1FBUA

Heat shock transcription factor dna binding domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
b'PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK FACTOR PROTEIN
molecule tags Transcription
source organism Kluyveromyces lactis
publication title Proline in alpha-helical kink is required for folding kinetics but not for kinked structure, function, or stability of heat shock transcription factor.
pubmed rcsb
total genus 25
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fbuA00
5FB2A 2XGXA 2W85A 1JHHA 1L0OC 4TV7A 3I59B 5FLXK 3SZPA 1ZG5A 3T8RA 5CVJA 1RIOH 2VN2A 5LLQA 1FY7A 2RNJA 4PGGA 5HDGA 1BIAA 3F21A 5FFZA 2IT0A 2MH9A 3I54A 3M7GA 3WTWC 1JGSA 5DEQA 1YQAA 5H6QA 3G3ZA 5FD5A 3V8KA 2LKPA 3KP2A 1GHCA 2P4WA 1XB4A 3LQRA 2FMLA 1IN5A 3K1NA 5E8IA 3WE3A 3ABUA 4S04A 2RQPA 3MCZA 2WC2A 3QU6A 2ACJA 1XGNA 3ELKA 5HDKA 2XIGA 1LQ1A 3KZZA 3ECOA 2DQRA 4ZYEA 2Y75A 4FX4A 4M9SA 5L3BA 1KQ9A 1LVAA 4EJVA 2VT2A 1FSEA 2CWEA 1T6SA 3HRUA 1QBJA 2HTJA 5AIQA 5ICEA 4IRIA 2K4BA 3T5XA 4LGWA 5CYVA 4GXOA 5LEJA 2DPUA 1G6NA 5K1YA 5DUIA 2MLGA 1BJAA 4JK1X 3RKYA 1SMYF 2A3SA 3IKVA 3GWZA 2HQNA 4BHBA 3J80Z 2QLZA 5A2QK 1KYZA 3J7AO 1U5TB 1GVJA 3SFZA 1TQPA 2ESNA 2QWWA 3VODA 3HRTA 1EV7A 3F8MA 1MJAA 4HDUA 1FPQA 4NHJA 4BXUA 5ERIA 5DCFA 2NNYA 3CUOA 2ADUA 2VE8A 1J75A 4QWQA 2M87A 2FEZA 1CF7B 4RAZA 2CO5A 2QQAA 2OZUA 2QZ8A 5D4SA 4RGSA 1R1TA 5H20A 4YFXF 1WWXA 3S2WA 4LLNA 4LK1F 4I0AA 2MH2A 3MQ0A 3HUGA 2A07F 2CQKA 1ONVA 3TOBA 2EFWA 4L0ZB 2RV8A 2AS5F 3NEUA 5H6RA 6PAXA 1FBUA 4M72A 5TRDA 1HW2A 4Y13A 4I0BA 1ON1A 1CGPA 1J59A 3GZ5A 2XAGA 4RGXA 3LSTA 2A5YB 4HV5A 5D5WB 4MNUA 3HRSA 3L7WA 4KA4A 1REPC 3LQQA 1FZPB 1TW3A 3Q9VA 2OU2A 4I2OA 4AIJA 1XD7A 1BOAA 3I4PA 4CICA 2QM3A 1DDNA 1LJ9A 4A0YA 3WG9A 1QO0D 5LBQA 3CO6C 4YG2F 2IA1A 5A2QZ 1R58A 1FP1D 1F1ZA 4AIHA 4WCGA 4MQVA 3ZN1A 1BBYA 1XDUA 1R36A 5HS8A 1QZYA 2CSOA 1L3LA 2O61A 1O3SA 3ZMZA 4RB3C 3LWFA 3I0TA 5D8LB 4XRFA 5JVTA 3FMRA 4OIOF 1TQIA 3QOPA 4MGRA 1OKRA 1YO5C 2RGVA 2Z5UA 4HF2A 3P7NA 1G3WA 1JHFA 5E20A 4HX7A 3SHFA 2FXAA 5D5VB 4MQ9F 2EK5A 3NQOA 3BPVA 5TJJA 3E6DA 4KIFA 2P8TA 4UV9A 3ULQB 1W7PD 4OIRF 4FX0A 1HW1A 3P9KA 1BI2A 2O0YA 5K5OA 2DPDA 5BOXA 3FXRA 3V7RA 3V4GA 1FYLA 1I6XA 2V6CA 1XGSA 1QNTA 5DUKA 5JR3A 3HOSA 3LA2A 4I98B 4G7OF 3JAMK 1B6AA 3ZMUA 1T98A 1XSXA 1FNNA 2FOKA 4U0VA 3KCCA 5LHIA 4OIQF 3C1DA 1I1GA 2Z3YA 3L9FA 1TLHB 1KYWA 4IHSA 4H0EA 2EA4A 4LG0A 2HTSA 3M8EA 2DO7A 4UHTA 2FA5A 3GXOA 4KUMA 5FGMA 3PQKA 3QRFF 1P6RA 4MEXF 1O3TA 5E8GA 3F8NA 4N9HA 4OU0A 1D5VA 3EETA 3RPUA 2P6SA 3R61A 4Q48A 3BY6A 2FF4A 4GYGA 3V8JA 3DQVC 1RNLA 4QLCU 3ZMVA 1FX7A 5CLSA 3K1PA 4EGZA 1S7OA 4IRGA 1DPRA 4A5MA 1FWZA 3EYYA 5E18F 1TNSA 3RPQA 1IXRC 4L9NA 2CW0F 3U1DA 1T2KA 1ZH5A 2JPCA 2EFOA 4RS8A 2STTA 5E1ZB 2H27A 1VTNC 1HXDA 4MHGA 4KIBA 4O3MA 2XVCA 5ILSA 1ZRFA 2PJPA 3KEQA 2VC1A 4EJWA 2K4JA 3BJAA 1EH8A 4IHTA 1QPMA 4EVIA 4M74A 1MDMB 3FZVA 3GF2A 4G7HF 2FNPA 4KN7X 1SFUA 1KU3A 1YW8A 5FFXA 3LAJA 2V1DA 3WODF 2UXXA 5DD8A 2QUFA 5LEKA 1XSDA 2KIUA 1KU7A 3HOTA 4HA8A 3IRQA 3J80K 2GXGA 4EGYA 1YIOA 4NQWA 3WTTC 5D4RA 2A68F 5CVRA 3TDUC 2EFQA 2HOEA 1IN4A 4HX4A 4AVPA 1QGPA 3KZYA 1J0RA 4HAMA 3WTZA 4XSZF 4WXDA 5HDNA 3KP5A 1SD5A 4A5NA 2HWVA 4CHUA 3I71A 4OMZA 3CUQA 1U3EM 3HHGA 4O5VA 2ISYA 1U78A 2EV6A 3SQNA 1ZHFA 1YW7A 2V1UA 5AIPA 2PLYA 3IWFA 2STWA 2EFNA 3RIRA 1I5ZA 3F3XA 1WKMA 4AD9A 3GLXA 2W24A 1OPCA 2GZWA 4P9UA 1OMIA 3CJNA 3KETA 1XMKA 5BPIA 3ERED 2L4MA 1U2WA 1YLFA 5LGTA 2L54A 4G8XA 4XLPF 4GO1A 3E6MA 1K78B 3FXUA 2LF7A 4M6YA 3KP7A 3KLNA 3DXJF 2VOPA 2GXBA 1USTA 4IXAA 1Z6RA 3VEPA 2J5OA 2M1BA 1YS6A 3T0YA 3R60A 3HIFA 1W5TA 1J9IA 1IF1A 2FNAA 2GWRA 4HQMA 2L02A 4OIPF 4ZYGA 5HOOA 2HYGD 1SFEA 3RTRA 2DAOA 2KIFA 3I64A 2EB7A 1PP7U 4RAYA 3K0LA 3R0AA 5E1XA 3IWZA 3SXYA 4R8HA 2EA2A 3N4MA 3DEUA 2DI3A 4O6JA 2A6HF 5EEGA 2BV6A 2JPBA 1FOKA 2DLLA 1LNWA 3FM3A 1TNTA 1ZGJA 1G3SA 2V1XA 1PUEE 2HDCA 5HLGA 3BZ6A 2OAZA 3W6KB 1HSTA 2VBXA 5IT3A 2BBYA 2R7DA 4MTDA 1U6GA 4IVNA 3DV8A 1IN6A 1YS7A 4WF2A 3IL2A 4UVBA 2Z33A 2QBYA 1IAWA 2HKXA 3CUQC 4RGUA 2OD5A 2GQQA 4B09A 4LLGF 4U7DA 3E5QA 2FU4A 3TDZC 3GW2A 1O7LA 4AIKA 2A69F 4ASNA 3FHZA 1R00A 5HVQC 3O2PE 4RGRA 2W57A 1ZRDA 2RC4A 1JXSA 4LLLA 4BNCA 2DT5A 5DDGA 1WRJA 3MAJA 2ZCWA 4KYWA 5J8FA 1R1UA 3E6CC 1BI3A 2X0LA 2WWYA 3ECHA 5KK1A 5IT9Z 4L18B 1B9NA 2PMUA 4K2EA 1H9GA 2YPRA 3H3UA 4ZZDA 2H09A 1IW7F 1UFMA 1O3QA 2XAFA 2HZTA 4ESJA 3QAHA 2BE5F 2ZFWA 5JHUA 3BPXA 3KP4A 3F22A 1YG2A 4PGHA 1QQIA 3R4KA 2FMYA 1F5TA 1O7FA 1UHWA 4HZFA 1XGOA 5L3GA 3MFKA 2K7LA 5HS7A 4BQAA 1IXSB 1IZ1A 2PI0A 3V7CA 3P9IA 4IRHA 1ZLJA 4A6DA 4ENKA 3IKTA 2CG4A 2MBFA 3KP3A 2ESHA 4Y15A 1K6OA 4EJTA 1EH7A 3JSOA 4FHTA 3ZQ7A 4U0WA 3V7SA 1SFXA 4WK8F 2OQGA 3V8LA 3BJOA 4WXCA 3LA7A 5J8CA 3E5UA 2IPQX 4BYYA 2GA2A 2B0LA 1XN7A 2F5FA 1NHAA 2E1NA 5L3DA 3JW4A 1W7PA 3L2CA 4PCQA 2ZJ2A 4I02A 3PFIA 2XKPA 3ZN0A 2LNBA 5DCMB 3ZPLA 3TQNA 1T38A 4ESBA 3WGHA 1BI1A 1XMAA 4IF4A 3WTUC 2RVCA 2YX7A 1D3YA 1X3UA 2RKHA 1SD6A 3IC7A 1FYMA 1S8NA 5DYMA 2E1CA 1DPUA 4KN4X 4BHPA 2O03A 1MKMA 1D8JA 4HDVA 2JSCA 1Z6TA 5IT9K 1B4AA 1LB2A 3J81K 2MD5A 2G7UA 1TQMA 4KDPA 3F8CA 3RYRA 2XKOA 2IA0A 2AXLA 5HS9A 1RUNA 2W25A 4ENJA 3G73A 2P7CB 2YSRA 4YIFA 3COAC 2L3DA 3C3WA 3BROA 2KJBA 2DQLA 2IA2A 1R5GA 4EV0A 1G3YA 1ULYA 3K69A 2QENA 2ZNYA 3ISPA 4P96A 3QP5A 4OOIA 3LAPA 2DK8A 4E70A 3GZ6A 3R6SA 5D5XB 2PQ8A 2F5CA 2ZXJA 3GFMA 2O3FA 3ZMSA 3HSEA 2ZKZA 1ON2A 1BM9A 3OV8A 3I53A 3HYIA 2QVOA 5FD6A 2J5PA 3GUDA 2XUBA 2EJRA 3U9GA 3B73A 2DBBA 3ROUA 1MJ9A 3VB2A 1K7AA 2NRAC 1OR7A 3CUQB 3QP6A 3DPLC 4U88A 3MZHA 1QZZA 3I5UA 2VBZA 1ZAOA 2OA4A 1Z9CA 3RKXA 4I01A 5K5RA 1XCVA 3JSPA 3CLOA 5ED4A 1MGTA 3D0SA 5BQTA 1G4DA 2WV0A 2PEXA 4L5JA 2FBIA 1LDDA 1H9TA 4AWXB 1ZG3A 3FMQA 2JRTA 2D1VA 2GIVA 2JZYA 3HSRA 4JBAA 3RYPA 3U2RA 3T8TA 1FP2A 2V79A 3F8FA 1I1SA 2ISZA 4EM1A 1CF7A 2ETHA 1OYYA 4ENMA 5DCMA 1MD0A 3JTGA 2EV5A 2VE9A 1Z05A 3E97A 3WTXC 2LF8A 2HS5A 2Y0MA 2VONA 3FWEA 2VBWA 3BJ6A 2GAUA 1KA8A 2P5VA 4M73A 2P5KA 2P7VB 1ZG1A 4KT5C 2QYOA 2R7FA 4EM0B 1IRGA 2FSWA 1MJBA 4I09A 2QQBA 3L00A 5ICGA 2HFHA 2YX4A 3M8FA 2COMA 2CGPA 1TTYA 1F4KA 1LEBA 1T0FA 3ML6A 4UUVA 1UCRA 4KICA 2GA1A 3N97A 2X4HA 5ICFA 4ZYHA 4A12A 3RDIA 4BHCA 1MDMA 5K5QA 1SD7A 5HLHA 5FLXZ 2BGCA 3GO5A 4IPAA 4HX8A 1W5SA 1FBSA 2QBYB 2FRHA 3L09A 4F7ZA 1WSUA 4Z2YA 2YR2A 1KU2A 2DW4A 1KQ0A 4CDGA 3DF8A 1A04A 1HKTA 4L5IA 3FX3A 2V9VA 2OZ6A 4MTEA 1IRFA 2XV4S 2FBHA 2NS0A 4JQFA 4WXHA 3WGIA 4D0PA 4DNCA 2D1HA 1STZA 5LHGA 2D45A 2H6BA 4UV8A 4G7ZF 3SZTA 2DTRA 3LFKA 2P5LC 5LGNA 1ZREA 1WQ2A 3QPTA 1V4RA 3R0JA 3GFJA 1AWCA 3HSFA 4NB5A 4G6QA 4HW0A 1R1VA 2VXZA 2E7WA 2MLKA 4CYDA 1GXQA 4YFKF 2F5DA 1P4XA 2DFIA 4MEYF 2PN6A 1XDSA 4OINF 2K02A 2JT1A 2ZO4A 3K1MA 3RI4A 4KIGA 5D6FA 5ILVA 3K2ZA 3PQJA 5BPDA 3MWMA 1YW9A 3AAFA 1P4AA 2Y48A 5CJ9A 1W4MA 4M9ZA 4KFCA 4HLXA 2VBYA 4L0YB 2DU9A 1P92A 3FMSA 4U0YA 1JE8A 3GVAA 4CZZA 1HKQA 4RB0A 1B9MA 2Q8KA 4IJAA 3QU3A 5LRRA 2D2WA 3CDHA 3GFIA 1ZGAA 1KGSA 5E1WA 4HQEA 1ZARA 2M5WA 3C7JA 2VT3A 1J5YA 4GYIA 4DQ2A 4N0BA 2PFBA 3F23A 1C0WA 4S05A 2IW5A 1UHMA 2KJCA 1PP8F 2BYVE 3E6BA 3KEOA 3GX4X 5D6EA 1DP7P 1FSHA 2FE3A 5E17F 3CO7C 1XSVA 4RB1A 1R5HA 2F2EA 2IP2A 2EWNA 4LJZF 4OMYA 1Z91A 1USSA 2BEOA 2EFPA 2ZMEA 5F1RA 4ENNA 4I7HA 4L9VA 1ZLKA 4KMFA 1KQ8A 5ILUA 5LRSA 1J7KA 1IUYA 4KMUX 2PG4A 2MA3A 2Z99A 4XBFA 5CVVA 3HHHA 2MC3A 2VODA 3KLOA 1K78A 5BMZA 2LSOA 2H94A 1FC3A 4YFNF 1S7AA 5D5UB 3DKWA 4UVCA 1O3RA 3RJPA 3TO6A 3ZMTA 3P9CA 4ZZLA 1KU9A 4A6EA 2K27A 3EUHA 3M1EA 4PZJA 1HQCA 3HTSB 3DFGA 4M9XA 5ICCA 2VC0A 3Q5FA 2VOOA 2CYYA 4P9FA 4Q5SF 2E7XA 1PDNC 5KVRA 2PMHA 2KRFA 5CVUA 1U5TA 1WI9A 1SAXA 4LK0F 2IJLA 4WWCA 2O8XA 2M30A 4R79A 3ABTA 1O57A 3VFZA 4XLNF 5HLIA 1S29A 5F64A 3FM5A 2IVMA 3VOEA 1Z7UA 5JFRA 4LB6B 3GEZA 1BN5A 1I27A 1S6LA 4Q4ZF 4P55A 1TBXA 3WU1B 4UVAA 1D8KA 2ZMEB 2A61A 3EYIA 1BC8C 4ZH4F 1FYKA 2M45A 3IRRA 1U8RA 5J6XA 5CVIA 2O6GE 1UB9A 4M71A 1T39A 4P5OA 1IN7A 3M9AA 3MEXA 3I59A 1RI7A 3WGGA 3REOA 4R1HA 2L4AA 3H3ZA 1V3FA 1DUXC 4UNOA 1OYIA 4L9TA 3W6JB 3QPHA 1IN8A 1XGMA 1ZRCA 1R7JA 2UWMA 1U5TC 2RN7A 3BWGA 2L01A 4HYEA 3D5LA 1HSJA 3C18A 4GGGA 3EQLF 2ZBKA 1RZ4A 1GXPA 2ELHA 3WU0A 2HEOA 2TDXA 1EH6A 4FT8A 4A2UA 3WE2A 2K86A 2QQ9A 2UXNA 5LHHA 5LGUA 3TO9A 3BP8A 3BDDA 4M6XA 5FO5A 2XHKA 3HTUA 2HYFA 3FF5A 4ESFA 4LFUA 3KP6A 1HBXG 2M8EA 3E5XA 3NRVA 2NAZA 4HLYA 2YU3A 4PDKA 1SD4A 4B8XA 4Q47A 2DK5A 3WTYC 1BC7C 4EQQA 3KFWX 3T1BA 5JI6A 1YFHA 2IRFG 4ETSA 4Y17A 4LMYA 3DPTA 4L9JA 4CO8A 3F6OA 4BAYA 1SMTA 3EDPA 4LG0B 3F8BA 2HR3A 2JTVA 4RB2C 4EMSA 1YTYA 2HKOA 2LDUA 1XCBA 2A6EF 2FQ3A 1HKSA 1J2XA 5D8KB 3I58A 1IXCA 3MZYA 3TOAA 5F6FA 1E17A 2RDPA 3TKYA 1P4WA 3O6BB 2Q2EA 1Y0UA 4EM2A 3LA3A 4HOBA 2XAHA 4U7BA 4N9IA 2Q0OA 2XAJA 3RKWA 4LD5A 1LEAA 4KNYA 2HGCA 2FBKA 3H92A 2Z9OA 2WTEA 4WX9A 4LB5A 3OOPA 5DV5A 4HF1A 1TW2A 2CFXA 2W84A 2EV0A 1H0MA 4BH9A 2XASA 4HF0A 1FBQA 4G94A 1LDKB 4XSXF 5DD4A 1FT9A 2ZNZA 4YIIA 2UZKA 3F72A 2XAQA 1R23A 1G3TA 1FLIA 3K9TA 3KE2A 2PBIA 1OYWA 2R3SA 1ZYRF 2NNNA 1B1BA 1R22A 1BIBA 5L3CA 3B02A 1S3JA 2H6CA 4GCVA 2OBPA 3CTAA 5L3FA 4A0ZA 1ODDA 2F5EA 3ZP5A 1Z1DA 1ZN2A 3BOQA 1P2FA 2KKOA 3TO7A 3IHUA 1K79A 3GYHX 5BS6A 1AOYA 3TGNA 1E2XA 1MZBA 2G9WA 3JAMZ 1YYVA 1RUOA 3WTVC 1Q1HA 3WTSC 3J81Z 1HW5A 4EJOA 5L3EA 5AONA 3Q9SA 2NYXA 4HV6A 2C6YA 3FXQA 4UXNA 4CXFA 2P6TA 1BI0A 1F9NA 2XRNA 3HRMA 3O3KA 4ON0A 2XROA 2OQRA 3GFLA 3DP7A 1LDJA 4HBLA 4G9YA 4EJUA 3F6VA 5EEHA 4A0XA 3ZMDA 1B59A 3E3VA 2HQRA 4CGZA 4G6DA 2KIMA 4ZYDA 3JTHA 2G7HA 1W7PB
chains in the Genus database with same CATH superfamily
5FB2A 1UHSA 3K4NA 2XGXA 2W85A 1D0ZA 4ABZA 1JHHA 2H1KA 4X0GA 2VASA 1L0OC 3RZOJ 3OYKA 2B7EA 2R0QC 4TV7A 3KYDB 1DP3A 3I59B 5FLXK 2UV1A 2VKEA 1WJCA 2E1MC 3SZPA 1ZG5A 1W5CC 3T8RA 5CVJA 1HDPA 2L9SA 1N78A 3JR9A 1RIOH 2VN2A 5LLQA 2HNHA 3JRAA 2DMNA 3FISA 2NVTJ 1FOXA 1FY7A 3HEFA 2XSJC 2RNJA 3LOCA 2IBDA 4PGGA 1JKQC 5HDGA 1BIAA 1A6QA 4D5FA 3F21A 3PSIA 2KRCA 5FFZA 2IT0A 5KNLA 2MH9A 3I54A 3M7GA 3WTWC 1JGGA 4IQ4A 2BOLA 4A3MJ 1JGSA 5E79C 5DEQA 1YQAA 2H8WA 5H6QA 2ZSHB 3G3ZA 5FD5A 5J4YA 3V8KA 2LKPA 4XRMA 3G71I 3DKYA 3SJMA 3JTHA 3VSKA 3KP2A 1GHCA 2HI3A 2P4WA 1PYVA 1XMXA 1XB4A 3LQRA 2FMLA 4CUGA 1IN5A 3K1NA 2EIMH 5E8IA 3WE3A 2IGMA 3DKXA 2WAQA 1VQLI 3ABUA 4S04A 3BC8A 2RQPA 2DDAA 3MCZA 4FE4A 3DU6A 2WC2A 3QU6A 4BUPA 2ACJA 3PNTA 1GDTA 5FJ8J 1XGNA 3ELKA 5HDKA 2XIGA 5CKTA 1LQ1A 5EZGA 4LOCA 1OCPA 5EZHA 3KZZA 3ECOA 2DQRA 4ZYEA 2VIXA 2Y75A 4FX4A 3HOXJ 4M9SA 5L3BA 1BW6A 2PJRA 1B8IA 1R5ID 1KQ9A 1LVAA 2E1MB 4EJVA 4A93J 2VT2A 3S17J 1FSEA 3BR5A 2CWEA 1T6SA 4QSHA 4DGWB 3HRUA 1QBJA 2HTJA 5AIQA 4AVZA 5ICEA 3S16J 4IRIA 2K4BA 5K7HA 4IO9F 3T5XA 4BS9A 2ID3A 4LGWA 5CYVA 4V19K 1HOMA 4GXOA 4I6ZA 5LEJA 2DPUA 1G6NA 3PNYA 3IAM2 2PX9A 5K1YA 1YX3A 1VQ8I 2B63J 5DUIA 2MLGA 2RAEA 5CPRB 4BJ5C 5JLXA 2ZSIB 5EF6A 1N77A 5B1AH 2KRHA 1BJAA 4JK1X 1OQYA 3QOEA 3RKYA 1SMYF 4A3CJ 3OS0A 2A3SA 2R7VA 3OYNA 3IKVA 4RDUA 3GWZA 3QWLA 5M5WJ 2HQNA 3GTGJ 4BHBA 3J80Z 1RETA 1LKXA 2QLZA 4YELA 5A2QK 1KYZA 1S5LC 3J7AO 1U5TB 1OCOH 3AG4H 1GVJA 3SFZA 1LFUP 1TQPA 2ESNA 2NOGA 2QWWA 2K9NA 3FBIB 3VODA 3HRTA 1EV7A 3F8MA 2ZJQF 3IH2A 1MJAA 2HVQA 2QCOA 4HDUA 1FPQA 4NHJA 1I3QJ 5ERIA 2NOJB 4BXUA 5DCFA 2NNYA 3GTMJ 4FASD 2XC7A 3CUOA 3WG7H 1I6HJ 1G2HA 2ADUA 2VE8A 1J75A 2RREA 5FKMA 4QWQA 3M07A 5J3LA 2M87A 3FXJA 2FEZA 2JN6A 4CCNA 3E7LA 1CF7B 3MVPA 4RAZA 1I3AA 2CO5A 2QQAA 2OZUA 2QZ8A 3ZOBA 1DU0A 1P7JA 5F08A 5D4SA 5E3LA 4U87A 4NNJA 4RGSA 1ETVA 1R1TA 4P1WA 2CV0A 5H20A 2Y9ZA 1TT0A 3LSMA 4YFXF 2ICWG 2DXIA 2LVSA 1WWXA 2WAQN 2ZXIA 3S2WA 4LLNA 2L5QA 2ECBA 2K9SA 3K4BA 4LK1F 4UB8C 4A3LJ 3GLLA 4I0AA 1Z7LA 2CQXA 5FKLA 2JK3A 2MH2A 3MQ0A 4J01A 3HUGA 3H9JA 2CQKA 1VF9A 3IH3A 2A07F 1NTCA 1ONVA 3TOBA 2EFWA 5K7ZA 4L0ZB 