1FBRA

Fourth and fifth fibronectin type i module pair
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title Solution structure of a pair of fibronectin type 1 modules with fibrin binding activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 7
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1995-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1fbrA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1fbrA02
4J38B 2MCYA 5HYUB 1HCCA 1E88A 2IZ4A 2YRAA 3TVJA 1GPZA 1ELVA 2JGWA 1E8BA 2XQWC 1TPGA 4K12A 2XRBA 1QUBA 3ERBA 1G4GA 3CALA 2KMSA 1OJVA 2O39C 1H04P 2JRAA 3NFPI 2WIIC 1GKNA 1SRZA 4B2SA 2UWNA 2XRDA 2MCZA 2V8EA 2YBYA 1O9AA 1GHQB 4AYIA 1VVCA 5I0QB 2W80A 4WJG2 4DJZA 1CKLA 4A5WB 1UOTP 3IU3I 1TPNA 3L89M 1PPQA 2RKZA 3M7PA 1VVDA 2ERJA 2LOJA 3T5OA 2RLPA 3OP8A 1NWVA 1ZJKA 3MQLA 5HZPB 1QO6A 3R62A 2XWBF 4YNXA 4ZH1D 1OK3A 1TPMA 2RL0A 5FO8C 2W81A 2XWJI 2BZMA 3IX0A 4AYDA 3RJ3D 1G4FA 5HYTB 4LOSA 4LOTA 3O8EB 4CSYA 1SS2A 5HYPA 2IZ3A 2RLQA 4C16A 4FXGG 2CKUA 2EHFA 3KZJA 1U5MA 1OJYA 3ZRZA 3GXEA 3INBC 1MD8A 3SW0X 1H03P 1H2QP 1MD7A 1Z92B 1H2PP 3GOVA 4ONTD 4B2RA 1FBRA 2A55A 2G7IA 1Q3XA 1OK1A 3OXUD 2RKYA 2JGXA 1GKGA 2B5ID 1C1ZA 3EJHA 2QY0A 2EC3A 4AYMA 1OJWA 5JPMG 1E5GA 4PZ5A 1HFHA 1LY2A 3OEDC 1OK2A 4IGDA 2CG6A 4F4OC 4JHSA 2KRIA 3ZD2A 2CG7A 4KKDA 3ZD1A 3KXVA 1HFIA 4AYEA 1QGBA 4MUCA 1OK9A
chains in the Genus database with same CATH superfamily
4J38B 2MCYA 5HYUB 4YIZA 5DN4A 3WSXA 1HCCA 1E88A 2IZ4A 2YRAA 3TVJA 1GPZA 1ELVA 2JGWA 1E8BA 2XQWC 2Y8SA 5DN5A 1TPGA 4K12A 2XRBA 2X2ZA 1QUBA 2I2LA 3ERBA 1G4GA 3CALA 2KMSA 1OJVA 2O39C 3FGRA 1H04P 2JRAA 4N7EA 3NFPI 2WIIC 1GKNA 1SRZA 4B2SA 2UWNA 2XRDA 2MCZA 2V8EA 2YBYA 3FGTA 4APLA 1O9AA 3K3TA 1GHQB 4AYIA 1VVCA 5I0QB 2W80A 4WJG2 4DJZA 3WSYA 1CKLA 4A5WB 1UOTP 4BWCA 3IU3I 1TPNA 3L89M 4PO7A 1PPQA 2RKZA 3M7PA 1VVDA 2ERJA 2LOJA 3T5OA 2RLPA 3OP8A 1NWVA 1ZJKA 3F6KA 3MQLA 3VWOA 5HZPB 1QO6A 3R62A 3ZLDA 2XWBF 4YNXA 4ZH1D 1RLHA 1OK3A 1TPMA 2RL0A 5FO8C 2W81A 2XWJI 2BZMA 