1FBTA

The bisphosphatase domain of the bifunctional rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
190
structure length
190
Chain Sequence
RSIYLCRHGESELNLRGRIGGDSGLSARGKQYAYALANFIRSQGISSLKVWTSHMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the rat liver fructose-2,6-bisphosphatase based on selenomethionine multiwavelength anomalous dispersion phases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords FRUCTOSE-2,6-BISPHOSPHATASE
total genus 59
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 1996-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1fbtA00
5AJYA 1SK8A 4FDUA 3IT1A 2H4ZA 3NTLA 2P75A 3BIFA 1YFKA 4D4KA 2IKQA 2EOAA 3FDZB 4D4MA 3PGMA 1E59A 2P2ZA 4ARVA 1K6MA 2H4XA 2HHJA 3EOZA 3QPWA 2P77A 2H52A 2HIAA 2P9FA 4GPZA 1QFXA 4MA4A 2OWDA 1ND6A 1BIFA 3DCYA 4HBZA 2QNIA 3E9DA 2BIFA 1QWOA 1FBTA 3IT2A 4EO9A 2DWPA 2GFIA 3NFYA 4E3WA 1EBBA 5AJXA 3OI7A 3E9CA 1C7ZA 5CX4A 3O0TA 1DKMA 2P30A 1SKBA 5AJVB 1QHFA 4PGMA 2P6OA 1RIIA 2EKBA 2WNHA 3LL4A 3FDZA 4IJ6A 3F3KA 1IHPA 1XQ9A 1BQ3A 1DKLA 3K4QA 2HPAA 2WNIA 3MXOA 4JODA 3D4IA 5AK0A 3LNTA 2P9YA 2YN2A 1FZTA 4IJ5A 1C80A 2ENWA 2YN0A 2ENUA 3D6AA 2P78A 2AXNA 2F90A 1YJXA 1RPTA 3MBKA 1NT4A 2PA0A 3GP3A 4AROA 3C7TA 4ODIA 4ARUA 3F2IA 1ND5A 1UJCA 2H0QA 3LG2A 3FJYA 5PGMA 3R7AA 4GPIB 3ZHCA 3EZNA 3GP5A 3DB1A 2P79A 5AJZA 1SKAA 1T8PA 5HTKA 1TIPA 5CU7A 3D8HA 2RFLA 4JOBA 2I1VB 4TSRA 2A6PA 2DWOA 4PZ9A 1SK9A 1RPAA 1UJBA 5HR5A 5AJWA 2EKZA 4D4JA 4D4LA 2WU0A 2A9JA 4QIHA 1V7QA 2P9ZA 3IT0A 1BQ4A 2OWEA 1H2FA 1DKPA 1DKNA 4PZAA 3KKKA 4EMBA 1E58A 2P2YA 3QPUA 4ARSA 1H2EA 2P6MA 4JOCA 5CDHA 1CVIA 1DKQA 3IT3A 3QPVA 1DKOA 3GW8A 1V37A 3HJGA 4FDTA 3K4PA 3E9EA 1C81A
chains in the Genus database with same CATH superfamily
5HBRA 4U7DA 3JWEA 1WMDA 4YAIA 1N5MA 1SQSA 2V5UA 1NU6A 3TPZA 3FMGA 1NN3A 4DCVA 1TYCA 1ECCA 1Y3DE 2DFKB 2W00A 1MB4A 1CJCA 3D0OA 3N6VA 4HSEA 4V02A 3PXGA 6LDHA 1U7ZA 3IQWA 4I50F 4EABA 2DHCA 2CJYA 4KIWA 4TMYA 1T5DX 1V3QE 4DRZA 3WGNA 2FN8A 1FFYA 4HXEB 3RUAA 1V1RA 3I42A 4QTZA 2RJNA 3KKOA 1FBNA 1FYDA 2QJWA 5L6LB 4K28A 1H0RA 2AUTA 3LQ1A 1XPJA 3SQWA 3OQMA 3Q8LA 5EUBA 3P19A 1X80A 1YE5A 1G8JA 2BEVB 1XNQB 4D9IA 4B79A 4EHAA 3MQ4A 1Y33E 3GZTB 4XSHA 2H17A 1SH7A 4YQFA 4RQBA 5K4HA 4FEAA 4R71A 3BVPA 4BMZA 4L75A 2RARA 1O8BA 3IEUA 2XITA 2VWHA 1IZZA 3O8BA 5AVZA 3HCDA 4BWVA 5DNWA 4R1PA 4RPGA 1W87A 3W4JA 1ZHFA 1CY7A 3B38A 1Z0FA 2WHEA 1I1NA 4AKSA 1SA0A 1NVTA 2O2IA 4Q16A 1TMOA 2VYQA 3UV7A 2W2KB 3RRYA 1Y5MA 4R5MA 2PRJA 3UHFA 2GPAA 4AW9A 2ZJ4A 1L7VC 1UIRA 1ZNQO 1JKJB 3U4MA 221PA 4DBZA 4M9UA 3Q6IA 4H1WA 1IZ7A 2YJ5A 4FK8A 3SCZA 1V8PA 2WP8J 1IBRA 2P2LA 5CJJA 4PLVA 3OP1A 5BY2A 5KYKA 1NULA 4C03A 4HWSA 3O9VA 1ZLYA 4ZI2A 4ZYYA 2DBVO 3BRQA 3RC1A 1FYVA 2D8MA 4D46A 2BI7A 1N1GA 1XTBA 5BRAA 3LYUA 4C6TB 1W0KA 2IEYA 2F43B 2DTDA 1X87A 3A8TA 1QC5B 3HB1A 3ZTWA 1O0CA 4XQ9A 2A5LA 2I22A 3S28A 3A32A 2FA9A 3GD7A 1T15A 3X1DA 1C4WA 1A8PA 3IHWA 3X1YA 1XKTA 1SQ0A 3QWAA 5I4IA 4NMMA 2VTBA 4DPLA 2EBWA 3ONWA 2IYXA 2GYWA 2H2GA 3GBSA 3R5HA 3A3YA 2VYVD 1EBUA 4AK9A 1NSYA 2WMNB 4L3WA 1K68A 3MLEA 4BLSA 3K6SB 2C1ZA 2WTBA 5KHOC 1AH2A 3F78A 5DX0A 3PHGA 2A0XA 2K5UA 3FVWA 4C7JA 3VSDA 3B6EA 4HPXB 4TYWA 3E53A 4QDOA 2CD9A 2D1RA 1L1FA 3DFUA 4QZVA 1EJ2A 2C31A 4MRPA 4B9EA 3D4PA 2Q4BA 4P3NA 1GTSA 1RAIA 2PEZA 4JMLA 5DHFA 2VPTA 3G7SA 2CMDA 4I5GA 5TGTA 3VBCA 4B8ZA 5JJIA 2JLUA 4KGXA 4TTJA 2WU3A 3VR4A 4RULA 2Y05A 1UPUA 4J3NA 3DE4X 2NU9B 2ZFUA 3CLSD 5KNLA 4JJKA 2VP0A 2AT1A 3QEJA 2C3UA 4GZ6A 4YFVA 1QIIA 3D4LA 3ZDAA 1U6JA 1CQIB 1XDUA 3ICEA 1W88A 3HCCA 3CO5A 5CFOA 1VYHA 5CLGA 5J58A 2FN3A 5BT9A 5K0SA 1LTQA 3BG5A 4EWLA 2AMFA 3GA7A 5KWEA 3QNUA 4QOIA 2X8JB 5T4HA 1JL3A 5I4BA 3OP4A 4LXYA 4C43A 4ZMSA 1PFGA 2FW7A 1GCGA 4DMHA 4R1SA 1JG6A 2QE7A 4NDNE 2QUKA 5EZYB 4BFTA 3H8WA 3LCUA 3Q8KA 3JASB 2IBMA 3DLIA 5IHPA 2Z2IA 4AY5A 1WULS 2WT4A 4NBWA 5T4EA 2AUNA 3H84A 4YV2A 2YXDA 2CFIA 3PJGA 2ERXA 4O1HA 1ZUIA 4LHXA 4DAEA 2ETVA 5FAKA 1WXXA 4HDMB 1OASA 1XZJA 4R8SA 5EIBD 4YJKA 1GA6A 1W73A 2QX7A 2RGCA 3HWRA 4QYIB 1XXHA 3ZCQA 3CCFA 3B8HA 1XL0A 4D42A 5BVHA 1RCUA 3FE2A 2P8SA 3KSDO 3NHYA 1I14A 1L4UA 3EIEA 1AKVA 3LYAA 4KJZA 4ZQIA 2HSGA 3NP9A 3LY7A 3WG9A 3WBBA 2EKPA 1JHZA 1H8ED 2DRIA 1WZEA 2DYKA 2PWZA 4JA2A 4X63A 2QZZA 5AJXA 3QUAA 3UAXA 3AL0C 3MYYA 3U5TA 1P2VA 5AXAA 1ORVA 3ONVA 4OH7A 2D1TA 4MV7A 3S99A 2BBOA 5TE9A 5H7XA 3DTNA 1KAQA 1NRXA 1NUTA 3G17A 2Q99A 2C9YA 4D9BA 4MVWA 5B7GA 4RVGA 4S2EA 3S68A 1VXOA 4OY3A 4EI9A 2FMFA 3SU8A 3CM0A 3GT4A 3Q3GE 1NBOA 1G1MA 3RVRA 1KBQA 3SQLA 5EJ7A 4IHQA 2IH5A 1FDSA 2D7CA 4O2BB 4TLDA 4U7GA 1F0KA 2EP7A 3TGLA 5BPHA 2QR5A 3DVLA 1NN0A 2H4JA 1IUNA 3FLEA 4W5JA 1NZDA 3BXZA 4UAUA 3DQPA 3S2EA 1WIWA 2YW2A 1U0EA 3NHJA 1HYEA 2F3RA 4RHXA 5FHRA 1AZLA 1N75A 3D3NA 2FZWA 2GUWA 3G9UA 1N36B 3ZJTA 3C3CA 8MHTA 4PLZA 4JQSA 3ILXA 4MHSA 4IVPA 3HDTA 2IEZA 1DC4A 3IJ5A 4QU5A 3NLLA 1ZRSA 1U7UA 4NH0A 1MVOA 5KYUA 4DV7B 1ZD2P 1FXWF 2RHTA 4I14A 4TL8A 1SWVA 5EHIA 4PN3A 1X7YA 3OZBA 2ZRLA 4RTPA 1T9HA 3ND5A 1DFIA 4AYWA 6AT1A 2KPOA 2J6CA 5G4KB 5BN5B 4JWKA 3RNOA 2Q41A 3FIJA 4IOJA 3AJDA 5BV8A 4MYTA 3PUZA 4OGGA 3PA6A 