3RZDJ 2RV8A 5FROA 2O5RA 1Y8QB 3NEUA 2AS5F 1D1CA 4CCOA 5IY5H 2EZLA 2IS4A 3S1RJ 5GAHJ 5H6RA 4V2FA 6PAXA 1FBUA 4M72A 2VJJA 5TRDA 1HW2A 4Y13A 4BXFA 2OTLI 4I0BA 3Q0WA 2XPVA 1ON1A 4XLEA 5JHFA 1CGPA 1B72A 1J59A 2R7OA 1FMVA 3GZ5A 3PIOF 3S3MA 1MNEA 2K85A 2XAGA 4HNUA 4RGXA 4XIDA 2NVXJ 3LSTA 2A5YB 4HV5A 1XTAA 2BW3B 1SAUA 5D5WB 4MNUA 3EUHC 5FLVA 3HRSA 3NWTA 4XONA 2L7KA 1XX5A 3L7WA 4KA4A 4PJJA 2XSDC 4HRIA 3GTPJ 1REPC 1T56A 2Z2SB 4DOZA 3LQQA 1POGA 2EBIA 1FZPB 3ZQLA 1TWGJ 1HF0A 1TW3A 3Q9VA 1BW5A 2OU2A 4I2OA 4AIJA 3S8PA 1XD7A 1BOAA 3I4PA 4CICA 2QM3A 1DDNA 1LJ9A 2ME6A 3WG9A 4A0YA 3V42A 4II2A 2NVQJ 1QO0D 3GTJJ 5LBQA 3CO6C 5IOZA 3VDXA 4CCJA 4YG2F 2CW8A 4ZDLA 2IA1A 2JJ7A 5TISC 5A2QZ 1R58A 3W6VA 2R4GA 1FP1D 4XM3A 1F1ZA 4AIHA 4WCGA 4MQVA 2WAEA 3OYHA 2DA6A 3ZN1A 1BBYA 1XDUA 1R36A 5HS8A 2X85A 4E7LA 1QZYA 1ERDA 3S2DJ 1QU3A 2CSOA 1L3LA 5F0HA 2O61A 3A0HC 1TWCJ 1JKRC 1QHHD 3MKZA 1X1BA 1O3SA 3ZMZA 4RB3C 2DMUA 3LWFA 3I0TA 5D8LB 5HNFA 4XRFA 2GLOA 5JVTA 3FMRA 4PJMA 4OIOF 1TQIA 3QOPA 3UNGC 4OAZA 3H3VK 4MGRA 1OKRA 2M4KA 1YIJI 1YO5C 1YRNB 2RGVA 3TW6A 2Z5UA 4C3JJ 1ETQA 5IOYA 1YRNA 5B3SH 4HF2A 5GPCA 3A2KA 4FQGA 3BZCA 1MMNA 3P7NA 3FKJA 1G3WA 1W0UA 2GXAA 1JHFA 1MBFA 5E20A 4A3EJ 3L2WA 3VWBA 3HGGA 4HX7A 1LE8B 3SHFA 1J09A 1DQUA 2FXAA 2W48A 5D5VB 1E3OC 2V9KA 4MQ9F 2EK5A 3NQOA 3BPVA 1Y1VJ 3BQZA 2OC6A 1JTYA 2OCCH 3E6DA 4KIFA 2P8TA 5TJJA 5C44J 3J7YJ 2O9LA 1K61A 4UV9A 3ULQB 2F5VA 3AFHA 2R7ZJ 1W7PD 4OIRF 3HGYA 2WBMA 1X2MA 2LD5A 5FKOA 4PK4A 4FX0A 1HW1A 3P9KA 1BI2A 2O0YA 1MBGA 3LSKA 4A3BJ 5K5OA 4BBRJ 1A31A 3PFYA 2DPDA 5BOXA 3FXRA 3V7RA 3RQ4A 3V4GA 1S9HA 4NQWB 1FYLA 1I6XA 1IDYA 2V6CA 3OYFA 3OYGA 3ZXSA 2IS2A 1XGSA 2M7AA 3VYSB 4J00A 1QNTA 5DUKA 5JR3A 3GTQJ 3HOSA 3LA2A 4I98B 4G7OF 1MMAA 3JAMK 1B6AA 3H36A 3ZMUA 1T98A 3OOUA 1XSXA 3JRFA 1FNNA 2FOKA 1R9TJ 4U0VA 3KCCA 3O8GA 2MABA 2X9DA 3CC4I 2XGEA 5LHIA 4OIQF 3C1DA 1I1GA 2CQ7A 2Z3YA 3ZR8X 3L9FA 1TLHB 2Y69H 2V26A 5B66C 1VQ4I 1KYWA 4IHSA 2JA5J 4H0EA 2EA4A 4LG0A 2HTSA 3M8EA 2JA2A 3G1MA 1MH3A 2DO7A 4UHTA 4W97A 2BY3A 2FA5A 3GXOA 4PFOA 4KUMA 5FGMA 1GT0C 3PQKA 3ZGKA 1P6RA 3QRFF 4MEXF 4C9YA 4XKBA 3BTJA 1O3TA 5E8GA 3F8NA 4N9HA 3IP4B 4OU0A 2IGNA 3OIPA 1D5VA 3EETA 3RPUA 3I4MJ 3VYUB 2P6SA 2BZTA 4IL6C 3R61A 4Q48A 2V6EA 3BY6A 3S2HJ 2FF4A 4GYGA 3V8JA 3C2HA 3DQVC 1RNLA 3H9GA 1GV2A 3LL7A 3ZMVA 4QLCU 1FX7A 5CLSA 2I5UA 3K1PA 2F6CA 4EGZA 3ABKH 1S7OA 3OL4A 1BR2A 4IRGA 1DPRA 2DFFA 2H1LA 3CCJI 3W2AA 1IO2A 2G0EA 3D5SC 4A5MA 1WJDA 3DU5A 1FWZA 5GPAA 2LK2A 3EYYA 3KYLA 2CW7A 2LOOA 5C4JJ 2AQEA 1TNSA 2HZDA 3RPQA 3IH4A 1IXRC 1Z3XA 5E18F 3OSFA 4L9NA 2CW0F 3OR1C 3FBNB 1SEUA 3U1DA 4BXXJ 3HXLA 1T2KA 4PSWA 2PJRB 1ZH5A 3K6GA 2JPCA 3JRCA 2EFOA 1VQ6I 1MBHA 2R7WA 1IV6A 4RS8A 2QKLB 2STTA 5E1ZB 2H27A 1SC7A 2E60A 3S14J 1VTNC 4NC8A 9ANTA 1HXDA 5EEAA 4MHGA 4KIBA 3H5RA 1JT0A 4O3MA 2XVCA 3GTOJ 2WA0A 2FX0A 2NS7A 4XKVA 3ABMH 5ILSA 1ZRFA 2DA3A 2PJPA 2K5CA 3KEQA 2VC1A 4EJWA 2K4JA 4HEA2 3BJAA 1EH8A 2O7OA 4IHTA 1QPMA 4EVIA 4M74A 1MDMB 2NS8A 3FZVA 2EILH 3GF2A 4G7HF 3CCRI 2CQQA 1MNMC 2FNPA 4KN7X 1SFUA 3QYFA 3IAS2 4NC7A 2EZIA 2VUMJ 1KU3A 1YJWI 3A0BC 1YW8A 2JVHA 5FFXA 2IXSA 3LAJA 2QGUA 3VYRB 4X6AJ 1WFXA 3GBGA 5C3EJ 2JMWA 2V1DA 3F0CA 5E3OA 3WODF 1BR1A 1Q1VA 2UXXA 5DD8A 3FKIJ 2QUFA 5LEKA 3CCUI 1XSDA 3PO3J 2KIUA 3JRBA 1KU7A 3HOTA 4HA8A 4OAYA 2HXOA 4F93B 3IRQA 3J80K 3SEZA 3GTLJ 2GXGA 4CA0A 1YIOA 4EGYA 4NQWA 1X2NA 1WHUA 3WTTC 4F91B 2A68F 5CVRA 5D4RA 3CD6I 3TDUC 2EFQA 2M8GX 2HOEA 1HA8A 4M6VA 1IN4A 1T33A 4AUXA 2VKDA 4HX4A 4AVPA 1ZK8A 2E19A 3OS2A 1QGPA 4XOTA 3KZYA 1J0RA 3S3NA 4HAMA 1X4PA 1IRZA 1W0TA 4JX5A 2P81A 4BGDA 3WTZA 4XSZF 4WXDA 2KFDA 5HDNA 2LYCA 3KP5A 1NH3A 1SD5A 1SVMA 4A5NA 2HWVA 1TZLA 3I71A 4CHUA 3I4NJ 2EZKA 4OMZA 3CUQA 3HUGB 1U3EM 1VZ0A 2DOAA 1R71A 4F92B 2HVSA 3HHGA 4O5VA 2ISYA 2BXZA 3PSFA 4D5CA 1TWFJ 1U78A 2EV6A 1MIJA 1ZHFA 1OJLA 2TRTA 3SQNA 1YW7A 2FOWA 4XL9A 2V1UA 3HG9A 5AIPA 5IP7J 2PLYA 3IWFA 2STWA 2EFNA 3RIRA 1I5ZA 3F3XA 1X3ZB 2EIKH 1OR7C 4S0HB 2R92J 2ZJRF 1VI0A 1WKMA 4AD9A 3GLXA 4E4HA 4H4KC 2W24A 3UKGA 1OPCA 2GZWA 4P9UA 1OMIA 3MKWB 3CJNA 4AM3A 4A3KJ 3KETA 3U21A 4BACA 1XMKA 5BPIA 3ERED 2L4MA 1U2WA 1YLFA 5LGTA 2KP6A 2L54A 2KHMA 2X1EA 2LKXA 1ORKA 4G8XA 4XLPF 4GO1A 3E6MA 4B47A 4XORA 3K2AA 3C2GA 3BR6A 4KT6A 1K78B 3FXUA 2LF7A 3Q3SA 4M6YA 3KP7A 3H0DA 3KLNA 3DXJF 3HZJA 2H8RA 3KIOA 2VOPA 2XB5A 2GXBA 1USTA 4IXAA 1Z6RA 2W1OA 2XB0X 3VEPA 2J5OA 2M1BA 1DU6A 1YS6A 3T0YA 3NAUA 4DW6A 3QYEA 4IHVA 4BU2A 3R60A 3HIFA 1W5TA 3BR0A 4L5EA 4Y3OA 1UJ8A 1J9IA 5EG0A 1IF1A 1I39A 4IHYA 2R5ZA 4RM2A 3KZIC 2FNAA 2AHQA 2GWRA 3RSNA 4HQMA 3DBHB 2LRDA 2L02A 5IP6A 1RKTA 4OIPF 4ZYGA 3CP2A 5HOOA 2GIZA 3HOUJ 1JUPA 2HYGD 3CCQI 1SFEA 3RTRA 2KZVA 4OWRB 1WJAA 2DAOA 3OL3A 2KIFA 5FLMJ 2QSGX 3I64A 1MBJA 3CMAI 2EB7A 5J4VA 4RAYA 3CF2A 3K0LA 3R0AA 5E1XA 3SDBA 1QHGA 3IWZA 3SXYA 4MO7A 2QSHX 4R8HA 2EA2A 3N4MA 3DEUA 1IRXA 2DI3A 3E0JB 4O6JA 2XGCA 2A6HF 5EEGA 2BV6A 1OFCX 2JPBA 1FOKA 5EDNA 2R93J 2DLLA 1LNWA 1N25A 3A02A 3BT9A 1TNTA 3HC7A 3FM3A 3K4MA 5CQEA 4CYCB 4ZDOA 1ZGJA 3OYLA 2KDZA 2L7ZA 1G3SA 2V1XA 3DEWA 5M3MJ 1PUEE 1RR7A 2HDCA 5HLGA 1S72I 3BZ6A 2OAZA 3W6KB 2ELJA 1HSTA 1T0FC 2VBXA 2BBYA 4HPQA 5IT3A 4XICA 4BY1J 2VJ4A 2R7DA 4MTDA 1U6GA 4BJ6C 4IVNA 2OCEA 3DV8A 1IN6A 1YS7A 3H5AA 4WF2A 2Q2EB 3IL2A 1Y0NA 4UVBA 2Z33A 2QBYA 1IAWA 2HKXA 2JQ7A 3CUQC 4RGUA 4I99C 4RAGA 3WHBA 2OD5A 2GQQA 4B09A 3OS1A 4LLGF 3LNQA 4U7DA 4RLQA 1D5YA 3E5QA 2FU4A 3TDZC 2R5YA 3OMYA 4RLFA 2ZMEC 2QA4I 4F55A 3GW2A 1O7LA 3AG3H 4AIKA 2A69F 2XF6A 4ASNA 1HLVA 4HNTA 3FHZA 5F0FA 3FXKA 2KMUA 2F4MB 1R00A 5HVQC 1G59A 3O2PE 3HPHA 4RGRA 1YX5A 1X1CA 3FXOA 2LKSA 2W57A 1ZRDA 2RC4A 5M5YJ 5J40A 2HYJA 1JXSA 4MLOA 2ID6A 4LLLA 1EJ9A 5C4XJ 4BNCA 2EH3A 2GOMA 4B44A 4QIWN 2DT5A 4PFPA 3CQZJ 5DDGA 4ZTFA 2BY0A 2XPWA 1UMQA 3JRGA 1LFPA 3WHCA 1WRJA 3MAJA 2LLKA 2ZCWA 3F9KA 1WH5A 4XMYA 2HU9A 2CJJA 1QPIA 3OR2C 4KYWA 1V5EA 2CQNA 5J8FA 2P0WA 3I9V2 1R1UA 3DWLE 3E6CC 3MD2A 1BI3A 2X0LA 2WWYA 3ECHA 3HJEA 1R4MB 5KK1A 5IT9Z 4L18B 1B9NA 2PMUA 1NK3P 3CJRB 4NDLA 3M4OJ 1UELB 4K2EA 2JA7J 2V1NA 3H1CA 1H9GA 2MYSA 2YPRA 3H3UA 3ASOH 4ZZDA 2H09A 5DM6F 1IW7F 1WCMJ 1UFMA 1O3QA 2XAFA 2HZTA 4A3IJ 2HDDA 2GM4A 2VQCA 1TL8A 4ESJA 3QAHA 2BE5F 2ZFWA 5JHUA 3BPXA 2DMPA 3KP4A 2HOAA 3F22A 2DCEA 3S93A 1YG2A 2MGQA 3S1NJ 4PGHA 1G8XA 1QQIA 2BHYA 2DDBA 3R4KA 2FMYA 1F5TA 1O7FA 2E1OA 1UHWA 3FIWA 3SFIA 3WU2C 4HZFA 4B4CA 3B6AA 1XGOA 5L3GA 4I76A 4AIDA 2HQAA 3MFKA 2K7LA 2HPIA 5HS7A 4BQAA 4XRSA 1IXSB 1IZ1A 4LIUA 2PI0A 3V7CA 1MBEA 1GLNA 1X19A 3KEYA 3P9IA 4IRHA 2E2IJ 1ZLJA 4A6DA 4ENKA 3IKTA 2HDWA 2CG4A 2MBFA 2VJ5A 1JI8A 3KP3A 2ESHA 4Y15A 2W7NA 2JVGA 3G1OA 1TP4A 3NARA 1K6OA 4EJTA 1EH7A 3VYTB 3JSOA 4FHTA 3ZQ7A 1IGNA 4U0WA 3V7SA 5JVGF 4FTHA 3BG9A 1SFXA 4WK8F 2OQGA 3V8LA 3TMOA 3BJOA 4WXCA 3LA7A 4UB6C 1HCRA 5J8CA 3E5UA 4DIQA 2KPMA 2IPQX 1IC8A 4BE2A 4BYYA 2E5ZA 2GA2A 4E7JA 4X1EA 2B0LA 4CSWA 2CUEA 1XN7A 1FEXA 2F5FA 2ZFUA 1NHAA 2JUGA 2E1NA 5L3DA 3JW4A 2V4JC 1W7PA 3HKZN 3L2CA 2CUZA 4PCQA 2ZJ2A 4I02A 3PFIA 2XKPA 5IPAA 3G1LA 1T08B 1TWHJ 3ZN0A 2HVRA 2LNBA 1A6IA 1P9QC 5DCMB 3ZPLA 3TQNA 1T38A 4ESBA 3AL0C 3WGHA 1MMDA 4N4OB 4DZJA 1XC5A 1BI1A 1XMAA 4IF4A 1K83J 4RAFA 4XLFA 3WTUC 2RVCA 3L2UA 1D0XA 2YX7A 1MSEC 1D3YA 2ZXWH 1X3UA 2YS9A 2RKHA 2DA1A 1SD6A 3IC7A 4YEJA 3PL8A 1FYMA 1XPXA 3BG5A 1TC3C 1S8NA 1R49A 5DYMA 2E1CA 1DPUA 3P5JA 4KN4X 4BHPA 2O03A 4C3HJ 1MKMA 3JREA 1D8JA 4HDVA 2JSCA 1Z6TA 3Q0VA 2FUG2 2WAFA 4QPQA 5LFAA 5IT9K 2M9HA 3CESA 1B4AA 1LB2A 3J81K 3H5NA 2BHZA 5EGOB 2MD5A 3KX2A 4XN3A 4RBOA 1ITYA 2G7UA 2K9LA 2Y0SA 2MW8A 1TQMA 1QVTA 1Z3YA 3OYMA 2X1DA 4KDPA 3F8CA 3RYRA 2XKOA 2FJ1A 2IA0A 2AXLA 2PMZN 4AYBA 2VPRA 1WZ2A 2RQQA 5HS9A 1RUNA 2W25A 4D7NA 4ENJA 3OY9A 3BR2A 3G73A 4NUBA 2P7CB 5EGOA 2X1CA 2YSRA 4NBQA 4JOMA 4YIFA 5H2FC 3COAC 2L3DA 1H89C 1U8BA 3C3WA 4ZTJA 3BROA 2CRGA 2KJBA 2DQLA 2IA2A 1R5GA 4EV0A 2W82A 3RKQA 3HL2A 1AHDP 1LPQA 1G3YA 1ULYA 3I56I 2DT6A 2MSYA 3K69A 4G12A 2Y2ZA 1P7IA 3S3OA 2R7QA 2QENA 2ZNYA 3ISPA 4LG3A 4P96A 1XG1A 2JUCA 3DLAA 3QP5A 3G2BA 3G6EI 4OOIA 3LAPA 4DYCA 1TWAJ 2DK8A 4E70A 1ETYA 1IV8A 3GZ6A 3R6SA 5HODA 3GZNB 5D5XB 2PQ8A 2F5CA 2ZXJA 3ZQGA 3GFMA 2O3FA 4PJLA 3ZMSA 3HSEA 2ZKZA 4Y33A 1ON2A 1BM9A 3OV8A 4HSTA 3I53A 2E2JJ 3HYIA 2QVOA 5FD6A 3HKZA 2J5PA 3GUDA 2WB1A 2WY7Q 2XUBA 2KZGA 2EJRA 3U9GA 3B73A 2VL8A 2DBBA 3H35A 3ROUA 1MJ9A 3DTIA 3VB2A 1K7AA 3M3YJ 2NRAC 3BG6A 2IS1A 1OR7A 3ESWB 2ZC2A 3CUQB 3DPLC 3QP6A 1Y6IA 4U88A 3TP3A 3MZHA 1QZZA 4IQJA 1FTTA 4C2MJ 3BG7A 4GDFA 3I5UA 2VBZA 1ZAOA 3OSGA 2OA4A 2F48A 1BR4A 1Z9CA 3L2RA 2HOTA 1JKOC 2A5WA 3RKXA 2CFOA 4I01A 5K5RA 1XCVA 3JSPA 4FETA 3RPUD 4BQNA 1ETWA 4C2TA 3CLOA 4F3QA 5ED4A 2EINH 2WV1A 3K4CA 1MGTA 3S15J 3D0SA 1RPWA 5BQTA 1G4DA 2KLOA 2PEXA 2WV0A 4CH7A 4BE0A 4L5JA 2E71A 1APLC 2FBIA 1LDDA 1H9TA 4AWXB 1ZG3A 3FMQA 2JRTA 2D1VA 2GIVA 2HOSA 2LR8A 4B3AA 2JZYA 4BKXA 3HSRA 4JBAA 3RYPA 1F43A 3K4JA 4UUTA 2CU7A 1X1DA 2X6YA 5DTDA 3U2RA 5EJCA 3T8TA 1FP2A 2V79A 3F8FA 3K7AJ 1I1SA 1T95A 5J1YA 2ISZA 4EM1A 2OF7A 1CF7A 4PUSA 1JKPC 2ETHA 3BQYA 1OYYA 4J19A 1UAAA 1YJ9I 3NWSA 4ENMA 5DCMA 2L7MP 5F0CA 1MD0A 5FRNA 3JTGA 3OYBA 1FOWA 2EV5A 5F27A 2YU9J 2VE9A 1Z05A 3E97A 1QA6A 1CQTA 1FOYA 3BCAA 4C30A 1W1WE 2Z16A 3WTXC 4HG2A 2LF8A 3ONQA 4JX4A 2HS5A 4XRSG 2L2OA 1MH4A 2Y0MA 2VONA 4DYRA 3FWEA 2VBWA 3BJ6A 2GAUA 4RMNA 4CCLA 5GAGJ 3K70D 1KA8A 5GTHC 2P5VA 4M73A 2P5KA 1YITI 2VXDA 2P7VB 1D0YA 1ZG1A 4KT5C 2QYOA 4D9JA 3LSGA 1D1AA 2R7FA 4EM0B 2R7UA 3BTCA 1IRGA 3LFUA 2XF7A 2FSWA 3QPLA 4LITA 1MJBA 4I09A 2BVMA 3M8JA 5B5EC 2M2EA 4MFEA 3VSLA 2L9NA 2QQBA 2UUZA 3L00A 5ICGA 2R7RA 5M5XJ 2HFHA 2YX4A 3DBRB 3M8FA 1O4XA 1RESA 2COMA 2CGPA 2EIJH 2R7XA 3CC7I 4GRIA 2CH0A 1TTYA 1F4KA 3HM5A 2OV7A 3Q0UA 1LEBA 1T0FA 3ML6A 3ZCOA 4UUVA 1UCRA 2ME0A 4A3FJ 4FISA 4KICA 1V5FA 2GA1A 2XF5A 2X4HA 5ICFA 5E3MA 3L2VA 4AU7A 4ZYHA 4A12A 3L2QA 3N97A 3RDIA 4BHCA 3CCVI 3D1NI 4B1RA 1MDMA 5K5QA 1LE8A 2LG4A 1AKHB 1SD7A 2FQ4A 2COBA 3S32A 5HLHA 5FLXZ 1VQ9I 2BGCA 3GO5A 2LREA 2NVYJ 3SYTA 3A01B 4IPAA 3OYIA 4HX8A 3FK6A 1WPKA 1W5SA 3HB9A 1FBSA 2QBYB 2FRHA 2R5ZB 3L09A 4F7ZA 1WSUA 4Z2YA 2YR2A 1KU2A 2DW4A 1KQ0A 4XNFA 2QKMB 4CDGA 3DF8A 1WJFA 1A04A 1HKTA 3EPZA 1GV5A 5EYRA 4PJNA 4L5IA 4XLAA 3FX3A 2V9VA 4M3BA 3ZQQA 2OZ6A 4MTEA 1IRFA 3ZRGA 5KAFC 2XV4S 2FBHA 2NS0A 4JQFA 4WXHA 3WGIA 1ZR4A 4D0PA 1W7PB 4DNCA 2D1HA 2M7BA 1STZA 3BR3A 5LHGA 2D45A 2H6BA 4A3GJ 4UV8A 3DEEA 1MSFC 4G7ZF 2XPUA 3SZTA 4DZPA 2DTRA 3LFKA 4E7KA 1B8IB 3A03A 2P5LC 5GP9A 2LY2A 1VQMI 5LGNA 1ZREA 2F4OB 1WQ2A 5FKNA 2KDOA 4XKWA 2Y31A 3QPTA 1X3WB 5J1UA 1V5GA 1RRJA 1MMSA 1V4RA 3R0JA 3GFJA 1AA7A 1AWCA 3PJRA 5F1JA 3HSFA 1PP7U 2IEKA 2EQRA 1FIPA 4NB5A 2XRLA 4G6QA 2DA2A 4HW0A 1R1VA 2VXZA 1OCTC 3I3LA 4XK4A 2E7WA 2OPTA 1HC8A 4A3JJ 3CC2I 2MLKA 4CYDA 1WJBA 1EF4A 2YUSA 5J47A 1UG0A 1GXQA 4IOCF 4YFKF 1V55H 2F5DA 1P4XA 2KL4A 2VB6A 2DFIA 3EUKL 4CYCA 2LC2A 4MEYF 4CZCA 2PN6A 1XDSA 4OINF 2K02A 2JT1A 2ZO4A 3K1MA 3H9QA 1Z21A 4C3IJ 2LMDA 4D7MA 2DA5A 3JRDA 3RI4A 5LD2C 2N8GA 2QF7A 4KIGA 1SANA 5D6FA 5ILVA 3OYCA 3UR3C 2K3FA 3B6CA 3K2ZA 3PQJA 2X48A 5BPDA 3MWMA 1YW9A 3CDLA 3AAFA 3QQAA 1P4AA 4IKFA 2Y48A 5CJ9A 1E3HA 2PMZA 4AYBN 5BNGA 1W4MA 4M9ZA 4FCYA 2E36A 2VKVA 3DLLF 4KFCA 2OUMA 4HLXA 2VBYA 1NK2P 4L0YB 2DU9A 1P92A 3FMSA 4BQQA 4U0YA 3L1PA 1JE8A 3GVAA 4CZZA 1HKQA 1KONA 4RB0A 1B9MA 2XGDA 4IJAA 2Q8KA 3QU3A 5LRRA 2D2WA 1ENHA 3CDHA 1PUFB 3GFIA 4D1QA 1ZGAA 1KGSA 5E1WA 1A5JA 3OIOA 1ZARA 5HLTA 4HQEA 4II3A 2M5WA 2ZXHA 3A1YA 4IOAF 1W36C 3S1QJ 5IP9J 1Y8RB 3C7JA 2VT3A 1J5YA 1GVDA 2OJED 4GYIA 4DQ2A 3OYAA 3BZKA 2PFBA 4N0BA 1Y56A 3F23A 2OTJI 1PVEA 1C0WA 4S05A 2M3AA 2IW5A 1X1AA 1UHMA 4YIRX 2KJCA 3W3CA 1PP8F 1Y39A 2DFHA 2BYVE 3E6BA 3U1KA 3KEOA 1A35A 1FJLA 