3IX0A 4AYDA 3RJ3D 4MSLA 5HYTB 4LOSA 1G4FA 2ZYCA 4LOTA 3O8EB 4CSYA 1SS2A 5HYPA 2IZ3A 2RLQA 3ZLEA 4C16A 4FXGG 2CKUA 2EHFA 3KZJA 1U5MA 1OJYA 3ZRZA 3GXEA 3INBC 1MD8A 3SW0X 1H03P 1H2QP 1MD7A 1Z92B 1H2PP 3GOVA 2Y8TA 4ONTD 3NJAA 4B2RA 1FBRA 2A55A 2G7IA 1Q3XA 1OK1A 3OXUD 2RKYA 2JGXA 1GKGA 2B5ID 1C1ZA 3EJHA 2QY0A 2EC3A 4AYMA 1OJWA 2Y8RA 3CI0J 5JPMG 1E5GA 4PZ5A 1HFHA 1LY2A 3OEDC 1OK2A 4IGDA 2CG6A 4F4OC 4JHSA 2KRIA 3ZD2A 2CG7A 4KKDA 3ZD1A 3KXVA 1HFIA 4AYEA 1QGBA 4MUCA 1OK9A
chains in the Genus database with same CATH topology
4J38B 2MCYA 5HYUB 1HCCA 1E88A 2IZ4A 2YRAA 3TVJA 1GPZA 1ELVA 2JGWA 1E8BA 2XQWC 1TPGA 4K12A 2XRBA 1QUBA 3ERBA 1G4GA 3CALA 2KMSA 1OJVA 2O39C 1H04P 2JRAA 3NFPI 2WIIC 1GKNA 1SRZA 4B2SA 2UWNA 2XRDA 2MCZA 2V8EA 2YBYA 1O9AA 1GHQB 4AYIA 1VVCA 5I0QB 2W80A 4WJG2 4DJZA 1CKLA 4A5WB 1UOTP 3IU3I 1TPNA 3L89M 1PPQA 2RKZA 3M7PA 1VVDA 2ERJA 2LOJA 3T5OA 2RLPA 3OP8A 1NWVA 1ZJKA 3MQLA 5HZPB 1QO6A 3R62A 2XWBF 4YNXA 4ZH1D 1OK3A 1TPMA 2RL0A 5FO8C 2W81A 2XWJI 2BZMA 3IX0A 4AYDA 3RJ3D 1G4FA 5HYTB 4LOSA 4LOTA 3O8EB 4CSYA 1SS2A 5HYPA 2IZ3A 2RLQA 4C16A 4FXGG 2CKUA 2EHFA 3KZJA 1U5MA 1OJYA 3ZRZA 3GXEA 3INBC 1MD8A 3SW0X 1H03P 1H2QP 1MD7A 1Z92B 1H2PP 3GOVA 4ONTD 4B2RA 1FBRA 2A55A 2G7IA 1Q3XA 1OK1A 3OXUD 2RKYA 2JGXA 1GKGA 2B5ID 1C1ZA 3EJHA 2QY0A 2EC3A 4AYMA 1OJWA 5JPMG 1E5GA 4PZ5A 1HFHA 1LY2A 3OEDC 1OK2A 4IGDA 2CG6A 4F4OC 4JHSA 2KRIA 3ZD2A 2CG7A 4KKDA 3ZD1A 3KXVA 1HFIA 4AYEA 1QGBA 4MUCA 1OK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J38 B;  2MCY A;  5HYU B;  1HCC A;  1E88 A;  2IZ4 A;  2YRA A;  3TVJ A;  1GPZ A;  1ELV A;  2JGW A;  1E8B A;  2XQW C;  1TPG A;  4K12 A;  2XRB A;  1QUB A;  3ERB A;  1G4G A;  3CAL A;  2KMS A;  1OJV A;  2O39 C;  1H04 P;  2JRA A;  3NFP I;  2WII C;  1GKN A;  1SRZ A;  4B2S A;  2UWN A;  2XRD A;  2MCZ A;  2V8E A;  2YBY A;  1O9A A;  1GHQ B;  4AYI A;  1VVC A;  5I0Q B;  2W80 A;  4WJG 2;  4DJZ A;  1CKL A;  4A5W B;  1UOT P;  3IU3 I;  1TPN A;  3L89 M;  1PPQ A;  2RKZ A;  3M7P A;  1VVD A;  