3ZXIA 4DJDC 2BMJA 3H17A 4NONA 1C1DB 2VPYA 2AUMA 3T9AA 3WMXA 4BVEA 1XPUA 5JG7A 2D0OB 1B73A 1SU6A 2BL4A 3DLCA 4RAOA 4JL8A 4QKQA 4IGEA 1SCQA 3ZGVA 3M6MD 1ZO8A 1IHXA 2HIGA 1Y4DE 2I6FA 2HPVA 2YFHA 4RMHA 4YDSA 5DNYB 3D81A 2ZTVA 4TTAA 4YCDA 1C30A 1IEWA 2P6UA 3L0BA 5CX1A 4CMHA 5BWBA 4MV8A 1GWNA 4ENQA 2OR3A 5LUAA 4W9RA 2HEIA 5LL6P 1NBME 3OLYA 3OEEA 3WIDA 1Z6XA 4L0MA 1JAXA 3RODA 1EINA 1YVPA 4BNTA 2ZROA 4IZHA 4C1NA 2VDNB 2Q7OE 3U3ZA 1MQ8B 1SKMA 5I4KA 5JH7B 4L4RA 3SC3A 3E82A 3GPLA 1VRVA 2HV8A 3CRQA 2GEVA 1C14A 2AG6A 1YZGA 1QGZA 5LMUB 3F6YA 5JJCA 2VT6A 3KJQA 4FX5A 1VHLA 5FTJA 3DA8A 2J9RA 2PLFA 2X2FA 4EG8A 2FEMA 1E3EA 2EIHA 1QYVA 1BMDA 1NJ2A 2HWUA 2YHUA 3FCCA 4F71A 4IXWA 3EOAI 1JI3A 4NAUA 2W48A 3KUXA 3TZLA 3ZX4A 5KC9A 2BDUA 3JRXA 4A8TA 3UPUA 5AI6A 1O97D 1E5LA 4D9CA 3PDWA 1ZESA 1K8RA 2JC3A 2CVOA 2JHGA 5FIUA 4NIMA 5LVAA 4KQFA 4LGYA 2GZ3A 2WKSA 4KNVA 4MVJH 4M0MA 1P7CA 1B1CA 3R3XA 3DMNA 3SBEA 5JEEA 4D3DA 3OOEA 3EIQA 1A9PA 2Q4EA 2VRWA 2OL4A 3KDAA 5EP4A 1JKXA 1HWYA 4F6CA 1W1WA 1WZCA 4J1TA 4TWZA 3AKZA 4F12A 3AHDA 3NKFA 3R75A 4FCVA 1R2QA 5DYWA 5K0EA 2NSDA 1LSUA 2REXB 4IXDA 2I67A 2VYCA 4PY2A 3L79A 1U3FA 5LDGA 1HO3A 1GV1A 1Z18A 1DV2A 3NBFA 1OMOA 4LZLA 5E7IA 4F46A 4BFYA 2CMGA 3CVVA 4PF1A 3R0QA 4S0XA 4YRCA 4FCCA 4KKVA 5CT5A 5CBPB 3HKDB 121PA 1BJKA 1BXGB 3L7IA 2CMHA 4GGPA 1D8TA 2F17A 3JQ7B 1Z34A 1KI4A 2JA2A 2ZYTX 3QOWA 3S7ZA 2DM6A 3VNBA 1JRLA 4IRUB 2XWJI 4S04A 4B7UA 3FRJA 4PAGA 4E51A 5EZQA 4MS3A 2JLXA 1SBTA 5DNDA 1WW8A 2ZBFA 3WRXC 4DABA 2HF9A 4IX9A 1ENZA 3H3FA 5K5EA 3CIOA 3I73A 3P2OA 4ILKA 4BP3A 5KYGA 3E3NA 1YS4A 4JEMA 4LKOA 2PX0A 3CRRA 1NBWB 3LY9A 4FZJA 4TTVA 2WF5A 5D3QA 3WY9A 1VFPA 3L0IB 1ZU4A 2OGUA 4S2UA 2PS9A 2O0LA 1YDHA 1U3VA 2BZSA 2VS1A 3BD7A 4BX2A 4M1SA 2GK4A 3I9V1 3CURA 4ONEA 1EFLA 3NZEA 1RADA 3QPDA 5KVCA 4P53A 3MCZA 1PJZA 1ACLA 3B1WA 3ZIAD 4DN6A 1R6XA 3AYZB 1GKYA 3TF5A 4FGJA 2IU6A 2GFQA 2WRZA 1CNFA 2YJ3A 3GN1A 4KR0A 4PAWA 4FEYA 1MQSA 4K81B 4M1MA 3R9XB 1KTVA 4ZYLA 1W93A 1W8IA 1UM9A 3DVRX 1JFFA 2B2XA 3JWGA 4H6VA 4M1TA 3SN6A 1G41A 4ER3A 4CEIB 3ZD8A 1EX1A 1NGSA 1FF9A 3DMTC 3FVTA 4X5OA 3RC3A 3T9DA 3NRCA 3I3OA 3CW9A 3ST7A 4MW1A 4C20A 4ZT7A 5AM0A 4UREA 2NTYC 4B3JA 5AIBA 4HEQA 1WBDA 5BMVF 1CDEA 1YDWA 2O6HA 3C3MA 5IMSA 1U11A 2EGHA 2NAPA 1CYEA 4GS5A 2H1LA 4QGGA 4HGQA 4TKMA 3DV9A 5FI1B 4AY6A 2FWJA 3WIEA 2DFTA 2BHRA 3R3HA 4M0EA 2CJWB 1WXQA 4QELA 3I34X 3TE6A 4K9SA 2R9VA 5HW0A 2PH3A 4ZQCB 3W7AA 2FR8A 5CDTA 3N75A 4JR1A 1R1DA 4WZBA 4S1WA 3TO5A 3WGMA 3VZQA 1IB6A 1JPUA 1A2QA 4BQSA 1FRVA 2X40A 1V48A 4YP1A 1Q6YA 5H59A 5CYFA 2QTCA 3QIAA 2QIOA 3QU7A 4XWOA 2MOKA 5A4KA 1YZLA 3QLVA 3EX7C 1E3SA 1RNLA 1WLSA 1P0CA 3ZE0B 4CQJA 1TB4A 4MNTA 3TIVA 4WZAA 4HB3A 3VOBA 3A28A 4AMVA 2ZQ5A 1TFRA 1E6MA 1EESA 3WLTA 2I7CA 4K3VA 3IUJA 3BM5A 3OE1A 2MYUA 4GVLA 2WUGA 5EYPB 3V1YA 4B40A 4AXXA 1N2CB 2IYYA 3FOBA 2DETA 2R7KA 3ZK7A 5KQGA 3W5CA 2VZ8A 2WICA 2INGX 4WL0A 3ZYZA 3HM2A 1VBKA 1V8BA 3IBTA 2IPLA 2YNMD 1MAAA 2XMQA 2MSNA 3P0JA 4FHDA 4XD7D 5K3DA 5TDHA 3CG0A 4D3XA 1Z22A 1W6UA 1GVNB 2XE4A 3B1ZA 2QY9A 4R05A 2G8NA 4ZU3A 2PMKA 3W9SA 3LQ4A 2CSUA 3DUWA 2QL5A 3IV7A 4GX2A 4TT8A 1RJEA 1ZYUA 4CF6A 2OPBA 1KI7A 3AV3A 1QZUA 3LQFA 1GZ6A 1HEUA 1NP6A 4HZGA 1QKJA 2CEKA 1T9CA 5FBRB 2FCRA 1WSDA 1E61A 1PWEA 4P7KA 1CP2A 1ZEJA 1CD5A 3ABIA 4JR2A 2P0AA 3VOTA 2QRVA 5IKMA 1Q0ZA 5FTWA 1PF7E 2OFPA 3M5CA 1WDWB 3BE4A 3QMVA 4LDQA 3QWHA 4QQNA 3LQRA 2OY0A 3OIFA 2OGWA 1XA0A 2J7PA 5DMHA 4ND5A 4V0MA 2MYNA 3LXMA 1X8XA 5C5EA 1G9TA 3A06A 2NZUG 3WWOA 3G2HA 2GN8A 3U7QA 2YV4A 2EXXA 1V1MB 3DE1X 3PT5A 5E95A 3LDFA 4WKNA 1J4AA 1GPWB 1SUWA 2FXIA 4YJHA 1L5OA 2BKAA 4IS3A 4IWNA 4JX9A 1WZNA 1AQJA 1KVQA 3A7DA 3JV7A 3VKHA 1F4PA 2QD3A 4MVJD 5EE5B 5JNWA 1Y4SA 1B8VA 1PHRA 2AH5A 4IHJF 1KY2A 3L4BC 3KJIA 1YR3A 1FDTA 5CH3A 2RH8A 5J63A 5LN1A 4DV6B 1S2LA 5AVJA 1ZA2A 2N75A 1QONA 3CLTD 3E2IA 3R6GA 3WGOA 4LAFA 4EYGA 3O2QB 4J0FA 1Z4MA 4AC9A 2FGKA 3E9QA 3QG1A 3THSA 1RKBA 4Y2UA 1FVHA 5E1BA 3WRYC 4ZI7B 1EQUA 1HZJA 4BO5A 3NBYC 4BO6A 2R8EA 2IX3A 4YP7A 3H97A 2C7BA 2QSYA 4TM8A 1SNYA 2F48A 3T3OA 1JPVA 2WOOA 3DXZA 2EW2A 3HHEA 2H07A 3DL4A 2B2CA 4KMOA 2ZT5A 4HNGA 4KWEA 3A1SA 1GTVA 4RORA 3RHTA 3TLZA 3ROEA 4GGMX 3HBJA 2JBHA 2Z3ZA 1MJHA 2VAMA 5I9SA 4A0GA 3LGSA 4LRUA 1JQBA 3EIOA 1W581 4COOA 3QM1A 3M2PA 1AT1A 1MV8A 4AIRA 4S24A 4LJAA 1GPYA 1UBTS 2F8LA 4I1SA 4RGBA 3KWLA 1MBZA 1Z4QA 3U48A 3H1GA 4YT4A 1A9XB 1X86B 4WUTA 1UWKA 1VB5A 1B0ZA 2PMEA 5K6AC 3ZW9A 2VRCA 3E15A 5SY9A 1ODLA 1UPFA 3EZYA 3INNA 1HZZA 4BL5A 1E3DA 3T3NA 3R5JA 2YUIA 1CUVA 2VOJA 3BIFA 4ILEA 1PFUA 2QSUA 1KE2A 3U4HA 3UENA 1J20A 3UJNA 1T2EA 1YR7A 2HA4A 2OO5A 3SXJA 3H65A 1M2HA 1JEQA 1XKQA 2V98A 5DH9A 3FUXA 1USKA 3NW9A 2HRQA 3AB3A 5F5XA 5GQSA 2AVDA 4QUDA 1XALA 4YUXA 5AXDA 3R8XA 4O3FA 5F5NA 1SBZA 1UXOA 2NV2B 1M10A 2V7QA 4C04A 1YZVA 4BWFB 3VPAA 5T4BA 4H0NA 1ZJYA 5JQGF 1FJHA 4FHZA 1EWVA 1L7MA 2JI6A 3CNQS 2FDRA 3HJTA 3K96A 3LUDA 5AM4A 1U28A 5FPTA 3U3OA 3EWAA 1Z73A 3ZD6A 2YJZA 3B8EA 2D7JA 4HDSA 1BGWA 2VEDA 2YINC 4IH4A 4I3GA 4QDKA 5AKLA 1FBTA 3ZN2A 1W48A 1ODKA 1V71A 1CUSA 3BSWA 3KYJB 3PQ8A 4FI3C 3CBQA 2A33A 3K5IA 4R2MA 4XIJA 2PUDA 