3GX4X 5D6EA 1DP7P 1FSHA 4ZJZA 2M34A 3MKYB 3M1CA 2AO9A 2FE3A 5E17F 3VPRA 1K4SA 4JYKA 4XLHA 3CO7C 1OCCH 3AG1H 2QQ8A 2NVUB 2QEXI 1XSVA 2BY2A 4RB1A 1R5HA 3PNVA 1WJEA 4DJAA 2F2EA 2IP2A 2E34A 2EWNA 4LJZF 4OMYA 1Z91A 1USSA 2BEOA 2DA4A 4IX7A 2EFPA 2ZMEA 1IUFA 5F1RA 4ENNA 4I7HA 4L9VA 1ZELA 5J1RA 4BEHB 1X4OA 2BXYA 1ZLKA 4KMFA 3GTKJ 4BDYA 3JRHA 2E2HJ 3IV5A 2B9SA 1KQ8A 2Z1DA 2HQ5A 4E6KG 2L9RA 5ILUA 3K4KA 5LRSA 1J7KA 3MZ8A 1BOBA 1SVOA 4KMUX 3LSPA 1IUYA 2PG4A 2V7FA 2MA3A 2Z99A 5HNHA 4XBFA 5CVVA 2VJIA 3HHHA 2MC3A 2VODA 3KLOA 1K78A 5BMZA 4AC0A 2LSOA 2H94A 3K70C 3CZ6A 1FC3A 4YFNF 1S7AA 2ELKA 3PUFA 2LTPA 5DS9A 4XN0A 1YOVB 2K9MA 5D5UB 3DKWA 3LSIA 4UVCA 2JSPA 5KAIC 2VLAA 2A05A 1O3RA 3RJPA 2DJIA 3AKZA 2VI6A 1ETOA 3TO6A 3BCBA 2QSFX 3ZMTA 2L0KA 3P9CA 5CQGA 4ZZLA 1KZHA 2IGOA 1KU9A 3QODA 2LBFB 4N4NB 2K27A 2CMPA 3A4CA 3EUHA 3M1EA 4PZJA 1HQCA 4A6EA 3HTSB 1QRYA 3PUBA 3DFGA 4M9XA 3DTKA 3CP8A 5ICCA 2CUFA 3CJQB 4EEFG 2VC0A 3Q5FA 2VOOA 3PIPF 3HOVJ 2CYYA 4P9FA 4Q5SF 3OYEA 2E7XA 1PDNC 4UY8I 5KVRA 2PMHA 2K3PA 2V9PA 2KRFA 2KQRA 5CVUA 1WJ5A 1U5TA 1WI9A 1SAXA 3ABLH 4LK0F 2IJLA 4WWCA 1PJRA 1K6YA 1MNDA 2M30A 2O8XA 2M4GA 3ABTA 4R79A 1O57A 1SVLA 3AG2H 1D1BA 3VFZA 4XLNF 5HLIA 3QPSA 1S29A 5F64A 1TT5B 3FXMA 1ZTRA 3FM5A 2IVMA 2KT0A 4BBSJ 4ANJA 3VOEA 1Z7UA 5JFRA 4LB6B 3GEZA 1BN5A 4W1UA 1I27A 4BQOA 1S6LA 2LH9A 4Q4ZF 1WGXA 3LSHA 4P55A 1TBXA 3WU1B 2JA8J 1VQ5I 4UVAA 4Y52J 1D8KA 1N75A 2ZMEB 1X58A 1JJ8C 2A61A 5IYCJ 5E3NA 3DTEA 3EYIA 3AL0B 1SFOJ 4M3GA 1BC8C 1WH7A 4JP0A 1YJNI 4ZH4F 3BG3A 1FYKA 2WB1N 4HSRA 3QYBA 2M45A 5GADJ 3IRRA 1U8RA 5J6XA 5CVIA 4M3DA 2O6GE 1IDZA 1UB9A 1I50J 1UZCA 4M71A 4BY7J 2EZHA 4BDZA 1T39A 4P5OA 1IN7A 2JA6J 3M9AA 3MEXA 1AU7A 4NC6A 1ACIA 2XDVA 3I59A 1IJWC 1RI7A 2KISA 3K10A 2ZJPF 3WGGA 3REOA 3GCMA 2DT7B 1ETXA 4R1HA 2L4AA 1BL0A 3H3ZA 1V3FA 1R4NB 1DUXC 4UNOA 1OYIA 2XAUA 4KJZA 4L9TA 3IUOA 3W6JB 2BVLA 3MKLA 2NXNB 3QPHA 1IN8A 1XGMA 1ZRCA 1DGWY 1R7JA 5KCMA 4M3FA 2UWMA 1SFKA 3W2WA 3CCLI 2R7SA 1JUSA 4EATA 1U5TC 3BTLA 3ZQHA 2RN7A 4DBQA 2VPLA 3CCMI 2LFBA 3BWGA 2L01A 3HOYJ 4HYEA 3D5LA 1HSJA 3C18A 4GGGA 4E7ZA 4GFBA 5FKKA 1UG2A 3EQLF 2ZBKA 3FK7A 3OWTA 1RZ4A 3FXLA 4MFDA 1GXPA 3JCUC 4JX6A 2ELHA 3WU0A 4UUSA 2HEOA 2DOEA 2TDXA 5IYBJ 2VQGA 2DMQA 2E35A 3CMYA 1EH6A 3CDIA 4FT8A 4A2UA 1MBKA 3WE2A 3J7ZI 2K86A 2QQ9A 4Y7NJ 1YHQI 2UXNA 5LHHA 4A69C 4E7SA 4ZC3A 5LGUA 3TP0A 1ZR2A 2O8KA 4MIMA 2DTZA 3I55I 4XQFA 1ZQ3P 4CCMA 3TO9A 1JUMA 1WI3A 3BP8A 3BDDA 4M6XA 3HPGA 1VNDA 5FO5A 2XHKA 3SEQA 2IAIA 3RCOA 3HTUA 4C2UA 2W4SA 2VQHA 4DYQA 2HYFA 1EKEA 1HDDC 3FF5A 4ESFA 1U0JA 4LFUA 4IZZA 3ZQCA 2DYRH 3KP6A 2I10A 4ZDPA 2Q1ZB 5GTIC 1BJZA 1AKHA 2AQFA 3CCEI 1VQKI 4IHWA 1HBXG 2M8EA 4BE1A 4A3DJ 3E5XA 3RQIA 3NRVA 2NAZA 4HLYA 2YU3A 3BLYA 4PDKA 1SD4A 4B8XA 4Q47A 1A36A 2DK5A 3WTYC 4KITB 1BC7C 4EQQA 3KFWX 3T1BA 4F52A 2ZB9A 3OYJA 3KYCB 5JI6A 4YRVA 1YFHA 2IRFG 1YI2I 4G6TB 4ETSA 4Y17A 1EA3A 2BW3A 4LMYA 4IHXA 1QZEA 3DPTA 5B1BH 4L9JA 4XR6A 3OIQA 4CO8A 3ASNH 3F6OA 1H88C 3MMYB 1WVRA 3LSJA 4PSXA 4BAYA 1SMTA 3EDPA 4LG0B 1VFCA 3F8BA 2HR3A 2DMTA 2JTVA 4RB2C 4EMSA 1YTYA 1FIAA 1JT6A 2HKOA 2HPMA 2M0MA 1FTZA 2LDUA 4M3EA 3ZQIA 1IG7A 1MMGA 1RC9A 4RA2A 1VQOI 1XCBA 2A6EF 2W00A 4XLCA 3PO2J 1LVKA 2FQ3A 2JWTA 1HKSA 4UUSB 5F04A 1H8AC 1J2XA 3A01A 2CV1A 5D8KB 4V2GA 3I58A 3TBIA 2DODA 1IXCA 3MZYA 2D5VA 3TOAA 2CS3A 2CV2A 5F6FA 3DBLB 1E17A 2RDPA 3TKYA 1P4WA 1DGRM 4E7IA 3O6BB 2L7FP 3H0GJ 5EG0B 2Q2EA 1Y0UA 3LSRA 1S7EA 1OCZH 4EM2A 3HOWJ 1F36A 3LA3A 4HOBA 2I8DA 3ZQFA 2DJNA 2LY9A 2XAHA 3BTIA 3CJTB 3PM1A 1V54H 4U7BA 3CMMA 4N9IA 3CLQA 2Q0OA 2K9QA 2LY1A 2XAJA 5M3FJ 3RKWA 4LD5A 2TCTA 1LEAA 4B43A 4KNYA 2HGCA 2FBKA 3H92A 1ETKA 2Z9OA 2WTEA 4WX9A 1OLTA 5K7FA 2MFZA 4LB5A 3OOPA 2X6WA 5DV5A 1U9NA 4HF1A 3TL4X 1Z77A 1TW2A 2BY1A 2R7TA 2LBFA 2CFXA 1E3PA 2W84A 2EV0A 2EPFA 1H0MA 4BH9A 2GBYA 2XASA 1K4TA 1VQ7I 4HF0A 4KISA 1FBQA 4G94A 3CF5F 1LDKB 2K40A 3JRIA 3ERMA 4Y4RA 4XSXF 5DD4A 1FT9A 2L9VA 2ZNZA 4YIIA 3FDYA 2UZKA 3F72A 1BA5A 1QVUA 1R23A 2XAQA 1RKWA 1G3TA 1FLIA 2RNGA 1NG6A 3C2BA 3K9TA 4ITVA 1OCRH 3KE2A 2PBIA 2DOFA 3TW7A 2DYSH 3W2VA 2VQLA 1OYWA 2R3SA 4HNVA 1LUJB 4BEHA 3LMMA 3X2QH 1B72B 1ZYRF 3HDDA 2NNNA 1B1BA 2R5YB 1ZGWA 1X1PA 1R22A 4FE7A 1MW7A 1BIBA 2Y30A 1GUUA 4RM3A 5L3CA 5FRMA 1Z0XA 3CCSI 1OISA 3B02A 1XS9A 1S3JA 2X6OA 2H6CA 4GCVA 4Z6YA 4CCKA 1JJ6C 2OBPA 5IYDJ 3CTAA 5L3FA 2KIQA 2LP0A 3KPHA 2X51A 4A0ZA 2DN0A 3O8HA 1ODDA 2F5EA 5JLWA 4QPOA 4ZYAA 3ZP5A 1Z1DA 1ZN2A 3BOQA 3S1MJ 1P2FA 3DCFA 1E0EA 2KKOA 3TO7A 3IHUA 1K79A 3J7AY 3GYHX 4QTRA 5BS6A 1AOYA 3TGNA 3CMEI 2WADA 1PUFA 1Z67A 1E2XA 3N05A 1MZBA 3CCYA 2X6XA 4BJTA 5GAEJ 3EUAA 4B48A 2F4IA 2M0CA 2G9WA 2DA7A 3JAMZ 3FHNA 1YYVA 3SDGA 1RUOA 3WTVC 2ECCA 3TEDA 3HOZJ 1Q1HA 2VKHA 3WTSC 1ZKGA 3SZGA 3J81Z 4B3XA 1W36D 1HW5A 2FD5A 4EJOA 2MC4A 4BL0B 5L3EA 5AONA 3Q9SA 2NYXA 4XOPA 1T8IA 3DPUA 4HV6A 2MG4A 1YE9A 3FXQA 4UXNA 3G4SI 2C6YA 4CXFA 4PJ0C 2P6TA 2WY8Q 1BI0A 1F9NA 3K4LA 2E5NA 3BR1A 3D5RC 2Y9YA 1RR8C 3MN2A 2XRNA 2A6TA 3HRMA 4XKCA 1FMWA 3O3KA 4ON0A 1U9OA 2XROA 4IEJA 3E1SA 2AXTC 2OQRA 2IS6A 3GFLA 2GOXB 1LFBA 5TGTA 3DP7A 3HBLA 1LDJA 4HBLA 4G9YA 4EJUA 3F6VA 1VQPI 2JRMA 1NG7A 2IGKA 5DM7F 1R6RA 1M1EB 5EEHA 4A0XA 3GMEA 3ZMDA 4DBRA 1B59A 3E3VA 4LIVA 1Y1WJ 2HQRA 2MD0A 4CGZA 1VQNI 4G6DA 2KIMA 2Y0SN 3OYDA 4E7HA 5KHDA 4ZYDA 2DFEA 1JTXA 2G7HA 2HXIA 2CUJA
chains in the Genus database with same CATH topology
5FB2A 2XGXA 2W85A 1JHHA 1L0OC 4TV7A 3I59B 5FLXK 3SZPA 1ZG5A 3T8RA 5CVJA 1RIOH 2VN2A 5LLQA 1FY7A 2RNJA 4PGGA 5HDGA 1BIAA 3F21A 5FFZA 2IT0A 2MH9A 3I54A 3M7GA 3WTWC 1JGSA 5DEQA 1YQAA 5H6QA 3G3ZA 5FD5A 3V8KA 2LKPA 3KP2A 1GHCA 2P4WA 1XB4A 3LQRA 2FMLA 1IN5A 3K1NA 5E8IA 3WE3A 3ABUA 4S04A 2RQPA 3MCZA 2WC2A 3QU6A 2ACJA 1XGNA 3ELKA 5HDKA 2XIGA 1LQ1A 3KZZA 3ECOA 2DQRA 4ZYEA 2Y75A 4FX4A 4M9SA 5L3BA 1KQ9A 1LVAA 4EJVA 2VT2A 1FSEA 2CWEA 1T6SA 3HRUA 1QBJA 2HTJA 5AIQA 5ICEA 4IRIA 2K4BA 3T5XA 4LGWA 5CYVA 4GXOA 5LEJA 2DPUA 1G6NA 5K1YA 5DUIA 2MLGA 1BJAA 4JK1X 3RKYA 1SMYF 2A3SA 3IKVA 3GWZA 2HQNA 4BHBA 3J80Z 2QLZA 5A2QK 1KYZA 3J7AO 1U5TB 1GVJA 3SFZA 1TQPA 2ESNA 2QWWA 3VODA 3HRTA 1EV7A 3F8MA 1MJAA 4HDUA 1FPQA 4NHJA 4BXUA 5ERIA 5DCFA 2NNYA 3CUOA 2ADUA 2VE8A 1J75A 4QWQA 2M87A 2FEZA 1CF7B 4RAZA 2CO5A 2QQAA 2OZUA 2QZ8A 5D4SA 4RGSA 1R1TA 5H20A 4YFXF 1WWXA 3S2WA 4LLNA 4LK1F 4I0AA 2MH2A 3MQ0A 3HUGA 2A07F 2CQKA 1ONVA 3TOBA 2EFWA 4L0ZB 2RV8A 2AS5F 3NEUA 5H6RA 6PAXA 1FBUA 4M72A 5TRDA 1HW2A 4Y13A 4I0BA 1ON1A 1CGPA 1J59A 3GZ5A 2XAGA 4RGXA 3LSTA 2A5YB 4HV5A 5D5WB 4MNUA 3HRSA 3L7WA 4KA4A 1REPC 3LQQA 1FZPB 1TW3A 3Q9VA 2OU2A 4I2OA 4AIJA 1XD7A 1BOAA 3I4PA 4CICA 2QM3A 1DDNA 1LJ9A 4A0YA 3WG9A 1QO0D 5LBQA 3CO6C 4YG2F 2IA1A 5A2QZ 1R58A 1FP1D 1F1ZA 4AIHA 4WCGA 4MQVA 3ZN1A 1BBYA 1XDUA 1R36A 5HS8A 1QZYA 2CSOA 1L3LA 2O61A 1O3SA 3ZMZA 4RB3C 3LWFA 3I0TA 5D8LB 4XRFA 5JVTA 3FMRA 4OIOF 1TQIA 3QOPA 4MGRA 1OKRA 1YO5C 2RGVA 2Z5UA 4HF2A 3P7NA 1G3WA 1JHFA 5E20A 4HX7A 3SHFA 2FXAA 5D5VB 4MQ9F 2EK5A 3NQOA 3BPVA 5TJJA 3E6DA 4KIFA 2P8TA 4UV9A 3ULQB 1W7PD 4OIRF 4FX0A 1HW1A 3P9KA 1BI2A 2O0YA 5K5OA 2DPDA 5BOXA 3FXRA 3V7RA 3V4GA 1FYLA 1I6XA 2V6CA 1XGSA 1QNTA 5DUKA 5JR3A 3HOSA 3LA2A 4I98B 4G7OF 3JAMK 1B6AA 3ZMUA 1T98A 1XSXA 1FNNA 2FOKA 4U0VA 3KCCA 5LHIA 4OIQF 3C1DA 1I1GA 2Z3YA 3L9FA 1TLHB 1KYWA 4IHSA 4H0EA 2EA4A 4LG0A 2HTSA 3M8EA 2DO7A 4UHTA 2FA5A 3GXOA 4KUMA 5FGMA 3PQKA 3QRFF 1P6RA 4MEXF 1O3TA 5E8GA 3F8NA 4N9HA 4OU0A 1D5VA 3EETA 3RPUA 2P6SA 3R61A 4Q48A 3BY6A 2FF4A 4GYGA 3V8JA 3DQVC 1RNLA 4QLCU 3ZMVA 1FX7A 5CLSA 3K1PA 4EGZA 1S7OA 4IRGA 1DPRA 4A5MA 1FWZA 3EYYA 5E18F 1TNSA 3RPQA 1IXRC 4L9NA 2CW0F 3U1DA 1T2KA 1ZH5A 2JPCA 2EFOA 4RS8A 2STTA 5E1ZB 2H27A 1VTNC 1HXDA 4MHGA 4KIBA 4O3MA 2XVCA 5ILSA 1ZRFA 2PJPA 3KEQA 2VC1A 4EJWA 2K4JA 3BJAA 1EH8A 4IHTA 1QPMA 4EVIA 4M74A 1MDMB 3FZVA 3GF2A 4G7HF 2FNPA 4KN7X 1SFUA 1KU3A 1YW8A 5FFXA 3LAJA 2V1DA 3WODF 2UXXA 5DD8A 2QUFA 5LEKA 1XSDA 2KIUA 1KU7A 3HOTA 4HA8A 3IRQA 3J80K 2GXGA 4EGYA 1YIOA 4NQWA 3WTTC 5D4RA 2A68F 5CVRA 3TDUC 2EFQA 2HOEA 1IN4A 4HX4A 4AVPA 1QGPA 3KZYA 1J0RA 4HAMA 3WTZA 4XSZF 4WXDA 5HDNA 3KP5A 1SD5A 4A5NA 2HWVA 4CHUA 3I71A 4OMZA 3CUQA 1U3EM 3HHGA 4O5VA 2ISYA 1U78A 2EV6A 3SQNA 1ZHFA 1YW7A 2V1UA 5AIPA 2PLYA 3IWFA 2STWA 2EFNA 3RIRA 1I5ZA 3F3XA 1WKMA 4AD9A 3GLXA 2W24A 1OPCA 2GZWA 4P9UA 1OMIA 3CJNA 3KETA 1XMKA 5BPIA 3ERED 2L4MA 1U2WA 1YLFA 5LGTA 2L54A 4G8XA 4XLPF 4GO1A 3E6MA 1K78B 3FXUA 2LF7A 4M6YA 3KP7A 3KLNA 3DXJF 2VOPA 2GXBA 1USTA 4IXAA 1Z6RA 3VEPA 2J5OA 2M1BA 1YS6A 3T0YA 3R60A 3HIFA 1W5TA 1J9IA 1IF1A 2FNAA 2GWRA 4HQMA 2L02A 4OIPF 4ZYGA 5HOOA 2HYGD 1SFEA 3RTRA 2DAOA 2KIFA 3I64A 2EB7A 1PP7U 4RAYA 3K0LA 3R0AA 5E1XA 3IWZA 3SXYA 4R8HA 2EA2A 3N4MA 3DEUA 2DI3A 4O6JA 2A6HF 5EEGA 2BV6A 2JPBA 1FOKA 2DLLA 1LNWA 3FM3A 1TNTA 1ZGJA 1G3SA 2V1XA 1PUEE 2HDCA 5HLGA 3BZ6A 2OAZA 3W6KB 1HSTA 2VBXA 5IT3A 2BBYA 2R7DA 4MTDA 1U6GA 4IVNA 3DV8A 1IN6A 1YS7A 4WF2A 3IL2A 4UVBA 2Z33A 2QBYA 1IAWA 2HKXA 3CUQC 4RGUA 2OD5A 2GQQA 4B09A 4LLGF 4U7DA 3E5QA 2FU4A 3TDZC 3GW2A 1O7LA 4AIKA 2A69F 4ASNA 3FHZA 1R00A 5HVQC 3O2PE 4RGRA 2W57A 1ZRDA 2RC4A 1JXSA 4LLLA 4BNCA 2DT5A 5DDGA 1WRJA 3MAJA 2ZCWA 4KYWA 5J8FA 1R1UA 3E6CC 1BI3A 2X0LA 2WWYA 3ECHA 5KK1A 5IT9Z 4L18B 1B9NA 2PMUA 4K2EA 1H9GA 2YPRA 3H3UA 4ZZDA 2H09A 1IW7F 1UFMA 1O3QA 2XAFA 2HZTA 4ESJA 3QAHA 2BE5F 2ZFWA 5JHUA 3BPXA 3KP4A 3F22A 1YG2A 4PGHA 1QQIA 3R4KA 2FMYA 1F5TA 1O7FA 1UHWA 4HZFA 1XGOA 5L3GA 3MFKA 2K7LA 5HS7A 4BQAA 1IXSB 1IZ1A 2PI0A 3V7CA 3P9IA 4IRHA 1ZLJA 4A6DA 4ENKA 3IKTA 2CG4A 2MBFA 3KP3A 2ESHA 4Y15A 1K6OA 4EJTA 1EH7A 3JSOA 4FHTA 3ZQ7A 4U0WA 3V7SA 1SFXA 4WK8F 2OQGA 3V8LA 3BJOA 4WXCA 3LA7A 5J8CA 3E5UA 2IPQX 4BYYA 2GA2A 2B0LA 1XN7A 2F5FA 1NHAA 2E1NA 5L3DA 3JW4A 1W7PA 3L2CA 4PCQA 2ZJ2A 4I02A 3PFIA 2XKPA 3ZN0A 2LNBA 5DCMB 3ZPLA 3TQNA 1T38A 4ESBA 3WGHA 1BI1A 1XMAA 4IF4A 3WTUC 2RVCA 2YX7A 1D3YA 1X3UA 2RKHA 1SD6A 3IC7A 1FYMA 1S8NA 5DYMA 2E1CA 1DPUA 4KN4X 4BHPA 2O03A 1MKMA 1D8JA 4HDVA 2JSCA 1Z6TA 5IT9K 1B4AA 1LB2A 3J81K 2MD5A 2G7UA 1TQMA 4KDPA 3F8CA 3RYRA 2XKOA 2IA0A 2AXLA 5HS9A 1RUNA 2W25A 4ENJA 3G73A 2P7CB 2YSRA 4YIFA 3COAC 2L3DA 3C3WA 3BROA 2KJBA 2DQLA 2IA2A 1R5GA 4EV0A 1G3YA 1ULYA 3K69A 2QENA 2ZNYA 3ISPA 4P96A 3QP5A 4OOIA 3LAPA 2DK8A 4E70A 3GZ6A 3R6SA 5D5XB 2PQ8A 2F5CA 2ZXJA 3GFMA 2O3FA 3ZMSA 3HSEA 2ZKZA 1ON2A 1BM9A 3OV8A 3I53A 3HYIA 2QVOA 5FD6A 2J5PA 3GUDA 2XUBA 2EJRA 3U9GA 3B73A 2DBBA 3ROUA 1MJ9A 3VB2A 1K7AA 2NRAC 1OR7A 3CUQB 3QP6A 3DPLC 4U88A 3MZHA 1QZZA 3I5UA 2VBZA 1ZAOA 2OA4A 1Z9CA 3RKXA 4I01A 5K5RA 1XCVA 3JSPA 3CLOA 5ED4A 1MGTA 3D0SA 5BQTA 1G4DA 2WV0A 2PEXA 4L5JA 2FBIA 1LDDA 1H9TA 4AWXB 1ZG3A 3FMQA 2JRTA 2D1VA 2GIVA 2JZYA 3HSRA 4JBAA 3RYPA 3U2RA 3T8TA 1FP2A 2V79A 3F8FA 1I1SA 2ISZA 4EM1A 1CF7A 2ETHA 1OYYA 4ENMA 5DCMA 1MD0A 3JTGA 2EV5A 2VE9A 1Z05A 3E97A 3WTXC 2LF8A 2HS5A 2Y0MA 2VONA 3FWEA 2VBWA 3BJ6A 2GAUA 1KA8A 2P5VA 4M73A 2P5KA 2P7VB 1ZG1A 4KT5C 2QYOA 2R7FA 4EM0B 1IRGA 2FSWA 1MJBA 4I09A 2QQBA 3L00A 5ICGA 2HFHA 2YX4A 3M8FA 2COMA 2CGPA 1TTYA 1F4KA 1LEBA 1T0FA 3ML6A 4UUVA 1UCRA 4KICA 2GA1A 3N97A 2X4HA 5ICFA 4ZYHA 4A12A 3RDIA 4BHCA 1MDMA 5K5QA 1SD7A 5HLHA 5FLXZ 2BGCA 3GO5A 4IPAA 4HX8A 1W5SA 1FBSA 2QBYB 2FRHA 3L09A 4F7ZA 1WSUA 4Z2YA 2YR2A 1KU2A 2DW4A 1KQ0A 4CDGA 3DF8A 1A04A 1HKTA 4L5IA 3FX3A 2V9VA 2OZ6A 4MTEA 1IRFA 2XV4S 2FBHA 2NS0A 4JQFA 4WXHA 3WGIA 4D0PA 4DNCA 2D1HA 1STZA 5LHGA 2D45A 2H6BA 4UV8A 4G7ZF 3SZTA 2DTRA 3LFKA 2P5LC 5LGNA 1ZREA 1WQ2A 3QPTA 1V4RA 3R0JA 3GFJA 1AWCA 3HSFA 4NB5A 4G6QA 4HW0A 1R1VA 2VXZA 2E7WA 2MLKA 4CYDA 1GXQA 4YFKF 2F5DA 1P4XA 2DFIA 4MEYF 2PN6A 1XDSA 4OINF 2K02A 2JT1A 2ZO4A 3K1MA 3RI4A 4KIGA 5D6FA 5ILVA 3K2ZA 3PQJA 5BPDA 3MWMA 1YW9A 3AAFA 1P4AA 2Y48A 5CJ9A 1W4MA 4M9ZA 4KFCA 4HLXA 2VBYA 