2ERJ A;  2LOJ A;  3T5O A;  2RLP A;  3OP8 A;  1NWV A;  1ZJK A;  3MQL A;  5HZP B;  1QO6 A;  3R62 A;  2XWB F;  4YNX A;  4ZH1 D;  1OK3 A;  1TPM A;  2RL0 A;  5FO8 C;  2W81 A;  2XWJ I;  2BZM A;  3IX0 A;  4AYD A;  3RJ3 D;  1G4F A;  5HYT B;  4LOS A;  4LOT A;  3O8E B;  4CSY A;  1SS2 A;  5HYP A;  2IZ3 A;  2RLQ A;  4C16 A;  4FXG G;  2CKU A;  2EHF A;  3KZJ A;  1U5M A;  1OJY A;  3ZRZ A;  3GXE A;  3INB C;  1MD8 A;  3SW0 X;  1H03 P;  1H2Q P;  1MD7 A;  1Z92 B;  1H2P P;  3GOV A;  4ONT D;  4B2R A;  1FBR A;  2A55 A;  2G7I A;  1Q3X A;  1OK1 A;  3OXU D;  2RKY A;  2JGX A;  1GKG A;  2B5I D;  1C1Z A;  3EJH A;  2QY0 A;  2EC3 A;  4AYM A;  1OJW A;  5JPM G;  1E5G A;  4PZ5 A;  1HFH A;  1LY2 A;  3OED C;  1OK2 A;  4IGD A;  2CG6 A;  4F4O C;  4JHS A;  2KRI A;  3ZD2 A;  2CG7 A;  4KKD A;  3ZD1 A;  3KXV A;  1HFI A;  4AYE A;  1QGB A;  4MUC A;  1OK9 A; 
#chains in the Genus database with same CATH topology
 4J38 B;  2MCY A;  5HYU B;  4YIZ A;  5DN4 A;  3WSX A;  1HCC A;  1E88 A;  2IZ4 A;  2YRA A;  3TVJ A;  1GPZ A;  1ELV A;  2JGW A;  1E8B A;  2XQW C;  2Y8S A;  5DN5 A;  1TPG A;  4K12 A;  2XRB A;  2X2Z A;  1QUB A;  2I2L A;  3ERB A;  1G4G A;  3CAL A;  2KMS A;  1OJV A;  2O39 C;  3FGR A;  1H04 P;  2JRA A;  4N7E A;  3NFP I;  2WII C;  1GKN A;  1SRZ A;  4B2S A;  2UWN A;  2XRD A;  2MCZ A;  2V8E A;  2YBY A;  3FGT A;  4APL A;  1O9A A;  3K3T A;  1GHQ B;  4AYI A;  1VVC A;  5I0Q B;  2W80 A;  4WJG 2;  4DJZ A;  3WSY A;  1CKL A;  4A5W B;  1UOT P;  4BWC A;  3IU3 I;  1TPN A;  3L89 M;  4PO7 A;  1PPQ A;  2RKZ A;  3M7P A;  1VVD A;  2ERJ A;  2LOJ A;  3T5O A;  2RLP A;  3OP8 A;  1NWV A;  1ZJK A;  3F6K A;  3MQL A;  3VWO A;  5HZP B;  1QO6 A;  3R62 A;  3ZLD A;  2XWB F;  4YNX A;  4ZH1 D;  1RLH A;  1OK3 A;  1TPM A;  2RL0 A;  5FO8 C;  2W81 A;  2XWJ I;  2BZM A;  3IX0 A;  4AYD A;  3RJ3 D;  4MSL A;  5HYT B;  4LOS A;  1G4F A;  2ZYC A;  4LOT A;  3O8E B;  4CSY A;  1SS2 A;  5HYP A;  2IZ3 A;  2RLQ A;  3ZLE A;  4C16 A;  4FXG G;  2CKU A;  2EHF A;  3KZJ A;  1U5M