1FBUA

Heat shock transcription factor dna binding domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proline in alpha-helical kink is required for folding kinetics but not for kinked structure, function, or stability of heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
molecule tags Transcription
molecule keywords HEAT SHOCK FACTOR PROTEIN
total genus 25
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fbuA00
4LB5A 3F8FA 2RNJA 2L02A 2A6EF 2DPDA 1F1ZA 3I4PA 3WU0A 2DU9A 1U5TA 2JSCA 5L3EA 1YFHA 3LFKA 5DCMA 4JQFA 1IN8A 4KFCA 2VBWA 1KQ9A 5E8IA 2F5CA 2L01A 4GO1A 4BQAA 3HYIA 5LRSA 3QU3A 1IXCA 2WC2A 4LK1F 3WODF 4RB1A 1TQPA 3TOBA 3I0TA 4G7OF 1B4AA 1W4MA 2PLYA 2H27A 4UV9A 1U3EM 2BEOA 4EM1A 4MTDA 2HGCA 3GEZA 1Z6RA 3GW2A 4M9ZA 4HF0A 2DK5A 1USSA 2DQRA 4L9JA 2HYFA 1SFEA 2UWMA 1B1BA 3U9GA 4LFUA 1XDSA 4PDKA 4ESFA 4HQMA 3KCCA 3J80K 4Q47A 3DXJF 5KVRA 2GXGA 2Y0MA 1K6OA 3GFMA 2ZMEB 3F8NA 4G7HF 1XD7A 4YIFA 2IA2A 4BAYA 4Y13A 1RNLA 5FD6A 3HRTA 2EV0A 3HIFA 3EYIA 2Y48A 3KE2A 1HKTA 3V7CA 2MH2A 4ENNA 2V1UA 4EV0A 4M9XA 1I5ZA 3SHFA 3TO6A 5BPIA 2FMYA 3K9TA 2VC1A 1R7JA 2QWWA 3IRRA 1BIBA 1FPQA 1Q1HA 4A2UA 1WRJA 1XN7A 3ABUA 5LHIA 3ZPLA 2Z9OA 4HX4A 2V1XA 3R6SA 1J5YA 1AWCA 4AIHA 5CVVA 5DUKA 1ZG1A 1R1TA 1J9IA 4Y17A 1R58A 5HLGA 2YPRA 2CW0F 2QQ9A 2ACJA 1GXPA 2VBYA 2X0LA 4UVCA 1STZA 5J8FA 5HDNA 4LMYA 4LG0B 2XAGA 5ILSA 2HR3A 3HOTA 3BWGA 1IN5A 3RYPA 4GYIA 4KIFA 5DYMA 4K2EA 2G7UA 5LHGA 2G9WA 1I6XA 3T5XA 4CGZA 1J59A 5DCFA 1X3UA 4M9SA 2H09A 4EQQA 2Z99A 4RB0A 1S3JA 4UVAA 3I71A 3PQKA 5L3BA 2XVCA 1T38A 1SD7A 2XAJA 2OQGA 3OOPA 3TKYA 3R0JA 2A69F 3VFZA 4B8XA 5EEHA 2CYYA 1I27A 1SD4A 2ZBKA 3U1DA 1IUYA 2W25A 4WCGA 2EJRA 2VE8A 2YX4A 2F5FA 4EMSA 3HTUA 4IF4A 1FOKA 1YG2A 2XASA 2HKXA 1HQCA 2O3FA 1G3YA 2ZNYA 3CO7C 4ZYHA 5HLIA 5DV5A 1FSEA 2KRFA 5E18F 1FBQA 4A12A 5JI6A 3E6CC 3BPXA 1W7PD 2QVOA 1FP2A 1WSUA 2FA5A 2K7LA 4I01A 3FXQA 1XSXA 1Z7UA 1U8RA 1CGPA 1ZRFA 1MD0A 3EDPA 4GCVA 3M1EA 2M5WA 2VONA 2JT1A 5FFZA 2O6GE 5LEJA 4OMYA 1ZAOA 3H92A 3TDUC 4KNYA 4I2OA 4IPAA 2HYGD 4L9VA 1Z9CA 3E6DA 1ZRDA 4MQVA 3WTZA 3HTSB 4LG0A 5L3DA 4AD9A 3CTAA 2IA1A 3LQQA 1LDDA 2MD5A 1KYZA 2K4BA 3T1BA 2QZ8A 2G7HA 1R1VA 5JR3A 4F7ZA 5E1ZB 3V7SA 1EH7A 5FLXK 2FNPA 2W24A 2FEZA 3I5UA 5DUIA 2IJLA 5F1RA 1QNTA 3RI4A 4P9FA 4CYDA 1U2WA 2QLZA 3H3UA 5JVTA 2EFQA 5LGNA 3O2PE 1G4DA 4O5VA 4YFNF 5CYVA 2EB7A 1W5SA 3KP5A 1OYWA 2XAQA 1TW3A 4UUVA 3F6OA 1HW1A 4HF1A 2V6CA 4OOIA 1HSJA 3LA3A 2KIUA 2P4WA 3CUOA 4BHBA 2BE5F 1Z91A 1XB4A 3QP5A 2P7VB 3L09A 2AS5F 3QP6A 1A04A 3KLOA 1FT9A 2JRTA 2P5LC 1XCBA 2M8EA 4AIKA 1UCRA 2OA4A 3ZMSA 4LK0F 5CVRA 3MFKA 1OR7A 4KIBA 1JHHA 4KA4A 2Z5UA 4UHTA 1TBXA 3T0YA 4OIQF 1FY7A 4UXNA 2C6YA 4LB6B 3WTXC 1G6NA 4EJUA 1F9NA 5ERIA 4AIJA 1IRFA 3DFGA 1O57A 5BMZA 2HDCA 2E7WA 1BI3A 4EJTA 2L3DA 5IT9Z 1EH8A 2GIVA 4QLCU 4BHPA 5ILUA 2P7CB 4M6XA 1U78A 1LB2A 1MJAA 3LQRA 2L4AA 1T6SA 3RKWA 4WXCA 1R5GA 3QRFF 2UXNA 2BV6A 3BJ6A 3K0LA 4RB2C 4IJAA 2R3SA 3TOAA 2R7FA 3TQNA 2CFXA 4O3MA 2RKHA 1RI7A 2FOKA 3FWEA 2PJPA 2IW5A 1G3TA 2IT0A 2DLLA 4UV8A 4HF2A 4A5MA 3R4KA 4S05A 3HRUA 3K1PA 3E97A 4M74A 4R8HA 3ZMZA 3BZ6A 3ZN0A 3V7RA 5HDGA 1IAWA 1W7PB 2KJBA 2BGCA 4LD5A 2YSRA 2XKOA 1P4AA 4UNOA 3VOEA 3HSEA 2L54A 1IF1A 1U5TC 1O3RA 1O7FA 4FX4A 2XHKA 3WTWC 1P2FA 4U0VA 4PCQA 4KIGA 1H0MA 2PEXA 1HW5A 4OIOF 4IHSA 1JGSA 3J80Z 2QENA 3MQ0A 2W57A 4P96A 5K5RA 4ZZLA 1QO0D 4KMFA 1K7AA 2OZ6A 3FMSA 5BS6A 2PQ8A 4MHGA 2M87A 1R22A 3EYYA 2F5DA 4LLLA 1ZLKA 1FWZA 5K5OA 1V4RA 4NB5A 4GGGA 1CF7A 1SMYF 1P6RA 4A6DA 3RKYA 2EA2A 1SMTA 2UXXA 3NRVA 5KK1A 2NRAC 3BJAA 1LDKB 3GLXA 5ICFA 3WG9A 2F2EA 1G3WA 5D5UB 3L7WA 2RN7A 1H9GA 5TJJA 4WF2A 4LJZF 3HRMA 2HWVA 3RPQA 3F8CA 1XDUA 4I02A 5AIPA 5H6RA 2YX7A 4HX8A 4EGYA 4Q4ZF 3ZMUA 2Z33A 2VBXA 5E17F 4G8XA 4OINF 5H20A 4PGHA 2QBYA 3JTHA 1XMAA 1DP7P 5CVJA 1BIAA 1LJ9A 2FRHA 1TW2A 3VB2A 2ISYA 2Z3YA 1RIOH 2HZTA 2XGXA 3H3ZA 5D4SA 2EA4A 3DEUA 4A0YA 1ULYA 2K4JA 2E7XA 2IRFG 2GAUA 3F6VA 3L9FA 3F3XA 2DAOA 2MH9A 2JPCA 4JBAA 3RPUA 2R7DA 1S8NA 3FM3A 2EFPA 2GQQA 4RGXA 4I09A 4BYYA 2M1BA 4L5IA 1IXSB 1XGMA 1FYKA 3ML6A 1YW7A 3I64A 4EVIA 2FSWA 3C3WA 1J7KA 3E6BA 3FXRA 5TRDA 3IWZA 1ON2A 5J6XA 5D8LB 1C0WA 4IVNA 3S2WA 1QBJA 2GWRA 2MBFA 3BROA 2DQLA 1L3LA 1IXRC 1ODDA 4GYGA 3I54A 3M8FA 3REOA 1BBYA 5BQTA 5HDKA 4YG2F 5ICEA 4N9HA 4WWCA 2QYOA 3NQOA 3VODA 1I1SA 2KKOA 3CJNA 2FBKA 4EM0B 4ESBA 2FBIA 3PQJA 4IRGA 3F8MA 2LF7A 3GFIA 5D4RA 1T98A 5DEQA 4O6JA 5HLHA 1O3QA 2XRNA 3CUQA 4CDGA 3CLOA 2P6SA 5JHUA 2ETHA 2NNNA 3F22A 1OYIA 2XIGA 3W6KB 1XCVA 5CVIA 1TNSA 4HYEA 2PBIA 3R60A 2O61A 2PMUA 3BPVA 1ONVA 4MGRA 1SFXA 4L18B 1GHCA 3ECHA 1KU2A 2Q0OA 3V8LA 1O3SA 5HOOA 5D6FA 3J81Z 2V79A 2ZNZA 4R1HA 1DDNA 2QM3A 1DPUA 3IRQA 2A3SA 1FP1D 3ISPA 3KP2A 4JK1X 1R36A 2MC3A 3E6MA 2VN2A 2VT2A 4D0PA 2EFWA 3DV8A 5IT9K 4A0XA 2XKPA 2D1VA 2EV6A 4HA8A 4M71A 4M6YA 4HDVA 