4L0YB 2DU9A 1P92A 3FMSA 4U0YA 1JE8A 3GVAA 4CZZA 1HKQA 4RB0A 1B9MA 2Q8KA 4IJAA 3QU3A 5LRRA 2D2WA 3CDHA 3GFIA 1ZGAA 1KGSA 5E1WA 4HQEA 1ZARA 2M5WA 3C7JA 2VT3A 1J5YA 4GYIA 4DQ2A 4N0BA 2PFBA 3F23A 1C0WA 4S05A 2IW5A 1UHMA 2KJCA 1PP8F 2BYVE 3E6BA 3KEOA 3GX4X 5D6EA 1DP7P 1FSHA 2FE3A 5E17F 3CO7C 1XSVA 4RB1A 1R5HA 2F2EA 2IP2A 2EWNA 4LJZF 4OMYA 1Z91A 1USSA 2BEOA 2EFPA 2ZMEA 5F1RA 4ENNA 4I7HA 4L9VA 1ZLKA 4KMFA 1KQ8A 5ILUA 5LRSA 1J7KA 1IUYA 4KMUX 2PG4A 2MA3A 2Z99A 4XBFA 5CVVA 3HHHA 2MC3A 2VODA 3KLOA 1K78A 5BMZA 2LSOA 2H94A 1FC3A 4YFNF 1S7AA 5D5UB 3DKWA 4UVCA 1O3RA 3RJPA 3TO6A 3ZMTA 3P9CA 4ZZLA 1KU9A 4A6EA 2K27A 3EUHA 3M1EA 4PZJA 1HQCA 3HTSB 3DFGA 4M9XA 5ICCA 2VC0A 3Q5FA 2VOOA 2CYYA 4P9FA 4Q5SF 2E7XA 1PDNC 5KVRA 2PMHA 2KRFA 5CVUA 1U5TA 1WI9A 1SAXA 4LK0F 2IJLA 4WWCA 2O8XA 2M30A 4R79A 3ABTA 1O57A 3VFZA 4XLNF 5HLIA 1S29A 5F64A 3FM5A 2IVMA 3VOEA 1Z7UA 5JFRA 4LB6B 3GEZA 1BN5A 1I27A 1S6LA 4Q4ZF 4P55A 1TBXA 3WU1B 4UVAA 1D8KA 2ZMEB 2A61A 3EYIA 1BC8C 4ZH4F 1FYKA 2M45A 3IRRA 1U8RA 5J6XA 5CVIA 2O6GE 1UB9A 4M71A 1T39A 4P5OA 1IN7A 3M9AA 3MEXA 3I59A 1RI7A 3WGGA 3REOA 4R1HA 2L4AA 3H3ZA 1V3FA 1DUXC 4UNOA 1OYIA 4L9TA 3W6JB 3QPHA 1IN8A 1XGMA 1ZRCA 1R7JA 2UWMA 1U5TC 2RN7A 3BWGA 2L01A 4HYEA 3D5LA 1HSJA 3C18A 4GGGA 3EQLF 2ZBKA 1RZ4A 1GXPA 2ELHA 3WU0A 2HEOA 2TDXA 1EH6A 4FT8A 4A2UA 3WE2A 2K86A 2QQ9A 2UXNA 5LHHA 5LGUA 3TO9A 3BP8A 3BDDA 4M6XA 5FO5A 2XHKA 3HTUA 2HYFA 3FF5A 4ESFA 4LFUA 3KP6A 1HBXG 2M8EA 3E5XA 3NRVA 2NAZA 4HLYA 2YU3A 4PDKA 1SD4A 4B8XA 4Q47A 2DK5A 3WTYC 1BC7C 4EQQA 3KFWX 3T1BA 5JI6A 1YFHA 2IRFG 4ETSA 4Y17A 4LMYA 3DPTA 4L9JA 4CO8A 3F6OA 4BAYA 1SMTA 3EDPA 4LG0B 3F8BA 2HR3A 2JTVA 4RB2C 4EMSA 1YTYA 2HKOA 2LDUA 1XCBA 2A6EF 2FQ3A 1HKSA 1J2XA 5D8KB 3I58A 1IXCA 3MZYA 3TOAA 5F6FA 1E17A 2RDPA 3TKYA 1P4WA 3O6BB 2Q2EA 1Y0UA 4EM2A 3LA3A 4HOBA 2XAHA 4U7BA 4N9IA 2Q0OA 2XAJA 3RKWA 4LD5A 1LEAA 4KNYA 2HGCA 2FBKA 3H92A 2Z9OA 2WTEA 4WX9A 4LB5A 3OOPA 5DV5A 4HF1A 1TW2A 2CFXA 2W84A 2EV0A 1H0MA 4BH9A 2XASA 4HF0A 1FBQA 4G94A 1LDKB 4XSXF 5DD4A 1FT9A 2ZNZA 4YIIA 2UZKA 3F72A 2XAQA 1R23A 1G3TA 1FLIA 3K9TA 3KE2A 2PBIA 1OYWA 2R3SA 1ZYRF 2NNNA 1B1BA 1R22A 1BIBA 5L3CA 3B02A 1S3JA 2H6CA 4GCVA 2OBPA 3CTAA 5L3FA 4A0ZA 1ODDA 2F5EA 3ZP5A 1Z1DA 1ZN2A 3BOQA 1P2FA 2KKOA 3TO7A 3IHUA 1K79A 3GYHX 5BS6A 1AOYA 3TGNA 1E2XA 1MZBA 2G9WA 3JAMZ 1YYVA 1RUOA 3WTVC 1Q1HA 3WTSC 3J81Z 1HW5A 4EJOA 5L3EA 5AONA 3Q9SA 2NYXA 4HV6A 2C6YA 3FXQA 4UXNA 4CXFA 2P6TA 1BI0A 1F9NA 2XRNA 3HRMA 3O3KA 4ON0A 2XROA 2OQRA 3GFLA 3DP7A 1LDJA 4HBLA 4G9YA 4EJUA 3F6VA 5EEHA 4A0XA 3ZMDA 1B59A 3E3VA 2HQRA 4CGZA 4G6DA 2KIMA 4ZYDA 3JTHA 2G7HA 1W7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB2 A;  2XGX A;  2W85 A;  1JHH A;  1L0O C;  4TV7 A;  3I59 B;  5FLX K;  3SZP A;  1ZG5 A;  3T8R A;  5CVJ A;  1RIO H;  2VN2 A;  5LLQ A;  1FY7 A;  2RNJ A;  4PGG A;  5HDG A;  1BIA A;  3F21 A;  5FFZ A;  2IT0 A;  2MH9 A;  3I54 A;  3M7G A;  3WTW C;  1JGS A;  5DEQ A;  1YQA A;  5H6Q A;  3G3Z A;  5FD5 A;  3V8K A;  2LKP A;  3KP2 A;  1GHC A;  2P4W A;  1XB4 A;  3LQR A;  2FML A;  1IN5 A;  3K1N A;  5E8I A;  3WE3 A;  3ABU A;  4S04 A;  2RQP A;  3MCZ A;  2WC2 A;  3QU6 A;  2ACJ A;  1XGN A;  3ELK A;  5HDK A;  2XIG A;  1LQ1 A;  3KZZ A;  3ECO A;  2DQR A;  4ZYE A;  2Y75 A;  4FX4 A;  4M9S A;  5L3B A;  1KQ9 A;  1LVA A;  4EJV A;  2VT2 A;  1FSE A;  2CWE A;  1T6S A;  3HRU A;  1QBJ A;  2HTJ A;  5AIQ A;  5ICE A;  4IRI A;  2K4B A;  3T5X A;  4LGW A;  5CYV A;  4GXO A;  5LEJ A;  2DPU A;  1G6N A;  5K1Y A;  5DUI A;  2MLG A;  1BJA A;  4JK1 X;  3RKY A;  1SMY F;  2A3S A;  3IKV A;  3GWZ A;  2HQN A;  4BHB A;  3J80 Z;  2QLZ A;  5A2Q K;  1KYZ A;  3J7A O;  1U5T B;  1GVJ A;  3SFZ A;  1TQP A;  2ESN A;  2QWW A;  3VOD A;  3HRT A;  1EV7 A;  3F8M A;  1MJA A;  4HDU A;  1FPQ A;  4NHJ A;  4BXU A;  5ERI A;  5DCF A;  2NNY A;  3CUO A;  2ADU A;  2VE8 A;  1J75 A;  4QWQ A;  2M87 A;  2FEZ A;  1CF7 B;  4RAZ A;  2CO5 A;  2QQA A;  2OZU A;  2QZ8 A;  5D4S A;  4RGS A;  1R1T A;  5H20 A;  4YFX F;  1WWX A;  3S2W A;  4LLN A;  4LK1 F;  4I0A A;  2MH2 A;  3MQ0 A;  3HUG A;  2A07 F;  2CQK A;  1ONV A;  3TOB A;  2EFW A;  4L0Z B;  2RV8 A;  2AS5 F;  3NEU A;  5H6R A;  6PAX A;  1FBU A;  4M72 A;  5TRD A;  1HW2 A;  4Y13 A;  4I0B A;  1ON1 A;  1CGP A;  1J59 A;  3GZ5 A;  2XAG A;  4RGX A;  3LST A;  2A5Y B;  4HV5 A;  5D5W B;  4MNU A;  3HRS A;  3L7W A;  4KA4 A;  1REP C;  3LQQ A;  1FZP B;  1TW3 A;  3Q9V A;  2OU2 A;  4I2O A;  4AIJ A;  1XD7 A;  1BOA A;  3I4P A;  4CIC A;  2QM3 A;  1DDN A;  1LJ9 A;  4A0Y A;  3WG9 A;  1QO0 D;  5LBQ A;  3CO6 C;  4YG2 F;  2IA1 A;  5A2Q Z;  1R58 A;  1FP1 D;  1F1Z A;  4AIH A;  4WCG A;  4MQV A;  3ZN1 A;  1BBY A;  1XDU A;  1R36 A;  5HS8 A;  1QZY A;  2CSO A;  1L3L A;  2O61 A;  1O3S A;  3ZMZ A;  4RB3 C;  3LWF A;  3I0T A;  5D8L B;  4XRF A;  5JVT A;  3FMR A;  4OIO F;  1TQI A;  3QOP A;  4MGR A;  1OKR A;  1YO5 C;  2RGV A;  2Z5U A;  4HF2 A;  3P7N A;  1G3W A;  1JHF A;  5E20 A;  4HX7 A;  3SHF A;  2FXA A;  5D5V B;  4MQ9 F;  2EK5 A;  3NQO A;  3BPV A;  5TJJ A;  3E6D A;  4KIF A;  2P8T A;  4UV9 A;  3ULQ B;  1W7P D;  4OIR F;  4FX0 A;  1HW1 A;  3P9K A;  1BI2 A;  2O0Y A;  5K5O A;  2DPD A;  5BOX A;  3FXR A;  3V7R A;  3V4G A;  1FYL A;  1I6X A;  2V6C A;  1XGS A;  1QNT A;  5DUK A;  5JR3 A;  3HOS A;  3LA2 A;  4I98 B;  4G7O F;  3JAM K;  1B6A A;  3ZMU A;  1T98 A;  1XSX A;  1FNN A;  2FOK A;  4U0V A;  3KCC A;  5LHI A;  4OIQ F;  3C1D A;  1I1G A;  2Z3Y A;  3L9F A;  1TLH B;  1KYW A;  4IHS A;  4H0E A;  2EA4 A;  4LG0 A;  2HTS A;  3M8E A;  2DO7 A;  4UHT A;  2FA5 A;  3GXO A;  4KUM A;  5FGM A;  3PQK A;  3QRF F;  1P6R A;  4MEX F;  1O3T A;  5E8G A;  3F8N A;  4N9H A;  4OU0 A;  1D5V A;  3EET A;  3RPU A;  2P6S A;  3R61 A;  4Q48 A;  3BY6 A;  2FF4 A;  4GYG A;  3V8J A;  3DQV C;  1RNL A;  4QLC U;  3ZMV A;  1FX7 A;  5CLS A;  3K1P A;  4EGZ A;  1S7O A;  4IRG A;  1DPR A;  4A5M A;  1FWZ A;  3EYY A;  5E18 F;  1TNS A;  3RPQ A;  1IXR C;  4L9N A;  2CW0 F;  3U1D A;  1T2K A;  1ZH5 A;  2JPC A;  2EFO A;  4RS8 A;  2STT A;  5E1Z B;  2H27 A;  1VTN C;  1HXD A;  4MHG A;  4KIB A;  4O3M A;  2XVC A;  5ILS A;  1ZRF A;  2PJP A;  3KEQ A;  2VC1 A;  4EJW A;  2K4J A;  3BJA A;  1EH8 A;  4IHT A;  1QPM A;  4EVI A;  4M74 A;  1MDM B;  3FZV A;  3GF2 A;  4G7H F;  2FNP A;  4KN7 X;  1SFU A;  1KU3 A;  1YW8 A;  5FFX A;  3LAJ A;  2V1D A;  3WOD F;  2UXX A;  5DD8 A;  2QUF A;  5LEK A;  1XSD A;  2KIU A;  1KU7 A;  3HOT A;  4HA8 A;  3IRQ A;  3J80 K;  2GXG A;  4EGY A;  1YIO A;  4NQW A;  3WTT C;  5D4R A;  2A68 F;  5CVR A;  3TDU C;  2EFQ A;  2HOE A;  1IN4 A;  4HX4 A;  4AVP A;  1QGP A;  3KZY A;  1J0R A;  4HAM A;  3WTZ A;  4XSZ F;  4WXD A;  5HDN A;  3KP5 A;  1SD5 A;  4A5N A;  2HWV A;  4CHU A;  3I71 A;  4OMZ A;  3CUQ A;  1U3E M;  3HHG A;  4O5V A;  2ISY A;  1U78 A;  2EV6 A;  3SQN A;  1ZHF A;  1YW7 A;  2V1U A;  5AIP A;  2PLY A;  3IWF A;  2STW A;  2EFN A;  3RIR A;  1I5Z A;  3F3X A;  1WKM A;  4AD9 A;  3GLX A;  2W24 A;  1OPC A;  2GZW A;  4P9U A;  1OMI A;  3CJN A;  3KET A;  1XMK A;  5BPI A;  3ERE D;  2L4M A;  1U2W A;  1YLF A;  5LGT A;  2L54 A;  4G8X A;  4XLP F;  4GO1 A;  3E6M A;  1K78 B;  3FXU A;  2LF7 A;  4M6Y A;  3KP7 A;  3KLN A;  3DXJ F;  2VOP A;  2GXB A;  1UST A;  4IXA A;  1Z6R A;  3VEP A;  2J5O A;  2M1B A;  1YS6 A;  3T0Y A;  3R60 A;  3HIF A;  1W5T A;  1J9I A;  1IF1 A;  2FNA A;  2GWR A;  4HQM A;  2L02 A;  4OIP F;  4ZYG A;  5HOO A;  2HYG D;  1SFE A;  3RTR A;  2DAO A;  2KIF A;  3I64 A;  2EB7 A;  1PP7 U;  4RAY A;  3K0L A;  3R0A A;  5E1X A;  3IWZ A;  3SXY A;  4R8H A;  2EA2 A;  3N4M A;  3DEU A;  2DI3 A;  4O6J A;  2A6H F;  5EEG A;  2BV6 A;  2JPB A;  1FOK A;  2DLL A;  1LNW A;  3FM3 A;  1TNT A;  1ZGJ A;  1G3S A;  2V1X A;  1PUE E;  2HDC A;  5HLG A;  3BZ6 A;  2OAZ A;  3W6K B;  1HST A;  2VBX A;  5IT3 A;  2BBY A;  2R7D A;  4MTD A;  1U6G A;  4IVN A;  3DV8 A;  1IN6 A;  1YS7 A;  4WF2 A;  3IL2 A;  4UVB A;  2Z33 A;  2QBY A;  1IAW A;  2HKX A;  3CUQ C;  4RGU A;  2OD5 A;  2GQQ A;  4B09 A;  4LLG F;  4U7D A;  3E5Q A;  2FU4 A;  3TDZ C;  3GW2 A;  1O7L A;  4AIK A;  2A69 F;  4ASN A;  3FHZ A;  1R00 A;  5HVQ C;  3O2P E;  4RGR A;  2W57 A;  1ZRD A;  2RC4 A;  1JXS A;  4LLL A;  4BNC A;  2DT5 A;  5DDG A;  1WRJ A;  3MAJ A;  2ZCW A;  4KYW A;  5J8F A;  1R1U A;  3E6C C;  1BI3 A;  2X0L A;  2WWY A;  3ECH A;  5KK1 A;  5IT9 Z;  4L18 B;  1B9N A;  2PMU A;  4K2E A;  1H9G A;  2YPR A;  3H3U A;  4ZZD A;  2H09 A;  1IW7 F;  1UFM A;  1O3Q A;  2XAF A;  2HZT A;  4ESJ A;  3QAH A;  2BE5 F;  2ZFW A;  5JHU A;  3BPX A;  3KP4 A;  3F22 A;  1YG2 A;  4PGH A;  1QQI A;  3R4K A;  2FMY A;  1F5T A;  1O7F A;  1UHW A;  4HZF A;  1XGO A;  5L3G A;  3MFK A;  2K7L A;  5HS7 A;  4BQA A;  1IXS B;  1IZ1 A;  2PI0 A;  3V7C A;  3P9I A;  4IRH A;  1ZLJ A;  4A6D A;  4ENK A;  3IKT A;  2CG4 A;  2MBF A;  3KP3 A;  2ESH A;  4Y15 A;  1K6O A;  4EJT A;  1EH7 A;  3JSO A;  4FHT A;  3ZQ7 A;  4U0W A;  3V7S A;  1SFX A;  4WK8 F;  2OQG A;  3V8L A;  3BJO A;  4WXC A;  3LA7 A;  5J8C A;  3E5U A;  2IPQ X;  4BYY A;  2GA2 A;  2B0L A;  1XN7 A;  2F5F A;  1NHA A;  2E1N A;  5L3D A;  3JW4 A;  1W7P A;  3L2C A;  4PCQ A;  2ZJ2 A;  4I02 A;  3PFI A;  2XKP A;  3ZN0 A;  2LNB A;  5DCM B;  3ZPL A;  3TQN A;  1T38 A;  4ESB A;  3WGH A;  1BI1 A;  1XMA A;  4IF4 A;  3WTU C;  2RVC A;  2YX7 A;  1D3Y A;  1X3U A;  2RKH A;  1SD6 A;  3IC7 A;  1FYM A;  1S8N A;  5DYM A;  2E1C A;  1DPU A;  4KN4 X;  4BHP A;  2O03 A;  1MKM A;  1D8J A;  4HDV A;  2JSC A;  1Z6T A;  5IT9 K;  1B4A A;  1LB2 A;  3J81 K;  2MD5 A;  2G7U A;  1TQM A;  4KDP A;  3F8C A;  3RYR A;  2XKO A;  2IA0 A;  2AXL A;  5HS9 A;  1RUN A;  2W25 A;  4ENJ A;  3G73 A;  2P7C B;  2YSR A;  4YIF A;  3COA C;  2L3D A;  3C3W A;  3BRO A;  2KJB A;  2DQL A;  2IA2 A;  1R5G A;  4EV0 A;  1G3Y A;  1ULY A;  3K69 A;  2QEN A;  2ZNY A;  3ISP A;  4P96 A;  3QP5 A;  4OOI A;  3LAP A;  2DK8 A;  4E70 A;  3GZ6 A;  3R6S A;  5D5X B;  2PQ8 A;  2F5C A;  2ZXJ A;  3GFM A;  2O3F A;  3ZMS A;  3HSE A;  2ZKZ A;  1ON2 A;  1BM9 A;  3OV8 A;  3I53 A;  3HYI A;  2QVO A;  5FD6 A;  2J5P A;  3GUD A;  2XUB A;  2EJR A;  3U9G A;  3B73 A;  2DBB A;  3ROU A;  1MJ9 A;  3VB2 A;  1K7A A;  2NRA C;  1OR7 A;  3CUQ B;  3QP6 A;  3DPL C;  4U88 A;  3MZH A;  1QZZ A;  3I5U A;  2VBZ A;  1ZAO A;  2OA4 A;  1Z9C A;  3RKX A;  4I01 A;  5K5R A;  1XCV A;  3JSP A;  3CLO A;  5ED4 A;  1MGT A;  3D0S A;  5BQT A;  1G4D A;  2WV0 A;  2PEX A;  4L5J A;  2FBI A;  1LDD A;  1H9T A;  4AWX B;  1ZG3 A;  3FMQ A;  2JRT A;  2D1V A;  2GIV A;  2JZY A;  3HSR A;  4JBA A;  3RYP A;  3U2R A;  3T8T A;  1FP2 A;  2V79 A;  3F8F A;  1I1S A;  2ISZ A;  4EM1 A;  1CF7 A;  2ETH A;  1OYY A;  4ENM A;  5DCM A;  1MD0 A;  3JTG A;  2EV5 A;  2VE9 A;  1Z05 A;  3E97 A;  3WTX C;  2LF8 A;  2HS5 A;  2Y0M A;  2VON A;  3FWE A;  2VBW A;  3BJ6 A;  2GAU A;  1KA8 A;  2P5V A;  4M73 A;  2P5K A;  2P7V B;  1ZG1 A;  4KT5 C;  2QYO A;  2R7F A;  4EM0 B;  1IRG A;  2FSW A;  1MJB A;  4I09 A;  2QQB A;  3L00 A;  5ICG A;  2HFH A;  2YX4 A;  3M8F A;  2COM A;  2CGP A;  1TTY A;  1F4K A;  1LEB A;  1T0F A;  3ML6 A;  4UUV A;  1UCR A;  4KIC A;  2GA1 A;  3N97 A;  2X4H A;  5ICF A;  4ZYH A;  4A12 A;  3RDI A;  4BHC A;  1MDM A;  5K5Q A;  1SD7 A;  5HLH A;  5FLX Z;  2BGC A;  3GO5 A;  4IPA A;  4HX8 A;  1W5S A;  1FBS A;  2QBY B;  2FRH A;  3L09 A;  4F7Z A;  1WSU A;  4Z2Y A;  2YR2 A;  1KU2 A;  2DW4 A;  1KQ0 A;  4CDG A;  3DF8 A;  1A04 A;  1HKT A;  4L5I A;  3FX3 A;  2V9V A;  2OZ6 A;  4MTE A;  1IRF A;  2XV4 S;  2FBH A;  2NS0 A;  4JQF A;  4WXH A;  3WGI A;  4D0P A;  4DNC A;  2D1H A;  1STZ A;  5LHG A;  2D45 A;  2H6B A;  4UV8 A;  4G7Z F;  3SZT A;  2DTR A;  3LFK A;  2P5L C;  5LGN A;  1ZRE A;  1WQ2 A;  