VK2A 3KB1A 1DZIA 3VV3A 5TGDA 2Q3MA 3W32A 2I22A 3RCBA 5AVRA 2HHAA 4UHJA 4C2BA 1QAQA 4FMBB 4UU8A 5CZHA 4LI0A 2VUUA 3CM0A 5DXAA 1OX6A 3SC2B 2Y68A 4OGWA 4F70A 1OKVA 3C4WA 2BZKB 2GJAA 4ZDKA 4BIMA 4JDJA 2YCLA 3ZC6A 1C3EA 2HMVA 2WELA 1F6BA 1BMQA 2GFCA 3Q3HA 3ERCA 4B1FA 1W85A 1FYVA 4ZREA 3EZGA 4ZEVA 3EHDA 1WP9A 3GY0A 2ZS8A 1OFVA 4ZOBA 3KTDA 1O03A 1ECPA 2VUHB 3CIKA 2R0QC 2CT8A 1FNMA 1IRKA 1SQSA 4LY9A 4M0KA 1I5RA 1PHKA 5EM6A 4DSTA 5INTA 5JJKA 1OPJA 3B5IA 4JBNA 4L42A 3N28A 1R78A 4GYGA 5DYIA 3MCZA 2Q07A 1U0HC 1GRQA 3THWB 3AT4A 1CFJA 3HS3A 4EOKA 4EFDA 3EC2A 3F7MA 5TQJA 4IQ6A 5BMOA 1GKLA 4GR5A 2YC2C 1IBCA 5H1YA 2PV7A 3L8FA 3BE9A 1KGDA 2I0VA 4D42A 3ZHXA 4OEHA 4RPHA 2K87A 4DF3A 2FV8A 2P6MA 4B83A 3FB4A 3CMCO 3CPSA 3BWBA 2GTNA 4WD3A 3QF7A 2F7EE 1GGKA 1B8NA 3LUJA 4URUR 3E18A 3GC9A 5DE3A 1O0BA 3E7FA 3LPBA 3TMYA 3G88A 4HPUE 2OU7A 4TTIA 5LUAA 4G1MB 2WYVA 2QYOA 1CKJA 3GFGA 5C80A 4A9YA 1IBKB 2PULA 4PZDA 2H18A 5CNOA 2WFMA 4P3YA 3H9OA 3UG1A 2JFQA 3LUPA 4W1SA 1ARZA 3VZQA 2QLQA 1W98A 2CSXA 3M5CA 3WQBA 3ZBXA 4PC2A 1G6HA 5CSXA 4Q7MB 2BF7A 4Q4AA 2QAGA 5CLLA 4YB8A 4S04A 4NPHA 3KSUA 3PJRA 2VTRA 3FFXA 2ZB2A 3FPKA 5LMZA 4HO1X 4RAOA 4XDHA 4P4LA 4R8KA 3KQNA 2ZUCA 2IUEA 3OIYA 2RH5A 4XG3A 3WMXA 1VBNA 5AP1A 4XWAA 2SNIE 3PLNA 2ZB4A 5ELXA 2GNIA 5BN3B 1OI3A 4F9EA 4QUIA 1M2PA 3KEFA 1LZKA 2BFDB 4NXNB 1TU0A 4KX5A 4JELA 5B1IA 3U4CA 4LC0A 5F7JA 1CYDA 4M1QA 4G56A 1J22A 1GVNB 3UKJA 1ZMXA 4UMDA 4MO2A 5BVGB 3KQ7A 4O0XA 2J30A 5JS8A 3C6MA 2YWRA 3JXWA 3D1LA 3CX4A 4F9CA 3WJ7A 4LUDA 4YJUA 3MUEA 2MMCA 3KF7A 3QFFA 2DHQA 2VDRB 3K6SB 3CLSC 4HAVA 1QYVA 5DX8A 2HMSA 3ORTA 1FUUA 2GYWA 3MH3A 1D1SA 4K1XA 4DJ5X 1WSDA 