5BOXA 4FX0A 1EV7A 4HBLA 5J8CA 2ZCWA 2ELHA 1MZBA 1R5HA 4EGZA 3RIRA 4HOBA 3CUQC 2YU3A 2DFIA 2ZFWA 3K2ZA 2TDXA 1HSTA 3M8EA 3IWFA 1E2XA 2LDUA 2QQAA 4P55A 2GA1A 1BJAA 1OYYA 5ED4A 2LKPA 2NAZA 3MCZA 1L0OC 3SXYA 1ZARA 1S7AA 3PFIA 2W84A 2HEOA 1OKRA 1JXSA 3G3ZA 3D5LA 1FYLA 3ROUA 4RS8A 1E17A 4ENKA 4OIPF 3FMRA 4P9UA 1KQ8A 3GXOA 2STTA 2MLKA 3IKVA 4XBFA 1YIOA 4CZZA 2Q8KA 3COAC 4G6QA 2FBHA 2K02A 2ESNA 2EV5A 1B9MA 1XSDA 3TO9A 2L4MA 1FBUA 4L0ZB 3F8BA 4L9TA 5K5QA 2HOEA 2CQKA 3WTUC 2A68F 5BPDA 2HKOA 4KN7X 2PN6A 4KT5C 2ZJ2A 1MGTA 1KU9A 3BOQA 3FZVA 2DW4A 4MTEA 4S04A 3U2RA 2HTJA 3WGIA 5ICGA 3VEPA 2JTVA 5D5VB 4UVBA 4ZYGA 3QU6A 1GXQA 4U7DA 3FM5A 3WTSC 2D45A 4OU0A 3KZYA 1SD5A 1PUEE 2H6BA 3NEUA 3V4GA 1FSHA 2KIFA 3F72A 3I53A 1FYMA 3QAHA 4RAYA 4RGUA 1D8JA 3GO5A 2VT3A 3RDIA 3GYHX 3HOSA 4LLGF 4Z2YA 2PI0A 4ZYDA 3KP3A 1BOAA 3EETA 5E1XA 2IVMA 4AVPA 1LVAA 1QQIA 4EJVA 2A5YB 5LGUA 2ZKZA 2DO7A 1UHWA 1BC8C 2P8TA 1IRGA 5FFXA 4HW0A 3N97A 1MDMA 4MNUA 2XV4S 3MEXA 2CG4A 3GFJA 3Q5FA 1QZYA 3K69A 4KUMA 1P4XA 1GVJA 3P9CA 2PG4A 4LGWA 1F5TA 1ZRCA 1YW9A 2LF8A 3L00A 4HLXA 1BM9A 3EUHA 3KP7A 3QOPA 2FU4A 1F4KA 4G94A 5ICCA 4M73A 1YYVA 2Y75A 3QPHA 4BHCA 5FB2A 2EK5A 2STWA 2HFHA 4L9NA 5E20A 5ILVA 4B09A 2LSOA 1J0RA 3F21A 4FHTA 4ESJA 4G6DA 1QPMA 1Z05A 1R1UA 1OMIA 4WK8F 1U6GA 3LA7A 4M72A 3K1NA 2PMHA 5F6FA 1DUXC 3JTGA 2OQRA 2RV8A 1WWXA 3LSTA 3SZTA 4XRFA 2XUBA 2EFNA 2RGVA 4OMZA 4N9IA 2FF4A 4KN4X 4RAZA 5E1WA 2PFBA 5DDGA 3FMQA 1IW7F 2DI3A 4WXDA 4E70A 3E3VA 3FHZA 4G9YA 1BI2A 3FX3A 1ZREA 4A0ZA 2H94A 2D2WA 2Q2EA 1KA8A 1ZG5A 2MA3A 2M45A 1ON1A 3C18A 4KYWA 3D0SA 4EM2A 1ZYRF 4R79A 2F5EA 2JZYA 1KYWA 2EFOA 2KJCA 3IHUA 5D5WB 3WTTC 3MWMA 1VTNC 2E1NA 4HX7A 4XLPF 2GZWA 4U88A 3GF2A 5LLQA 3R0AA 2WV0A 3I59A 2VOOA 3WTYC 1YW8A 5CJ9A 3SFZA 2FMLA 4XLNF 2NYXA 3BJOA 1IZ1A 4NQWA 1W5TA 2M30A 1BC7C 4P5OA 3QPTA 3P9KA 3ABTA 4ZYEA 5CVUA 2ZO4A 1S6LA 3ZP5A 4IRIA 2HTSA 3C7JA 1KU7A 1LEAA 5K1YA 5H6QA 1USTA 1G3SA 4TV7A 2NNYA 2GA2A 2VC0A 2P5KA 3ELKA 1UFMA 3FXUA 3RJPA 4EJWA 4ENJA 2VBZA 3BY6A 1TQMA 4WX9A 5FLXZ 4KICA 3HSFA 5EEGA 1B9NA 3JSPA 1KGSA 4HV5A 5D6EA 2MLGA 2AXLA 2VE9A 1LNWA 3LA2A 4HAMA 3WGGA 4MQ9F 1I1GA 2XROA 2E1CA 2DK8A 1DPRA 3L2CA 1UB9A 4FT8A 1ZLJA 3O3KA 1D3YA 4YFKF 2IP2A 3V8KA 2OU2A 1BI0A 2EWNA 2X4HA 4U0WA 4L0YB 1YO5C 3MZHA 3GZ6A 3ZMDA 1PDNC 2O8XA 1J75A 3J7AO 3IKTA 1XGOA 3M7GA 4ZH4F 3SZPA 1AOYA 3HHGA 3I59B 1B59A 1Z6TA 3HRSA 4AWXB 1K78A 1SFUA 4Q48A 4DNCA 4ZZDA 2XAFA 1YLFA 2RVCA 2DTRA 4H0EA 1HBXG 3ZN1A 5CLSA 1JE8A 5LGTA 4CXFA 2CSOA 2H6CA 1TTYA 4MEXF 1MKMA 2CGPA 3B73A 3ULQB 5LHHA 1ZHFA 2OZUA 3DQVC 2QQBA 2RC4A 5DCMB 2QUFA 2HQRA 3F23A 4YFXF 1PP7U 3KEOA 3E5XA 4XSXF 4L5JA 1BN5A 4G7ZF 4IRHA 2HQNA 3KP6A 2COMA 2HS5A 4N0BA 3CUQB 2KIMA 1XMKA 2VXZA 4I98B 2DT5A 3T8TA 1ZH5A 2FQ3A 3KFWX 2NS0A 1ZGAA 4PGGA 2B0LA 2ISZA 2P6TA 2BBYA 1B6AA 1ZN2A 3RYRA 4ENMA 3Q9SA 1W7PA 1YTYA 5D8KB 3IC7A 2W85A 1IN7A 2JPBA 1MDMB 1WI9A 3I58A 1S7OA 1FBSA 5JFRA 3JAMK 2VODA 1KU3A 2V1DA 5LRRA 3RTRA 3LWFA 5LEKA 3HHHA 5FD5A 5FGMA 3MAJA 3TGNA 1FC3A 1D8KA 4HDUA 4YIIA 1P92A 2D1HA 3R61A 1RUOA 4ON0A 1R00A 2A07F 1Y0UA 4I0AA 4CHUA 1T39A 2WTEA 1TNTA 1WKMA 3OV8A 1REPC 3ZMVA 2FE3A 1FNNA 1BI1A 1YS6A 5E8GA 2WWYA 1PP8F 1HKQA 3LAJA 1IN4A 3MZYA 2VOPA 4A6EA 3WE3A 3LAPA 1KQ0A 3DPTA 4MEYF 1HKSA 1NHAA 2XAHA 4CICA 1D5VA 4Q5SF 3N4MA 4HZFA 3V8JA 2ZXJA 3T8RA 1K79A 2J5OA 4HLYA 3WU1B 3ERED 4BH9A 3AAFA 5AIQA 1SD6A 1XSVA 5D5XB 2K86A 2IPQX 3WGHA 1XGNA 6PAXA 3SQNA 2BYVE 1O7LA 3GWZA 3ZQ7A 1FX7A 1UHMA 5L3GA 4PZJA 3O6BB 1O3TA 5HVQC 2UZKA 3TDZC 2RQPA 3C1DA 1JHFA 1HXDA 3KLNA 4HV6A 3P7NA 2OBPA 4A5NA 3DKWA 1YQAA 3GUDA 4ASNA 2J5PA 2P5VA 2ESHA 3KETA 2CO5A 3ECOA 1T0FA 5LBQA 1J2XA 3J81K 1S29A 3W6JB 5A2QK 1XGSA 2ADUA 4RB3C 3ZMTA 3GVAA 2A6HF 1LEBA 2A61A 3GZ5A 1MJBA 3RKXA 4U7BA 4EJOA 4RGRA 2O0YA 3GFLA 1V3FA 3M9AA 5L3FA 3GX4X 4I7HA 4DQ2A 1RUNA 3EQLF 2YR2A 2GXBA 1SAXA 1FLIA 1T2KA 3KEQA 4ETSA 4U0YA 2DBBA 5DD4A 2RDPA 4Y15A 4WXHA 4BXUA 3WTVC 5HS8A 1K78B 3WE2A 4GXOA 3Q9VA 3KZZA 2LNBA 5F64A 3KP4A 3P9IA 4KMUX 2FXAA 2OAZA 4KDPA 1ZGJA 1ZG3A 3G73A 1CF7B 1Z1DA 1RZ4A 5A2QZ 3JAMZ 1HW2A 5DD8A 4IHTA 3HSRA 2FNAA 4IXAA 4LLNA 4RGSA 3JW4A 2O03A 3CO6C 4QWQA 1LQ1A 1EH6A 5HS9A 1TQIA 1QZZA 3TO7A 5AONA 3JSOA 3HUGA 2OD5A 1IN6A 5HS7A 4BNCA 3BDDA 2DPUA 2K27A 3IL2A 3DP7A 3E5QA 2CWEA 1P4WA 4NHJA 1MJ9A 1TLHB 1H9TA 2QBYB 3CDHA 2IA0A 1R23A 5FO5A 1WQ2A 2ZMEA 1QGPA 3K1MA 5L3CA 4CO8A 2V9VA 3E5UA 1YS7A 3DF8A 4XSZF 1FZPB 3FF5A 1LDJA 1OPCA 4HQEA 3DPLC 1U5TB 4I0BA 3B02A 5IT3A 4OIRF 3BP8A
chains in the Genus database with same CATH superfamily