3QPT A;  1V4R A;  3R0J A;  3GFJ A;  1AWC A;  3HSF A;  4NB5 A;  4G6Q A;  4HW0 A;  1R1V A;  2VXZ A;  2E7W A;  2MLK A;  4CYD A;  1GXQ A;  4YFK F;  2F5D A;  1P4X A;  2DFI A;  4MEY F;  2PN6 A;  1XDS A;  4OIN F;  2K02 A;  2JT1 A;  2ZO4 A;  3K1M A;  3RI4 A;  4KIG A;  5D6F A;  5ILV A;  3K2Z A;  3PQJ A;  5BPD A;  3MWM A;  1YW9 A;  3AAF A;  1P4A A;  2Y48 A;  5CJ9 A;  1W4M A;  4M9Z A;  4KFC A;  4HLX A;  2VBY A;  4L0Y B;  2DU9 A;  1P92 A;  3FMS A;  4U0Y A;  1JE8 A;  3GVA A;  4CZZ A;  1HKQ A;  4RB0 A;  1B9M A;  2Q8K A;  4IJA A;  3QU3 A;  5LRR A;  2D2W A;  3CDH A;  3GFI A;  1ZGA A;  1KGS A;  5E1W A;  4HQE A;  1ZAR A;  2M5W A;  3C7J A;  2VT3 A;  1J5Y A;  4GYI A;  4DQ2 A;  4N0B A;  2PFB A;  3F23 A;  1C0W A;  4S05 A;  2IW5 A;  1UHM A;  2KJC A;  1PP8 F;  2BYV E;  3E6B A;  3KEO A;  3GX4 X;  5D6E A;  1DP7 P;  1FSH A;  2FE3 A;  5E17 F;  3CO7 C;  1XSV A;  4RB1 A;  1R5H A;  2F2E A;  2IP2 A;  2EWN A;  4LJZ F;  4OMY A;  1Z91 A;  1USS A;  2BEO A;  2EFP A;  2ZME A;  5F1R A;  4ENN A;  4I7H A;  4L9V A;  1ZLK A;  4KMF A;  1KQ8 A;  5ILU A;  5LRS A;  1J7K A;  1IUY A;  4KMU X;  2PG4 A;  2MA3 A;  2Z99 A;  4XBF A;  5CVV A;  3HHH A;  2MC3 A;  2VOD A;  3KLO A;  1K78 A;  5BMZ A;  2LSO A;  2H94 A;  1FC3 A;  4YFN F;  1S7A A;  5D5U B;  3DKW A;  4UVC A;  1O3R A;  3RJP A;  3TO6 A;  3ZMT A;  3P9C A;  4ZZL A;  1KU9 A;  4A6E A;  2K27 A;  3EUH A;  3M1E A;  4PZJ A;  1HQC A;  3HTS B;  3DFG A;  4M9X A;  5ICC A;  2VC0 A;  3Q5F A;  2VOO A;  2CYY A;  4P9F A;  4Q5S F;  2E7X A;  1PDN C;  5KVR A;  2PMH A;  2KRF A;  5CVU A;  1U5T A;  1WI9 A;  1SAX A;  4LK0 F;  2IJL A;  4WWC A;  2O8X A;  2M30 A;  4R79 A;  3ABT A;  1O57 A;  3VFZ A;  4XLN F;  5HLI A;  1S29 A;  5F64 A;  3FM5 A;  2IVM A;  3VOE A;  1Z7U A;  5JFR A;  4LB6 B;  3GEZ A;  1BN5 A;  1I27 A;  1S6L A;  4Q4Z F;  4P55 A;  1TBX A;  3WU1 B;  4UVA A;  1D8K A;  2ZME B;  2A61 A;  3EYI A;  1BC8 C;  4ZH4 F;  1FYK A;  2M45 A;  3IRR A;  1U8R A;  5J6X A;  5CVI A;  2O6G E;  1UB9 A;  4M71 A;  1T39 A;  4P5O A;  1IN7 A;  3M9A A;  3MEX A;  3I59 A;  1RI7 A;  3WGG A;  3REO A;  4R1H A;  2L4A A;  3H3Z A;  1V3F A;  1DUX C;  4UNO A;  1OYI A;  4L9T A;  3W6J B;  3QPH A;  1IN8 A;  1XGM A;  1ZRC A;  1R7J A;  2UWM A;  1U5T C;  2RN7 A;  3BWG A;  2L01 A;  4HYE A;  3D5L A;  1HSJ A;  3C18 A;  4GGG A;  3EQL F;  2ZBK A;  1RZ4 A;  1GXP A;  2ELH A;  3WU0 A;  2HEO A;  2TDX A;  1EH6 A;  4FT8 A;  4A2U A;  3WE2 A;  2K86 A;  2QQ9 A;  2UXN A;  5LHH A;  5LGU A;  3TO9 A;  3BP8 A;  3BDD A;  4M6X A;  5FO5 A;  2XHK A;  3HTU A;  2HYF A;  3FF5 A;  4ESF A;  4LFU A;  3KP6 A;  1HBX G;  2M8E A;  3E5X A;  3NRV A;  2NAZ A;  4HLY A;  2YU3 A;  4PDK A;  1SD4 A;  4B8X A;  4Q47 A;  2DK5 A;  3WTY C;  1BC7 C;  4EQQ A;  3KFW X;  3T1B A;  5JI6 A;  1YFH A;  2IRF G;  4ETS A;  4Y17 A;  4LMY A;  3DPT A;  4L9J A;  4CO8 A;  3F6O A;  4BAY A;  1SMT A;  3EDP A;  4LG0 B;  3F8B A;  2HR3 A;  2JTV A;  4RB2 C;  4EMS A;  1YTY A;  2HKO A;  2LDU A;  1XCB A;  2A6E F;  2FQ3 A;  1HKS A;  1J2X A;  5D8K B;  3I58 A;  1IXC A;  3MZY A;  3TOA A;  5F6F A;  1E17 A;  2RDP A;  3TKY A;  1P4W A;  3O6B B;  2Q2E A;  1Y0U A;  4EM2 A;  3LA3 A;  4HOB A;  2XAH A;  4U7B A;  4N9I A;  2Q0O A;  2XAJ A;  3RKW A;  4LD5 A;  1LEA A;  4KNY A;  2HGC A;  2FBK A;  3H92 A;  2Z9O A;  2WTE A;  4WX9 A;  4LB5 A;  3OOP A;  5DV5 A;  4HF1 A;  1TW2 A;  2CFX A;  2W84 A;  2EV0 A;  1H0M A;  4BH9 A;  2XAS A;  4HF0 A;  1FBQ A;  4G94 A;  1LDK B;  4XSX F;  5DD4 A;  1FT9 A;  2ZNZ A;  4YII A;  2UZK A;  3F72 A;  2XAQ A;  1R23 A;  1G3T A;  1FLI A;  3K9T A;  3KE2 A;  2PBI A;  1OYW A;  2R3S A;  1ZYR F;  2NNN A;  1B1B A;  1R22 A;  1BIB A;  5L3C A;  3B02 A;  1S3J A;  2H6C A;  4GCV A;  2OBP A;  3CTA A;  5L3F A;  4A0Z A;  1ODD A;  2F5E A;  3ZP5 A;  1Z1D A;  1ZN2 A;  3BOQ A;  1P2F A;  2KKO A;  3TO7 A;  3IHU A;  1K79 A;  3GYH X;  5BS6 A;  1AOY A;  3TGN A;  1E2X A;  1MZB A;  2G9W A;  3JAM Z;  1YYV A;  1RUO A;  3WTV C;  1Q1H A;  3WTS C;  3J81 Z;  1HW5 A;  4EJO A;  5L3E A;  5AON A;  3Q9S A;  2NYX A;  4HV6 A;  2C6Y A;  3FXQ A;  4UXN A;  4CXF A;  2P6T A;  1BI0 A;  1F9N A;  2XRN A;  3HRM A;  3O3K A;  4ON0 A;  2XRO A;  2OQR A;  3GFL A;  3DP7 A;  1LDJ A;  4HBL A;  4G9Y A;  4EJU A;  3F6V A;  5EEH A;  4A0X A;  3ZMD A;  1B59 A;  3E3V A;  2HQR A;  4CGZ A;  4G6D A;  2KIM A;  4ZYD A;  3JTH A;  2G7H A;  1W7P B; 
#chains in the Genus database with same CATH topology
 5FB2 A;  1UHS A;  3K4N A;  2XGX A;  2W85 A;  1D0Z A;  4ABZ A;  1JHH A;  2H1K A;  4X0G A;  2VAS A;  1L0O C;  3RZO J;  3OYK A;  2B7E A;  2R0Q C;  4TV7 A;  3KYD B;  1DP3 A;  3I59 B;  5FLX K;  2UV1 A;  2VKE A;  1WJC A;  2E1M C;  3SZP A;  1ZG5 A;  1W5C C;  3T8R A;  5CVJ A;  1HDP A;  2L9S A;  1N78 A;  3JR9 A;  1RIO H;  2VN2 A;  5LLQ A;  2HNH A;  3JRA A;  2DMN A;  3FIS A;  2NVT J;  1FOX A;  1FY7 A;  3HEF A;  2XSJ C;  2RNJ A;  3LOC A;  2IBD A;  4PGG A;  1JKQ C;  5HDG A;  1BIA A;  1A6Q A;  4D5F A;  3F21 A;  3PSI A;  2KRC A;  5FFZ A;  2IT0 A;  5KNL A;  2MH9 A;  3I54 A;  3M7G A;  3WTW C;  1JGG A;  4IQ4 A;  2BOL A;  4A3M J;  1JGS A;  5E79 C;  5DEQ A;  1YQA A;  2H8W A;  5H6Q A;  2ZSH B;  3G3Z A;  5FD5 A;  5J4Y A;  3V8K A;  2LKP A;  4XRM A;  3G71 I;  3DKY A;  3SJM A;  3JTH A;  3VSK A;  3KP2 A;  1GHC A;  2HI3 A;  2P4W A;  1PYV A;  1XMX A;  1XB4 A;  3LQR A;  2FML A;  4CUG A;  1IN5 A;  3K1N A;  2EIM H;  5E8I A;  3WE3 A;  2IGM A;  3DKX A;  2WAQ A;  1VQL I;  3ABU A;  4S04 A;  3BC8 A;  2RQP A;  2DDA A;  3MCZ A;  4FE4 A;  3DU6 A;  2WC2 A;  3QU6 A;  4BUP A;  2ACJ A;  3PNT A;  1GDT A;  5FJ8 J;  1XGN A;  3ELK A;  5HDK A;  2XIG A;  5CKT A;  1LQ1 A;  5EZG A;  4LOC A;  1OCP A;  5EZH A;  3KZZ A;  3ECO A;  2DQR A;  4ZYE A;  2VIX A;  2Y75 A;  4FX4 A;  3HOX J;  4M9S A;  5L3B A;  1BW6 A;  2PJR A;  1B8I A;  1R5I D;  1KQ9 A;  1LVA A;  2E1M B;  4EJV A;  4A93 J;  2VT2 A;  3S17 J;  1FSE A;  3BR5 A;  2CWE A;  1T6S A;  4QSH A;  4DGW B;  3HRU A;  1QBJ A;  2HTJ A;  5AIQ A;  4AVZ A;  5ICE A;  3S16 J;  4IRI A;  2K4B A;  5K7H A;  4IO9 F;  3T5X A;  4BS9 A;  2ID3 A;  4LGW A;  5CYV A;  4V19 K;  1HOM A;  4GXO A;  4I6Z A;  5LEJ A;  2DPU A;  1G6N A;  3PNY A;  3IAM 2;  2PX9 A;  5K1Y A;  1YX3 A;  1VQ8 I;  2B63 J;  5DUI A;  2MLG A;  2RAE A;  5CPR B;  4BJ5 C;  5JLX A;  2ZSI B;  5EF6 A;  1N77 A;  5B1A H;  2KRH A;  1BJA A;  4JK1 X;  1OQY A;  3QOE A;  3RKY A;  1SMY F;  4A3C J;  3OS0 A;  2A3S A;  2R7V A;  3OYN A;  3IKV A;  4RDU A;  3GWZ A;  3QWL A;  5M5W J;  2HQN A;  3GTG J;  4BHB A;  3J80 Z;  1RET A;  1LKX A;  2QLZ A;  4YEL A;  5A2Q K;  1KYZ A;  1S5L C;  3J7A O;  1U5T B;  1OCO H;  3AG4 H;  1GVJ A;  3SFZ A;  1LFU P;  1TQP A;  2ESN A;  2NOG A;  2QWW A;  2K9N A;  3FBI B;  3VOD A;  3HRT A;  1EV7 A;  3F8M A;  2ZJQ F;  3IH2 A;  1MJA A;  2HVQ A;  2QCO A;  4HDU A;  1FPQ A;  4NHJ A;  1I3Q J;  5ERI A;  2NOJ B;  4BXU A;  5DCF A;  2NNY A;  3GTM J;  4FAS D;  2XC7 A;  3CUO A;  3WG7 H;  1I6H J;  1G2H A;  2ADU A;  2VE8 A;  1J75 A;  2RRE A;  5FKM A;  4QWQ A;  3M07 A;  5J3L A;  2M87 A;  3FXJ A;  2FEZ A;  2JN6 A;  4CCN A;  3E7L A;  1CF7 B;  3MVP A;  4RAZ A;  1I3A A;  2CO5 A;  2QQA A;  2OZU A;  2QZ8 A;  3ZOB A;  1DU0 A;  1P7J A;  5F08 A;  5D4S A;  5E3L A;  4U87 A;  4NNJ A;  4RGS A;  1ETV A;  1R1T A;  4P1W A;  2CV0 A;  5H20 A;  2Y9Z A;  1TT0 A;  3LSM A;  4YFX F;  2ICW G;  2DXI A;  2LVS A;  1WWX A;  2WAQ N;  2ZXI A;  3S2W A;  4LLN A;  2L5Q A;  2ECB A;  2K9S A;  3K4B A;  4LK1 F;  4UB8 C;  4A3L J;  3GLL A;  4I0A A;  1Z7L A;  2CQX A;  5FKL A;  2JK3 A;  2MH2 A;  3MQ0 A;  4J01 A;  3HUG A;  3H9J A;  2CQK A;  1VF9 A;  3IH3 A;  2A07 F;  1NTC A;  1ONV A;  3TOB A;  2EFW A;  5K7Z A;  4L0Z B;  3RZD J;  2RV8 A;  5FRO A;  2O5R A;  1Y8Q B;  3NEU A;  2AS5 F;  1D1C A;  4CCO A;  5IY5 H;  2EZL A;  2IS4 A;  3S1R J;  5GAH J;  5H6R A;  4V2F A;  6PAX A;  1FBU A;  4M72 A;  2VJJ A;  5TRD A;  1HW2 A;  4Y13 A;  4BXF A;  2OTL I;  4I0B A;  3Q0W A;  2XPV A;  1ON1 A;  4XLE A;  5JHF A;  1CGP A;  1B72 A;  1J59 A;  2R7O A;  1FMV A;  3GZ5 A;  3PIO F;  3S3M A;  1MNE A;  2K85 A;  2XAG A;  4HNU A;  4RGX A;  4XID A;  2NVX J;  3LST A;  2A5Y B;  4HV5 A;  1XTA A;  2BW3 B;  1SAU A;  5D5W B;  4MNU A;  3EUH C;  5FLV A;  3HRS A;  3NWT A;  4XON A;  2L7K A;  1XX5 A;  3L7W A;  4KA4 A;  4PJJ A;  2XSD C;  4HRI A;  3GTP J;  1REP C;  1T56 A;  2Z2S B;  4DOZ A;  3LQQ A;  1POG A;  2EBI A;  1FZP B;  3ZQL A;  1TWG J;  1HF0 A;  1TW3 A;  3Q9V A;  1BW5 A;  2OU2 A;  4I2O A;  4AIJ A;  3S8P A;  1XD7 A;  1BOA A;  3I4P A;  4CIC A;  2QM3 A;  1DDN A;  1LJ9 A;  2ME6 A;  3WG9 A;  4A0Y A;  3V42 A;  4II2 A;  2NVQ J;  1QO0 D;  3GTJ J;  5LBQ A;  3CO6 C;  5IOZ A;  3VDX A;  4CCJ A;  4YG2 F;  2CW8 A;  4ZDL A;  2IA1 A;  2JJ7 A;  5TIS C;  5A2Q Z;  1R58 A;  3W6V A;  2R4G A;  1FP1 D;  4XM3 A;  1F1Z A;  4AIH A;  4WCG A;  4MQV A;  2WAE A;  3OYH A;  2DA6 A;  3ZN1 A;  1BBY A;  1XDU A;  1R36 A;  5HS8 A;  2X85 A;  4E7L A;  1QZY A;  1ERD A;  3S2D J;  1QU3 A;  2CSO A;  1L3L A;  5F0H A;  2O61 A;  3A0H C;  1TWC J;  1JKR C;  1QHH D;  3MKZ A;  1X1B A;  1O3S A;  3ZMZ A;  4RB3 C;  2DMU A;  3LWF A;  3I0T A;  5D8L B;  5HNF A;  4XRF A;  2GLO A;  5JVT A;  3FMR A;  4PJM A;  4OIO F;  1TQI A;  3QOP A;  3UNG C;  4OAZ A;  3H3V K;  4MGR A;  1OKR A;  2M4K A;  1YIJ I;  1YO5 C;  1YRN B;  2RGV A;  3TW6 A;  2Z5U A;  4C3J J;  1ETQ A;  5IOY A;  1YRN A;  5B3S H;  4HF2 A;  5GPC A;  3A2K A;  4FQG A;  3BZC A;  1MMN A;  3P7N A;  3FKJ A;  1G3W A;  1W0U A;  2GXA A;  1JHF A;  1MBF A;  5E20 A;  4A3E J;  3L2W A;  3VWB A;  3HGG A;  4HX7 A;  1LE8 B;  3SHF A;  1J09 A;  1DQU A;  2FXA A;  2W48 A;  5D5V B;  1E3O C;  2V9K A;  4MQ9 F;  2EK5 A;  3NQO A;  3BPV A;  1Y1V J;  3BQZ A;  2OC6 A;  1JTY A;  2OCC H;  3E6D A;  4KIF A;  2P8T A;  5TJJ A;  5C44 J;  3J7Y J;  2O9L A;  1K61 A;  4UV9 A;  3ULQ B;  2F5V A;  3AFH A;  2R7Z J;  1W7P D;  4OIR F;  3HGY A;  2WBM A;  1X2M A;  2LD5 A;  5FKO A;  4PK4 A;  4FX0 A;  1HW1 A;  3P9K A;  1BI2 A;  2O0Y A;  1MBG A;  3LSK A;  4A3B J;  5K5O A;  4BBR J;  1A31 A;  3PFY A;  2DPD A;  5BOX A;  3FXR A;  3V7R A;  3RQ4 A;  3V4G A;  1S9H A;  4NQW B;  1FYL A;  1I6X A;  1IDY A;  2V6C A;  3OYF A;  3OYG A;  3ZXS A;  2IS2 A;  1XGS A;  2M7A A;  3VYS B;  4J00 A;  1QNT A;  5DUK A;  5JR3 A;  3GTQ J;  3HOS A;  3LA2 A;  4I98 B;  4G7O F;  1MMA A;  3JAM K;  1B6A A;  3H36 A;  3ZMU A;  1T98 A;  3OOU A;  1XSX A;  3JRF A;  1FNN A;  2FOK A;  1R9T J;  4U0V A;  3KCC A;  3O8G A;  2MAB A;  2X9D A;  3CC4 I;  2XGE A;  5LHI A;  4OIQ F;  3C1D A;  1I1G A;  2CQ7 A;  2Z3Y A;  3ZR8 X;  3L9F A;  1TLH B;  2Y69 H;  2V26 A;  5B66 C;  1VQ4 I;  1KYW A;  4IHS A;  2JA5 J;  4H0E A;  2EA4 A;  4LG0 A;  2HTS A;  3M8E A;  2JA2 A;  3G1M A;  1MH3 A;  2DO7 A;  4UHT A;  4W97 A;  2BY3 A;  2FA5 A;  3GXO A;  4PFO A;  4KUM A;  5FGM A;  1GT0 C;  3PQK A;  3ZGK A;  1P6R A;  3QRF F;  4MEX F;  4C9Y A;  4XKB A;  3BTJ A;  1O3T A;  5E8G A;  3F8N A;  4N9H A;  3IP4 B;  4OU0 A;  2IGN A;  3OIP A;  1D5V A;  3EET A;  3RPU A;  3I4M J;  3VYU B;  2P6S A;  2BZT A;  4IL6 C;  3R61 A;  4Q48 A;  2V6E A;  3BY6 A;  3S2H J;  2FF4 A;  4GYG A;  3V8J A;  3C2H A;  3DQV C;  1RNL A;  3H9G A;  1GV2 A;  3LL7 A;  3ZMV A;  4QLC U;  1FX7 A;  5CLS A;  2I5U A;  3K1P A;  2F6C A;  4EGZ A;  3ABK H;  1S7O A;  3OL4 A;  1BR2 A;  4IRG A;  1DPR A;  2DFF A;  2H1L A;  3CCJ I;  3W2A A;  1IO2 A;  2G0E A;  3D5S C;  4A5M A;  1WJD A;  3DU5 A;  1FWZ A;  5GPA A;  2LK2 A;  3EYY A;  3KYL A;  2CW7 A;  2LOO A;  5C4J J;  2AQE A;  1TNS A;  2HZD A;  3RPQ A;  3IH4 A;  1IXR C;  1Z3X A;  5E18 F;  3OSF A;  4L9N A;  2CW0 F;  3OR1 C;  3FBN B;  1SEU A;  3U1D A;  4BXX J;  3HXL A;  