A;  1OJY A;  3ZRZ A;  3GXE A;  3INB C;  1MD8 A;  3SW0 X;  1H03 P;  1H2Q P;  1MD7 A;  1Z92 B;  1H2P P;  3GOV A;  2Y8T A;  4ONT D;  3NJA A;  4B2R A;  1FBR A;  2A55 A;  2G7I A;  1Q3X A;  1OK1 A;  3OXU D;  2RKY A;  2JGX A;  1GKG A;  2B5I D;  1C1Z A;  3EJH A;  2QY0 A;  2EC3 A;  4AYM A;  1OJW A;  2Y8R A;  3CI0 J;  5JPM G;  1E5G A;  4PZ5 A;  1HFH A;  1LY2 A;  3OED C;  1OK2 A;  4IGD A;  2CG6 A;  4F4O C;  4JHS A;  2KRI A;  3ZD2 A;  2CG7 A;  4KKD A;  3ZD1 A;  3KXV A;  1HFI A;  4AYE A;  1QGB A;  4MUC A;  1OK9 A; 
#chains in the Genus database with same CATH homology
 4J38 B;  2MCY A;  5HYU B;  1HCC A;  1E88 A;  2IZ4 A;  2YRA A;  3TVJ A;  1GPZ A;  1ELV A;  2JGW A;  1E8B A;  2XQW C;  1TPG A;  4K12 A;  2XRB A;  1QUB A;  3ERB A;  1G4G A;  3CAL A;  2KMS A;  1OJV A;  2O39 C;  1H04 P;  2JRA A;  3NFP I;  2WII C;  1GKN A;  1SRZ A;  4B2S A;  2UWN A;  2XRD A;  2MCZ A;  2V8E A;  2YBY A;  1O9A A;  1GHQ B;  4AYI A;  1VVC A;  5I0Q B;  2W80 A;  4WJG 2;  4DJZ A;  1CKL A;  4A5W B;  1UOT P;  3IU3 I;  1TPN A;  3L89 M;  1PPQ A;  2RKZ A;  3M7P A;  1VVD A;  2ERJ A;  2LOJ A;  3T5O A;  2RLP A;  3OP8 A;  1NWV A;  1ZJK A;  3MQL A;  5HZP B;  1QO6 A;  3R62 A;  2XWB F;  4YNX A;  4ZH1 D;  1OK3 A;  1TPM A;  2RL0 A;  5FO8 C;  2W81 A;  2XWJ I;  2BZM A;  3IX0 A;  4AYD A;  3RJ3 D;  1G4F A;  5HYT B;  4LOS A;  4LOT A;  3O8E B;  4CSY A;  1SS2 A;  5HYP A;  2IZ3 A;  2RLQ A;  4C16 A;  4FXG G;  2CKU A;  2EHF A;  3KZJ A;  1U5M A;  1OJY A;  3ZRZ A;  3GXE A;  3INB C;  1MD8 A;  3SW0 X;  1H03 P;  1H2Q P;  1MD7 A;  1Z92 B;  1H2P P;  3GOV A;  4ONT D;  4B2R A;  1FBR A;  2A55 A;  2G7I A;  1Q3X A;  1OK1 A;  3OXU D;  2RKY A;  2JGX A;  1GKG A;  2B5I D;  1C1Z A;  3EJH A;  2QY0 A;  2EC3 A;  4AYM A;  1OJW A;  5JPM G;  1E5G A;  4PZ5 A;  1HFH A;  1LY2 A;  3OED C;  1OK2 A;  4IGD A;  2CG6 A;  4F4O C;  4JHS A;  2KRI A;  3ZD2 A;  2CG7 A;  4KKD A;  3ZD1 A;  3KXV A;  1HFI A;  4AYE A;  1QGB A;  4MUC A;  1OK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...