4LB5A 3F8FA 5H2FC 3H9QA 4B3AA 2RNJA 2L02A 2A6EF 2DPDA 1F1ZA 2EIJH 2JUGA 3I4PA 3PNVA 3WU0A 1CQTA 2DU9A 2F4OB 1U5TA 2IAIA 2E2HJ 2PMZN 1D0XA 1XTAA 4LG3A 3SJMA 2R7XA 5J1UA 5KAIC 4J19A 2DOEA 4F52A 2JSCA 1AU7A 5L3EA 1YFHA 3LFKA 5DCMA 1ACIA 4JQFA 1IN8A 4KFCA 2WAQA 2VBWA 1KQ9A 1VF9A 4AVZA 5E8IA 2F5CA 3JRFA 2M0MA 2L01A 2WB1A 3S2DJ 4NQWB 4HNVA 2UUZA 1FEXA 3UR3C 4CYCA 4GO1A 4BQAA 3K4CA 2HOSA 3S17J 3HYIA 3Q0WA 5LRSA 4EEFG 1RPWA 3QU3A 1N78A 1IXCA 3QPLA 2WC2A 4FETA 4LK1F 3WODF 4BXFA 1TQPA 1NG7A 2ZSIB 4RB1A 4E4HA 3TOBA 5IYCJ 2Y9ZA 3OL4A 1W36D 2LREA 3I0TA 4G7OF 1B4AA 2LK2A 4GDFA 3TP3A 1W4MA 2PLYA 2H27A 4UV9A 1U3EM 2BEOA 1UG2A 2LG4A 5GPAA 3VYUB 2I10A 1Z21A 4ZTJA 4IOAF 3GZNB 4YEJA 4EM1A 4MTDA 3UKGA 2HGCA 3E7LA 1QA6A 3GEZA 1Z6RA 3GW2A 4M9ZA 5KAFC 2LYCA 4HF0A 2DYRH 2DK5A 1LVKA 2NS7A 3OSGA 1USSA 2DQRA 4L9JA 3WG7H 1JJ8C 2HYFA 1IRZA 2M8GX 1SFEA 2UWMA 3FXMA 1B1BA 3U9GA 2EBIA 4LFUA 1S9HA 1XDSA 4PDKA 4ESFA 3DLLF 4HQMA 3KCCA 3J80K 2VKDA 4Q47A 3MVPA 3DXJF 2AHQA 2W4SA 5KVRA 2GXGA 3CESA 2Y0MA 1K6OA 2H8WA 2DJIA 4IEJA 2K3FA 1PUFB 3GFMA 2ZMEB 3F8NA 3PUFA 4Y3OA 4IQ4A 4X6AJ 3LMMA 3QOEA 4G7HF 2R5ZA 4I6ZA 1XD7A 4BUPA 4YIFA 1TP4A 1IJWC 2IA2A 4BAYA 4Y13A 1RNLA 1HC8A 5FD6A 3HRTA 4NC6A 2BXYA 4CCOA 2EV0A 1E3PA 5FJ8J 3HIFA 4A3FJ 1PUFA 3EYIA 2Y48A 3HGGA 3KE2A 1HKTA 3V7CA 2MH2A 1TWFJ 4ENNA 2V1UA 4EV0A 4MFEA 3DU5A 2VJIA 4M9XA 4ANJA 1I5ZA 3AL0C 2R5ZB 1A6QA 4G6TB 3SHFA 3TO6A 5IOZA 5BPIA 2FMYA 3K9TA 3FXKA 4OWRB 2VC1A 4JOMA 1TWHJ 4XMYA 1R7JA 2OC6A 2QWWA 5CQGA 3IRRA 1BIBA 2V1NA 1FPQA 1Q1HA 4BS9A 5J1YA 4A2UA 1FOYA 2M7BA 3A03A 3TL4X 1JI8A 2CUFA 1NG6A 3NWSA 3K4NA 4XNFA 5F27A 3K4JA 3M1CA 1WRJA 4W97A 1XN7A 3ABUA 5LHIA 4BE1A 3ZPLA 2Z9OA 4HX4A 2V1XA 3R6SA 1J5YA 1AWCA 4AIHA 5CVVA 5DUKA 1GV5A 2R0QC 1ZG1A 4A3LJ 1R1TA 1J9IA 1ETYA 1SEUA 4Y17A 1R58A 5HLGA 2YPRA 2CW0F 2QQ9A 3S32A 2X48A 2ACJA 1GXPA 2VBYA 2X0LA 4F3QA 4UVCA 1STZA 3HOYJ 5J8FA 5HDNA 4LMYA 5B5EC 4LG0B 4X0GA 2XAGA 3DTIA 4M3FA 5ILSA 3H5AA 1HDDC 2O5RA 2HR3A 2OCCH 1X19A 3HOTA 1DU6A 3BWGA 1IN5A 2XPUA 3RYPA 1ZKGA 1OQYA 3BCBA 4GYIA 4KIFA 2DYSH 5DYMA 2LC2A 4K2EA 2G7UA 3DEWA 1MMGA 5LHGA 3E1SA 2IBDA 3F0CA 2VUMJ 2G9WA 2ZFUA 2IGMA 3FISA 2WAEA 1I6XA 3T5XA 3OYMA 4CGZA 1ETWA 1J59A 5DCFA 1X3UA 3JRAA 5EJCA 4M9SA 2H09A 4EQQA 2LY1A 2LFBA 2Z99A 4RB0A 2XC7A 1HDPA 1S3JA 4QSHA 4UVAA 3I71A 2NVQJ 2X1CA 3VSKA 1I39A 3PQKA 5B1BH 3AL0B 3G4SI 5L3BA 2XVCA 1T38A 1SD7A 2XAJA 2OQGA 3OOPA 4XOPA 4IZZA 3BG9A 3TKYA 3D5RC 3R0JA 2A69F 1P7JA 2ZJPF 1UJ8A 1MBKA 2L7FP 3VFZA 4B8XA 2QEXI 3HPHA 5EEHA 1VQPI 4A3GJ 5FROA 1Y1WJ 1LFUP 1POGA 1Z3XA 2BY2A 2CYYA 4DYRA 2CUZA 1I27A 1SD4A 2ZBKA 1TZLA 3U1DA 4BE0A 1IUYA 2W25A 2LLKA 4D7NA 3LSKA 4WCGA 1QZEA 2CMPA 2HZDA 2EJRA 1MH4A 2VE8A 2XB0X 3Q3SA 1MH3A 2YX4A 2F5FA 4EMSA 3HTUA 4IF4A 1Q1VA 2QQ8A 1FOKA 2L2OA 1YG2A 2OJED 2XASA 1X1BA 4BQQA 2HKXA 1HQCA 2O3FA 4FTHA 1G3YA 4XRSG 2ZNYA 3CO7C 4ZYHA 5HLIA 5DV5A 2ZXHA 1FSEA 2WY7Q 2KRFA 5EDNA 1WJBA 5E18F 4ZJZA 1R49A 3CCSI 1FBQA 4A12A 5JI6A 3E6CC 2KL4A 3DU6A 3BPXA 2W00A 2L7MP 3ZQFA 1W7PD 1QHGA 2MC4A 1VZ0A 1FP2A 2QVOA 1WSUA 2FA5A 1R6RA 3K2AA 5FLMJ 1GLNA 3B6CA 2KPMA 2BY3A 1Z67A 1RESA 2HDDA 2MFZA 3GMEA 2K7LA 4B48A 3L2VA 3CP8A 4I01A 3FXQA 1XSXA 1Z7UA 1U8RA 1CGPA 1ZRFA 1MD0A 3I9V2 4ZDLA 5DTDA 2Y9YA 3EDPA 4IO9F 2CV1A 2HI3A 2X1EA 2EQRA 1LFPA 4GCVA 1MBFA 3M1EA 2M5WA 1LPQA 2VONA 2JT1A 2QSGX 5FFZA 2EZKA 2O6GE 5LEJA 1ZAOA 3H92A 3TDUC 4OMYA 4KNYA 2E1MC 1P7IA 4I2OA 4IPAA 3FDYA 2HYGD 4RM2A 2JJ7A 2VXDA 5B3SH 4L9VA 3OYFA 1Z9CA 3E6DA 3BZKA 4RA2A 1ZRDA 4MQVA 4ITVA 2IS4A 3WTZA 3CCVI 3HTSB 4LG0A 4F55A 5L3DA 4AD9A 4CCNA 2AQFA 3CTAA 4C3JJ 2IA1A 1ETKA 3LQQA 1LDDA 5EYRA 2MD5A 1KYZA 2K4BA 1WCMJ 3H0DA 2HPIA 3T1BA 3ERMA 2DFHA 2QZ8A 3ZGKA 3S15J 3IH3A 2G7HA 1R1VA 3EUKL 5JR3A 1XPXA 4F7ZA 1XG1A 5E1ZB 1BA5A 5EG0A 2ME0A 4FISA 3HG9A 3V7SA 3AG4H 1IG7A 2Y69H 1EH7A 5FLXK 2FNPA 3JRCA 2W24A 2FEZA 3I5UA 5F04A 4HSRA 1WJDA 2IJLA 5F1RA 5DUIA 1QNTA 3K4LA 3CF2A 1T95A 2K9LA 5LFAA 3RI4A 4NNJA 4P9FA 2VJ4A 4CYDA 1U2WA 3OS1A 1N75A 2JWTA 2QLZA 2VQGA 3H3UA 4CCJA 4BBRJ 5JVTA 2EFQA 4F93B 5LGNA 5HNFA 3O2PE 1G4DA 4O5VA 4PK4A 4YFNF 1QVUA 1KONA 5CYVA 3HEFA 4KJZA 2EB7A 4BQOA 1YIJI 1W5SA 3KP5A 1OYWA 2BHZA 2XAQA 5FKMA 4Y52J 1TW3A 3ABLH 3DTKA 4UUVA 3F6OA 1X4OA 3M3YJ 1YX5A 4IHWA 1ETQA 1HW1A 1UG0A 2K40A 4HF1A 4KISA 3DPUA 1A6IA 2V6CA 4OOIA 1HSJA 4IX7A 4N4OB 3LA3A 2KIUA 1ORKA 2P4WA 2Z2SB 3CMAI 2UV1A 1ETVA 3CUOA 4BHBA 5GAEJ 2BE5F 1Z91A 3H36A 4LOCA 1YJWI 5IP9J 3OYDA 2DA7A 1MSFC 1XB4A 3QP5A 2P7VB 5FKNA 3L09A 2AS5F 1X3WB 3QP6A 3BG6A 1A04A 3KLOA 1FT9A 3V42A 3D1NI 2JRTA 5EEAA 4D1QA 2P5LC 5EGOA 2DA3A 1XCBA 3S14J 2M8EA 4AIKA 1UCRA 2DCEA 3W2WA 2OA4A 3ZMSA 2Y0SN 4LK0F 1G2HA 1I3QJ 2L9RA 5CVRA 4IKFA 3MFKA 1OR7A 2ZC2A 2ZJQF 4KIBA 1JHHA 2HQ5A 1WI3A 4RAGA 3QYFA 4KA4A 3GTMJ 2QF7A 2KRCA 3U21A 2Z5UA 2GBYA 4UHTA 1TBXA 3FKIJ 5FKOA 1APLC 3T0YA 3N05A 4OIQF 3KYDB 1FY7A 4UXNA 2C6YA 2LKXA 4LB6B 3WTXC 1G6NA 4EJUA 1F9NA 3K4KA 3AG3H 3K70C 1U8BA 2OTJI 5ERIA 3OYIA 1JUMA 1MW7A 4AIJA 1IRFA 3HOVJ 3QWLA 2E1OA 3DFGA 1A36A 2F48A 1O57A 3OYLA 3H3VK 3BZCA 4V2GA 3ZQQA 5BMZA 3OWTA 1A35A 2HDCA 3J7YJ 2E7WA 4YIRX 1SAUA 1BI3A 3PO3J 4EJTA 