1T2K A;  4PSW A;  2PJR B;  1ZH5 A;  3K6G A;  2JPC A;  3JRC A;  2EFO A;  1VQ6 I;  1MBH A;  2R7W A;  1IV6 A;  4RS8 A;  2QKL B;  2STT A;  5E1Z B;  2H27 A;  1SC7 A;  2E60 A;  3S14 J;  1VTN C;  4NC8 A;  9ANT A;  1HXD A;  5EEA A;  4MHG A;  4KIB A;  3H5R A;  1JT0 A;  4O3M A;  2XVC A;  3GTO J;  2WA0 A;  2FX0 A;  2NS7 A;  4XKV A;  3ABM H;  5ILS A;  1ZRF A;  2DA3 A;  2PJP A;  2K5C A;  3KEQ A;  2VC1 A;  4EJW A;  2K4J A;  4HEA 2;  3BJA A;  1EH8 A;  2O7O A;  4IHT A;  1QPM A;  4EVI A;  4M74 A;  1MDM B;  2NS8 A;  3FZV A;  2EIL H;  3GF2 A;  4G7H F;  3CCR I;  2CQQ A;  1MNM C;  2FNP A;  4KN7 X;  1SFU A;  3QYF A;  3IAS 2;  4NC7 A;  2EZI A;  2VUM J;  1KU3 A;  1YJW I;  3A0B C;  1YW8 A;  2JVH A;  5FFX A;  2IXS A;  3LAJ A;  2QGU A;  3VYR B;  4X6A J;  1WFX A;  3GBG A;  5C3E J;  2JMW A;  2V1D A;  3F0C A;  5E3O A;  3WOD F;  1BR1 A;  1Q1V A;  2UXX A;  5DD8 A;  3FKI J;  2QUF A;  5LEK A;  3CCU I;  1XSD A;  3PO3 J;  2KIU A;  3JRB A;  1KU7 A;  3HOT A;  4HA8 A;  4OAY A;  2HXO A;  4F93 B;  3IRQ A;  3J80 K;  3SEZ A;  3GTL J;  2GXG A;  4CA0 A;  1YIO A;  4EGY A;  4NQW A;  1X2N A;  1WHU A;  3WTT C;  4F91 B;  2A68 F;  5CVR A;  5D4R A;  3CD6 I;  3TDU C;  2EFQ A;  2M8G X;  2HOE A;  1HA8 A;  4M6V A;  1IN4 A;  1T33 A;  4AUX A;  2VKD A;  4HX4 A;  4AVP A;  1ZK8 A;  2E19 A;  3OS2 A;  1QGP A;  4XOT A;  3KZY A;  1J0R A;  3S3N A;  4HAM A;  1X4P A;  1IRZ A;  1W0T A;  4JX5 A;  2P81 A;  4BGD A;  3WTZ A;  4XSZ F;  4WXD A;  2KFD A;  5HDN A;  2LYC A;  3KP5 A;  1NH3 A;  1SD5 A;  1SVM A;  4A5N A;  2HWV A;  1TZL A;  3I71 A;  4CHU A;  3I4N J;  2EZK A;  4OMZ A;  3CUQ A;  3HUG B;  1U3E M;  1VZ0 A;  2DOA A;  1R71 A;  4F92 B;  2HVS A;  3HHG A;  4O5V A;  2ISY A;  2BXZ A;  3PSF A;  4D5C A;  1TWF J;  1U78 A;  2EV6 A;  1MIJ A;  1ZHF A;  1OJL A;  2TRT A;  3SQN A;  1YW7 A;  2FOW A;  4XL9 A;  2V1U A;  3HG9 A;  5AIP A;  5IP7 J;  2PLY A;  3IWF A;  2STW A;  2EFN A;  3RIR A;  1I5Z A;  3F3X A;  1X3Z B;  2EIK H;  1OR7 C;  4S0H B;  2R92 J;  2ZJR F;  1VI0 A;  1WKM A;  4AD9 A;  3GLX A;  4E4H A;  4H4K C;  2W24 A;  3UKG A;  1OPC A;  2GZW A;  4P9U A;  1OMI A;  3MKW B;  3CJN A;  4AM3 A;  4A3K J;  3KET A;  3U21 A;  4BAC A;  1XMK A;  5BPI A;  3ERE D;  2L4M A;  1U2W A;  1YLF A;  5LGT A;  2KP6 A;  2L54 A;  2KHM A;  2X1E A;  2LKX A;  1ORK A;  4G8X A;  4XLP F;  4GO1 A;  3E6M A;  4B47 A;  4XOR A;  3K2A A;  3C2G A;  3BR6 A;  4KT6 A;  1K78 B;  3FXU A;  2LF7 A;  3Q3S A;  4M6Y A;  3KP7 A;  3H0D A;  3KLN A;  3DXJ F;  3HZJ A;  2H8R A;  3KIO A;  2VOP A;  2XB5 A;  2GXB A;  1UST A;  4IXA A;  1Z6R A;  2W1O A;  2XB0 X;  3VEP A;  2J5O A;  2M1B A;  1DU6 A;  1YS6 A;  3T0Y A;  3NAU A;  4DW6 A;  3QYE A;  4IHV A;  4BU2 A;  3R60 A;  3HIF A;  1W5T A;  3BR0 A;  4L5E A;  4Y3O A;  1UJ8 A;  1J9I A;  5EG0 A;  1IF1 A;  1I39 A;  4IHY A;  2R5Z A;  4RM2 A;  3KZI C;  2FNA A;  2AHQ A;  2GWR A;  3RSN A;  4HQM A;  3DBH B;  2LRD A;  2L02 A;  5IP6 A;  1RKT A;  4OIP F;  4ZYG A;  3CP2 A;  5HOO A;  2GIZ A;  3HOU J;  1JUP A;  2HYG D;  3CCQ I;  1SFE A;  3RTR A;  2KZV A;  4OWR B;  1WJA A;  2DAO A;  3OL3 A;  2KIF A;  5FLM J;  2QSG X;  3I64 A;  1MBJ A;  3CMA I;  2EB7 A;  5J4V A;  4RAY A;  3CF2 A;  3K0L A;  3R0A A;  5E1X A;  3SDB A;  1QHG A;  3IWZ A;  3SXY A;  4MO7 A;  2QSH X;  4R8H A;  2EA2 A;  3N4M A;  3DEU A;  1IRX A;  2DI3 A;  3E0J B;  4O6J A;  2XGC A;  2A6H F;  5EEG A;  2BV6 A;  1OFC X;  2JPB A;  1FOK A;  5EDN A;  2R93 J;  2DLL A;  1LNW A;  1N25 A;  3A02 A;  3BT9 A;  1TNT A;  3HC7 A;  3FM3 A;  3K4M A;  5CQE A;  4CYC B;  4ZDO A;  1ZGJ A;  3OYL A;  2KDZ A;  2L7Z A;  1G3S A;  2V1X A;  3DEW A;  5M3M J;  1PUE E;  1RR7 A;  2HDC A;  5HLG A;  1S72 I;  3BZ6 A;  2OAZ A;  3W6K B;  2ELJ A;  1HST A;  1T0F C;  2VBX A;  2BBY A;  4HPQ A;  5IT3 A;  4XIC A;  4BY1 J;  2VJ4 A;  2R7D A;  4MTD A;  1U6G A;  4BJ6 C;  4IVN A;  2OCE A;  3DV8 A;  1IN6 A;  1YS7 A;  3H5A A;  4WF2 A;  2Q2E B;  3IL2 A;  1Y0N A;  4UVB A;  2Z33 A;  2QBY A;  1IAW A;  2HKX A;  2JQ7 A;  3CUQ C;  4RGU A;  4I99 C;  4RAG A;  3WHB A;  2OD5 A;  2GQQ A;  4B09 A;  3OS1 A;  4LLG F;  3LNQ A;  4U7D A;  4RLQ A;  1D5Y A;  3E5Q A;  2FU4 A;  3TDZ C;  2R5Y A;  3OMY A;  4RLF A;  2ZME C;  2QA4 I;  4F55 A;  3GW2 A;  1O7L A;  3AG3 H;  4AIK A;  2A69 F;  2XF6 A;  4ASN A;  1HLV A;  4HNT A;  3FHZ A;  5F0F A;  3FXK A;  2KMU A;  2F4M B;  1R00 A;  5HVQ C;  1G59 A;  3O2P E;  3HPH A;  4RGR A;  1YX5 A;  1X1C A;  3FXO A;  2LKS A;  2W57 A;  1ZRD A;  2RC4 A;  5M5Y J;  5J40 A;  2HYJ A;  1JXS A;  4MLO A;  2ID6 A;  4LLL A;  1EJ9 A;  5C4X J;  4BNC A;  2EH3 A;  2GOM A;  4B44 A;  4QIW N;  2DT5 A;  4PFP A;  3CQZ J;  5DDG A;  4ZTF A;  2BY0 A;  2XPW A;  1UMQ A;  3JRG A;  1LFP A;  3WHC A;  1WRJ A;  3MAJ A;  2LLK A;  2ZCW A;  3F9K A;  1WH5 A;  4XMY A;  2HU9 A;  2CJJ A;  1QPI A;  3OR2 C;  4KYW A;  1V5E A;  2CQN A;  5J8F A;  2P0W A;  3I9V 2;  1R1U A;  3DWL E;  3E6C C;  3MD2 A;  1BI3 A;  2X0L A;  2WWY A;  3ECH A;  3HJE A;  1R4M B;  5KK1 A;  5IT9 Z;  4L18 B;  1B9N A;  2PMU A;  1NK3 P;  3CJR B;  4NDL A;  3M4O J;  1UEL B;  4K2E A;  2JA7 J;  2V1N A;  3H1C A;  1H9G A;  2MYS A;  2YPR A;  3H3U A;  3ASO H;  4ZZD A;  2H09 A;  5DM6 F;  1IW7 F;  1WCM J;  1UFM A;  1O3Q A;  2XAF A;  2HZT A;  4A3I J;  2HDD A;  2GM4 A;  2VQC A;  1TL8 A;  4ESJ A;  3QAH A;  2BE5 F;  2ZFW A;  5JHU A;  3BPX A;  2DMP A;  3KP4 A;  2HOA A;  3F22 A;  2DCE A;  3S93 A;  1YG2 A;  2MGQ A;  3S1N J;  4PGH A;  1G8X A;  1QQI A;  2BHY A;  2DDB A;  3R4K A;  2FMY A;  1F5T A;  1O7F A;  2E1O A;  1UHW A;  3FIW A;  3SFI A;  3WU2 C;  4HZF A;  4B4C A;  3B6A A;  1XGO A;  5L3G A;  4I76 A;  4AID A;  2HQA A;  3MFK A;  2K7L A;  2HPI A;  5HS7 A;  4BQA A;  4XRS A;  1IXS B;  1IZ1 A;  4LIU A;  2PI0 A;  3V7C A;  1MBE A;  1GLN A;  1X19 A;  3KEY A;  3P9I A;  4IRH A;  2E2I J;  1ZLJ A;  4A6D A;  4ENK A;  3IKT A;  2HDW A;  2CG4 A;  2MBF A;  2VJ5 A;  1JI8 A;  3KP3 A;  2ESH A;  4Y15 A;  2W7N A;  2JVG A;  3G1O A;  1TP4 A;  3NAR A;  1K6O A;  4EJT A;  1EH7 A;  3VYT B;  3JSO A;  4FHT A;  3ZQ7 A;  1IGN A;  4U0W A;  3V7S A;  5JVG F;  4FTH A;  3BG9 A;  1SFX A;  4WK8 F;  2OQG A;  3V8L A;  3TMO A;  3BJO A;  4WXC A;  3LA7 A;  4UB6 C;  1HCR A;  5J8C A;  3E5U A;  4DIQ A;  2KPM A;  2IPQ X;  1IC8 A;  4BE2 A;  4BYY A;  2E5Z A;  2GA2 A;  4E7J A;  4X1E A;  2B0L A;  4CSW A;  2CUE A;  1XN7 A;  1FEX A;  2F5F A;  2ZFU A;  1NHA A;  2JUG A;  2E1N A;  5L3D A;  3JW4 A;  2V4J C;  1W7P A;  3HKZ N;  3L2C A;  2CUZ A;  4PCQ A;  2ZJ2 A;  4I02 A;  3PFI A;  2XKP A;  5IPA A;  3G1L A;  1T08 B;  1TWH J;  3ZN0 A;  2HVR A;  2LNB A;  1A6I A;  1P9Q C;  5DCM B;  3ZPL A;  3TQN A;  1T38 A;  4ESB A;  3AL0 C;  3WGH A;  1MMD A;  4N4O B;  4DZJ A;  1XC5 A;  1BI1 A;  1XMA A;  4IF4 A;  1K83 J;  4RAF A;  4XLF A;  3WTU C;  2RVC A;  3L2U A;  1D0X A;  2YX7 A;  1MSE C;  1D3Y A;  2ZXW H;  1X3U A;  2YS9 A;  2RKH A;  2DA1 A;  1SD6 A;  3IC7 A;  4YEJ A;  3PL8 A;  1FYM A;  1XPX A;  3BG5 A;  1TC3 C;  1S8N A;  1R49 A;  5DYM A;  2E1C A;  1DPU A;  3P5J A;  4KN4 X;  4BHP A;  2O03 A;  4C3H J;  1MKM A;  3JRE A;  1D8J A;  4HDV A;  2JSC A;  1Z6T A;  3Q0V A;  2FUG 2;  2WAF A;  4QPQ A;  5LFA A;  5IT9 K;  2M9H A;  3CES A;  1B4A A;  1LB2 A;  3J81 K;  3H5N A;  2BHZ A;  5EGO B;  2MD5 A;  3KX2 A;  4XN3 A;  4RBO A;  1ITY A;  2G7U A;  2K9L A;  2Y0S A;  2MW8 A;  1TQM A;  1QVT A;  1Z3Y A;  3OYM A;  2X1D A;  4KDP A;  3F8C A;  3RYR A;  2XKO A;  2FJ1 A;  2IA0 A;  2AXL A;  2PMZ N;  4AYB A;  2VPR A;  1WZ2 A;  2RQQ A;  5HS9 A;  1RUN A;  2W25 A;  4D7N A;  4ENJ A;  3OY9 A;  3BR2 A;  3G73 A;  4NUB A;  2P7C B;  5EGO A;  2X1C A;  2YSR A;  4NBQ A;  4JOM A;  4YIF A;  5H2F C;  3COA C;  2L3D A;  1H89 C;  1U8B A;  3C3W A;  4ZTJ A;  3BRO A;  2CRG A;  2KJB A;  2DQL A;  2IA2 A;  1R5G A;  4EV0 A;  2W82 A;  3RKQ A;  3HL2 A;  1AHD P;  1LPQ A;  1G3Y A;  1ULY A;  3I56 I;  2DT6 A;  2MSY A;  3K69 A;  4G12 A;  2Y2Z A;  1P7I A;  3S3O A;  2R7Q A;  2QEN A;  2ZNY A;  3ISP A;  4LG3 A;  4P96 A;  1XG1 A;  2JUC A;  3DLA A;  3QP5 A;  3G2B A;  3G6E I;  4OOI A;  3LAP A;  4DYC A;  1TWA J;  2DK8 A;  4E70 A;  1ETY A;  1IV8 A;  3GZ6 A;  3R6S A;  5HOD A;  3GZN B;  5D5X B;  2PQ8 A;  2F5C A;  2ZXJ A;  3ZQG A;  3GFM A;  2O3F A;  4PJL A;  3ZMS A;  3HSE A;  2ZKZ A;  4Y33 A;  1ON2 A;  1BM9 A;  3OV8 A;  4HST A;  3I53 A;  2E2J J;  3HYI A;  2QVO A;  5FD6 A;  3HKZ A;  2J5P A;  3GUD A;  2WB1 A;  2WY7 Q;  2XUB A;  2KZG A;  2EJR A;  3U9G A;  3B73 A;  2VL8 A;  2DBB A;  3H35 A;  3ROU A;  1MJ9 A;  3DTI A;  3VB2 A;  1K7A A;  3M3Y J;  2NRA C;  3BG6 A;  2IS1 A;  1OR7 A;  3ESW B;  2ZC2 A;  3CUQ B;  3DPL C;  3QP6 A;  1Y6I A;  4U88 A;  3TP3 A;  3MZH A;  1QZZ A;  4IQJ A;  1FTT A;  4C2M J;  3BG7 A;  4GDF A;  3I5U A;  2VBZ A;  1ZAO A;  3OSG A;  2OA4 A;  2F48 A;  1BR4 A;  1Z9C A;  3L2R A;  2HOT A;  1JKO C;  2A5W A;  3RKX A;  2CFO A;  4I01 A;  5K5R A;  1XCV A;  3JSP A;  4FET A;  3RPU D;  4BQN A;  1ETW A;  4C2T A;  3CLO A;  4F3Q A;  5ED4 A;  2EIN H;  2WV1 A;  3K4C A;  1MGT A;  3S15 J;  3D0S A;  1RPW A;  5BQT A;  1G4D A;  2KLO A;  2PEX A;  2WV0 A;  4CH7 A;  4BE0 A;  4L5J A;  2E71 A;  1APL C;  2FBI A;  1LDD A;  1H9T A;  4AWX B;  1ZG3 A;  3FMQ A;  2JRT A;  2D1V A;  2GIV A;  2HOS A;  2LR8 A;  4B3A A;  2JZY A;  4BKX A;  3HSR A;  4JBA A;  3RYP A;  1F43 A;  3K4J A;  4UUT A;  2CU7 A;  1X1D A;  2X6Y A;  5DTD A;  3U2R A;  5EJC A;  3T8T A;  1FP2 A;  2V79 A;  3F8F A;  3K7A J;  1I1S A;  1T95 A;  5J1Y A;  2ISZ A;  4EM1 A;  2OF7 A;  1CF7 A;  4PUS A;  1JKP C;  2ETH A;  3BQY A;  1OYY A;  4J19 A;  1UAA A;  1YJ9 I;  3NWS A;  4ENM A;  5DCM A;  2L7M P;  5F0C A;  1MD0 A;  5FRN A;  3JTG A;  3OYB A;  1FOW A;  2EV5 A;  5F27 A;  2YU9 J;  2VE9 A;  1Z05 A;  3E97 A;  1QA6 A;  1CQT A;  1FOY A;  3BCA A;  4C30 A;  1W1W E;  2Z16 A;  3WTX C;  4HG2 A;  2LF8 A;  3ONQ A;  4JX4 A;  2HS5 A;  4XRS G;  2L2O A;  1MH4 A;  2Y0M A;  2VON A;  4DYR A;  3FWE A;  2VBW A;  3BJ6 A;  2GAU A;  4RMN A;  4CCL A;  5GAG J;  3K70 D;  1KA8 A;  5GTH C;  2P5V A;  4M73 A;  2P5K A;  1YIT I;  2VXD A;  2P7V B;  1D0Y A;  1ZG1 A;  4KT5 C;  2QYO A;  4D9J A;  3LSG A;  1D1A A;  2R7F A;  4EM0 B;  2R7U A;  3BTC A;  1IRG A;  3LFU A;  2XF7 A;  2FSW A;  3QPL A;  4LIT A;  1MJB A;  4I09 A;  2BVM A;  3M8J A;  5B5E C;  2M2E A;  4MFE A;  3VSL A;  2L9N A;  2QQB A;  2UUZ A;  3L00 A;  5ICG A;  2R7R A;  5M5X J;  2HFH A;  2YX4 A;  3DBR B;  3M8F A;  1O4X A;  1RES A;  2COM A;  2CGP A;  2EIJ H;  2R7X A;  3CC7 I;  4GRI A;  2CH0 A;  1TTY A;  1F4K A;  3HM5 A;  2OV7 A;  3Q0U A;  1LEB A;  1T0F A;  3ML6 A;  3ZCO A;  4UUV A;  1UCR A;  2ME0 A;  4A3F J;  4FIS A;  4KIC A;  1V5F A;  2GA1 A;  2XF5 A;  2X4H A;  5ICF A;  5E3M A;  3L2V A;  4AU7 A;  4ZYH A;  4A12 A;  3L2Q A;  3N97 A;  3RDI A;  4BHC A;  3CCV I;  3D1N I;  4B1R A;  1MDM A;  5K5Q A;  1LE8 A;  2LG4 A;  1AKH B;  1SD7 A;  2FQ4 A;  2COB A;  3S32 A;  5HLH A;  5FLX Z;  1VQ9 I;  2BGC A;  3GO5 A;  2LRE A;  2NVY J;  3SYT A;  3A01 B;  4IPA A;  3OYI A;  4HX8 A;  3FK6 A;  1WPK A;  1W5S A;  3HB9 A;  1FBS A;  2QBY B;  2FRH A;  2R5Z B;  3L09 A;  4F7Z A;  1WSU A;  4Z2Y A;  2YR2 A;  1KU2 A;  2DW4 A;  1KQ0 A;  4XNF A;  2QKM B;  4CDG A;  3DF8 A;  1WJF A;  1A04 A;  1HKT A;  3EPZ A;  1GV5 A;  5EYR A;  4PJN A;  4L5I A;  4XLA A;  3FX3 A;  2V9V A;  4M3B A;  3ZQQ A;  2OZ6 A;  4MTE A;  1IRF A;  3ZRG A;  5KAF C;  2XV4 S;  2FBH A;  2NS0 A;  4JQF A;  4WXH A;  3WGI A;  1ZR4 A;  4D0P A;  1W7P B;  4DNC A;  2D1H A;  2M7B A;  1STZ A;  3BR3 A;  5LHG A;  2D45 A;  2H6B A;  4A3G J;  4UV8 A;  3DEE A;  1MSF C;  4G7Z F;  2XPU A;  3SZT A;  4DZP A;  2DTR A;  3LFK A;  4E7K A;  1B8I B;  3A03 A;  2P5L C;  5GP9 