1TGVA 2TYSB 2IYVA 2MCFA 4DT1A 1C1DA 4KPUB 1PUXA 5DFAA 1FU8A 1DB3A 4MUXA 3L0DA 5CK5A 2BZGA 4BQEA 1MB3A 2QPOA 4AP9A 1HK7A 1TFUA 2VTKA 1EVKA 1HEYA 5HZGA 1JS1X 3G0OA 2RHGB 3AHFA 4GG1A 4HXFB 4URXR 1PL8A 3FB4A 1JV2B 5FBKA 3T4PA 5BUCA 1BQ3A 1T9ZA 1E1KA 1SVOA 2DG2A 3NBXX 3WYFA 1FE8A 1LH0A 5AK0A 1CUCA 1TXGA 1ZH8A 5A9SA 1U2EA 1EDZA 3T5MA 1P6QA 4BZZA 4FTWA 2E4UA 5H80A 1CJMA 1KK3A 1NMYA 2PH7A 2WF7A 1EPUA 4GL2A 4HX5A 1K4MA 1U1FA 3AUTA 3AR2A 3IQXA 3LZDA 3O7MA 5ALHA 2GNOA 3OETA 4FEGA 4ARUA 5L95A 2HMUA 2C5HA 2VATA 1QG6A 4OX9B 2BHSA 5LQSA 1CB7A 3ENWA 4X3OA 1I94B 4EYQA 3G7UA 1DUIA 3UCXA 4MS4A 3ZQUA 4TSFA 2G6TA 3JD2A 5FL7A 2V7UA 1K89A 1WHTA 4Y9DA 4TTPA 1ZGBA 3E03A 2HK7A 1SVSA 2W8BB 3L8EA 1T2AA 5KSYA 2HU8A 1G55A 1B3BA 1NDQA 1XK7A 3DE0X 4GIBA 4ZEOA 3RSZA 4PANA 2I4TA 2MMGA 2XZDA 1T5BA 1E1NA 2RGEA 5B1HA 4BTEA 2VDPB 2J9XB 2ZUSA 1WY7A 4Q4LA 2CXUA 1E79A 4PHHA 4AWBA 2JEZA 5EJIA 4D96A 3MF4A 2YS6A 3N2IA 4KIGA 2ZSHA 4KJXA 2DULA 4NCJA 5K0JA 2VAVA 5ITZA 5BW5A 4N18A 1XXHB 1JQEA 2I2WA 5TPZA 3HRHA 3O93A 1UFQA 4N41A 3PDUA 2UZ4A 1I1OA 4YJ3A 3SMVA 3W8FA 1CF4A 4CT0A 4EO4A 3O4IA 1FNMA 3CNEA 4KDRA 4Q1EA 2V74B 2PS0A 2Q2QA 3ANLA 1UAAA 2AHOA 2RB4A 4LF9B 3II6X 3QJ5A 2DE0X 1D2AA 4KO1S 4H35A 2PQMA 1SC4A 1FP4A 3OZIA 4ADSG 1A77A 2C4UA 2H7CA 2VN8A 5K6RA 1G17A 4ZMBA 4G25A 4ZVTA 5KDDA 2PBZA 1QHHA 5K3SA 3HBAA 4PNPA 1M75A 5FOXA 2ATXA 3ITNA 1DSSG 1P4GA 3O4GA 3SYLA 2V59A 3S2SA 4JYAB 4H4DA 3REFA 3SSOA 4A0QA 4JLUA 2CHUA 1T24A 2B92A 3D64A 1I3CA 1KR2A 3BXHA 2GN0A 2I8LA 2YH2A 3NYQA 4JJ4A 5COQA 3QEOA 4QD3A 3MIIA 3DOCA 3ROGA 3T5GA 3FTQA 4YJ3F 5IKOA 4QREA 4BC0A 4LHWA 1EIZA 2VHXA 3A14A 3HCAA 4C06A 2VF8A 3CNHA 3LWDA 2QP4A 4WBSA 1BW9A 1QS0A 1NP3A 4YJGB 3ER9A 1VI5A 4HVCA 5L3SB 4ZTZB 5IZCC 5FJJA 3UT5A 4KHPB 2K7ZA 1GSAA 1ZM9A 4PSUA 4YB8A 3HA5A 2P41A 3B1KA 4U00A 5H0IA 4D2IA 5AW0A 1NPDA 1KOLA 5ESRA 2GESA 4MYDA 4G4JA 2K2WA 2DHDA 4POOA 1X1QA 4OHBA 1NI4A 2HUNA 2NXCA 3TLAA 3TSYA 4BNGA 4JFAA 3QF7A 3PHHA 1ZM4A 3KKZA 1MX1A 4CKEA 2LUOA 1I7SB 1Q19A 3S70A 1IIBA 3HWWA 5FNZA 3IHLA 3UTDA 1MIHA 1G16A 3PB3A 3W4IA 5TMBA 4UVHA 4UAVA 1XYYA 4H1VA 5FBQB 5T8KC 1H0KA 2E55A 2CHEA 3L1JA 5C9ZA 1LEHA 3PHLA 2IYLD 3CZ9A 3K94A 4BLUA 4IWYA 4XQCA 4CM9A 3I83A 2P40A 4QATA 5A3SA 1B26A 3SLGA 2D4AA 1FDOA 2ZJ7A 5F9MA 1VLJA 1L5HA 1JXOA 4Q3EA 2JDID 3KYIB 4KU4A 5SYNA 2D5BA 4L51A 4Y2JA 1EK0A 1EX9A 1TO1E 4IXMA 3MCTA 1Z16A 2M32A 1G42A 5FOVA 1E32A 1GLVA 5LCXA 1KA9H 3K2BA 3R8FA 2WAOA 4YK7A 1D9ZA 1EH5A 2GOYA 4EW3A 3MTJA 4CFZA 3T1TA 2EWVA 4UEKA 5IYZA 3OMWA 2JCGA 4I1RA 4XSVA 5P8WA 1KI3A 1V3UA 4FNAA 1SXHA 2POQX 2R8YA 2TSYB 2PX8A 4LXQA 1U6IA 1U9ZA 2ZW9A 4J0KA 4J0CA 4K8RB 1PGNA 2C0QA 2D5IA 1G4AE 1Y89A 2DUNA 2FOXA 4PE5B 5B1IA 1XL1A 5ES3A 1MZPA 3PNVA 3VUEA 1AGPA 2GD0A 4ZRNA 4FLEA 3ZV3A 2OV2A 1JLLB 1YC5A 2YQ5A 1RIFA 1ULTA 3PT9A 3QG5A 3K70C 1R7RA 3INRA 3K72B 4MYUA 1UJBA 4GW3A 1SHKA 3ZLBA 4LZPA 4XPIB 3EVEA 2DHRA 4NLLA 5L51A 5TMDA 3PE6A 1RJFA 3NHUA 1KXZA 3FYDA 1PP4A 3O26A 4K9QA 4PYLA 2XCTB 1AGYA 1XX6A 3ETNA 1DZIA 3RC9A 2IUSA 3GLTA 2P67A 3R6TA 3THWA 1F38A 1GNRA 3OE7D 4PR3A 1WMSA 2PS1A 2ZDHA 1ISMA 2VAXA 4X45A 3IE2A 4C7XA 5L7WA 2P9JA 1QU3A 4UJ3A 1DKQA 2AJLI 2P4HX 4PW0A 4Q24A 1UXIA 1J0DA 1U2GC 2VRNA 4A6PA 3K1JA 2HA7A 3NORA 4V38A 1U98A 1BH2A 3H2HA 2D3TA 5K8JB 4O0LA 4JP5A 4Y2QA 2B7CA 2XUFA 1Y42X 3GJ4A 4ETIA 2Z43A 4H6PA 2XXJA 1BMQA 1JDNA 2BEUB 4YRPA 2BLNA 1YK0A 4C4RA 1EGQA 4QEDA 1UANA 4OQPA 3UYLA 5GZ1A 2I91A 3PNOA 3L2OB 1JDZA 2IZ6A 2RH4A 2FVYA 3EXFA 1IBSA 4OXNA 1YH3A 2Q3EA 5JR3A 2FEAA 2R00C 3AG6A 3GX1A 3KDSE 4YQZA 5KYYB 2WKQA 3W78A 5LZ4A 1XMXA 3A1CA 1HFWA 2EBUA 1WW2A 3ZI7A 5LIRA 5KX5A 4KN5A 3PG5A 3A4YA 1ZVVA 1TM7E 4H7DA 3D8SA 4DUGA 1KHTA 3PQ5A 4Q1CA 2R6JA 4R68A 4U39A 3RU7A 1L5ZA 3M4JA 4WZAB 4XKJA 2JEOA 1QIKA 2IHJA 2PXCA 4HTFB 1GRQA 4JEUA 1KF0A 3ELDA 1G9SA 3C24A 1TJYA 2H63A 3GFBA 1E6UA 1NN5A 2IWHA 5ER9A 5DXFA 4NU6A 5SYAA 3TKYA 2QN3A 3CYFA 3DFZA 4OBXA 1C9KA 4IXTA 5IX8A 3PQEA 4GLBA 1P2BA 5F77A 4KRXA 2ZI9A 4NBTA 4KLZA 1J0AA 1GHTA 3LP6A 4FJ1A 4QPNA 3W6PA 2ZS9A 5ADUS 3I05A 3PEUA 1QPBA 2WIBA 4LBYA 1PFKA 2JGKA 1UZAA 3K4QA 2E1PA 3O5AA 4FSDA 1AHIA 1JA9A 4PC6A 4AJ4A 1S6YA 4DLKA 6REQA 1P9NA 5DCUA 3FFAA 2IV2X 1G20B 2BE7A 3IILA 3S5UA 3TI9A 1HQDA 1ZOPA 2HIMA 1LPNA 2V8OA 3L8FA 3A9SA 1QVRA 4KQ2A 4R1QA 3KKEA 2RJOA 3CX7A 3NOXA 2XTNA 4IIJF 2FMUA 2LNDA 4BJ6A 4YAOA 2R0QC 1XWFA 5DTJA 3ZLJA 1U04A 3R7SA 2APJA 3SX4A 3QYFA 2O1EA 3HEAA 4YAEA 1O8CA 4P35A 2OXIA 2BKLA 1YJBA 2XECA 3CFYA 1R50A 2R8BA 5DM70 1G0NA 3FPFA 3EMVA 4CM4A 1JDUA 2ZIVB 3O1HB 3BMOA 3R9XA 1X7GA 1ZNYA 2Z9DA 5JSFA 4L6CA 1SCBA 4K40A 2FWAA 4RVOA 1W44A 3BGOS 3CZCA 1ZGCA 5FBVB 2K4MA 4TLBA 2H2HA 3EVGA 3SJUA 2HJ9A 2VHEA 1VE5A 5D86A 2G4VA 3OCZA 1KGSA 1VJ5A 1HA3A 3CN7A 2UUBB 1NBHA 1N8TA 2BMVA 4R9RA 5BMVA 2MYPA 2R48A 1XEXA 5K8UA 4ZC8A 5JUWA 1PGOA 2XV1A 2H4FA 5AO9A 1SK9A 2NUAA 3SDSA 3ZWDA 3K7EA 3U44A 1H94A 3U9SA 5CDSA 1NBIA 4MGEA 1XNJA 1YS1X 2CLLB 1VIDA 2Y1GA 1ISFA 5AKEA 5EP2A 5EY5B 3G8YA 5BOVA 2YUTA 2C7GA 4F9FA 2XTAA 3HKBA 3QV2A 3EGEA 1BXGA 2JGMA 3FPHA 3O1LA 5CH5A 3ROXA 5F3WB 2HC9A 4OOFA 2JEYA 3WC4A 4MA5A 2IDMA 4EF4A 4ZV4A 2YICA 5E6SB 3JYQA 