2L3DA 5IT9Z 1EH8A 2R7ZJ 2GIVA 2CUJA 4Y4RA 4QLCU 1FOXA 2DODA 2M3AA 3IUOA 4BHPA 4M3BA 5ILUA 3WHCA 2P7CB 4M6XA 1U78A 2EPFA 1LB2A 5C3EJ 1MJAA 4CCLA 3LQRA 2L4AA 1T6SA 2VQLA 3RKWA 4WXCA 1R5GA 3B6AA 3QRFF 2UXNA 2XGEA 2BV6A 1OCOH 4D5FA 3BJ6A 3ASOH 2VIXA 3K0LA 4RB2C 3IAM2 4IJAA 5M3FJ 3PIOF 2R3SA 3TOAA 2R7FA 3TQNA 2R7SA 2CFXA 4O3MA 4B47A 4XIDA 2RKHA 1G59A 1RI7A 2DT7B 5EG0B 3OYHA 3ZRGA 4D9JA 2FOKA 3FWEA 1VQKI 3HC7A 2BW3A 3MMYB 4UB8C 2E35A 4B44A 2PJPA 2IW5A 1GVDA 3WU2C 2DOFA 3S3NA 1G3TA 2IT0A 5IP6A 2DLLA 4UV8A 1R4NB 2ZB9A 4HF2A 4A5MA 3R4KA 3G1LA 4S05A 5C4XJ 3HRUA 3K1PA 3E97A 4M74A 4R8HA 3ZMZA 3BZ6A 3ZN0A 1W5CC 3V7RA 1D1BA 2G0EA 3K70D 5HDGA 1IAWA 4AIDA 2MGQA 3DBRB 1X58A 2Y0SA 2EILH 5K7FA 2NXNB 3LSPA 1W7PB 2KJBA 1V5GA 3LNQA 3RZOJ 3MKZA 2BGCA 2NOGA 3MD2A 2YSRA 4LD5A 2BY0A 2O7OA 2XKOA 3OL3A 4AYBN 1P4AA 1SVLA 2DOAA 3VOEA 4UNOA 3HSEA 2L54A 1IF1A 4KT6A 1U5TC 1O3RA 2EZLA 1O7FA 4FX4A 2FQ4A 2XHKA 4XLAA 3WTWC 1P2FA 4U0VA 3RPUD 2EH3A 4PCQA 4DBQA 4KIGA 1H0MA 2PEXA 3H35A 2V6EA 2W7NA 1HW5A 4OIOF 2KIQA 4IHSA 1JGSA 3HB9A 1VQMI 3J80Z 2QENA 1WJFA 3MQ0A 1T0FC 1MBJA 3U1KA 2W57A 4P96A 2L7ZA 4ZZLA 5K5RA 3MZ8A 2W82A 5J47A 1QO0D 2HVQA 4KMFA 1K7AA 1QRYA 2OZ6A 3FMSA 5BS6A 2PQ8A 3KEYA 4MHGA 2QKMB 1P9QC 1YRNA 2M87A 3BG3A 1R22A 3EYYA 1R5ID 2F5DA 5E3MA 1ZTRA 4LLLA 1IV6A 2L5QA 1UELB 3L2QA 1ZLKA 2OTLI 1FWZA 2QA4I 5K5OA 2NS8A 1V4RA 3ZQCA 2YS9A 4NB5A 4GGGA 1CF7A 1SMYF 1VQ6I 2TCTA 1P6RA 4AYBA 4A6DA 3HOZJ 3RKYA 2EA2A 5FKKA 1SMTA 2UXXA 3NRVA 3AG2H 3C2GA 2KRHA 3CP2A 5KK1A 2CV2A 2AQEA 2NRAC 2K9QA 3H0GJ 3BJAA 2CV0A 4UY8I 5IYBJ 3HKZN 2ZJRF 3SDBA 4CYCB 1LDKB 3GLXA 4MLOA 5ICFA 2M9HA 3WG9A 4CCKA 5FRMA 2F2EA 3L2RA 1G3WA 1IUFA 1YX3A 1S5LC 4FE7A 1Z77A 5D5UB 3L7WA 2RN7A 4ZDOA 2X6WA 1B72A 2LH9A 1H9GA 5TJJA 4WF2A 4LJZF 3HRMA 1GDTA 2HWVA 3RPQA 1JT6A 3F8CA 1XDUA 2R7UA 4I02A 5AIPA 5H6RA 2YX7A 4HX8A 4AU7A 4EGYA 2NVTJ 4Q4ZF 2JVGA 5C44J 3QPSA 3JRBA 2WV1A 4UUSB 2VBXA 3ZMUA 2Z33A 4XLEA 5E17F 4G8XA 4OINF 3G6EI 5H20A 4PGHA 3ASNH 2QBYA 4RLQA 3JTHA 5F0CA 4HEA2 1XMAA 1DGWY 3FXOA 3O8GA 3IH2A 1DP7P 5CVJA 4YELA 1BIAA 2PJRB 1LJ9A 2XRLA 2FRHA 1TW2A 3TEDA 3KYCB 3VB2A 2ISYA 2Z3YA 5EF6A 2ELKA 1RIOH 3OR2C 5JHFA 4DBRA 5E3NA 2HZTA 3K4MA 4IHVA 2DT6A 4V19K 2XGXA 3GBGA 3CQZJ 3H3ZA 5D4SA 3ZXSA 2Z16A 3CMMA 5B66C 2EA4A 3DEUA 4A0YA 1ULYA 2K4JA 3VWBA 2E7XA 2IRFG 2JA8J 2GAUA 2XF6A 3F6VA 3L9FA 2R5YA 4A3IJ 1RR8C 4FCYA 3F3XA 1UMQA 3S8PA 2LY2A 2DAOA 4E7JA 2MH9A 2JPCA 4JBAA 3RPUA 3HM5A 3ZQIA 1SANA 2R7DA 1S8NA 3JCUC 4XLCA 1H89C 2IXSA 1ZR2A 3BTCA 1V55H 2L9SA 1MIJA 1X2MA 3CLQA 1JGGA 3JRDA 2HYJA 3FM3A 4PJ0C 4RAFA 3KX2A 2EFPA 2WA0A 5GTHC 2GQQA 2HU9A 4RGXA 3EUAA 2GOXB 4I09A 4BYYA 2M1BA 4L5IA 3VYRB 3PIPF 2LVSA 5GAGJ 1IXSB 1XGMA 1FYKA 2BOLA 1MNDA 2JA7J 4II3A 2K9SA 3ML6A 2I8DA 5EGOB 1YW7A 2XF5A 3I64A 4XKBA 4EVIA 2FSWA 3C3WA 2JVHA 3C2BA 1J7KA 3H5RA 2XGCA 5IP7J 1MMSA 3E6BA 4D7MA 3FXRA 2ID6A 3KZIC 4QPOA 5TRDA 3IWZA 4JYKA 1IRXA 1ON2A 5J6XA 5D8LB 1C0WA 4IVNA 3G2BA 3S2WA 1QBJA 3BTLA 4ZDPA 2GWRA 3S3OA 4B43A 3HGYA 2FD5A 2MBFA 3BROA 2DQLA 5J4YA 1IXRC 1L3LA 1FTTA 1ODDA 3CCUI 2YU9J 4GYGA 1B72B 2LD5A 3I54A 3LSIA 3M8FA 3PNYA 5F08A 4KITB 1JTXA 2CQ7A 3REOA 1BBYA 3S1RJ 5BQTA 3G1MA 5F0HA 5HDKA 4A3BJ 3W6VA 4YG2F 1WJEA 5ICEA 4N9HA 3VPRA 4WWCA 2F4IA 2QYOA 1XX5A 3NQOA 3VODA 3K10A 3TW6A 4J00A 1I1SA 3FHNA 4IHYA 2BXZA 2KKOA 2RQQA 3CZ6A 3CJNA 4UUSA 2FBKA 4EM0B 4ESBA 1BJZA 5BNGA 2FBIA 3PQJA 1ENHA 4IRGA 3F8MA 2LF7A 2Y2ZA 3HJEA 2BHYA 3GFIA 3S2HJ 5D4RA 1T98A 5DEQA 4Z6YA 2EIKH 4J01A 4O6JA 5HLHA 1O3QA 2XRNA 3GCMA 3QYEA 3CUQA 4CDGA 1H8AC 3CLOA 2P6SA 5JHUA 2ETHA 3AG1H 5HNHA 2W1OA 2NNNA 3H5NA 3SDGA 3TMOA 1ZR4A 1XS9A 3F22A 3SFIA 1OYIA 1GUUA 2XIGA 3W6KB 1XCVA 3OYCA 1WZ2A 1F43A 5CVIA 1TNSA 4HYEA 9ANTA 2PBIA 3R60A 2E34A 3HXLA 3P5JA 2PMUA 2O61A 3BPVA 1ONVA 3IH4A 4BEHB 4MGRA 1SFXA 4CCMA 1QPIA 2ECCA 4L18B 3SEZA 1EF4A 3PSIA 3NWTA 1GHCA 3ECHA 1KU2A 3ZQGA 5GADJ 2Q0OA 3V8LA 1O3SA 5HOOA 4E7ZA 3H9JA 5D6FA 5FLVA 2LTPA 2E71A 4IOCF 2GXAA 2KZVA 2VJ5A 4Y33A 3J81Z 2V79A 2ZNZA 4R1HA 3PNTA 1DDNA 2QM3A 2V9PA 1R9TJ 4OAZA 1DPUA 2IEKA 3IRQA 3VSLA 2A3SA 1FP1D 3ISPA 3LSJA 2N8GA 3KP2A 4JK1X 2HXIA 3G71I 1R36A 4CA0A 3LL7A 2MC3A 2FUG2 3E6MA 2VN2A 2VT2A 4LIUA 4H4KC 3D5SC 4D0PA 3OIOA 3I56I 4UUTA 3GTKJ 2EFWA 3DV8A 2A5WA 4IQJA 1ERDA 4DYCA 5C4JJ 1JKPC 2JQ7A 5IT9K 4BBSJ 3CJQB 4A0XA 2XKPA 3MKYB 1FIPA 2D1VA 1HCRA 4LIVA 2EV6A 4HA8A 3BG7A 4M71A 4M6YA 4HDVA 5BOXA 4FX0A 1EV7A 1B8IA 4XONA 5KNLA 2VKVA 4HBLA 3DBHB 1TL8A 5JLWA 1JJ6C 5J8CA 2ZCWA 2ELHA 1MZBA 1R5HA 2IGOA 2K9MA 4EGZA 3RIRA 4HOBA 3CUQC 2YU3A 2DFIA 4ABZA 2DMQA 4HPQA 4DIQA 1JTYA 2ZFWA 3K2ZA 2TDXA 1HSTA 2DMPA 5F1JA 1T56A 3M8EA 3IWFA 4F92B 3DTEA 2KQRA 1FMWA 1E2XA 2LDUA 2QQAA 4P55A 2GA1A 5HLTA 1BJAA 1OYYA 5ED4A 2LKPA 2NAZA 3MCZA 4NBQA 1L0OC 3SXYA 1ZARA 1S7AA 3PFIA 4HNUA 1K4SA 1SC7A 2JN6A 2W84A 5IOYA 2HEOA 1OKRA 1EJ9A 