1E6CA 4WN3A 3MUNA 1T8SA 2IEGA 2LRHA 3H1GA 3MPUA 1CF4A 3AR4A 1HGXA 2J9GA 2RGXA 1VJRA 1MB3A 3K1YA 1PQ4A 3ZCPA 1C3XA 1K5HA 2JAXA 1V9SA 3C3EA 3L2OB 5LJLA 2IBSA 4S1PA 3C1AA 2ZRAA 3EYGA 4RX5A 4E5BA 3WP0A 3I5YA 3OUZA 1ZH2A 5C46F 4NCIA 1GAXA 4KMRA 4DLAA 3CA8A 4ISCA 2SHKA 5JZNA 5BRNA 2FW8A 2UV8A 4C4SA 3DPSA 1ZNWA 5HIDA 4E21A 1KY2A 3FPAA 4YFVA 3I0ZA 2DCUA 3WA6A 2B4AA 5F7ZA 2WHPA 3MT7A 3DHNA 4LOIA 4A8HA 5AW7A 5ESRA 3PE1A 5DHQA 3VU9A 3R74A 1U5BA 1YR9A 4L4RA 1AKVA 1B1CA 2W6QA 1OLUA 5HQ3A 1ZJWA 2HMAA 2PJDA 1MDFA 3JWGA 5CT5A 1A50B 4BNUA 3HO6A 4FEAA 4U5JA 2FSSA 4YRAA 2H1WA 1SOMA 2OFOA 4QAJA 1NHGA 3MTAA 4MHOA 3QD3A 1Z9XA 4ZVNA 3B38A 3NX4A 4PSDA 2AX4A 4ZHQA 1CUZA 5M7EA 1MH1A 4W5QA 4UASA 1YE3A 1ODFA 1TO2E 4GECA 3W8NA 4A8JB 2FSUA 1P0MA 4H1VA 3LT2A 4JQSA 2I9KA 3RS5A 4BVGA 2XD9A 2NNWB 1BU8A 2O8NA 4F3KA 2WQ7A 2UW3A 1J6UA 3SHOA 1IDN1 3RKUA 1IUOA 3PNYA 4N41A 1Z7WA 5DOZA 1AS3A 4J91A 5FXMA 3UFBA 5CMLA 5CT7A 2IDZA 4E5WA 4H6WA 1L6IA 3HG7A 1CMKE 4MD7E 3BD9A 3DQPA 5FUMA 1HT1E 3QCYA 2Y1EA 1GAGA 3W0OA 3RAFC 4GJ3A 4R2LA 2WIJA 2UZ4A 5DYYA 2H7CA 4XV1A 4ND1A 3SLGA 2JLXA 1J9ZA 3FCOA 5LR6A 1QZXA 4LXQA 4OBEA 1VYZA 1LPMA 3FD8A 4LX0A 4OD0A 1MVLA 4Q18A 2C20A 1VLQA 3N0TA 2X7OA 3OS3A 1MRSA 1SC3A 4XWWA 5DPVA 5JU6A 2WI8A 4QFDA 1EVZA 5ES3A 1IVSA 2HCKA 1T4CA 2I34A 2X0RA 3E9ZA 4RJ4A 4HLQB 1V0OA 3BJIC 4AN2A 4K03A 4QASA 4P7EA 3QUDA 5B58C 2RJNA 3EZVA 5AUUA 5CQWA 4BTFA 4KRGA 3THOA 3DFFA 5M44A 4UQPA 1J3HA 3C7KA 2CLFB 4BMPB 4P7JA 3BGVA 4O7RA 1MVNA 1P7VA 2Q4DA 3FUUA 3DLBA 1T2VA 4KQJA 1O95A 2POQX 2YJ5A 2OQ2A 1UJ5A 3THXB 4YRIA 1P33A 4UYNA 3P52A 4WY2A 4KIPA 4F7WA 5AP0A 5GM2A 5HQ0A 3KXDA 5D5HA 4LV5A 3EZ9A 3PA8A 4C3OB 