5H3CA 1VGVA 3IP1A 4DCTA 4N48A 5I7AA 3ISJA 5FBWB 2ZIAA 1QWSA 2ZIGA 1ECGA 5TGZA 3PJFA 2RG1A 1E99A 1PR9A 1RWXA 1YI8A 1TUBB 3LX6A 1DKOA 3M3PA 3OQIA 4FC6A 3ZI4A 4D9KA 4B6GA 1H9CA 3RU2A 2O8EA 3UG6A 4QICA 4HDAA 1X1BA 2RH9B 2I29A 4BDTA 5BT8A 2MSKA 4LGCA 2HRBA 4NBSA 1Z8HA 3VYRB 2B8TA 4YLEA 4NMHA 4DDVA 1Q3KA 2GJ4A 3OKCA 4HLUC 5EXPA 2KX7A 4FMDF 3CVUA 2FCAA 1CU1A 4AIIA 3K2EA 4HN9A 3D7SA 1ATIA 3IPRA 1GNQA 5AK3A 4JSYA 3TDNA 3WLMA 3U1BA 5GINE 1A9TA 4XJXA 2OYSA 1EK2A 3IKLA 1SXPA 2F8SA 3D0QA 3GJYA 3TK1A 5JMOA 1XD9A 1UJ2A 2ZKLA 4PQEA 2JFZA 4A0FA 1JYEA 4N7RA 1B8OA 1TZCA 5B37A 1OGJA 1BVYF 5IZCA 1X0VA 2BJWA 4CMAA 1YDMA 5K20A 3LX4A 2L17A 3QENA 1N2BA 2PQ6A 3TINA 4I8XA 5F3DA 1Z4NA 1M9NA 2C8KA 4NWIA 1DWQA 4U1RA 2O8FB 1OLXA 1VLQA 2BIFA 4TL9A 2Y4NA 4Z0NA 4CHGA 3AZOA 5JLAA 3VR4H 4UBLA 3DL2A 4V0LA 1KP9A 4CCAA 4DUPA 4DC1A 3PUWA 2G25A 5BSWA 4IPTA 2OBFA 4LJ5A 1OUMA 1NX6A 1JG2A 4U6NA 1CZOA 3I09A 3WIVA 4IP0A 4N40A 3B1FA 2SECE 1PWZA 4ALKA 3QVUA 3H5TA 4H2DA 4DBLC 3PENA 2YY7A 4GXNA 5IH7A 3OCXA 4ESHA 2KJQA 4WDQA 2W6PA 2BUAA 3TEFA 1E3WA 1YI0A 1YQWA 3L0ZA 4FQ5A 4Q15A 1HSOA 1T0IA 1CUZA 2QTVA 2BI4A 3AEYA 3WK9A 1J22A 3HTXA 5C4GB 1N1EA 4K46A 4JEIA 3A2KA 2IEGA 3KVRA 1JPJA 4N8EA 4J16C 3UF0A 2B99A 3WJAA 3LE8A 4Y2PA 4B6RA 3EZFA 1HG1A 1P8AA 2J46A 1OX4B 4HAIA 1HV8A 1EAYA 5CCEA 3NXKA 2ZE6A 3HABA 1U1DA 2W4MA 3EAGA 4KUHA 4DGQA 4ZCRA 3SC2B 1UC8A 4IDAA 3VYVA 5KYWA 1Q0UA 3LDAA 4UPEA 4IHJA 1TTTA 2B8EA 3HJHA 2I9KA 2FE4A 1PK7A 4MS1A 3FETA 1DT5A 1WE2A 5CW1A 1JDSA 1Z2EA 4KW7A 4KYUA 2R8OA 1U9CA 2Q5QA 2YDYA 2A30A 2Q46A 2VDWB 3KXDA 3FSGA 1IU9A 3P94A 4G86A 4AJ2A 3OWXA 5JXGA 3ZWBA 4AVYA 2H4HA 3OZSA 4ZO4A 4DNXA 1TT5B 4C0WA 2H06A 3BMNB 1WVGA 5CVUA 4MH0R 3TAXA 2OXEA 5C51B 2W90A 4YVFA 2C78A 4UHCA 1VMEA 1E0AA 3SYRA 1P9RA 4ZQHA 1N5RA 3OPYA 2PK3A 3WFJA 3R4VA 3WHPA 4KIJA 2JHFA 2CLCX 4ID9A 2JLAA 1JVNA 4JU8A 1OXUA 1RHJA 2E5WA 4P2GA 3J81A 3C97A 2B4TO 2A92A 2QRMA 3GL9A 3BRCA 3DH0A 5KVAA 4UU7A 3F5SA 5JT1A 4M1YA 4DV3B 3IBFA 3ROPA 5BVGB 5D7NA 4UCFA 5ALZA 3EEYA 1NZJA 1TAUA 3VR3D 1GDHA 1CUIA 3OPNA 4WXMA 5AM1A 1MN6A 4ZREA 3VX3A 1AGRA 3E9EA 2H08A 2QENA 1UDAA 1RJGA 3CSSA 5JQWA 2D1SA 3P0HA 4HH4A 1E1CB 2FJPA 2JIQA 4C7VA 5IT0A 1XCOA 3PSAA 3N39C 3JWIA 3EUWA 2EKDA 3E9RA 5AHWA 1R8XA 2FPRA 3Q5EA 2J87A 4TYQA 3QEAZ 3IBYA 3FOAA 2VJCA 3FCEA 1LC0A 3NTRA 1W7AA 4ALNA 1ODIA 1GY8A 4MPJA 4PGFA 2AX3A 5B1YA 2BTEA 3OLVA 2ZTUA 3UKDA 2V7VA 1YBFA 4RTJA 3DEHA 3VR6D 3AY3A 3KNZA 2FH5B 3E1KA 1XVLA 3MTAA 4S0ZA 1QKIA 1R6AA 4DSUA 4A4DA 4UFPA 1QQ5A 1QO9A 2WM8A 3WR5A 2XUHA 3H2YA 1Z5NA 3CNNA 3C1AA 3HSKA 4L3VA 4GNRA 2GHRA 1WQ3A 4DJEC 3OQIB 1SXJE 2FY8A 2JI9A 2ZR9A 3HJBA 5CFZA 5H4GA 2O9JA 2X8JA 1NQWA 2DQKA 3K9CA 5J4VA 3EVBA 3T0GA 4G85A 2E48A 4JYPA 3VU1A 5T7BA 1U8UA 2BFOA 3A6KA 1GSIA 2PKRA 2WNHA 1I3MA 5KNCA 3B2EA 2CNOA 1Z7WA 1T2NA 2P9QA 2VG8A 1M1YB 1NBMD 4PPFA 4F60A 5K09A 2HPAA 4P31A 5L4NA 4RIFA 4ZRMA 1XZBA 1D2CA 4FMDB 1PJ4A 3U4QB 1YTLA 3IO5A 4YP0A 2BFWA 1XNRB 1V9CA 1H2YA 1E0JA 1FNBA 4GRIA 4JL5A 5GZ3A 1IBCA 1SPXA 4O1IA 4QTTB 1XA4A 4FZ3A 5A3VA 3VAAA 3WWEA 5ADWA 3EFOB 1ULHA 3AOEA 2C9ZA 3QFFA 4ZALA 3RVJA 5A1TA 3GA5A 1U8EA 1J0BA 4QPCA 4NJEA 3A1WA 2RHMA 3SVZA 2I7XA 1WOYA 4DDWA 1QZZA 4QBTA 2CUKA 3ZWOA 4EGAA 2DECA 2MYTA 3ZE9A 1FRFS 1ZMXA 2OXCA 2WPNA 4ZOLA 2ZI7A 3WRWA 3AUYA 2MINA 2QXYA 4NU5A 4RYLA 3D5QA 5E7JA 1O94A 1IQ0A 2FPGB 1ZAKA 2HXSA 4QLBA 2FMIA 1EUCB 3SHTA 3HE3A 5A02A 2ES4A 3KHSA 3VAYA 3RV3A 3TOZA 3O8NA 3ZNNA 4CM4B 1Y8QB 3GHYA 1OLSB 5DO9A 3OQOA 2UZ3A 3E8XA 4FYVA 4G2NA 2F43A 1SQ5A 4UTNA 2WAYA 2GAAA 1KEEA 4HQOA 1SQ6A 1USGA 3AO0B 1F2TA 2FRXA 2IYOA 1RQ7A 3BK2A 4CIDA 2X5KO 4RFSA 1N2CE 1XQYA 3IUBA 3STTA 4AO8A 1V8FA 2G09A 2KW5A 1SC1A 5EWLB 1U94A 1W5FA 4AJOA 2HMTA 5K99A 2B3DA 1J7JA 3DHYA 2NP7A 4H16A 1HQKA 2V3WA 1HETA 4FFPA 2A0FA 2HRRA 1PU2A 4BEBA 2XQFA 2AFHB 1RXWA 2Y0DA 3NTUA 3IP9A 4XOIA 3UANA 3K1ZA 5FEMA 2C5SA 2QG6A 2W2KA 3LECA 2H9YA 2Q1UA 3LLUA 1JHQA 1PJQA 2EU8A 4KR6A 1ZS9A 1U2PA 1W5BA 3VR6H 4CR8A 1IN5A 2ANBA 4H3VA 4JJAA 4MI1A 3GAZA 4Q9JA 1Z2AA 3OCCA 5CIYA 2RBEA 4A16A 1YA8A 2RGWA 3QLTA 5F64A 3JSAA 1D4FA 3Q1LA 5BSRA 2IVFA 4MDFA 5LYYA 4D0LB 4MKZA 1KS9A 1V7ZA 4B81A 1G18A 4O4JB 1OZHA 4IQFA 1DLJA 2IVZA 3OQJA 1XVTA 1XRPA 3NUGA 3C45A 3HGQA 1ZJ4A 1P19A 2H5LA 4Z51A 4BNFA 1DX9A 1F2UB 3I2GA 2ZJYA 2ZYSA 3OZVA 4CPDA 2BEUA 3NOOA 4PLCA 2BZ0A 2I6QA 3L6DA 4JN6B 3ED1A 1ZQ1A 3ND9A 4DREA 4WRRA 2RHDA 4Z2AA 1CJUC 2OO5C 5K3FA 5ELXA 2IZ5A 1G0OA 4B6QA 2QTGA 1LFAA 1PUIA 1NNUA 2C84A 1C3VA 4MVJA 1C2TA 1H8HD 1UKAA 1FYFA 3OLCX 4PVDA 3P20A 3W2TA 4EJ6A 2Y2VA 4ARCA 1J0XO 5ER6A 2V9ZA 1UP4A 1F2UA 4H1HA 5C53B 4C4SA 4IDCA 1HYBA 3BDIA 4H9GA 1GR1A 1AKRA 4IWXA 4Y7DA 1X9GA 4CKXA 5ADVA 1ZOLA 3D54D 5K0NA 5IVHA 2MSWA 3MERA 1LNQA 4WCFC 4CN9A 3PQFA 3JD1A 2V7BA 1MORA 1QLHA 4I3FA 4UTZA 1Q0TA 1OZ0A 2XRYA 5EKTA 3UXHA 4F11A 1CKEA 4LPSA 4PSAA 1NC1A 3EW7A 2B2NA 2EQAA 3ROZA 5B6PA 1AUVA 3DZDA 3EVDA 4OK6A 4DG5A 3T7RA 1TYBE 4IZ6A 3S55A 2IS2A 1X13A 3AI1A 2AN5A 1ZCBA 5F78A 5FV4A 4NXNB 1WP9A 3NBZC 3SFVA 3DP9A 1S7CA 1NMEA 3UICA 4J29A 5IVDA 2M1XA 4AROA 3B7GA 2ZRQA 4MICA 3N0TA 3FFBA 2I3DA 4B7XA 3Q2IA 5FYDA 3ZGLA 2FR8C 