1UZCA 5GPCA 1JXSA 4C9YA 3GLLA 3G3ZA 4RBOA 1OCRH 3D5LA 1AKHA 4PJMA 1FYLA 3ROUA 4RS8A 1E17A 1E3HA 4ENKA 1I6HJ 1WH5A 4XKWA 4OIPF 3FMRA 2R7QA 2L0KA 4P9UA 1KQ8A 3GXOA 2STTA 1LUJB 2MLKA 1V5EA 3IKVA 3QYBA 4XBFA 1YIOA 3BTIA 3LSGA 4CZZA 1FTZA 3O8HA 1WGXA 2Q8KA 2VPLA 1ZQ3P 1A5JA 3COAC 2LMDA 3H9GA 1BR2A 1OFCX 4PJJA 4G6QA 2FBHA 2BY1A 3DEEA 3HOWJ 2K02A 3DLAA 4XR6A 2ESNA 2EV5A 1B9MA 2TRTA 2DFFA 1T33A 2ZMEC 1ITYA 3L1PA 4BQNA 1XSDA 3TO9A 2A05A 1RETA 1U0JA 2L4MA 1FBUA 4E7SA 1LFBA 4A93J 3UNGC 4CZCA 4L0ZB 3F8BA 1OCCH 4L9TA 2K5CA 1RKWA 1VI0A 5K5QA 2HOEA 2CQKA 2BZTA 1S72I 2QCOA 3WTUC 2R5YB 3ESWB 2EINH 2A68F 5IY5H 5BPDA 2DXIA 2HKOA 2XF7A 2XDVA 4KN7X 2KHMA 2PN6A 2M4GA 2V9KA 2ZJ2A 1MGTA 4KT5C 3OS2A 1KU9A 4GFBA 3BOQA 3FZVA 1DQUA 2DW4A 3S1MJ 2DFEA 4MTEA 5KCMA 4S04A 3U2RA 2HTJA 3TP0A 3PUBA 2E5NA 3WGIA 1X4PA 3VEPA 5ICGA 3KPHA 3DCFA 4E6KG 2JTVA 2X6YA 5D5VB 1VQ8I 4C2UA 4UVBA 2R93J 4ZYGA 3QU6A 2X9DA 3BLYA 3OYAA 2VLAA 1HLVA 1GXQA 4U7DA 3FM5A 3A0BC 3SEQA 3WTSC 2D45A 2COBA 1MSEC 1Y6IA 4OU0A 3KZYA 3EPZA 3LSMA 1SD5A 2GIZA 1PUEE 2H6BA 3A1YA 3NEUA 3W3CA 1VQLI 3V4GA 1YJNI 3S3MA 1FSHA 2KIFA 3ZQLA 4UB6C 3GTQJ 3F72A 2Z1DA 3I53A 3OIPA 3M4OJ 1FYMA 1WFXA 4ZTFA 3QAHA 1QVTA 4RAYA 4RGUA 4N4NB 5J1RA 5IPAA 3C2HA 1D8JA 3GO5A 4PJNA 2VT3A 5E3OA 2ME6A 3RDIA 3GYHX 4BY1J 3HOSA 2IS6A 4LLGF 4Z2YA 2PI0A 4RMNA 5B1AH 2LKSA 4ZYDA 3KP3A 2D5VA 3OYGA 2FJ1A 1A31A 1BOAA 3EETA 5E1XA 4B4CA 2IVMA 4AVPA 1LVAA 4IL6C 1O4XA 2OUMA 4JX6A 3QODA 1AKHB 1QQIA 2F6CA 4C2MJ 3HUGB 1U9NA 4E7LA 4EJVA 2M7AA 4XRMA 2A5YB 5LGUA 2ZKZA 1D1AA 2DO7A 1UHWA 1BC8C 1Y1VJ 1XC5A 2P8TA 1JUPA 2WBMA 1Y39A 1IRGA 4HW0A 5FFXA 3MKLA 3N97A 2HPMA 3SZGA 1MDMA 4MNUA 2H8RA 2XV4S 2Y31A 1MNEA 2MSYA 1YITI 3MEXA 2MYSA 2CG4A 1SVMA 3GFJA 3Q5FA 1QZYA 1IV8A 3K69A 4KUMA 2QKLB 2WB1N 1I50J 1P4XA 3S1NJ 4HG2A 2WAQN 3FIWA 2ID3A 1GVJA 4BDZA 3P9CA 2PG4A 4E7KA 4LGWA 1F5TA 3KIOA 1ZRCA 1VQ7I 1X3ZB 2X6OA 4PUSA 4AC0A 1YW9A 3QQAA 4HNTA 2LF8A 4EATA 4A3DJ 2BVMA 3L00A 1KZHA 4HLXA 1BM9A 3EUHA 1VQOI 3KP7A 1VQ5I 3QOPA 4C30A 2FU4A 2HQAA 1F4KA 1DU0A 3CJTB 4G94A 3CF5F 5ICCA 4M73A 1YYVA 1T8IA 2Y75A 4ZC3A 3QPHA 3CC7I 4BHCA 5FB2A 2LY9A 3DBLB 2QSFX 2EK5A 3A01B 2CW7A 1NK3P 2STWA 2VASA 2DA2A 3HOUJ 2M34A 3PO2J 2HFHA 4L9NA 5GAHJ 5E20A 1YRNB 5ILVA 2HDWA 3VYTB 4B09A 4C3IJ 2LSOA 1FOWA 1J0RA 3F21A 3OOUA 4FHTA 4ESJA 1W1WE 4G6DA 1QPMA 1Z05A 1R1UA 1PJRA 1OMIA 4WK8F 1U6GA 3LA7A 4HRIA 4M72A 3K1NA 4M3EA 2PMHA 5E3LA 1UAAA 5F6FA 3HZJA 1DUXC 3TW7A 3JTGA 2OQRA 2RV8A 1M1EB 1WWXA 2R4GA 4CUGA 4BJTA 2KISA 3LSTA 3SZTA 4XRFA 2XUBA 2EFNA 2RGVA 1T08B 4OMZA 4N9IA 4YRVA 2M0CA 3JRIA 2FF4A 3BR2A 4KN4X 1D5YA 1TWGJ 4RAZA 3OIQA 5E1WA 5GTIC 2PFBA 5DDGA 3FK7A 4XRSA 3S16J 5TISC 2JK3A 3FMQA 3OYKA 1IW7F 2Q2EB 5J3LA 2DI3A 4MIMA 4WXDA 3OS0A 4E70A 2WY8Q 3E3VA 4XKVA 3FHZA 1TT0A 2RAEA 4G9YA 1RRJA 1BI2A 2OF7A 2HOTA 3FX3A 4U87A 5FRNA 2VKEA 1ZREA 3DWLE 4A0ZA 4DYQA 4CSWA 4RDUA 2H94A 2D2WA 2Q2EA 1KA8A 5IYDJ 5J40A 1RC9A 1ZG5A 2LRDA 2JA6J 2DMTA 2P81A 3ABMH 2MA3A 2M45A 1ON1A 3C18A 3VDXA 4KYWA 3D0SA 4EM2A 1ZYRF 1TWCJ 4R79A 2F5EA 2JZYA 4BGDA 4XQFA 1KYWA 2E5ZA 3BQZA 4HSTA 2EFOA 3TBIA 1ETOA 3CCLI 4BACA 1VQ4I 2KJCA 3H1CA 3IHUA 5D5WB 3WTTC 3MWMA 3RSNA 1VTNC 2E1NA 4HX7A 4II2A 4DGWB 4XLPF 2GZWA 4U88A 3GF2A 5LLQA 3GTGJ 3R0AA 2WV0A 1MBGA 2DA5A 4X1EA 3MKWB 1TT5B 3I59A 4B1RA 2VOOA 3CD6I 3WTYC 1YW8A 2FX0A 5CJ9A 3SFZA 2FMLA 4XLNF 1X2NA 3BG5A 2NYXA 3BJOA 1IZ1A 4NQWA 1W5TA 2M30A 3BQYA 4P5OA 3RKQA 4A3EJ 1BC7C 3QPTA 3P9KA 3ABTA 4E7IA 3I55I 4ZYEA 5CVUA 3CMYA 4NDLA 3G1OA 3GTPJ 4PFOA 2ZO4A 2FOWA 1S6LA 5M5XJ 1WJAA 3ZP5A 4XKCA 1K83J 3A4CA 4IRIA 2CQNA 3CCMI 2HTSA 3C7JA 1KU7A 1LEAA 3W2VA 1X1PA 1X1DA 5K1YA 5H6QA 1USTA 1G3SA 4TV7A 4XICA 3FK6A 2DTZA 2CW8A 2NNYA 2GA2A 2VC0A 3I4NJ 2L7KA 2P5KA 3ELKA 1UFMA 1BW5A 3FXUA 1WVRA 3E0JB 3MN2A 5CKTA 2VB6A 4XOTA 4BJ6C 1DP3A 4XN0A 3RJPA 1NTCA 4EJWA 4ENJA 1N77A 4XN3A 1MBEA 2VBZA 2B7EA 3S93A 3BY6A 1TQMA 4A69C 4WX9A 5FLXZ 4KICA 2W48A 3HSFA 2E1MB 3LOCA 5EEGA 1B9NA 3JSPA 2DA6A 2XGDA 2MD0A 1KGSA 4HV5A 3CJRB 4C3HJ 5GP9A 4I99C 4XK4A 5D6EA 1NK2P 2MLGA 2AXLA 2VE9A 1LNWA 2ELJA 3CCEI 3LA2A 1EKEA 3OYJA 1VNDA 4HAMA 3WGGA 4MQ9F 1MNMC 1I1GA 2XROA 2Q1ZB 3J7AY 2LBFB 5J4VA 2E1CA 5DM7F 3RQIA 2OPTA 2DK8A 1DPRA 2LP0A 3L2CA 1Y0NA 1UB9A 2AXTC 4FT8A 1YHQI 4BXXJ 1ZLJA 3O3KA 3BR5A 1D3YA 3ZQHA 1N25A 4YFKF 4Y7NJ 4DZJA 2IP2A 2F5VA 2K85A 5LD2C 3V8KA 2OU2A 1BI0A 2EWNA 2X4HA 3BR1A 4U0WA 3CCYA 2HVRA 1WPKA 4L0YB 1YO5C 3MZHA 3A2KA 3GZ6A 1YE9A 2X6XA 2DMNA 3ZMDA 2O8XA 3IV5A 1J75A 1PDNC 2HVSA 3J7AO 3IKTA 2EIMH 1XGOA 5TGTA 2R92J 2B9SA 3JR9A 3M7GA 1IDZA 4ZH4F 4BEHA 4JX4A 2VQCA 5KHDA 3FBIB 1AHDP 1U9OA 3OY9A 2V26A 1OCZH 3SZPA 1AOYA 3HHGA 2CQXA 3DKYA 4QPQA 1HA8A 3I59B 1B59A 1Z6TA 3FXJA 3HRSA 4AWXB 3CCQI 1K78A 1OJLA 1SFUA 1JKOC 4Q48A 2ZXWH 2XB5A 3K7AJ 3NAUA 2R7VA 3Q0VA 4DNCA 3PL8A 4ZZDA 1BR4A 2CU7A 4JP0A 2V4JC 2KLOA 