A;  2LY2 A;  1VQM I;  5LGN A;  1ZRE A;  2F4O B;  1WQ2 A;  5FKN A;  2KDO A;  4XKW A;  2Y31 A;  3QPT A;  1X3W B;  5J1U A;  1V5G A;  1RRJ A;  1MMS A;  1V4R A;  3R0J A;  3GFJ A;  1AA7 A;  1AWC A;  3PJR A;  5F1J A;  3HSF A;  1PP7 U;  2IEK A;  2EQR A;  1FIP A;  4NB5 A;  2XRL A;  4G6Q A;  2DA2 A;  4HW0 A;  1R1V A;  2VXZ A;  1OCT C;  3I3L A;  4XK4 A;  2E7W A;  2OPT A;  1HC8 A;  4A3J J;  3CC2 I;  2MLK A;  4CYD A;  1WJB A;  1EF4 A;  2YUS A;  5J47 A;  1UG0 A;  1GXQ A;  4IOC F;  4YFK F;  1V55 H;  2F5D A;  1P4X A;  2KL4 A;  2VB6 A;  2DFI A;  3EUK L;  4CYC A;  2LC2 A;  4MEY F;  4CZC A;  2PN6 A;  1XDS A;  4OIN F;  2K02 A;  2JT1 A;  2ZO4 A;  3K1M A;  3H9Q A;  1Z21 A;  4C3I J;  2LMD A;  4D7M A;  2DA5 A;  3JRD A;  3RI4 A;  5LD2 C;  2N8G A;  2QF7 A;  4KIG A;  1SAN A;  5D6F A;  5ILV A;  3OYC A;  3UR3 C;  2K3F A;  3B6C A;  3K2Z A;  3PQJ A;  2X48 A;  5BPD A;  3MWM A;  1YW9 A;  3CDL A;  3AAF A;  3QQA A;  1P4A A;  4IKF A;  2Y48 A;  5CJ9 A;  1E3H A;  2PMZ A;  4AYB N;  5BNG A;  1W4M A;  4M9Z A;  4FCY A;  2E36 A;  2VKV A;  3DLL F;  4KFC A;  2OUM A;  4HLX A;  2VBY A;  1NK2 P;  4L0Y B;  2DU9 A;  1P92 A;  3FMS A;  4BQQ A;  4U0Y A;  3L1P A;  1JE8 A;  3GVA A;  4CZZ A;  1HKQ A;  1KON A;  4RB0 A;  1B9M A;  2XGD A;  4IJA A;  2Q8K A;  3QU3 A;  5LRR A;  2D2W A;  1ENH A;  3CDH A;  1PUF B;  3GFI A;  4D1Q A;  1ZGA A;  1KGS A;  5E1W A;  1A5J A;  3OIO A;  1ZAR A;  5HLT A;  4HQE A;  4II3 A;  2M5W A;  2ZXH A;  3A1Y A;  4IOA F;  1W36 C;  3S1Q J;  5IP9 J;  1Y8R B;  3C7J A;  2VT3 A;  1J5Y A;  1GVD A;  2OJE D;  4GYI A;  4DQ2 A;  3OYA A;  3BZK A;  2PFB A;  4N0B A;  1Y56 A;  3F23 A;  2OTJ I;  1PVE A;  1C0W A;  4S05 A;  2M3A A;  2IW5 A;  1X1A A;  1UHM A;  4YIR X;  2KJC A;  3W3C A;  1PP8 F;  1Y39 A;  2DFH A;  2BYV E;  3E6B A;  3U1K A;  3KEO A;  1A35 A;  1FJL A;  3GX4 X;  5D6E A;  1DP7 P;  1FSH A;  4ZJZ A;  2M34 A;  3MKY B;  3M1C A;  2AO9 A;  2FE3 A;  5E17 F;  3VPR A;  1K4S A;  4JYK A;  4XLH A;  3CO7 C;  1OCC H;  3AG1 H;  2QQ8 A;  2NVU B;  2QEX I;  1XSV A;  2BY2 A;  4RB1 A;  1R5H A;  3PNV A;  1WJE A;  4DJA A;  2F2E A;  2IP2 A;  2E34 A;  2EWN A;  4LJZ F;  4OMY A;  1Z91 A;  1USS A;  2BEO A;  2DA4 A;  4IX7 A;  2EFP A;  2ZME A;  1IUF A;  5F1R A;  4ENN A;  4I7H A;  4L9V A;  1ZEL A;  5J1R A;  4BEH B;  1X4O A;  2BXY A;  1ZLK A;  4KMF A;  3GTK J;  4BDY A;  3JRH A;  2E2H J;  3IV5 A;  2B9S A;  1KQ8 A;  2Z1D A;  2HQ5 A;  4E6K G;  2L9R A;  5ILU A;  3K4K A;  5LRS A;  1J7K A;  3MZ8 A;  1BOB A;  1SVO A;  4KMU X;  3LSP A;  1IUY A;  2PG4 A;  2V7F A;  2MA3 A;  2Z99 A;  5HNH A;  4XBF A;  5CVV A;  2VJI A;  3HHH A;  2MC3 A;  2VOD A;  3KLO A;  1K78 A;  5BMZ A;  4AC0 A;  2LSO A;  2H94 A;  3K70 C;  3CZ6 A;  1FC3 A;  4YFN F;  1S7A A;  2ELK A;  3PUF A;  2LTP A;  5DS9 A;  4XN0 A;  1YOV B;  2K9M A;  5D5U B;  3DKW A;  3LSI A;  4UVC A;  2JSP A;  5KAI C;  2VLA A;  2A05 A;  1O3R A;  3RJP A;  2DJI A;  3AKZ A;  2VI6 A;  1ETO A;  3TO6 A;  3BCB A;  2QSF X;  3ZMT A;  2L0K A;  3P9C A;  5CQG A;  4ZZL A;  1KZH A;  2IGO A;  1KU9 A;  3QOD A;  2LBF B;  4N4N B;  2K27 A;  2CMP A;  3A4C A;  3EUH A;  3M1E A;  4PZJ A;  1HQC A;  4A6E A;  3HTS B;  1QRY A;  3PUB A;  3DFG A;  4M9X A;  3DTK A;  3CP8 A;  5ICC A;  2CUF A;  3CJQ B;  4EEF G;  2VC0 A;  3Q5F A;  2VOO A;  3PIP F;  3HOV J;  2CYY A;  4P9F A;  4Q5S F;  3OYE A;  2E7X A;  1PDN C;  4UY8 I;  5KVR A;  2PMH A;  2K3P A;  2V9P A;  2KRF A;  2KQR A;  5CVU A;  1WJ5 A;  1U5T A;  1WI9 A;  1SAX A;  3ABL H;  4LK0 F;  2IJL A;  4WWC A;  1PJR A;  1K6Y A;  1MND A;  2M30 A;  2O8X A;  2M4G A;  3ABT A;  4R79 A;  1O57 A;  1SVL A;  3AG2 H;  1D1B A;  3VFZ A;  4XLN F;  5HLI A;  3QPS A;  1S29 A;  5F64 A;  1TT5 B;  3FXM A;  1ZTR A;  3FM5 A;  2IVM A;  2KT0 A;  4BBS J;  4ANJ A;  3VOE A;  1Z7U A;  5JFR A;  4LB6 B;  3GEZ A;  1BN5 A;  4W1U A;  1I27 A;  4BQO A;  1S6L A;  2LH9 A;  4Q4Z F;  1WGX A;  3LSH A;  4P55 A;  1TBX A;  3WU1 B;  2JA8 J;  1VQ5 I;  4UVA A;  4Y52 J;  1D8K A;  1N75 A;  2ZME B;  1X58 A;  1JJ8 C;  2A61 A;  5IYC J;  5E3N A;  3DTE A;  3EYI A;  3AL0 B;  1SFO J;  4M3G A;  1BC8 C;  1WH7 A;  4JP0 A;  1YJN I;  4ZH4 F;  3BG3 A;  1FYK A;  2WB1 N;  4HSR A;  3QYB A;  2M45 A;  5GAD J;  3IRR A;  1U8R A;  5J6X A;  5CVI A;  4M3D A;  2O6G E;  1IDZ A;  1UB9 A;  1I50 J;  1UZC A;  4M71 A;  4BY7 J;  2EZH A;  4BDZ A;  1T39 A;  4P5O A;  1IN7 A;  2JA6 J;  3M9A A;  3MEX A;  1AU7 A;  4NC6 A;  1ACI A;  2XDV A;  3I59 A;  1IJW C;  1RI7 A;  2KIS A;  3K10 A;  2ZJP F;  3WGG A;  3REO A;  3GCM A;  2DT7 B;  1ETX A;  4R1H A;  2L4A A;  1BL0 A;  3H3Z A;  1V3F A;  1R4N B;  1DUX C;  4UNO A;  1OYI A;  2XAU A;  4KJZ A;  4L9T A;  3IUO A;  3W6J B;  2BVL A;  3MKL A;  2NXN B;  3QPH A;  1IN8 A;  1XGM A;  1ZRC A;  1DGW Y;  1R7J A;  5KCM A;  4M3F A;  2UWM A;  1SFK A;  3W2W A;  3CCL I;  2R7S A;  1JUS A;  4EAT A;  1U5T C;  3BTL A;  3ZQH A;  2RN7 A;  4DBQ A;  2VPL A;  3CCM I;  2LFB A;  3BWG A;  2L01 A;  3HOY J;  4HYE A;  3D5L A;  1HSJ A;  3C18 A;  4GGG A;  4E7Z A;  4GFB A;  5FKK A;  1UG2 A;  3EQL F;  2ZBK A;  3FK7 A;  3OWT A;  1RZ4 A;  3FXL A;  4MFD A;  1GXP A;  3JCU C;  4JX6 A;  2ELH A;  3WU0 A;  4UUS A;  2HEO A;  2DOE A;  2TDX A;  5IYB J;  2VQG A;  2DMQ A;  2E35 A;  3CMY A;  1EH6 A;  3CDI A;  4FT8 A;  4A2U A;  1MBK A;  3WE2 A;  3J7Z I;  2K86 A;  2QQ9 A;  4Y7N J;  1YHQ I;  2UXN A;  5LHH A;  4A69 C;  4E7S A;  4ZC3 A;  5LGU A;  3TP0 A;  1ZR2 A;  2O8K A;  4MIM A;  2DTZ A;  3I55 I;  4XQF A;  1ZQ3 P;  4CCM A;  3TO9 A;  1JUM A;  1WI3 A;  3BP8 A;  3BDD A;  4M6X A;  3HPG A;  1VND A;  5FO5 A;  2XHK A;  3SEQ A;  2IAI A;  3RCO A;  3HTU A;  4C2U A;  2W4S A;  2VQH A;  4DYQ A;  2HYF A;  1EKE A;  1HDD C;  3FF5 A;  4ESF A;  1U0J A;  4LFU A;  4IZZ A;  3ZQC A;  2DYR H;  3KP6 A;  2I10 A;  4ZDP A;  2Q1Z B;  5GTI C;  1BJZ A;  1AKH A;  2AQF A;  3CCE I;  1VQK I;  4IHW A;  1HBX G;  2M8E A;  4BE1 A;  4A3D J;  3E5X A;  3RQI A;  3NRV A;  2NAZ A;  4HLY A;  2YU3 A;  3BLY A;  4PDK A;  1SD4 A;  4B8X A;  4Q47 A;  1A36 A;  2DK5 A;  3WTY C;  4KIT B;  1BC7 C;  4EQQ A;  3KFW X;  3T1B A;  4F52 A;  2ZB9 A;  3OYJ A;  3KYC B;  5JI6 A;  4YRV A;  1YFH A;  2IRF G;  1YI2 I;  4G6T B;  4ETS A;  4Y17 A;  1EA3 A;  2BW3 A;  4LMY A;  4IHX A;  1QZE A;  3DPT A;  5B1B H;  4L9J A;  4XR6 A;  3OIQ A;  4CO8 A;  3ASN H;  3F6O A;  1H88 C;  3MMY B;  1WVR A;  3LSJ A;  4PSX A;  4BAY A;  1SMT A;  3EDP A;  4LG0 B;  1VFC A;  3F8B A;  2HR3 A;  2DMT A;  2JTV A;  4RB2 C;  4EMS A;  1YTY A;  1FIA A;  1JT6 A;  2HKO A;  2HPM A;  2M0M A;  1FTZ A;  2LDU A;  4M3E A;  3ZQI A;  1IG7 A;  1MMG A;  1RC9 A;  4RA2 A;  1VQO I;  1XCB A;  2A6E F;  2W00 A;  4XLC A;  3PO2 J;  1LVK A;  2FQ3 A;  2JWT A;  1HKS A;  4UUS B;  5F04 A;  1H8A C;  1J2X A;  3A01 A;  2CV1 A;  5D8K B;  4V2G A;  3I58 A;  3TBI A;  2DOD A;  1IXC A;  3MZY A;  2D5V A;  3TOA A;  2CS3 A;  2CV2 A;  5F6F A;  3DBL B;  1E17 A;  2RDP A;  3TKY A;  1P4W A;  1DGR M;  4E7I A;  3O6B B;  2L7F P;  3H0G J;  5EG0 B;  2Q2E A;  1Y0U A;  3LSR A;  1S7E A;  1OCZ H;  4EM2 A;  3HOW J;  1F36 A;  3LA3 A;  4HOB A;  2I8D A;  3ZQF A;  2DJN A;  2LY9 A;  2XAH A;  3BTI A;  3CJT B;  3PM1 A;  1V54 H;  4U7B A;  3CMM A;  4N9I A;  3CLQ A;  2Q0O A;  2K9Q A;  2LY1 A;  2XAJ A;  5M3F J;  3RKW A;  4LD5 A;  2TCT A;  1LEA A;  4B43 A;  4KNY A;  2HGC A;  2FBK A;  3H92 A;  1ETK A;  2Z9O A;  2WTE A;  4WX9 A;  1OLT A;  5K7F A;  2MFZ A;  4LB5 A;  3OOP A;  2X6W A;  5DV5 A;  1U9N A;  4HF1 A;  3TL4 X;  1Z77 A;  1TW2 A;  2BY1 A;  2R7T A;  2LBF A;  2CFX A;  1E3P A;  2W84 A;  2EV0 A;  2EPF A;  1H0M A;  4BH9 A;  2GBY A;  2XAS A;  1K4T A;  1VQ7 I;  4HF0 A;  4KIS A;  1FBQ A;  4G94 A;  3CF5 F;  1LDK B;  2K40 A;  3JRI A;  3ERM A;  4Y4R A;  4XSX F;  5DD4 A;  1FT9 A;  2L9V A;  2ZNZ A;  4YII A;  3FDY A;  2UZK A;  3F72 A;  1BA5 A;  1QVU A;  1R23 A;  2XAQ A;  1RKW A;  1G3T A;  1FLI A;  2RNG A;  1NG6 A;  3C2B A;  3K9T A;  4ITV A;  1OCR H;  3KE2 A;  2PBI A;  2DOF A;  3TW7 A;  2DYS H;  3W2V A;  2VQL A;  1OYW A;  2R3S A;  4HNV A;  1LUJ B;  4BEH A;  3LMM A;  3X2Q H;  1B72 B;  1ZYR F;  3HDD A;  2NNN A;  1B1B A;  2R5Y B;  1ZGW A;  1X1P A;  1R22 A;  4FE7 A;  1MW7 A;  1BIB A;  2Y30 A;  1GUU A;  4RM3 A;  5L3C A;  5FRM A;  1Z0X A;  3CCS I;  1OIS A;  3B02 A;  1XS9 A;  1S3J A;  2X6O A;  2H6C A;  4GCV A;  4Z6Y A;  4CCK A;  1JJ6 C;  2OBP A;  5IYD J;  3CTA A;  5L3F A;  2KIQ A;  2LP0 A;  3KPH A;  2X51 A;  4A0Z A;  2DN0 A;  3O8H A;  1ODD A;  2F5E A;  5JLW A;  4QPO A;  4ZYA A;  3ZP5 A;  1Z1D A;  1ZN2 A;  3BOQ A;  3S1M J;  1P2F A;  3DCF A;  1E0E A;  2KKO A;  3TO7 A;  3IHU A;  1K79 A;  3J7A Y;  3GYH X;  4QTR A;  5BS6 A;  1AOY A;  3TGN A;  3CME I;  2WAD A;  1PUF A;  1Z67 A;  1E2X A;  3N05 A;  1MZB A;  3CCY A;  2X6X A;  4BJT A;  5GAE J;  3EUA A;  4B48 A;  2F4I A;  2M0C A;  2G9W A;  2DA7 A;  3JAM Z;  3FHN A;  1YYV A;  3SDG A;  1RUO A;  3WTV C;  2ECC A;  3TED A;  3HOZ J;  1Q1H A;  2VKH A;  3WTS C;  1ZKG A;  3SZG A;  3J81 Z;  4B3X A;  1W36 D;  1HW5 A;  2FD5 A;  4EJO A;  2MC4 A;  4BL0 B;  5L3E A;  5AON A;  3Q9S A;  2NYX A;  4XOP A;  1T8I A;  3DPU A;  4HV6 A;  2MG4 A;  1YE9 A;  3FXQ A;  4UXN A;  3G4S I;  2C6Y A;  4CXF A;  4PJ0 C;  2P6T A;  2WY8 Q;  1BI0 A;  1F9N A;  3K4L A;  2E5N A;  3BR1 A;  3D5R C;  2Y9Y A;  1RR8 C;  3MN2 A;  2XRN A;  2A6T A;  3HRM A;  4XKC A;  1FMW A;  3O3K A;  4ON0 A;  1U9O A;  2XRO A;  4IEJ A;  3E1S A;  2AXT C;  2OQR A;  2IS6 A;  3GFL A;  2GOX B;  1LFB A;  5TGT A;  3DP7 A;  3HBL A;  1LDJ A;  4HBL A;  4G9Y A;  4EJU A;  3F6V A;  1VQP I;  2JRM A;  1NG7 A;  2IGK A;  5DM7 F;  1R6R A;  1M1E B;  5EEH A;  4A0X A;  3GME A;  3ZMD A;  4DBR A;  1B59 A;  3E3V A;  4LIV A;  1Y1W J;  2HQR A;  2MD0 A;  4CGZ A;  1VQN I;  4G6D A;  2KIM A;  2Y0S N;  3OYD A;  4E7H A;  5KHD A;  4ZYD A;  2DFE A;  1JTX A;  2G7H A;  2HXI A;  2CUJ A; 
#chains in the Genus database with same CATH homology
 5FB2 A;  2XGX A;  2W85 A;  1JHH A;  1L0O C;  4TV7 A;  3I59 B;  5FLX K;  3SZP A;  1ZG5 A;  3T8R A;  5CVJ A;  1RIO H;  2VN2 A;  5LLQ A;  1FY7 A;  2RNJ A;  4PGG A;  5HDG A;  1BIA A;  3F21 A;  5FFZ A;  2IT0 A;  2MH9 A;  3I54 A;  3M7G A;  3WTW C;  1JGS A;  5DEQ A;  1YQA A;  5H6Q A;  3G3Z A;  5FD5 A;  3V8K A;  2LKP A;  3KP2 A;  1GHC A;  2P4W A;  1XB4 A;  3LQR A;  2FML A;  1IN5 A;  3K1N A;  5E8I A;  3WE3 A;  3ABU A;  4S04 A;  2RQP A;  3MCZ A;  2WC2 A;  3QU6 A;  2ACJ A;  1XGN A;  3ELK A;  5HDK A;  2XIG A;  1LQ1 A;  3KZZ A;  3ECO A;  2DQR A;  4ZYE A;  2Y75 A;  4FX4 A;  4M9S A;  5L3B A;  1KQ9 A;  1LVA A;  4EJV A;  2VT2 A;  1FSE A;  2CWE A;  1T6S A;  3HRU A;  1QBJ A;  2HTJ A;  5AIQ A;  5ICE A;  4IRI A;  2K4B A;  3T5X A;  4LGW A;  5CYV A;  4GXO A;  5LEJ A;  2DPU A;  1G6N A;  5K1Y A;  5DUI A;  2MLG A;  1BJA A;  4JK1 X;  3RKY A;  1SMY F;  2A3S A;  3IKV A;  3GWZ A;  2HQN A;  4BHB A;  3J80 Z;  2QLZ A;  5A2Q K;  1KYZ A;  3J7A O;  1U5T B;  1GVJ A;  3SFZ A;  1TQP A;  2ESN A;  2QWW A;  3VOD A;  3HRT A;  1EV7 A;  3F8M A;  1MJA A;  4HDU A;  1FPQ A;  4NHJ A;  4BXU A;  5ERI A;  5DCF A;  2NNY A;  3CUO A;  2ADU A;  2VE8 A;  1J75 A;  4QWQ A;  2M87 A;  2FEZ A;  1CF7 B;  4RAZ A;  2CO5 A;  2QQA A;  2OZU A;  2QZ8 A;  5D4S A;  4RGS A;  1R1T A;  5H20 A;  4YFX F;  1WWX A;  3S2W A;  4LLN A;  4LK1 F;  4I0A A;  2MH2 A;  3MQ0 A;  3HUG A;  2A07 F;  2CQK A;  1ONV A;  3TOB A;  2EFW A;  4L0Z B;  2RV8 A;  2AS5 F;  3NEU A;  5H6R A;  6PAX A;  1FBU A;  4M72 A;  5TRD A;  1HW2 A;  4Y13 A;  4I0B A;  1ON1 A;  1CGP A;  1J59 A;  3GZ5 A;  2XAG A;  4RGX A;  3LST A;  2A5Y B;  4HV5 A;  5D5W B;  4MNU A;  3HRS A;  3L7W A;  4KA4 A;  1REP C;  3LQQ A;  1FZP B;  1TW3 A;  3Q9V A;  2OU2 