5DCWA 1AV6A 4U7PB 3WP1B 1QIHA 2BE9A 1O3YA 4LRWA 1AS3A 1DC6A 1SULA 3DWFA 3GEGA 3I6BA 4G0PA 2H65A 4LBWA 1A5SB 1FVOA 4ER7A 5KTTA 5FTKA 4RC9A 4LUCA 2BGKA 4D8TA 4JBLA 1YBHA 4KTTE 2VT7A 1COWA 1EDOA 2VPWA 3AJ8A 3DFIA 5DGTA 3CLSC 4MYRA 2OLJA 1FS5A 4D26A 5REQA 1B41A 3T8YA 1S96A 1F3LA 2XUZA 1E2UA 1WXEA 4RA6B 1ZUHA 3VPDA 4B82A 2FPWA 4HFJA 4KYTA 5ALOA 1LPSA 2C7RA 1M2GA 2BY4A 3RV4A 3NWPA 1K7SN 3GOHA 5DHRA 3V8PA 1W4CA 4REOA 2HW8A 1Z6ZA 3S2YA 4QOGA 1OZFA 2HRCA 2G17A 3TFQA 1CNEA 1QBKC 1WDMA 3WL6A 4ARZB 5B36A 1ST2A 1XVVA 3OLZA 4UBIA 4ISCA 3B20A 5C35A 4OHZA 4WY8A 3FNGA 1S2GA 3GELA 4XVQA 2P2YA 1YUBA 2PRIA 3TXAA 3N2KA 2HNKA 2FUNB 4RA6A 3H5RA 4D82A 5AM2A 5EJFA 1CCWA 2C97A 5AW2A 1UKYA 1IM5A 5H81A 1HOTA 1QPGA 1VDZA 1J5XA 4FUTA 4MI3A 1Z0AA 1QQ7A 4UMFA 3HJGA 1T9BA 4UE3S 5AVWA 2WD8A 1DKUA 2PXAA 3CRVA 2QN2A 1IPEA 1WS6A 3EXEB 3HZHA 4MVCA 2QB5A 3CVWA 1A5TA 3UT5B 1EHYA 1T0BA 2ZBRA 2VH1A 2QJRA 3VHLB 4RDXA 2CL7X 2WFZA 4HAYA 1XLTC 2A1TR 3I9LA 4YC7A 2BW0A 5BQPA 3NT2A 1YIDA 3EARA 1ZI8A 3LYHA 5FAXA 3W5VA 4M99A 4U6SA 4C29A 4E14A 1UXKA 3WAKA 4XM2A 2REQB 2W22A 3LO8A 2VT3A 1H3FA 2LD4A 3I0NA 5CLJA 3L77A 3QQPA 5JDCA 4LZAA 1P4HA 1T26A 2PJZA 1IYZA 4LMPA 4MZXA 3H87A 3L1HA 1KKUA 5FEUA 3C3JA 1QFXA 2PD4A 3ZOKA 1XFAA 2WIDA 3UH0A 5KWIA 4ZARA 3GZJA 4U2GA 1HRDA 1JG1A 2C5EA 2ZR0A 1R6UA 1IXYA 1GG2A 5FO0A 1FUIA 1QWOA 1Z35A 1F6WA 1CJSA 1XJ0A 3RHZA 5JECA 1DBIA 9ABPA 5AW1A 4LFBB 4X93A 1DQZA 3KAKA 3LHSA 3LPAA 2ORWA 3N76A 4WZAE 3UMGA 1DEAA 3Q11A 5TVKA 2I55A 4KE7A 1VPDA 2C03A 3SHOA 1ZN8A 2Y0EA 4MV5A 4W8GA 5CVDA 4N3NA 1Y1SA 2PUWA 3JQ9C 2GS9A 3L46A 4S3MA 4IMIB 1N9ZA 2AG0A 1D7OA 5K3FB 1EA7A 4Q47A 3PSHA 1GAWA 5DI9A 1OFUA 3PYLA 3R3ZA 4G5GA 3T3HA 4H6XA 3VJMA 1NUSA 4E0BA 2NV6A 4QG3A 3JATA 1MPXA 1NY6A 3QU5A 1W5AA 2HTFA 4GC9A 4MEBA 1ZXLA 4HUJA 3QMWA 4R81A 1TEZA 4MVJP 2Y99A 3RYHA 2K87A 3EXHB 1XI2A 2XMZA 1T6NA 1XVAA 1BX3A 4EOGA 2BKVA 1N1MA 1ZUNA 3TAUA 4Z4FA 4RY9A 2VSYA 1J1UA 1KYYA 2ZYVX 1WUIS 4XR9A 2QLNA 2WE7A 3BJZA 5B4UA 1QGUA 3BH7A 1D03A 2AZTA 4E31A 3A6JA 1NW8A 2D54A 4PTLA 3UFBA 1RM0A 2ZRNA 1OAKA 2IEBA 4K6KA 3TZCA 3C0KA 5A5GA 4IMRA 3UYKA 1KRHA 1CRLA 3NHPA 4Y67A 3CW2A 2Y6UA 1YULA 4ZTUB 4LN1A 3D1LA 4LOKA 1TTQB 1U1IA 4WW0A 1P91A 2BM9A 5IH3A 1MX3A 3HY4A 4G0OA 3OFVA 4LGMA 1AURA 3ZJYA 3ZOZA 3P0RA 1LV8A 2FPLA 3S29A 1GRRA 1E5DA 1GVHA 1TEVA 1UT5A 5FUBA 1UOPA 4TMZA 4ZANA 2OBBA 1Z08A 2D2EA 2K6GA 4D4GA 5GP1A 1OH7A 5BYBA 1I9CA 3MMSA 4L4YA 4RD3A 2Z8YM 5KSWB 2NACA 3DGFC 3H1PA 3NR2A 3QK7A 3I62A 2BMDA 3AKYA 3PZRA 1NKVA 4RSHA 5EMJA 5LMCA 2E4WA 4BNJA 2PLNA 1YVUA 2IXDA 4B71A 1EWKA 4LXHA 1K5HA 2PJUA 5EZSA 2PVCA 4RJJA 1VJCA 1WA5A 4AJPA 1ZLXA 1WTAA 2PFSA 3DLPX 3MW8A 3OC0A 4KK4A 4B4WA 1DCKA 5HUHA 3UWKA 1QZ3A 1V4BA 1MG5A 3DNFA 3GXBA 4C05A 4AJJA 2J41A 1E8NA 2FQ1A 4C2UA 3GARA 2FPGA 1T91A 1QHYA 2CHFA 1KK2A 4B6FA 3RF6A 5EGNA 1RLUA 3BIOA 3G2PA 3V2IA 1XZKA 1XQXA 1GA4A 5JLJA 1B7GO 3JAKB 1XG5A 1GGVA 3MN1A 5I3CA 3QVXA 2ODEA 2QTFA 4OXYA 2AR7A 2QK4A 4QUGA 4N65A 1RTKA 5KTRA 5AR1A 3VZBA 3ZCSA 1KI6B 1WNTA 5DV9A 3STHA 4C4ZA 2HBQA 3E7WA 5KNCH 1ACMA 4WMLA 1ZD9A 1NXQA 2H00A 4X7RA 4IJKA 1UZMA 4PONA 2ZYRA 3G9QA 3IB3A 3ZNQA 2B36A 1R3DA 1KJJA 2O8FA 2W6ZA 4MCHA 1WHSA 4F3RA 3AESA 2D6FA 2HQSA 4BVBA 1M7HA 1EK1A 2ZRBA 2FFRA 4MWSA 5K0GA 2WYHA 1DINA 1QGDA 1XD2B 3K0EA 5FI3A 3WLQA 4YYZA 1S01A 4B47A 3HN2A 4TS1A 2GSDA 4MVJE 5C3UA 3HO6A 4MEAA 4L76A 2GVNA 3LDGA 3R7FA 3QF4A 2ZI3A 3QGMA 1ULBA 4C4AA 4ZAYA 4F3TA 1HBJA 1MV5A 3E7FA 3OESA 3GH1A 1P9OA 3OPMA 4RY0A 3VU3A 4HT3B 2JHAA 1Q1ZA 3OSZA 4DV2B 1AX9A 3MVEA 5ED4A 3IR5A 2B0JA 1A2KC 1I4EB 4PGHA 1RWKA 3KALA 2O50A 1C0PA 4WKBA 2XB4A 2PYZA 2XVYA 5HM8A 4HDRA 4K9PA 4OQNA 5IDVA 1PTKA 3FKSA 2GCIA 3PFBA 1FZQA 2FW0A 2QNBA 2XA9A 3GJXC 3OZAA 5CFNA 3PWKA 4NKRA 2PUGA 4US0R 2X6TA 4OQFA 4UCQA 5L3ZA 4QYTA 1ZGHA 1XAIA 3CT6A 3MTQA 4U4AA 3IUPA 2JH9A 3EH1A 4U7TB 5D1NA 1T1GA 4PBSA 3HUFA 3QFTA 2O05A 3GG9A 3MRSA 5AJHA 1M8FA 1H8HA 4EUNA 3F49S 3ED5A 1KP2A 2X5JO 1NF2A 2YJNA 3OZCA 3R7BA 4AMUA 4HAOA 2JBWA 3GT7A 4S1TA 4TKUB 2HYIC 2R5NA 4RVCA 2GBLA 5AI8A 1UQUA 4XM1A 1TKCA 3A6EA 1CUAA 3ESCA 1OB2A 2OPHA 1I7DA 2EX4A 3G2LA 3CLKA 2XQKA 1K88A 4IQ0A 4PIMA 1SC3A 3T7JA 2OSVA 3C6XA 4FFBA 4MI6A 3GHHA 4JCCA 1I01A 3E8MA 3F6EX 1X39A 1ZNXA 2X15A 2NVWA 4ZVQA 3N3BC 2VSNA 3PNPA 4O4IF 2PUHA 1NBEA 1VCOA 1NQAO 4WXYB 4MRRA 3ZHQA 1GFWA 5AQ1A 4OHYA 5AKJA 3H04A 5C8ZA 2PJDA 5L45A 4AN0A 4OL0A 4P4SB 1BQ4A 4XYGA 4B76A 4DLYA 1EDDA 4PZAA 4BDSA 4C6SA 2GCOB 1KJ8A 2PU5A 1XEWX 2LDXA 3L1UA 4G23A 2C83A 3CE6A 3NHWA 4UZEA 1AMNA 1TX4B 3N74A 2OFFA 4QU0A 2XRMA 3WLPA 5JY1A 3PJDA 1IWPB 5BNWA 2IP4A 3CEJA 4FZVA 4KV7A 2JFVA 1XRRA 3NT4A 4QXQA 1RE0A 2QSZA 2W58A 1B74A 1QFMA 1LQ2A 2CF6A 3BREA 2P1RA 3DR3A 4RH0A 2NNLD 3KEFA 5JEDA 5EE9A 2DVMA 3L40A 4MGIR 5LYJF 5L40A 3STYA 2QMUA 5CX1B 3TCNA 1YZNA 1FPMA 2JKZA 4EPWA 2Z3WA 4M0CA 2X13A 3N8KA 4QNNA 5BSMA 1GPKA 1OYYA 1PZNA 4FGZA 1S2NA 1GYPA 3AEQB 4I4LA 4PVCA 2X4GA 4OHMA 3QTBA 4AKEA 5TF4A 5J2TA 3D3QA 3IR6A 1JB9A 3WHIA 2QI9C 3T7DA 5I45A 5LYJB 3D2AA 4FBGA 4QU9A 5DOZA 1CF2O 1ENPA 2PSHA 1SXJB 1BIFA 2QMOA 4C5CA 2CUZA 1ULSA 5BQXA 1PR4A 4IF6A 4LYDA 3R20A 4OP3A 2PV7A 