2XAFA 1YLFA 2RVCA 2DTRA 4H0EA 1HBXG 4AM3A 3PJRA 1WJ5A 3FXLA 3ZN1A 5CLSA 1V5FA 4OAYA 1JE8A 1BR1A 5LGTA 4XM3A 2BVLA 4CXFA 4BY7J 2CSOA 2H6CA 4AUXA 1TTYA 4MEXF 2IS1A 1MKMA 4A3MJ 2CGPA 3B73A 2DDBA 3ULQB 5LHHA 1ZHFA 2AO9A 2OZUA 3HL2A 2EZHA 3L2UA 2JA2A 2QQBA 2RC4A 3DQVC 5M5YJ 5DCMB 5JVGF 1MMNA 4W1UA 4E7HA 2QUFA 3CCRI 3ONQA 3ZR8X 3K6GA 1Z7LA 1IO2A 2HQRA 1IC8A 3F23A 4YFXF 2V7FA 1PP7U 3KEOA 3PM1A 3E5XA 4XSXF 4L5JA 1BN5A 4G7ZF 4IRHA 4V2FA 2HQNA 1MBHA 3CC2I 5DM6F 3KP6A 2COMA 2VI6A 2XSDC 2ECBA 1PVEA 2NVYJ 2HS5A 4N0BA 2CS3A 2A6TA 4A3KJ 1R71A 3CUQB 2KIMA 1WJCA 3BR0A 2BW3B 4XLHA 2CJJA 1XMKA 4NC7A 2GOMA 2VXZA 5DS9A 4I98B 2DT5A 3HPGA 3T8TA 1ZH5A 3X2QH 2FQ3A 3KFWX 2NVUB 4C2TA 2NS0A 1ZGAA 2PMZA 2X85A 3LFUA 2B0LA 4PGGA 2ISZA 3CDLA 2P6TA 2BBYA 1B6AA 1ZN2A 3LSRA 2R7RA 2CQQA 3RYRA 5K7ZA 2IGKA 1LE8B 4ENMA 1YI2I 3Q9SA 1GV2A 2MABA 1JKQC 2E2JJ 1BOBA 1VQ9I 1W7PA 4PFPA 1YTYA 5M5WJ 5D8KB 3IC7A 2W85A 2JMWA 1IN7A 2JPBA 1MDMB 1TWAJ 1WI9A 4F91B 3BR6A 3I58A 2JA5J 1S7OA 1FBSA 5JFRA 3JAMK 2VODA 2XAUA 5JLXA 1KU3A 2EZIA 3J7ZI 2KFDA 2V1DA 4M3GA 5LRRA 3RTRA 3LWFA 1JT0A 1OCTC 3GTOJ 5LEKA 3HHHA 5FD5A 2I5UA 5FGMA 3MAJA 3S1QJ 3TGNA 3L2WA 1FC3A 1D8KA 4HDUA 1BW6A 4YIIA 5CQEA 4DOZA 1QU3A 1P92A 2D1HA 2DN0A 3R61A 2R7OA 1RUOA 4ON0A 2DDAA 1MMDA 1R00A 1W0TA 2A07F 2KT0A 1Y0UA 3OMYA 1OISA 4I0AA 4CHUA 3BCAA 1T39A 1WHUA 1E3OC 2WTEA 1TNTA 4A3CJ 3CC4I 1FJLA 1SFKA 1WKMA 2XPWA 2MG4A 3OV8A 2VL8A 2P0WA 1REPC 3ZMVA 4BKXA 4RLFA 3M8JA 1J09A 2FE3A 1FNNA 1BI1A 1YS6A 5E8GA 2WWYA 1UHSA 1PP8F 2R7TA 1HKQA 3LAJA 1IN4A 3MZYA 2GLOA 2VOPA 3WE3A 4A6EA 3LAPA 2XPVA 1E0EA 1KQ0A 2B63J 4JX5A 1K6YA 3DPTA 2KDZA 2QSHX 1ETXA 2CH0A 1K61A 3I4MJ 3VYSB 4MEYF 1HKSA 1NHAA 1B8IB 1ZELA 4RM3A 1D0YA 3JRGA 3NARA 3BTJA 3PSFA 2XAHA 3RZDJ 1OR7C 4CICA 1BL0A 1D5VA 4Q5SF 3N4MA 3LSHA 4L5EA 1X1AA 4HZFA 3V8JA 5EZGA 4DW6A 2ZXJA 2IGNA 4PSWA 3T8RA 1K79A 2NOJB 2J5OA 4HLYA 3OYEA 2OV7A 3WU1B 2VKHA 3ERED 2YUSA 4M3DA 3GTLJ 4BH9A 3AAFA 2M2EA 5AIQA 1SD6A 1XSVA 5D5XB 2K86A 2IPQX 3WHBA 2KP6A 3WGHA 1XGNA 2JSPA 3CCJI 2NVXJ 6PAXA 3SQNA 2BYVE 1O7LA 3GWZA 3ZQ7A 1FX7A 1UHMA 3DKXA 5L3GA 4PZJA 3IAS2 3O6BB 1O3TA 3AFHA 2OCEA 5HVQC 2UZKA 1SFOJ 4LITA 1V54H 3TDZC 1I3AA 2PJRA 4IHXA 2JRMA 1LE8A 3HKZA 2RQPA 2KMUA 5EZHA 3C1DA 1JHFA 1LKXA 3W2AA 1HOMA 1JUSA 4P1WA 1HXDA 2LR8A 1F36A 2RNGA 2M4KA 3KLNA 4HV6A 3P7NA 2OBPA 2L9NA 4A5NA 4FASD 1S7EA 3DKWA 2VPRA 1YQAA 3GUDA 2O8KA 4BL0B 2CFOA 4ASNA 2J5PA 2HXOA 2VJJA 2P5VA 2ESHA 3OYBA 3KETA 1D0ZA 2CO5A 4BJ5C 1RKTA 1Z3YA 3RQ4A 2LOOA 4G12A 3ECOA 1T0FA 3RCOA 5LBQA 1DGRM 1J2XA 1JKRC 4BE2A 4PJLA 4BDYA 3J81K 1S29A 3W6JB 5A2QK 1XGSA 2E60A 2ADUA 1R4MB 4ZYAA 4RB3C 3ZMTA 4A3JJ 3F9KA 4D5CA 3GVAA 3OSFA 2A6HF 2HOAA 2DMUA 1LEBA 4CH7A 2A61A 3GZ5A 2PX9A 1MJBA 2HNHA 3RKXA 4U7BA 4EJOA 4DJAA 3OYNA 4RGRA 2O0YA 1W36C 3GFLA 2CRGA 2ICWG 1V3FA 1Y56A 3M9AA 5L3FA 3GX4X 2DJNA 4I7HA 2E2IJ 3BC8A 1VFCA 3SYTA 2Y30A 1SVOA 4XL9A 4DQ2A 1RUNA 3EQLF 2YR2A 2CUEA 2GXBA 1SAXA 1FLIA 5F0FA 5FKLA 1T2KA 2E19A 1OLTA 3KEQA 3GTJJ 4ETSA 4U0YA 2DBBA 4MO7A 4B3XA 1EA3A 5DD4A 1OCPA 2RDPA 3FBNB 4XORA 4Y15A 4WXHA 5K7HA 4BXUA 3WTVC 2O9LA 5HS8A 1K78B 1TC3C 1AA7A 1NH3A 3M07A 3HDDA 3WE2A 4GXOA 3Q9VA 1MMAA 3KZZA 3BR3A 2LNBA 5F64A 2VQHA 3KP4A 3Q0UA 3P9IA 1YJ9I 4KMUX 2FXAA 2OAZA 4KDPA 1ZGJA 4BU2A 1Y8QB 2JUCA 2X1DA 2ZSHB 1D1CA 3A0HC 4M6VA 1ZG3A 2GM4A 3ABKH 1GT0C 3G73A 1QHHD 1FIAA 3A01A 4NC8A 3KYLA 1CF7B 1Z1DA 3ZOBA 2H1KA 1RZ4A 2X51A 4QIWN 5A2QZ 2F4MB 2RREA 3JAMZ 1Z0XA 1HW2A 3CDIA 1WH7A 5DD8A 2K3PA 3OR1C 2ZXIA 4QTRA 1G8XA 3IP4B 1VQNI 4IHTA 3HSRA 2FNAA 4IXAA 4LLNA 3HBLA 4RGSA 3JW4A 3JREA 2O03A 2XSJC 3CO6C 4QWQA 1HF0A 1LQ1A 4MFDA 2MW8A 3HOXJ 3A02A 1EH6A 2LBFA 4GRIA 5HODA 3PFYA 5HS9A 3BT9A 1TQIA 1QZZA 3K4BA 3TO7A 5AONA 2H1LA 3JSOA 2KDOA 3HUGA 2E36A 3FKJA 2OD5A 5CPRB 1Y8RB 1FMVA 1XMXA 1IN6A 5HS7A 2WAFA 4BNCA 3ZCOA 4DZPA 3BDDA 4NUBA 2DPUA 2K27A 1IGNA 4FQGA 3IL2A 3DP7A 3E5QA 2CWEA 3CMEI 1ZK8A 4FE4A 1P4WA 4NHJA 1MJ9A 3EUHC 1TLHB 2R7WA 2WADA 1H9TA 2QBYB 3CDHA 1X1CA 3I3LA 2IA0A 1R23A 2QGUA 5FO5A 1W0UA 1WQ2A 4I76A 2ZMEA 1QGPA 4S0HB 3K1MA 5M3MJ 1RR7A 5L3CA 1YOVB 1ZGWA 2IS2A 2K9NA 2V9VA 2L9VA 3E5UA 4CO8A 1YS7A 2KZGA 3DF8A 4XSZF 1FZPB 1K4TA 3AKZA 3FF5A 1LDJA 1H88C 1IDYA 1OPCA 2DA4A 4HQEA 3DPLC 4PSXA 1U5TB 4I0BA 5E79C 2DA1A 3B02A 5IT3A 3JRHA 4XLFA 4OIRF 1PYVA 3BP8A
chains in the Genus database with same CATH topology