2Q0SA 3PGJA 5JLJA 3GLTA 3KE8A 4KFSA 1TAGA 2X1LA 3MRXA 3DE6X 2UUEA 4GCJA 2YV3A 1ENOA 4FXPA 4IJ5A 1W29A 3UQGA 2O2ZA 3T5PA 2ZT8A 3FI8A 4KXVA 2C3IB 2VLBA 3DW3X 4LYEA 2J7PD 1B41A 4QZVA 4OAQA 3ITZA 3KKOA 2GNFA 4C4FA 1XPUA 1UKVY 2MIIA 3AJ8A 1YQGA 4IJMA 4PYLA 1OBFO 1G5TA 3A9SA 2ZBFA 3HVUA 4RQTA 2H29A 2R6CA 1LF5A 3PTLA 2LAVA 5DB4A 4JV5B 1ZIPA 3AKEA 1D0SA 1IMOA 3TZBA 5KDLA 1ZU4A 4PG4A 5BOVA 4QMSA 2P9CA 2C0QA 4DLNA 4XX0A 2JIPA 5B7QA 1GL6A 1QG0A 3CKLA 4IHJF 3A6FA 2GH1A 4E1VA 1U7UA 2HWYA 2BGGA 3SG8A 1NI5A 2PG3A 4QUHA 2HWPA 2A0WA 4UOEA 2BFMA 2G88A 2KQUA 3UANA 8ABPA 2AYPA 1FRFS 4AQDA 5A7FA 3GWGA 3QZFA 4DH8A 1CWUA 3HDGA 1CNEA 3TW0A 2YY5A 3O4FA 5ALIA 4OM8A 3CP9A 1YZHA 3QMMA 4ZV9A 3ORKA 4KX3A 1NMXA 4WSYA 4LY3A 4QELA 5JHGB 2VAXA 1UP7A 4D98A 1L5RA 3TJRA 4QGBA 3TGLA 3CB2A 1BX6A 1EJBA 4M13A 2OP0A 4BNJA 1XXHB 2PKRA 1FMLA 1JILA 4R1YA 2PUNA 4O4JF 1DKUA 4FTWA 5AADA 1KP2A 2I99A 2QDXA 4HNSA 2FPIB 1T9AA 3QH4A 4DC9A 1UNGA 4MNEA 4QP8A 3QU9A 4ZTMA 5KEIA 5CAPA 1VYTA 2PL3A 4DLYA 4IE9A 4D25A 4YCSA 5EQDA 2A0YA 4ZQIA 4RIWB 3VW8A 1NR7A 1N7HA 2QPOA 1LCIA 4MYUA 5AWFC 3GN1A 1FNCA 5E38A 2A27A 3WLRA 1UXOA 4R5MA 1VRWA 3KSDO 3MOIA 2WVAA 3C1UA 2Z7SA 3MIAA 1HV8A 3I9V1 5JNRA 4EG7A 4YZ9A 2KI5A 3VU9B 1BQ3A 2CN1A 1ZCFA 2AK3A 3KOUA 4EYQA 1XAGA 2VG8A 1D2HA 2QTBA 5C7LO 3WLNA 3T1NA 3DMGA 3S5JA 5CEPA 4A6XA 4RKRA 3IVXA 2H3HA 4C0TA 4LAFA 3R1YA 4OHCA 5FIUA 4DWJA 3OFJA 3R5XA 3OCZA 2NU9B 1Z8FA 3DJFA 4FNMA 3ZTXA 3LECA 3QMWA 3CR0A 3I4FA 1H1LB 4UMFA 3JPYA 5ECGC 1E7QA 3VGPA 4B8ZA 4ZV4A 1L4MA 4TLEA 2R6DA 3SBXA 4O0YA 5DOSA 1UPFA 3Q3GE 4ZY5A 3WBKA 1KZ1A 3DYVA 2YDJA 1I4WA 5ER9A 1N34B 4CF6A 3FTFA 1FNNA 1DX9A 3OT8A 2JH9A