2WJHA 3I2JA 4KX5A 4REQA 2VRBA 3D3WA 1ADBA 5LYJA 2ZUUA 3TM4A 1N0VC 2FJUA 1Q7TA 1H5QA 5GAJA 4GWKA 4ZYUA 4X62B 4IFEA 3K4HA 4KGDA 1TEHA 4OHCA 4E94A 1QH8A 5HK9A 2CXPA 2ZU0C 3AUFA 5A03A 4JLPA 2BHNA 1VG0B 2JZCA 2JAXA 2DCMA 4WINA 4AY3A 2EQ5A 4GKBA 4PZUA 2PKEA 3AERA 1SFRA 4C7OB 1BDHA 3AR7A 3QU4A 1UWCA 3PHIA 4F1JA 4ZJUA 9LDTA 4OHOA 3I5AA 3ZDYB 3MJFA 4KR2A 1LX6A 1XQ1A 4RYDA 5L9AA 2CHQA 1TLFA 2QM7A 3KUDA 4HNQA 2F1JA 4BKUA 4PN7A 2DBYA 1ONBA 1H4VB 4XI9A 1UKCA 2QMYA 4G9GA 4DMCA 4X65B 1GGEA 4X7MA 3LPLA 4K0KB 2JH8A 2YIMA 4OOEA 2BHTA 3VZPA 3X2FA 5EJ9A 1N2EA 4PAMA 3UKOA 5B3AA 5DGXA 3O3CA 2P4EA 3FCSB 3VU0A 4BRSA 3GIDA 3GN2A 5LQKA 5HF5A 1YNSA 3OZXA 2Z5FA 5MHTA 3A4VA 5LLSA 1JDTA 2ZXFA 4CKBB 1U2GA 3DKPA 3R74A 4B2PA 2CBZA 2O8EB 1B6GA 3OTQA 1SVLA 2L42A 1X7ZB 3JY6A 3MWLA 4EUHA 4DLRA 4R3WA 1LW6E 3FBGA 1XROA 4TMXA 1M1NB 3H9GA 5CU7A 2VHZA 4ME6A 1SEPA 4NULA 4RD4A 5EC8A 2F59A 2ZBEA 6YASA 5EQTA 2VDMB 1WPXA 2AOTA 3OIUA 1E2IA 3OIWA 4LDZA 2C4NA 3UJBA 5CVVA 4KIFA 4AMZA 4QPPA 3QVGA 4WCFB 4EARA 4JBIA 3TPFA 4DTIA 4IIJB 2C9OA 4IYJA 5CA0B 3QVGB 4F5EA 1RCTE 5ITWA 3K32A 1E7WA 5C4MA 1M6EX 5CVCA 1AQ6A 2PLRA 4BV9A 4WFIA 3VV2A 4EUSA 4IW3B 1CQPA 2AE1A 3RPEA 4IVNA 1Y63A 4P22A 4D80A 1Y1TA 5KKCA 2VDQB 2YOFA 4IOKA 4MQEB 4YWJA 3R7DA 3SM9A 3UMJA 1Z4OA 2FN4A 1TAGA 5DTIA 1Q7BA 1K7XB 1JJ7A 1CZKA 1UT6A 4TGLA 1BYUA 3KUKA 4ETWA 1PJAA 1DFHA 4IH1A 4AQ7A 1XCBA 2BFDA 3Q3HA 1GTJ1 2Z6UA 1JB1A 3HRIA 3IE0A 3DDCA 3G1UA 3P45A 3UQYS 1P81A 3JQ8B 4HEA1 4F56A 4PXYA 3FYUB 3CW8X 4C5BA 1N7JA 5FV7A 2YWEA 3BJEA 4LNHA 4V3BA 1BKDR 2HHJA 2PCLA 4RD0A 4Z9AA 3RSGA 3WMGA 2HFJA 1KQOA 1BEEA 4N5LA 4PC2A 4ER6A 5AVYA 2JIMA 4G67A 1NFRA 2QU8A 4XRGA 2XAUA 3UAZA 4IJWA 1NDHA 1J2RA 1M0SA 2GBIA 2X2OA 1YD7A 2ZWPA 3I2FA 3KK0A 3ZHZA 5EFZA 3SWWA 1HTWA 3AERB 1XCPA 3GLUA 2OA0A 3H2IA 4D3FA 4EG3A 4P84A 1RBMA 4C76A 1J00A 5CH8A 5L3SA 1EFTA 2VP2A 3GXOA 4YJGA 4AKGA 2I6GA 3PXEA 2GKOA 3DPSA 4GOOD 3CEMA 5HIJA 1XOIA 1KYIA 3JR7A 4GX5A 1WDLA 4HFMA 3MWKA 5CLQA 4FGKA 4FE3A 4XWTA 3D3WB 3ZVRA 3M4YA 1DWOA 3FRHA 4J4HA 1WB6A 4CMEA 4ZOQI 4P80A 2R7NA 2R7AA 4A10A 4EPYA 2Y76A 3JAKA 3QUCA 4MCJA 2J0QA 3QYAA 3L1KA 1NVMB 4AYTA 5EZ6B 4V3CA 5CG1A 3HLTA 3EPJA 1Q1BA 5HA5A 3VR2D 1SKYE 4YMWA 1Z5WA 2ISSD 1VPEA 3A9CA 6PFKA 2GBGA 3MAGA 3QXGA 3EXFB 3FPGA 4BMNA 2QRQA 4FXPA 4PIVA 1F2DA 1ZSNA 3GYGA 4EF5A 4DWVA 4OI4A 2F8MA 2R6FA 4WK4B 3EY4A 4GBMA 2C99A 1CLEA 5DT9A 3GGGA 3OX3A 1FX1A 2EIXA 2ZETA 3HVRA 4R16A 2IBSA 1N1DA 1J56A 5HWSA 3S8EA 4X64B 5JFGA 2FNAA 4UD2A 1NPTO 4KLRA 5DLPA 3ZHCA 3Q7EA 1QP4A 1G291 2GYYA 3L4BA 2LKCA 4P7JA 2G9ZA 3HBNA 1FTQA 4D9EA 4C21A 2WUVA 2FOLA 2E2WA 3ADPA 2Y0PA 3VMMA 2I1QA 3SFTA 2CV0A 4AJIA 4RZ2A 4BGEA 1G5HA 3ZHBA 1C41A 3FBWA 4R4JA 2P9CA 2VXBA 2YOGA 1OI2A 5E0KB 5ULLA 3WNZA 4HZUA 4J3FA 5EIFA 1A4RA 1O94C 3A70A 2PLWA 5IJZA 2IYFA 3G0DA 2WA2A 1GZSA 1RLOA 4CLRB 2NU7A 3ILSA 5HK8A 5HOQA 5MF6A 2XT9A 3OBBA 4YHHB 1NNSA 2NLOA 2XSZD 3ECCA 5IMBA 1DGQA 3A11A 3PUXA 4PGAA 2PMWB 5CAEB 1SU8A 1GU1A 4YPVA 1DJNA 1V6AA 3FSJX 4ROTA 4DLAA 4UAJA 1VJTA 2I2AA 2P2NA 2W2TA 4MLCA 3AIMA 1XZ8A 4O2AB 2QBYB 2WVHA 3EXHA 5SZHB 5F5LA 4ZJZA 4K9KA 2NO6A 1OWMA 5ALNA 1ZL2A 1DEHA 2ZVPX 5KKAA 2Z9BA 5ELLA 3A6LA 1PN3A 1R0YA 2WSBA 3CH4B 3ZJ4A 5KQMA 4KGVA 2VNIA 4IIXA 1A7JA 4GM4A 4N6NA 3SHVA 1B0AA 2ZG6A 4QWMA 4QJIA 1E5VA 1W29A 3GLIA 1SBNE 2AE2A 3WKEA 4JVSB 3AUAA 1NRJB 1AKMA 1IDOA 1Z68A 4UATA 2WWVD 3RABA 4ASUD 1RE1A 2Z04A 3FD8A 1Q57A 3JVVA 1E2DA 1TW3A 1DZ3A 2Y8EA 3FVQA 3GGDA 5EN4A 3EK2A 4HDMA 3R44A 2FP3A 3RTBA 1QPZA 4MVYA 1SY7A 4NBVA 5FQOA 5FJIA 3WNDA 1PFWA 3DLTA 4UVEA 3BX1A 3A10A 5HNKA 3A0UA 4GPZA 1L7BA 4TTRA 3D31A 1F6DA 1Y8AA 4BGDA 4B43A 1JWBB 1UC4B 1EZ4A 2CWDA 2I3GA 1R8YA 2F9LA 4HGNA 3BWVA 1IQPA 3IMEA 1Z07A 1DG1G 1JW9B 1SQFA 3LF1A 4CNBA 2J9YB 2WM3A 1TJ3A 5IANA 1F1JA 3NIBA 1U8TA 2Q3MA 3GQVA 3H5VA 3R7WA 1OAOC 3ERCA 1ULAA 4C3OB 3BD8A 1IUOA 5KU1A 2YKGA 1BXRA 2F1RA 2HBZA 2EJVA 3CR8A 3PC6A 3OO1A 2A5FA 4RK1A 3SYMA 4AP6A 5JWRA 4J16A 3MUNA 1L5GB 2PKCA 3K5WA 1UIMA 4H3SA 2CWWA 3FI0A 3KVNA 3NM6B 5KOJB 1YFLA 4F4HA 4JB3A 2AFRA 5EMNA 3T5TA 1E3IA 1KFEB 2DAPA 1H85A 2A9VA 3V9PA 3D1VA 3Q6NA 1Q0SA 1XDBA 3ZS9A 1IG3A 4BUJA 3EZLA 5C0OE 3SLKA 3LUJA 3TRJA 2PT6A 2Q3FA 4HDQB 4IO0A 1ORHA 2FK7A 1RJWA 2B30A 3KPUA 3J81k 3PS9A 3ZQ6A 3GWGA 3ND7A 2WOJA 1W36B 1WUHS 4M3NA 4IJMA 3ZHRA 5F51A 3GNTA 5AI5A 3C4QA 4ALJA 721PA 1U4NA 5KQRA 2MSEB 4WLOA 2GXUA 3CISA 3GZNB 2PBRA 2OBYA 1BXRB 4JB0A 4MQMA 2O8DA 3MC1A 1I3OA 4B31A 2QUJA 1VMDA 3N8DA 4R1TA 3H9JA 1BYIA 3FYUA 2XYVA 1KAEA 3HQ4O 1JE0A 2FX5A 4TLLB 5CVEA 5KCMA 2VSXA 4AZTA 1FJ2A 2AW5A 5HQTA 4OJQA 1U2ZA 4QJ3A 3HDYA 4K05A 3T5PA 1CEYA 2WW8A 3PWZA 4G84A 1XP5A 3QVTA 1JEYA 1WMFA 1C1YA 1YVRA 3EASA 4H7PA 2ZSIA 4WI1A 1BRTA 2OHFA 1YOBA 2G4LA 2GR9A 5COAA 1OXTA 3PKZA 4I5FA 3V4LA 3VR0A 1Q92A 2C5BA 2YVAA 4M54A 4TWAA 4F85A 2G1AA 4LF8B 1CVRA 5KWJA 1M67A 4ZAGA 7YASA 1FX0B 4KMMA 4UEOA 3WRVA 2GDZA 1G21E 4TLAA 3WTBA 4M8LA 3EZ9A 2C2HA 3L8CA 3T7TA 4BB5A 4C5AA 4UTPA 3D6MA 4FKZA 4CDNA 3AHIA 5K7SA 2B34A 2NP6A 2GN1A 1R18A 1JFTA 3R6LA 3ER8A 1TMGE 4DIBA 3NEAA 5D5QA 4AWAA 3E3OA 4KUEA 3LD9A 5CIQA 1PR2A 1ZN7A 5I7FA 3P32A 1PDVA 