4LB5A 3F8FA 2RNJA 2L02A 2A6EF 2DPDA 1F1ZA 3I4PA 3WU0A 2DU9A 1U5TA 2JSCA 5L3EA 1YFHA 3LFKA 5DCMA 4JQFA 1IN8A 4KFCA 2VBWA 1KQ9A 5E8IA 2F5CA 2L01A 4GO1A 4BQAA 3HYIA 5LRSA 3QU3A 1IXCA 2WC2A 4LK1F 3WODF 4RB1A 1TQPA 3TOBA 3I0TA 4G7OF 1B4AA 1W4MA 2PLYA 2H27A 4UV9A 1U3EM 2BEOA 4EM1A 4MTDA 2HGCA 3GEZA 1Z6RA 3GW2A 4M9ZA 4HF0A 2DK5A 1USSA 2DQRA 4L9JA 2HYFA 1SFEA 2UWMA 1B1BA 3U9GA 4LFUA 1XDSA 4PDKA 4ESFA 4HQMA 3KCCA 3J80K 4Q47A 3DXJF 5KVRA 2GXGA 2Y0MA 1K6OA 3GFMA 2ZMEB 3F8NA 4G7HF 1XD7A 4YIFA 2IA2A 4BAYA 4Y13A 1RNLA 5FD6A 3HRTA 2EV0A 3HIFA 3EYIA 2Y48A 3KE2A 1HKTA 3V7CA 2MH2A 4ENNA 2V1UA 4EV0A 4M9XA 1I5ZA 3SHFA 3TO6A 5BPIA 2FMYA 3K9TA 2VC1A 1R7JA 2QWWA 3IRRA 1BIBA 1FPQA 1Q1HA 4A2UA 1WRJA 1XN7A 3ABUA 5LHIA 3ZPLA 2Z9OA 4HX4A 2V1XA 3R6SA 1J5YA 1AWCA 4AIHA 5CVVA 5DUKA 1ZG1A 1R1TA 1J9IA 4Y17A 1R58A 5HLGA 2YPRA 2CW0F 2QQ9A 2ACJA 1GXPA 2VBYA 2X0LA 4UVCA 1STZA 5J8FA 5HDNA 4LMYA 4LG0B 2XAGA 5ILSA 2HR3A 3HOTA 3BWGA 1IN5A 3RYPA 4GYIA 4KIFA 5DYMA 4K2EA 2G7UA 5LHGA 2G9WA 1I6XA 3T5XA 4CGZA 1J59A 5DCFA 1X3UA 4M9SA 2H09A 4EQQA 2Z99A 4RB0A 1S3JA 4UVAA 3I71A 3PQKA 5L3BA 2XVCA 1T38A 1SD7A 2XAJA 2OQGA 3OOPA 3TKYA 3R0JA 2A69F 3VFZA 4B8XA 5EEHA 2CYYA 1I27A 1SD4A 2ZBKA 3U1DA 1IUYA 2W25A 4WCGA 2EJRA 2VE8A 2YX4A 2F5FA 4EMSA 3HTUA 4IF4A 1FOKA 1YG2A 2XASA 2HKXA 1HQCA 2O3FA 1G3YA 2ZNYA 3CO7C 4ZYHA 5HLIA 5DV5A 1FSEA 2KRFA 5E18F 1FBQA 4A12A 5JI6A 3E6CC 3BPXA 1W7PD 2QVOA 1FP2A 1WSUA 2FA5A 2K7LA 4I01A 3FXQA 1XSXA 1Z7UA 1U8RA 1CGPA 1ZRFA 1MD0A 3EDPA 4GCVA 3M1EA 2M5WA 2VONA 2JT1A 5FFZA 2O6GE 5LEJA 4OMYA 1ZAOA 3H92A 3TDUC 4KNYA 4I2OA 4IPAA 2HYGD 4L9VA 1Z9CA 3E6DA 1ZRDA 4MQVA 3WTZA 3HTSB 4LG0A 5L3DA 4AD9A 3CTAA 2IA1A 3LQQA 1LDDA 2MD5A 1KYZA 2K4BA 3T1BA 2QZ8A 2G7HA 1R1VA 5JR3A 4F7ZA 5E1ZB 3V7SA 1EH7A 5FLXK 2FNPA 2W24A 2FEZA 3I5UA 5DUIA 2IJLA 5F1RA 1QNTA 3RI4A 4P9FA 4CYDA 1U2WA 2QLZA 3H3UA 5JVTA 2EFQA 5LGNA 3O2PE 1G4DA 4O5VA 4YFNF 5CYVA 2EB7A 1W5SA 3KP5A 1OYWA 2XAQA 1TW3A 4UUVA 3F6OA 1HW1A 4HF1A 2V6CA 4OOIA 1HSJA 3LA3A 2KIUA 2P4WA 3CUOA 4BHBA 2BE5F 1Z91A 1XB4A 3QP5A 2P7VB 3L09A 2AS5F 3QP6A 1A04A 3KLOA 1FT9A 2JRTA 2P5LC 1XCBA 2M8EA 4AIKA 1UCRA 2OA4A 3ZMSA 4LK0F 5CVRA 3MFKA 1OR7A 4KIBA 1JHHA 4KA4A 2Z5UA 4UHTA 1TBXA 3T0YA 4OIQF 1FY7A 4UXNA 2C6YA 4LB6B 3WTXC 1G6NA 4EJUA 1F9NA 5ERIA 4AIJA 1IRFA 3DFGA 1O57A 5BMZA 2HDCA 2E7WA 1BI3A 4EJTA 2L3DA 5IT9Z 1EH8A 2GIVA 4QLCU 4BHPA 5ILUA 2P7CB 4M6XA 1U78A 1LB2A 1MJAA 3LQRA 2L4AA 1T6SA 3RKWA 4WXCA 1R5GA 3QRFF 2UXNA 2BV6A 3BJ6A 3K0LA 4RB2C 4IJAA 2R3SA 3TOAA 2R7FA 3TQNA 2CFXA 4O3MA 2RKHA 1RI7A 2FOKA 3FWEA 2PJPA 2IW5A 1G3TA 2IT0A 2DLLA 4UV8A 4HF2A 4A5MA 3R4KA 4S05A 3HRUA 3K1PA 3E97A 4M74A 4R8HA 3ZMZA 3BZ6A 3ZN0A 3V7RA 5HDGA 1IAWA 1W7PB 2KJBA 2BGCA 4LD5A 2YSRA 2XKOA 1P4AA 4UNOA 3VOEA 3HSEA 2L54A 1IF1A 1U5TC 1O3RA 1O7FA 4FX4A 2XHKA 3WTWC 1P2FA 4U0VA 4PCQA 4KIGA 1H0MA 2PEXA 1HW5A 4OIOF 4IHSA 1JGSA 3J80Z 2QENA 3MQ0A 2W57A 4P96A 5K5RA 4ZZLA 1QO0D 4KMFA 1K7AA 2OZ6A 3FMSA 5BS6A 2PQ8A 4MHGA 2M87A 1R22A 3EYYA 2F5DA 4LLLA 1ZLKA 1FWZA 5K5OA 1V4RA 4NB5A 4GGGA 1CF7A 1SMYF 1P6RA 4A6DA 3RKYA 2EA2A 1SMTA 2UXXA 3NRVA 5KK1A 2NRAC 3BJAA 1LDKB 3GLXA 5ICFA 3WG9A 2F2EA 1G3WA 5D5UB 3L7WA 2RN7A 1H9GA 5TJJA 4WF2A 4LJZF 3HRMA 2HWVA 3RPQA 3F8CA 1XDUA 4I02A 5AIPA 5H6RA 2YX7A 4HX8A 4EGYA 4Q4ZF 3ZMUA 2Z33A 2VBXA 5E17F 4G8XA 4OINF 5H20A 4PGHA 2QBYA 3JTHA 1XMAA 1DP7P 5CVJA 1BIAA 1LJ9A 2FRHA 1TW2A 3VB2A 2ISYA 2Z3YA 1RIOH 2HZTA 2XGXA 3H3ZA 5D4SA 2EA4A 3DEUA 4A0YA 1ULYA 2K4JA 2E7XA 2IRFG 2GAUA 3F6VA 3L9FA 3F3XA 2DAOA 2MH9A 2JPCA 4JBAA 3RPUA 2R7DA 1S8NA 3FM3A 2EFPA 2GQQA 4RGXA 4I09A 4BYYA 2M1BA 4L5IA 1IXSB 1XGMA 1FYKA 3ML6A 1YW7A 3I64A 4EVIA 2FSWA 3C3WA 1J7KA 3E6BA 3FXRA 5TRDA 3IWZA 1ON2A 5J6XA 5D8LB 1C0WA 4IVNA 3S2WA 1QBJA 2GWRA 2MBFA 3BROA 2DQLA 1L3LA 1IXRC 1ODDA 4GYGA 3I54A 3M8FA 3REOA 1BBYA 5BQTA 5HDKA 4YG2F 5ICEA 4N9HA 4WWCA 2QYOA 3NQOA 3VODA 1I1SA 2KKOA 3CJNA 2FBKA 4EM0B 4ESBA 2FBIA 3PQJA 4IRGA 3F8MA 2LF7A 3GFIA 5D4RA 1T98A 5DEQA 4O6JA 5HLHA 1O3QA 2XRNA 3CUQA 4CDGA 3CLOA 2P6SA 5JHUA 2ETHA 2NNNA 3F22A 1OYIA 2XIGA 3W6KB 1XCVA 5CVIA 1TNSA 4HYEA 2PBIA 3R60A 2O61A 2PMUA 3BPVA 1ONVA 4MGRA 1SFXA 4L18B 1GHCA 3ECHA 1KU2A 2Q0OA 3V8LA 1O3SA 5HOOA 5D6FA 3J81Z 2V79A 2ZNZA 4R1HA 1DDNA 2QM3A 1DPUA 3IRQA 2A3SA 1FP1D 3ISPA 3KP2A 4JK1X 1R36A 2MC3A 3E6MA 2VN2A 2VT2A 4D0PA 2EFWA 3DV8A 5IT9K 4A0XA 2XKPA 2D1VA 2EV6A 4HA8A 4M71A 4M6YA 4HDVA 5BOXA 4FX0A 1EV7A 4HBLA 5J8CA 2ZCWA 2ELHA 1MZBA 1R5HA 4EGZA 3RIRA 4HOBA 3CUQC 2YU3A 2DFIA 2ZFWA 3K2ZA 2TDXA 1HSTA 3M8EA 3IWFA 1E2XA 2LDUA 2QQAA 4P55A 2GA1A 1BJAA 1OYYA 5ED4A 2LKPA 2NAZA 3MCZA 1L0OC 3SXYA 1ZARA 1S7AA 3PFIA 2W84A 2HEOA 1OKRA 1JXSA 3G3ZA 3D5LA 1FYLA 3ROUA 4RS8A 1E17A 4ENKA 4OIPF 3FMRA 4P9UA 1KQ8A 3GXOA 2STTA 2MLKA 3IKVA 4XBFA 1YIOA 4CZZA 2Q8KA 3COAC 4G6QA 2FBHA 2K02A 2ESNA 2EV5A 1B9MA 1XSDA 3TO9A 2L4MA 1FBUA 4L0ZB 3F8BA 4L9TA 5K5QA 2HOEA 2CQKA 3WTUC 2A68F 5BPDA 2HKOA 4KN7X 2PN6A 4KT5C 2ZJ2A 1MGTA 1KU9A 3BOQA 3FZVA 2DW4A 4MTEA 4S04A 3U2RA 2HTJA 3WGIA 5ICGA 3VEPA 2JTVA 5D5VB 4UVBA 4ZYGA 3QU6A 1GXQA 4U7DA 3FM5A 3WTSC 2D45A 4OU0A 3KZYA 1SD5A 1PUEE 2H6BA 3NEUA 3V4GA 1FSHA 2KIFA 3F72A 3I53A 1FYMA 3QAHA 4RAYA 4RGUA 1D8JA 3GO5A 2VT3A 3RDIA 3GYHX 3HOSA 4LLGF 4Z2YA 2PI0A 4ZYDA 3KP3A 1BOAA 3EETA 5E1XA 2IVMA 4AVPA 1LVAA 1QQIA 4EJVA 2A5YB 5LGUA 2ZKZA 2DO7A 1UHWA 1BC8C 