A;  4I2O A;  4AIJ A;  1XD7 A;  1BOA A;  3I4P A;  4CIC A;  2QM3 A;  1DDN A;  1LJ9 A;  4A0Y A;  3WG9 A;  1QO0 D;  5LBQ A;  3CO6 C;  4YG2 F;  2IA1 A;  5A2Q Z;  1R58 A;  1FP1 D;  1F1Z A;  4AIH A;  4WCG A;  4MQV A;  3ZN1 A;  1BBY A;  1XDU A;  1R36 A;  5HS8 A;  1QZY A;  2CSO A;  1L3L A;  2O61 A;  1O3S A;  3ZMZ A;  4RB3 C;  3LWF A;  3I0T A;  5D8L B;  4XRF A;  5JVT A;  3FMR A;  4OIO F;  1TQI A;  3QOP A;  4MGR A;  1OKR A;  1YO5 C;  2RGV A;  2Z5U A;  4HF2 A;  3P7N A;  1G3W A;  1JHF A;  5E20 A;  4HX7 A;  3SHF A;  2FXA A;  5D5V B;  4MQ9 F;  2EK5 A;  3NQO A;  3BPV A;  5TJJ A;  3E6D A;  4KIF A;  2P8T A;  4UV9 A;  3ULQ B;  1W7P D;  4OIR F;  4FX0 A;  1HW1 A;  3P9K A;  1BI2 A;  2O0Y A;  5K5O A;  2DPD A;  5BOX A;  3FXR A;  3V7R A;  3V4G A;  1FYL A;  1I6X A;  2V6C A;  1XGS A;  1QNT A;  5DUK A;  5JR3 A;  3HOS A;  3LA2 A;  4I98 B;  4G7O F;  3JAM K;  1B6A A;  3ZMU A;  1T98 A;  1XSX A;  1FNN A;  2FOK A;  4U0V A;  3KCC A;  5LHI A;  4OIQ F;  3C1D A;  1I1G A;  2Z3Y A;  3L9F A;  1TLH B;  1KYW A;  4IHS A;  4H0E A;  2EA4 A;  4LG0 A;  2HTS A;  3M8E A;  2DO7 A;  4UHT A;  2FA5 A;  3GXO A;  4KUM A;  5FGM A;  3PQK A;  3QRF F;  1P6R A;  4MEX F;  1O3T A;  5E8G A;  3F8N A;  4N9H A;  4OU0 A;  1D5V A;  3EET A;  3RPU A;  2P6S A;  3R61 A;  4Q48 A;  3BY6 A;  2FF4 A;  4GYG A;  3V8J A;  3DQV C;  1RNL A;  4QLC U;  3ZMV A;  1FX7 A;  5CLS A;  3K1P A;  4EGZ A;  1S7O A;  4IRG A;  1DPR A;  4A5M A;  1FWZ A;  3EYY A;  5E18 F;  1TNS A;  3RPQ A;  1IXR C;  4L9N A;  2CW0 F;  3U1D A;  1T2K A;  1ZH5 A;  2JPC A;  2EFO A;  4RS8 A;  2STT A;  5E1Z B;  2H27 A;  1VTN C;  1HXD A;  4MHG A;  4KIB A;  4O3M A;  2XVC A;  5ILS A;  1ZRF A;  2PJP A;  3KEQ A;  2VC1 A;  4EJW A;  2K4J A;  3BJA A;  1EH8 A;  4IHT A;  1QPM A;  4EVI A;  4M74 A;  1MDM B;  3FZV A;  3GF2 A;  4G7H F;  2FNP A;  4KN7 X;  1SFU A;  1KU3 A;  1YW8 A;  5FFX A;  3LAJ A;  2V1D A;  3WOD F;  2UXX A;  5DD8 A;  2QUF A;  5LEK A;  1XSD A;  2KIU A;  1KU7 A;  3HOT A;  4HA8 A;  3IRQ A;  3J80 K;  2GXG A;  4EGY A;  1YIO A;  4NQW A;  3WTT C;  5D4R A;  2A68 F;  5CVR A;  3TDU C;  2EFQ A;  2HOE A;  1IN4 A;  4HX4 A;  4AVP A;  1QGP A;  3KZY A;  1J0R A;  4HAM A;  3WTZ A;  4XSZ F;  4WXD A;  5HDN A;  3KP5 A;  1SD5 A;  4A5N A;  2HWV A;  4CHU A;  3I71 A;  4OMZ A;  3CUQ A;  1U3E M;  3HHG A;  4O5V A;  2ISY A;  1U78 A;  2EV6 A;  3SQN A;  1ZHF A;  1YW7 A;  2V1U A;  5AIP A;  2PLY A;  3IWF A;  2STW A;  2EFN A;  3RIR A;  1I5Z A;  3F3X A;  1WKM A;  4AD9 A;  3GLX A;  2W24 A;  1OPC A;  2GZW A;  4P9U A;  1OMI A;  3CJN A;  3KET A;  1XMK A;  5BPI A;  3ERE D;  2L4M A;  1U2W A;  1YLF A;  5LGT A;  2L54 A;  4G8X A;  4XLP F;  4GO1 A;  3E6M A;  1K78 B;  3FXU A;  2LF7 A;  4M6Y A;  3KP7 A;  3KLN A;  3DXJ F;  2VOP A;  2GXB A;  1UST A;  4IXA A;  1Z6R A;  3VEP A;  2J5O A;  2M1B A;  1YS6 A;  3T0Y A;  3R60 A;  3HIF A;  1W5T A;  1J9I A;  1IF1 A;  2FNA A;  2GWR A;  4HQM A;  2L02 A;  4OIP F;  4ZYG A;  5HOO A;  2HYG D;  1SFE A;  3RTR A;  2DAO A;  2KIF A;  3I64 A;  2EB7 A;  1PP7 U;  4RAY A;  3K0L A;  3R0A A;  5E1X A;  3IWZ A;  3SXY A;  4R8H A;  2EA2 A;  3N4M A;  3DEU A;  2DI3 A;  4O6J A;  2A6H F;  5EEG A;  2BV6 A;  2JPB A;  1FOK A;  2DLL A;  1LNW A;  3FM3 A;  1TNT A;  1ZGJ A;  1G3S A;  2V1X A;  1PUE E;  2HDC A;  5HLG A;  3BZ6 A;  2OAZ A;  3W6K B;  1HST A;  2VBX A;  5IT3 A;  2BBY A;  2R7D A;  4MTD A;  1U6G A;  4IVN A;  3DV8 A;  1IN6 A;  1YS7 A;  4WF2 A;  3IL2 A;  4UVB A;  2Z33 A;  2QBY A;  1IAW A;  2HKX A;  3CUQ C;  4RGU A;  2OD5 A;  2GQQ A;  4B09 A;  4LLG F;  4U7D A;  3E5Q A;  2FU4 A;  3TDZ C;  3GW2 A;  1O7L A;  4AIK A;  2A69 F;  4ASN A;  3FHZ A;  1R00 A;  5HVQ C;  3O2P E;  4RGR A;  2W57 A;  1ZRD A;  2RC4 A;  1JXS A;  4LLL A;  4BNC A;  2DT5 A;  5DDG A;  1WRJ A;  3MAJ A;  2ZCW A;  4KYW A;  5J8F A;  1R1U A;  3E6C C;  1BI3 A;  2X0L A;  2WWY A;  3ECH A;  5KK1 A;  5IT9 Z;  4L18 B;  1B9N A;  2PMU A;  4K2E A;  1H9G A;  2YPR A;  3H3U A;  4ZZD A;  2H09 A;  1IW7 F;  1UFM A;  1O3Q A;  2XAF A;  2HZT A;  4ESJ A;  3QAH A;  2BE5 F;  2ZFW A;  5JHU A;  3BPX A;  3KP4 A;  3F22 A;  1YG2 A;  4PGH A;  1QQI A;  3R4K A;  2FMY A;  1F5T A;  1O7F A;  1UHW A;  4HZF A;  1XGO A;  5L3G A;  3MFK A;  2K7L A;  5HS7 A;  4BQA A;  1IXS B;  1IZ1 A;  2PI0 A;  3V7C A;  3P9I A;  4IRH A;  1ZLJ A;  4A6D A;  4ENK A;  3IKT A;  2CG4 A;  2MBF A;  3KP3 A;  2ESH A;  4Y15 A;  1K6O A;  4EJT A;  1EH7 A;  3JSO A;  4FHT A;  3ZQ7 A;  4U0W A;  3V7S A;  1SFX A;  4WK8 F;  2OQG A;  3V8L A;  3BJO A;  4WXC A;  3LA7 A;  5J8C A;  3E5U A;  2IPQ X;  4BYY A;  2GA2 A;  2B0L A;  1XN7 A;  2F5F A;  1NHA A;  2E1N A;  5L3D A;  3JW4 A;  1W7P A;  3L2C A;  4PCQ A;  2ZJ2 A;  4I02 A;  3PFI A;  2XKP A;  3ZN0 A;  2LNB A;  5DCM B;  3ZPL A;  3TQN A;  1T38 A;  4ESB A;  3WGH A;  1BI1 A;  1XMA A;  4IF4 A;  3WTU C;  2RVC A;  2YX7 A;  1D3Y A;  1X3U A;  2RKH A;  1SD6 A;  3IC7 A;  1FYM A;  1S8N A;  5DYM A;  2E1C A;  1DPU A;  4KN4 X;  4BHP A;  2O03 A;  1MKM A;  1D8J A;  4HDV A;  2JSC A;  1Z6T A;  5IT9 K;  1B4A A;  1LB2 A;  3J81 K;  2MD5 A;  2G7U A;  1TQM A;  4KDP A;  3F8C A;  3RYR A;  2XKO A;  2IA0 A;  2AXL A;  5HS9 A;  1RUN A;  2W25 A;  4ENJ A;  3G73 A;  2P7C B;  2YSR A;  4YIF A;  3COA C;  2L3D A;  3C3W A;  3BRO A;  2KJB A;  2DQL A;  2IA2 A;  1R5G A;  4EV0 A;  1G3Y A;  1ULY A;  3K69 A;  2QEN A;  2ZNY A;  3ISP A;  4P96 A;  3QP5 A;  4OOI A;  3LAP A;  2DK8 A;  4E70 A;  3GZ6 A;  3R6S A;  5D5X B;  2PQ8 A;  2F5C A;  2ZXJ A;  3GFM A;  2O3F A;  3ZMS A;  3HSE A;  2ZKZ A;  1ON2 A;  1BM9 A;  3OV8 A;  3I53 A;  3HYI A;  2QVO A;  5FD6 A;  2J5P A;  3GUD A;  2XUB A;  2EJR A;  3U9G A;  3B73 A;  2DBB A;  3ROU A;  1MJ9 A;  3VB2 A;  1K7A A;  2NRA C;  1OR7 A;  3CUQ B;  3QP6 A;  3DPL C;  4U88 A;  3MZH A;  1QZZ A;  3I5U A;  2VBZ A;  1ZAO A;  2OA4 A;  1Z9C A;  3RKX A;  4I01 A;  5K5R A;  1XCV A;  3JSP A;  3CLO A;  5ED4 A;  1MGT A;  3D0S A;  5BQT A;  1G4D A;  2WV0 A;  2PEX A;  4L5J A;  2FBI A;  1LDD A;  1H9T A;  4AWX B;  1ZG3 A;  3FMQ A;  2JRT A;  2D1V A;  2GIV A;  2JZY A;  3HSR A;  4JBA A;  3RYP A;  3U2R A;  3T8T A;  1FP2 A;  2V79 A;  3F8F A;  1I1S A;  2ISZ A;  4EM1 A;  1CF7 A;  2ETH A;  1OYY A;  4ENM A;  5DCM A;  1MD0 A;  3JTG A;  2EV5 A;  2VE9 A;  1Z05 A;  3E97 A;  3WTX C;  2LF8 A;  2HS5 A;  2Y0M A;  2VON A;  3FWE A;  2VBW A;  3BJ6 A;  2GAU A;  1KA8 A;  2P5V A;  4M73 A;  2P5K A;  2P7V B;  1ZG1 A;  4KT5 C;  2QYO A;  2R7F A;  4EM0 B;  1IRG A;  2FSW A;  1MJB A;  4I09 A;  2QQB A;  3L00 A;  5ICG A;  2HFH A;  2YX4 A;  3M8F A;  2COM A;  2CGP A;  1TTY A;  1F4K A;  1LEB A;  1T0F A;  3ML6 A;  4UUV A;  1UCR A;  4KIC A;  2GA1 A;  3N97 A;  2X4H A;  5ICF A;  4ZYH A;  4A12 A;  3RDI A;  4BHC A;  1MDM A;  5K5Q A;  1SD7 A;  5HLH A;  5FLX Z;  2BGC A;  3GO5 A;  4IPA A;  4HX8 A;  1W5S A;  1FBS A;  2QBY B;  2FRH A;  3L09 A;  4F7Z A;  1WSU A;  4Z2Y A;  2YR2 A;  1KU2 A;  2DW4 A;  1KQ0 A;  4CDG A;  3DF8 A;  1A04 A;  1HKT A;  4L5I A;  3FX3 A;  2V9V A;  2OZ6 A;  4MTE A;  1IRF A;  2XV4 S;  2FBH A;  2NS0 A;  4JQF A;  4WXH A;  3WGI A;  4D0P A;  4DNC A;  2D1H A;  1STZ A;  5LHG A;  2D45 A;  2H6B A;  4UV8 A;  4G7Z F;  3SZT A;  2DTR A;  3LFK A;  2P5L C;  5LGN A;  1ZRE A;  1WQ2 A;  3QPT A;  1V4R A;  3R0J A;  3GFJ A;  1AWC A;  3HSF A;  4NB5 A;  4G6Q A;  4HW0 A;  1R1V A;  2VXZ A;  2E7W A;  2MLK A;  4CYD A;  1GXQ A;  4YFK F;  2F5D A;  1P4X A;  2DFI A;  4MEY F;  2PN6 A;  1XDS A;  4OIN F;  2K02 A;  2JT1 A;  2ZO4 A;  3K1M A;  3RI4 A;  4KIG A;  5D6F A;  5ILV A;  3K2Z A;  3PQJ A;  5BPD A;  3MWM A;  1YW9 A;  3AAF A;  1P4A A;  2Y48 A;  5CJ9 A;  1W4M A;  4M9Z A;  4KFC A;  4HLX A;  2VBY A;  4L0Y B;  2DU9 A;  1P92 A;  3FMS A;  4U0Y A;  1JE8 A;  3GVA A;  4CZZ A;  1HKQ A;  4RB0 A;  1B9M A;  2Q8K A;  4IJA A;  3QU3 A;  5LRR A;  2D2W A;  3CDH A;  3GFI A;  1ZGA A;  1KGS A;  5E1W A;  4HQE A;  1ZAR A;  2M5W A;  3C7J A;  2VT3 A;  1J5Y A;  4GYI A;  4DQ2 A;  4N0B A;  2PFB A;  3F23 A;  1C0W A;  4S05 A;  2IW5 A;  1UHM A;  2KJC A;  1PP8 F;  2BYV E;  3E6B A;  3KEO A;  3GX4 X;  5D6E A;  1DP7 P;  1FSH A;  2FE3 A;  5E17 F;  3CO7 C;  1XSV A;  4RB1 A;  1R5H A;  2F2E A;  2IP2 A;  2EWN A;  4LJZ F;  4OMY A;  1Z91 A;  1USS A;  2BEO A;  2EFP A;  2ZME A;  5F1R A;  4ENN A;  4I7H A;  4L9V A;  1ZLK A;  4KMF A;  1KQ8 A;  5ILU A;  5LRS A;  1J7K A;  1IUY A;  4KMU X;  2PG4 A;  2MA3 A;  2Z99 A;  4XBF A;  5CVV A;  3HHH A;  2MC3 A;  2VOD A;  3KLO A;  1K78 A;  5BMZ A;  2LSO A;  2H94 A;  1FC3 A;  4YFN F;  1S7A A;  5D5U B;  3DKW A;  4UVC A;  1O3R A;  3RJP A;  3TO6 A;  3ZMT A;  3P9C A;  4ZZL A;  1KU9 A;  4A6E A;  2K27 A;  3EUH A;  3M1E A;  4PZJ A;  1HQC A;  3HTS B;  3DFG A;  4M9X A;  5ICC A;  2VC0 A;  3Q5F A;  2VOO A;  2CYY A;  4P9F A;  4Q5S F;  2E7X A;  1PDN C;  5KVR A;  2PMH A;  2KRF A;  5CVU A;  1U5T A;  1WI9 A;  1SAX A;  4LK0 F;  2IJL A;  4WWC A;  2O8X A;  2M30 A;  4R79 A;  3ABT A;  1O57 A;  3VFZ A;  4XLN F;  5HLI A;  1S29 A;  5F64 A;  3FM5 A;  2IVM A;  3VOE A;  1Z7U A;  5JFR A;  4LB6 B;  3GEZ A;  1BN5 A;  1I27 A;  1S6L A;  4Q4Z F;  4P55 A;  1TBX A;  3WU1 B;  4UVA A;  1D8K A;  2ZME B;  2A61 A;  3EYI A;  1BC8 C;  4ZH4 F;  1FYK A;  2M45 A;  3IRR A;  1U8R A;  5J6X A;  5CVI A;  2O6G E;  1UB9 A;  4M71 A;  1T39 A;  4P5O A;  1IN7 A;  3M9A A;  3MEX A;  3I59 A;  1RI7 A;  3WGG A;  3REO A;  4R1H A;  2L4A A;  3H3Z A;  1V3F A;  1DUX C;  4UNO A;  1OYI A;  4L9T A;  3W6J B;  3QPH A;  1IN8 A;  1XGM A;  1ZRC A;  1R7J A;  2UWM A;  1U5T C;  2RN7 A;  3BWG A;  2L01 A;  4HYE A;  3D5L A;  1HSJ A;  3C18 A;  4GGG A;  3EQL F;  2ZBK A;  1RZ4 A;  1GXP A;  2ELH A;  3WU0 A;  2HEO A;  2TDX A;  1EH6 A;  4FT8 A;  4A2U A;  3WE2 A;  2K86 A;  2QQ9 A;  2UXN A;  5LHH A;  5LGU A;  3TO9 A;  3BP8 A;  3BDD A;  4M6X A;  5FO5 A;  2XHK A;  3HTU A;  2HYF A;  3FF5 A;  4ESF A;  4LFU A;  3KP6 A;  1HBX G;  2M8E A;  3E5X A;  3NRV A;  2NAZ A;  4HLY A;  2YU3 A;  4PDK A;  1SD4 A;  4B8X A;  4Q47 A;  2DK5 A;  3WTY C;  1BC7 C;  4EQQ A;  3KFW X;  3T1B A;  5JI6 A;  1YFH A;  2IRF G;  4ETS A;  4Y17 A;  4LMY A;  3DPT A;  4L9J A;  4CO8 A;  3F6O A;  4BAY A;  1SMT A;  3EDP A;  4LG0 B;  3F8B A;  2HR3 A;  2JTV A;  4RB2 C;  4EMS A;  1YTY A;  2HKO A;  2LDU A;  1XCB A;  2A6E F;  2FQ3 A;  1HKS A;  1J2X A;  5D8K B;  3I58 A;  1IXC A;  3MZY A;  3TOA A;  5F6F A;  1E17 A;  2RDP A;  3TKY A;  1P4W A;  3O6B B;  2Q2E A;  1Y0U A;  4EM2 A;  3LA3 A;  4HOB A;  2XAH A;  4U7B A;  4N9I A;  2Q0O A;  2XAJ A;  3RKW A;  4LD5 A;  1LEA A;  4KNY A;  2HGC A;  2FBK A;  3H92 A;  2Z9O A;  2WTE A;  4WX9 A;  4LB5 A;  3OOP A;  5DV5 A;  4HF1 A;  1TW2 A;  2CFX A;  2W84 A;  2EV0 A;  1H0M A;  4BH9 A;  2XAS A;  4HF0 A;  1FBQ A;  4G94 A;  1LDK B;  4XSX F;  5DD4 A;  1FT9 A;  2ZNZ A;  4YII A;  2UZK A;  3F72 A;  2XAQ A;  1R23 A;  1G3T A;  1FLI A;  3K9T A;  3KE2 A;  2PBI A;  1OYW A;  2R3S A;  1ZYR F;  2NNN A;  1B1B A;  1R22 A;  1BIB A;  5L3C A;  3B02 A;  1S3J A;  2H6C A;  4GCV A;  2OBP A;  3CTA A;  5L3F A;  4A0Z A;  1ODD A;  2F5E A;  3ZP5 A;  1Z1D A;  1ZN2 A;  3BOQ A;  1P2F A;  2KKO A;  3TO7 A;  3IHU A;  1K79 A;  3GYH X;  5BS6 A;  1AOY A;  3TGN A;  1E2X A;  1MZB A;  2G9W A;  3JAM Z;  1YYV A;  1RUO A;  3WTV C;  1Q1H A;  3WTS C;  3J81 Z;  1HW5 A;  4EJO A;  5L3E A;  5AON A;  3Q9S A;  2NYX A;  4HV6 A;  2C6Y A;  3FXQ A;  4UXN A;  4CXF A;  2P6T A;  1BI0 A;  1F9N A;  2XRN A;  3HRM A;  3O3K A;  4ON0 A;  2XRO A;  2OQR A;  3GFL A;  3DP7 A;  1LDJ A;  4HBL A;  4G9Y A;  4EJU A;  3F6V A;  5EEH A;  4A0X A;  3ZMD A;  1B59 A;  3E3V A;  2HQR A;  4CGZ A;  4G6D A;  2KIM A;  4ZYD A;  3JTH A;  2G7H A;  1W7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...