1TPYA 3GFSA 1X8KA 1ZD1A 3VTKA 4Y2VA 1EFPA 1WHTB 1MT0A 4LZNA 1TM4E 3CINA 4P93A 4RHTA 3TGWA 1FTGA 2ACWA 2JGJA 3IMKA 4G2TA 3WYDA 3PTZA 1FRQA 1T6XA 2B20A 3V1TC 2P8JA 1V43A 3TL3A 5ALEA 2H1VA 4MIEA 2OG1A 3JQAA 1EMDA 1R12A 3NONA 3OQ6A 1L5WA 1EM8A 4Z6KA 1GGHA 4MROA 2X0JA 4HHEA 5AOAA 5F2KA 3PEWA 2IBTA 1I7LA 4IV0A 1E59A 1NXWA 3DE5X 1BDMA 1NKTA 1XU7A 1Q15A 2RK6A 1R00A 2OK7A 1KU6A 3GGPA 1C5KA 4PBRA 1JQLB 2OC4A 1Q11A 3ME5A 2Z83A 3W8RA 1NMXA 1JQJC 1R6TA 4GKKB 2QNRA 1A95A 2R1TA 5FWAA 5JS2A 2QAIA 4TYNA 1PZMA 1ZM7A 1U8XX 2ZRKA 5F73A 4EJSB 2ZEJA 3KQSA 3EEBA 3U4AA 4WFKA 3Q4GA 2H0RA 3VDRA 4C7KA 1X15A 2FZCA 2ZZMA 1Z7EA 3A6HA 2SHKA 3AU8A 3FNHA 4KXMA 4EG0A 3VPCA 1JR3A 3HB9A 3DL7A 4B32A 1YO6A 2AMYA 2CDNA 3K0BA 3E35A 4MW4A 2R66A 4FJ2A 4H0FA 5JNTA 3K73O 3MCWA 3RS9A 2BBSA 3QUTA 4HQNA 3PNLA 5DGCA 2YMQA 2WWXA 5K8IA 3TWOA 4EVQA 3U4IA 2ZJ3A 2XOKA 3KAPA 4CIWA 1NW3A 1X94A 4M0UA 3KVOA 3RIMA 3C6KA 3F9CA 4YI5A 5C31A 4EA9A 1T8SA 1N5JA 4U7FA 4XGIA 2NUPB 2P1ZA 1YZHA 3JQFC 3V4SA 1OWNA 4FYHA 1SXJA 2H2DA 1C9MA 2IT1A 2ZRJA 3LLCA 5IK2A 3GMTA 2A35A 1N3YA 2REQA 4BKMA 3HUDA 3PRKE 1BNCA 4RABA 2NXEA 5KWVA 2OV1A 4QRHA 1SB8A 4OUDB 2VDKB 3UBMA 3Q15C 4YDRA 3WGTA 3P2MA 1BWSA 1YVDA 2R25B 4AM8A 2I3ZA 4PFSA 4Q3LA 2CFOA 2Q0XA 1RPJA 2NYUA 2HNBA 3DMFA 4UHDA 1K86A 2HHHB 1GKUB 1O4VA 4O4IB 4BRWA 1RABA 1C1HA 1BHSA 4G8CA 4L5YA 5EMMA 2HWXA 5BV7A 3QE9Y 4KR7A 5E8RA 3H83A 4ZKDA 2ZKIA 1K7YA 3TW0A 2QD1A 3JALA 2HV9A 2RAUA 4D74A 1PKEA 3ZXYA 3CJQA 4DRXB 1VI2A 5DK4A 4CWAA 3TQSA 3KAJA 2VEOA 1RFGE 2QMEA 5KDLA 3ZU4A 5BYKA 3BC1A 4M9RA 4WPGA 2JJ2D 4DKJA 1TVKB 2AQHA 4HLNA 1Y8QA 5LQUA 2PMBA 3JQ6A 3R3VA 1BCSA 1YU6A 1PHPA 3EAFA 3ZIUA 4EFDA 3DOHA 1NVGA 1E9FA 1PT6A 1WR8A 2I33A 4O6VA 3L0YA 1FLDA 1P74A 2O1WA 4ZOLB 4KRYA 1LK0A 3NAMA 3NWEA 4MDHA 1I0LA 1POXA 4N6GA 4NJEB 1RW4A 1FDVA 5DTQA 2ZYGA 4O5OA 4QOSA 3RAFC 2IUYA 3GO4A 2QRJA 1VHWA 1OWOA 3PFGA 3ROMA 3SZMA 3UPDA 1DUSA 3N2LA 2B5VA 1BJTA 3REOA 4KR9A 4B4OA 5BMOA 2VHUA 2CXSA 1Z6GA 3B6JA 3I1IA 1L4LA 1C8LA 1HH4A 2TRSB 5I7HA 3PX2A 2VSQA 4WN3A 1PT8A 4A2CA 3DBIA 1O97C 3GPIA 1Y5RA 3Q3EA 5IUNC 5GJCA 4WCFA 2DCUA 4YCNA 3CF4G 2IV3A 1NXXA 2KB0A 3KOMA 1RWVA 1A72A 1RWMA 3O03A 4O25A 1UMBA 2O7NA 3X2EA 5J2TF 3SJBA 3VC3A 4DSZA 1XJQA 1M1NA 3BWYA 2ORIA 4LOHA 4UUPA 1TMYA 5U9CA 1Y6GA 3MJTA 3OZDA 2EP8A 3M4NA 1GZUA 2ZSFA 4UBMA 3LIPA 3GMIA 4M0FA 3BCRA 3O1JC 2I7DA 3PXUA 3OZRA 3HU2A 1ZW6A 2W2LD 3TCKA 2O23A 5GGXA 1H65A 2JK1A 2XD4A 1EVLA 2WWRA 3OOWA 4M4SA 4N01A 4CL3A 3UHAA 4EO9A 4Q4CA 2R1UA 2A0YA 2HA5A 1IK4A 1XZIA 4GMKA 4MAMA 1U0LA 1ZWLA 3DM5A 3WQSB 1B8UA 2W2MA 4B1FA 4B48A 1SWWA 1GAEO 2WYOA 3KP1A 4DF3A 3HGMA 4GPTA 2H7YA 3IQZA 2Y0BA 1WPRA 4TVBA 3ZE7A 3QPCA 2FHPA 4PLPA 3VFDA 2BM1A 3Q41A 4L9RA 4I9NA 4Q37A 4QGBA 4CMIB 1LV7A 2XW6A 2HA0A 3JQ9A 3RW9A 1AB5A 1E1CA 1MABB 2AQ8A 3HWSA 1LLUA 1BU5A 2LPMA 4MGKR 4BGVA 4BMDA 2BFPA 3SKYA 5LDHA 3SBDA 2J85A 5BR7A 3LL7A 2BEJA 3BWEA 5EPOA 4A23A 1GRCA 4K6GA 3LBNA 4DYVA 2YJ4A 1N2CA 3D2BA 3IOBA 5BVGA 1XHEA 1Y3CE 2EF1A 2HJGA 3A37A 1GDDA 4PTYA 4C7BA 2OZKA 2V3VA 2IP1A 3DBLA 2B9EA 3WGUA 4TQGA 2RHBA 1RRKA 1KO1A 1Z88A 2BGTA 4HN4B 4V0KA 1QZXA 4U9IS 1GRNA 4RHCA 4Z1MD 5HUJA 5JTUA 1E9EA 5MDHA 3ID6C 2VLIA 4KIUA 2PXHA 1NRWA 3LT4A 3VH1A 5DNEA 1L6IA 3OPYB 3EPHA 4UTOA 5EJ6A 4HOYA 3K0HA 3PLAE 2OB1A 2DFLA 3OZTA 4FYJA 2GJ8A 1VJGA 3N2EA 2CK3A 3CF6R 4Y8VA 1AQIA 3OD1A 1UXGA 3LXUX 1TT5A 2I5PO 3WIOA 2WSMA 2J6BA 4NNPA 4RMIA 3SD7A 4M0DA 5EMLA 3TLGB 1DMRA 2AD1A 2BKEA 5T41A 5BNTA 3EIUA 1Y6QA 1F7VA 2NT4A 4LJ9A 4HUQA 3I23A 4D98A 5F12A 2IQIA 2V96A 1YKSA 1JTVA 2TS1A 3NBMA 5KYTA 2E4ZA 1MH9A 1JMYA 1HG0A 1NM5A 1QIJA 4XYBA 4Y2SA 5G0SA 2FTKE 3TKLA 5HX7A 2GQ0A 2UVDA 2ZSKA 3PCXA 1A7KA 4RFSB 1L3IA 4ZCMA 1VKHA 3T9BA 1SOUA 2PKWA 2BKUA 3BWDD 3TEJA 2ZVDA 3K9LA 4R51A 4RPLA 5JD4A 3RVMA 1ZI6A 1QANA 3I92A 3MGKA 3IQHX 5EXTA 4M7PA 5KVSA 2XNKA 3GRPA 4CEIA 4E4TA 5KPDA 2E4YA 5IK2D 1E2PA 2WD9A 2H16A 3HRKA 4U9HS 4RKWA 1CHNA 3KYDA 1P3DA 4AQDA 2EJCA 3EA5A 4G1BA 3QELB 3W4KA 3UVEA 4QBGB 2XOKD 1RQLA 4HF7A 4MPTA 1O6CA 1GUAA 5I8ZA 3NAGA 1QR6A 2XYHA 4PPYA 2ZT6A 4D4IA 1I2DA 1G4UR 4GBED 1BAPA 1N6HA 1RMQA 2PE5A 5K6AA 2I2DA 3I04M 2W98A 1M7BA 1JR3D 3AFNA 3IEIA 3GFPA 3RYHB 1XDWA 4N9QA 3WLIA 2PR2A 1RQRA 1W36C 2A1UA 2UUCB 4JFRA 5J4HA 3OMXA 4MP8A 5DX8A 1D3AA 5F1PA 1FL9A 5BQOA 5CT6A 2NSYA 1FYXA 3E81A 4NATA 1WCWA 3M6AA 4DBVO 3U60B 3REQB 3L7KA 3KQKA 2OQRA 4ENSA 1GPNA 4CMIA 2HF7A 4D25A 1KEZA 2CL0X 2QD2A 2ZRIA 4IV5A 1OI7A 4PZCA 4B6OA 3L1VA 3V7WA 3WGVA 3E4CA 4QXMA 3RSCA 3VSBA 5JYCA 1YR8A 1KQPA 5KVVA 4ALMA 3QUQA 2VNAA 2H7XA 4J91A 4KWHA 3G82C 1WBJB 1I3NA 3IXLA 1E1YA 4AZ0A 3VNRA 1CIVA 4LECA 3VAZA 5BW4A 1P7WA 3EGIA 5JALA 1U3CA 3EIFA 3BB4A 5FBLB 1KIMA 3B6MA 1EUZA 2Q1SA 4TTIA 2ZTHA 1V8DA 2MSCB 2CVPA 4FCTA 3BQNB 2YYAA 3T54A 5CGQB 5G0UA 2F4VB 5IJAA 2J3EA 3F3SA 1RPTA 2XB9A 3E70C 2IP2A 1DPGA 3WL4A 2ZBDA 5A6SA 3AVUA 4RENA 2RHJA 1JECA 2GHTA 4FGWA 4V0QA 1JJFA 4YN3A 1NI3A 2PT9A 2YCLA 2W4QA 1IQRA 1GPJA 3C6YA 5HIIA 1E0SA 3OBIA 4M37A 3TTXA 2G9UA 2NU9A 2AYYA 2WG1A 2VZLA 2J4DA 1RU3A 1M74A 3LY5A 4M7RA 5H3LA 2QLJA 3V1KA 1EVZA 2GMWA 5AK4A 2XMBA 1KO4A 5EJ8A 3FNIA 3CH5A 1K5GA 4BMSA 5EKDA 2COUA 4EO7A 4W5OA 2NO4A 2HLDD 3QW2A 4K1XA 1KI6A 1ZH0A 1TIBA 3KZOA 2R8RA 4RCYA 4DA4A 2D74A 1U0OC 4QJ5A 5DK6A 3ZIDA 3ON5A 3GIWA 5K8CA 1OTYA 2QBYA 2V58A 2ZZNA 5T8KA 2RHRA 3U7EB 4XR4A 3ZGOA 3KSUA 3DVAB 4QGSA 2BGRA 4IIEA 3L9XA 2RGYA 3WYEA 1KYZA 1H2FA 2HJWA 2Q45A 1ZP6A 2XCQA 1N6IA 1MQ9A 1URPA 1XRNA 2JFYA 1BFKA 1KGDA 3PDIB 3GH3A 2AZDA 4ZODA 1DV1A 2H2WA 1QC5A 2HA6A 3R3WA 1G21A 4EJSC 1A96A 2GF0A 1MAUA 3GLHE 4ZVVA 1A27A 1M1YE 3UXYA 3WWPA 2B98A 5ESWA 2OBLA 3DUFA 1C81A 3VOSA 4JUFA 4E5KA 3F67A 1ESNA 1DO2A 5MN6A 3PEFA 1LDMA 3CKKA 3ND8A 4HP8A 4P3KA 4XPZA 4YAJA 4Z3DA 2NPIA 4C4TA 2LKDA 2IXAA 1X9HA 2XYQA 3TRFA 4CG3A 2JAWA 3M1YA 1BZYA 3AT1A 4CG0A 4E09A 2QPLA 3SKXA 3NIDB 3AEKA 1HPLA 3X44A 4RTQA 1BE1A 2JLZA 4YV1A 3C8HA 5EOVA 1A2OA 4V0ME 5EUCA 5BNFA 5LUBA 3HPQA 5D3MA 4ZVOA 3U4GA 2CXOA 3MWEB 5ICMA 1YL7A 2IRWA 3KOOA 3SNHA 3VI3B 1U28C 3GEPA 1EGMB 2Z2KA 3DQQA 1ZGAA 1XZDA 4BRUA 2VK1A 2ZYUX 3OEYA 4XIGS 3CLUD 3KHTA 3CB2A 5LZ8A 3UMMA 1UBMS 4LYYA 4NDZA 3AF1A 3N2ZB 2JZOA 1K8ZB 1YKGA 2OD2A 3AF5A 4KI0A 3ZU3A 3DBLB 3L4KA 1FVXA 1ZUNB 4ZJYA 2ODBA 1EFAA 3CEPB 3ONFA 3TW8B 5BWNA 1ONPA 2FQQA 3PITA 4GC5A 3ZD9A 3F3MA 3FZEA 1RYMA 5JADA 5ALJA 3UK6A 2VDVE 3AF0A 2A1TS 1PJTA 2LIPA 2W83A 4MV1A 4Y6SA 2UZAA 1DARA 4ZDIA 2QXUA 3KFVA 4KGZA 4UQPA 4RIGA 1M1UA 2ONJA 3DOOA 4LYGA 4RTLA 1UFRA 4WY2A 2VWGA 4NX2A 4RVNA 3NRBA 1W5EA 3K35A 4NICA 1OFIA 2VI5A 3PD7A 2PA0A 4OB8A 4XTCS 5CM9C 1F6BA 1LA2A 2AC7A 4UHKA 3ROQA 3MFQA 3ZDXB 4I55A 4AUKA 2VDJA 4JLKA 4LDJA 2ZPUA 5DT2A 4U2BA 1YS7A 4GNKA 4J2OA 1BDBA 1YOVB 4KMSA 1GZ4A 3IP6A 5DDIP 2HMAA 5DXAA 3JQPA 4DIMA 2VJPA 2WWIA 4YWHA 5HIMA 3ACCA 4BNMA 1D1TA 2DUJA 2F1HA 1TYEB 1YF3A 1B93A 4EKNB 1RWWA 2X1LA 5J4YA 3ABOB 4QUBA 2ZVJA 3RKSA 4TX1A 2QQFA 2IY9A 3PK0A 2QTAA 5CNIA 3WYNA 2I1VB 3B70A 4FOPA 4HSGA 1P0QA 3OM8A 4BB6A 4BO8A 3CF4A 3F4KA 3MG9A 4OFWA 3LBHA 4B80A 2A7XA 4BNWA 4G9EA 5CHYA 4IDEA 2DWUA 5G02A 5FFMA 4XVHA 4BWGA 1KP3A 4KDCA 4UU8A 4XDZA 1ONNA 4EA7A 4BBJA 3I32A 1IE3A 4YGXB 3H6GA 4KODA 1FX0A 1GQ2A 3F74A 4MUBA 3SYNA 4B34A 4QECA 4I66A 3MM4A 2RAFA 2X9NA 3ESZA 3K8OE 4WXEA 1DNPA 3CR3C 1KKMA 1BX0A 3FI9A 4RCVA 1K6IA 2IYRA 3ZU6A 3IPXA 4OJKA 1QQ6A 1F2TB 2RBGA 2PVSA 1N2ZA 1U4OA 4A36A 1U63A 3I53A 4DM3A 1ISSA 4L22A 1R64A 2OAP1 3ZJ5A 2HDWA 2O8CA 3KQWA 4QOHA 3FJ1A 4ESEA 2AIRA 2OQIA 1BE8A 1RI2A 2H85A 1BCSB 4MVJG 4CQMA 3G0HA 3ICQB 5TSDA 4CCSA 1UK9A 2KS6A 1MCZA 3PXXA 3ZYCA 3LK6A 5JS1A 3ASZA 3UT0A 2R6AA 2YZKA 4HAXA 1YMQA 4MUYA 4FINA 5IBRA 4LJ7A 4NG4A 4UEWA 1N32B 1YGYA 5KHAA 2A88A 2V4ZA 2YFKA 421PA 1HDRA 3PC4A 1C8VB 3MEQA 2BFFB 4R1OA 1CWUA 2DU8A 3NJRA 1FCJA 1G20A 3DJFA 3RYTC 4NQZA 3ZE2B 1SM4A 1NSTA 3DAOA 1HDGO 3WMEA 2GEUA 1NJ1A 4NK4A 3RBVA 4BO3A 3ZCPA 4MVXA 5CXXA 1F0PA 4E11A 5FWYA 1QLJA 1YZKA 2Z4SA 3KHUA 3F7NA 1PLKA 2OHXA 4IEIA 4AMBA 1KMNA 1M3SA 1RXUA 3GDFA 3AIIA 5DSXA 2X0FA 4BPBA 2O5CA 4IUDS 1VE1A 4KO4S 4OUDA 3TSWA 4I9HA 4YT8A 1C9YA 3L7YA 3WK8A 1OD6A 3EVFA 2R6GA 4PS0A 2CFSA 4HWGA 1CZNA 4UQOA 1VHTA 4XASA 1YSCA 2VOEA 3KCNA 4IDHA 4ND2A 1LJ8A 3R5KA 1H1TA 3D7RA 5HGJA 4JC5A 7ABPA 4Y30A 1XTVA 4LZZA 4BBZA 3FPAA 5KTMA 4EGJA 1OT3A 1WXWA 2D0PB 2WB4A 2X5XA 3FGZA 4LRTB 4B73A 2W6CX 3RFUA 8AT1A 2CDBA 4GLLA 2YBEA 5HKAA 1XU9A 2R4QA 3A1NA 3DEJA 4G65A 4MW9A 5C5IA 3RSOA 2ISCA 2IV7A 4ND1A 1CUHA 3FHOA 1OREA 1SBYA 3L7CA 2FEXA 1UP6A 4J7AA 1FA9A 4JVOA 2GD2A 4E5SA 3RG8A 2OV6A 3MTGA 2GK3A 4J1TC 4KDEA 4YP5A 5TY0A 2JG3A 4HQLA 3Q85A 2UYYA 4B75A 4D0GA 3WA6A 1AMOA 2PM8A 5GVRA 4F6RB 1EJ0A 1Q44A 5GJVC 2C92A 5GMOA 4G0XA 5HPYB 1ORDA 4RLFA 4YX9A 3AF3A 4C9BA 1WUKS 1YQXA 4TV8F 1R16A 3FYSA 3Q6MA 2DUUA 4NYMQ 4FOSA 1JAHA 4INZA 2Z2JA 2GJAA 2Q6OA 5CLIA 3B85A 4UTVA 2JRLA 1ZBDA 3E61A 2MR6A 4AJNA 1PS9A 3CVJA 1KPHA 2AQKA 1PR5A 2X2PA 3AR6A 3Q40A 4INOA 4RDIA 1XHFA 2Z9CA 5CYOA 3UXMA 3V1UA 1ZMBA 5JC1A 2JFQA 5JWOA 3BD9A 1INLA 3K0CC 3P71T 4ISBA 2NG1A 3E1GA 4GRAA 1SHUX 3W5AA 3HXKA 3TW8A 3L41A 1UADA 4OB6A 4Q3KA 1FTNA 1X7WB 2OHGA 2IEAA 2J3QA 1N7HA 1XDSA 1AHHA 3JQAB 3MOSA 4R6XA 1JSZA 3N0VA 3CRNA 3HZRA 3IQFA 4KFUA 2AEEA 1GGMA 1DQSA 2G1KA 4PZDA 1RM4A 2V9PA 3AUJB 4LBZA 4MR9B 2ZWAA 3RVKA 3ML1A 3FPSA 2ZB7A 3GUZA 5CIWA 4ZV7A 4W1RA 5CYPA 3OM0A 1E7RA 1BKSB 1CVIA 2H92A 3BMCB 3WX0A 3S2ZA 1MEEA 2EGGA 4KO2S 4N76A 3FTEA 1FYEA 4MQ5A 4N03A 4PU0A 2H1OA 4CEJB 4GDMA 4JP2A 4D43A 2EL9A 1OHHA 3OLQA 2ERYA 2V6FA 3TNYA 4GKJB 3UJPA 1DX6A 2CLSA 3B6IA 4F96A 2HPZA 4K9NA 2AZXA 2BC9A 3WL8A 5A9SB 5ILOA 3IELA 4BNDA 1OPRA 1NMZA 2C96A 3GCWA 3IBSA 5CLLA 2FI1A 2NU6A 2O3TA 1Q7EA 8ABPA 2Q4TA 3K0KA 4Y1FA 5GTDA 4D3SA 3OY2A 3DBHA 4MDYA 1DAPA 3KAQA 4YAWA 1NWCA 5IFKA 3KWFA 2B8JA 3KQYA 4E2YA 4M22A 3SC2A 5LD2B 3QPWA 4HO1X 1KEEB 2Q8QA 4GLFA 2DPYA 2NXWA 4K9OA 4RDHA 1G21B 3FXAA 1FNNA 1EXWA 4RZXA 1RHQA 3MINB 4ZT3A 2A4MA 2VA9A 5AVKA 4BE4A 2J3LA 5HJEA 4L8VA 1NLMA 1CJVC 4OU4A 4MW5A 1XRMA 3PDIA 3I64A 4I19A 4JXJA 5EESA 1XTQA 2FZVA 2QTWB 1TD1A 2HCTA 1WMAA 3CJTA 2QTVB 2HDHA 4XD2A 821PA 1XTUA 1A82A 1QDLB 2IPOA 2PL1A 3NETA 4DBLE 4MPPA 5DBGA 5IBPA 2B8WA 1ZH2A 3LVBA 4WV3A 4C07A 4XGRA 3DTTA 4ZXFA 3TXXA 1BFDA 1DWPA 3KTFA 2W70A 2X0DA 2H54A 4KV9A 4N7JA 3O31A 4V0OA 1M6VB 5KOHB 2P6RA