2P8TA 1IRGA 5FFXA 4HW0A 3N97A 1MDMA 4MNUA 2XV4S 3MEXA 2CG4A 3GFJA 3Q5FA 1QZYA 3K69A 4KUMA 1P4XA 1GVJA 3P9CA 2PG4A 4LGWA 1F5TA 1ZRCA 1YW9A 2LF8A 3L00A 4HLXA 1BM9A 3EUHA 3KP7A 3QOPA 2FU4A 1F4KA 4G94A 5ICCA 4M73A 1YYVA 2Y75A 3QPHA 4BHCA 5FB2A 2EK5A 2STWA 2HFHA 4L9NA 5E20A 5ILVA 4B09A 2LSOA 1J0RA 3F21A 4FHTA 4ESJA 4G6DA 1QPMA 1Z05A 1R1UA 1OMIA 4WK8F 1U6GA 3LA7A 4M72A 3K1NA 2PMHA 5F6FA 1DUXC 3JTGA 2OQRA 2RV8A 1WWXA 3LSTA 3SZTA 4XRFA 2XUBA 2EFNA 2RGVA 4OMZA 4N9IA 2FF4A 4KN4X 4RAZA 5E1WA 2PFBA 5DDGA 3FMQA 1IW7F 2DI3A 4WXDA 4E70A 3E3VA 3FHZA 4G9YA 1BI2A 3FX3A 1ZREA 4A0ZA 2H94A 2D2WA 2Q2EA 1KA8A 1ZG5A 2MA3A 2M45A 1ON1A 3C18A 4KYWA 3D0SA 4EM2A 1ZYRF 4R79A 2F5EA 2JZYA 1KYWA 2EFOA 2KJCA 3IHUA 5D5WB 3WTTC 3MWMA 1VTNC 2E1NA 4HX7A 4XLPF 2GZWA 4U88A 3GF2A 5LLQA 3R0AA 2WV0A 3I59A 2VOOA 3WTYC 1YW8A 5CJ9A 3SFZA 2FMLA 4XLNF 2NYXA 3BJOA 1IZ1A 4NQWA 1W5TA 2M30A 1BC7C 4P5OA 3QPTA 3P9KA 3ABTA 4ZYEA 5CVUA 2ZO4A 1S6LA 3ZP5A 4IRIA 2HTSA 3C7JA 1KU7A 1LEAA 5K1YA 5H6QA 1USTA 1G3SA 4TV7A 2NNYA 2GA2A 2VC0A 2P5KA 3ELKA 1UFMA 3FXUA 3RJPA 4EJWA 4ENJA 2VBZA 3BY6A 1TQMA 4WX9A 5FLXZ 4KICA 3HSFA 5EEGA 1B9NA 3JSPA 1KGSA 4HV5A 5D6EA 2MLGA 2AXLA 2VE9A 1LNWA 3LA2A 4HAMA 3WGGA 4MQ9F 1I1GA 2XROA 2E1CA 2DK8A 1DPRA 3L2CA 1UB9A 4FT8A 1ZLJA 3O3KA 1D3YA 4YFKF 2IP2A 3V8KA 2OU2A 1BI0A 2EWNA 2X4HA 4U0WA 4L0YB 1YO5C 3MZHA 3GZ6A 3ZMDA 1PDNC 2O8XA 1J75A 3J7AO 3IKTA 1XGOA 3M7GA 4ZH4F 3SZPA 1AOYA 3HHGA 3I59B 1B59A 1Z6TA 3HRSA 4AWXB 1K78A 1SFUA 4Q48A 4DNCA 4ZZDA 2XAFA 1YLFA 2RVCA 2DTRA 4H0EA 1HBXG 3ZN1A 5CLSA 1JE8A 5LGTA 4CXFA 2CSOA 2H6CA 1TTYA 4MEXF 1MKMA 2CGPA 3B73A 3ULQB 5LHHA 1ZHFA 2OZUA 3DQVC 2QQBA 2RC4A 5DCMB 2QUFA 2HQRA 3F23A 4YFXF 1PP7U 3KEOA 3E5XA 4XSXF 4L5JA 1BN5A 4G7ZF 4IRHA 2HQNA 3KP6A 2COMA 2HS5A 4N0BA 3CUQB 2KIMA 1XMKA 2VXZA 4I98B 2DT5A 3T8TA 1ZH5A 2FQ3A 3KFWX 2NS0A 1ZGAA 4PGGA 2B0LA 2ISZA 2P6TA 2BBYA 1B6AA 1ZN2A 3RYRA 4ENMA 3Q9SA 1W7PA 1YTYA 5D8KB 3IC7A 2W85A 1IN7A 2JPBA 1MDMB 1WI9A 3I58A 1S7OA 1FBSA 5JFRA 3JAMK 2VODA 1KU3A 2V1DA 5LRRA 3RTRA 3LWFA 5LEKA 3HHHA 5FD5A 5FGMA 3MAJA 3TGNA 1FC3A 1D8KA 4HDUA 4YIIA 1P92A 2D1HA 3R61A 1RUOA 4ON0A 1R00A 2A07F 1Y0UA 4I0AA 4CHUA 1T39A 2WTEA 1TNTA 1WKMA 3OV8A 1REPC 3ZMVA 2FE3A 1FNNA 1BI1A 1YS6A 5E8GA 2WWYA 1PP8F 1HKQA 3LAJA 1IN4A 3MZYA 2VOPA 4A6EA 3WE3A 3LAPA 1KQ0A 3DPTA 4MEYF 1HKSA 1NHAA 2XAHA 4CICA 1D5VA 4Q5SF 3N4MA 4HZFA 3V8JA 2ZXJA 3T8RA 1K79A 2J5OA 4HLYA 3WU1B 3ERED 4BH9A 3AAFA 5AIQA 1SD6A 1XSVA 5D5XB 2K86A 2IPQX 3WGHA 1XGNA 6PAXA 3SQNA 2BYVE 1O7LA 3GWZA 3ZQ7A 1FX7A 1UHMA 5L3GA 4PZJA 3O6BB 1O3TA 5HVQC 2UZKA 3TDZC 2RQPA 3C1DA 1JHFA 1HXDA 3KLNA 4HV6A 3P7NA 2OBPA 4A5NA 3DKWA 1YQAA 3GUDA 4ASNA 2J5PA 2P5VA 2ESHA 3KETA 2CO5A 3ECOA 1T0FA 5LBQA 1J2XA 3J81K 1S29A 3W6JB 5A2QK 1XGSA 2ADUA 4RB3C 3ZMTA 3GVAA 2A6HF 1LEBA 2A61A 3GZ5A 1MJBA 3RKXA 4U7BA 4EJOA 4RGRA 2O0YA 3GFLA 1V3FA 3M9AA 5L3FA 3GX4X 4I7HA 4DQ2A 1RUNA 3EQLF 2YR2A 2GXBA 1SAXA 1FLIA 1T2KA 3KEQA 4ETSA 4U0YA 2DBBA 5DD4A 2RDPA 4Y15A 4WXHA 4BXUA 3WTVC 5HS8A 1K78B 3WE2A 4GXOA 3Q9VA 3KZZA 2LNBA 5F64A 3KP4A 3P9IA 4KMUX 2FXAA 2OAZA 4KDPA 1ZGJA 1ZG3A 3G73A 1CF7B 1Z1DA 1RZ4A 5A2QZ 3JAMZ 1HW2A 5DD8A 4IHTA 3HSRA 2FNAA 4IXAA 4LLNA 4RGSA 3JW4A 2O03A 3CO6C 4QWQA 1LQ1A 1EH6A 5HS9A 1TQIA 1QZZA 3TO7A 5AONA 3JSOA 3HUGA 2OD5A 1IN6A 5HS7A 4BNCA 3BDDA 2DPUA 2K27A 3IL2A 3DP7A 3E5QA 2CWEA 1P4WA 4NHJA 1MJ9A 1TLHB 1H9TA 2QBYB 3CDHA 2IA0A 1R23A 5FO5A 1WQ2A 2ZMEA 1QGPA 3K1MA 5L3CA 4CO8A 2V9VA 3E5UA 1YS7A 3DF8A 4XSZF 1FZPB 3FF5A 1LDJA 1OPCA 4HQEA 3DPLC 1U5TB 4I0BA 3B02A 5IT3A 4OIRF 3BP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LB5 A;  3F8F A;  2RNJ A;  2L02 A;  2A6E F;  2DPD A;  1F1Z A;  3I4P A;  3WU0 A;  2DU9 A;  1U5T A;  2JSC A;  5L3E A;  1YFH A;  3LFK A;  5DCM A;  4JQF A;  1IN8 A;  4KFC A;  2VBW A;  1KQ9 A;  5E8I A;  2F5C A;  2L01 A;  4GO1 A;  4BQA A;  3HYI A;  5LRS A;  3QU3 A;  1IXC A;  2WC2 A;  4LK1 F;  3WOD F;  4RB1 A;  1TQP A;  3TOB A;  3I0T A;  4G7O F;  1B4A A;  1W4M A;  2PLY A;  2H27 A;  4UV9 A;  1U3E M;  2BEO A;  4EM1 A;  4MTD A;  2HGC A;  3GEZ A;  1Z6R A;  3GW2 A;  4M9Z A;  4HF0 A;  2DK5 A;  1USS A;  2DQR A;  4L9J A;  2HYF A;  1SFE A;  2UWM A;  1B1B A;  3U9G A;  4LFU A;  1XDS A;  4PDK A;  4ESF A;  4HQM A;  3KCC A;  3J80 K;  4Q47 A;  3DXJ F;  5KVR A;  2GXG A;  2Y0M A;  1K6O A;  3GFM A;  2ZME B;  3F8N A;  4G7H F;  1XD7 A;  4YIF A;  2IA2 A;  4BAY A;  4Y13 A;  1RNL A;  5FD6 A;  3HRT A;  2EV0 A;  3HIF A;  3EYI A;  2Y48 A;  3KE2 A;  1HKT A;  3V7C A;  2MH2 A;  4ENN A;  2V1U A;  4EV0 A;  4M9X A;  1I5Z A;  3SHF A;  3TO6 A;  5BPI A;  2FMY A;  3K9T A;  2VC1 A;  1R7J A;  2QWW A;  3IRR A;  1BIB A;  1FPQ A;  1Q1H A;  4A2U A;  1WRJ A;  1XN7 A;  3ABU A;  5LHI A;  3ZPL A;  2Z9O A;  4HX4 A;  2V1X A;  3R6S A;  1J5Y A;  1AWC A;  4AIH A;  5CVV A;  5DUK A;  1ZG1 A;  1R1T A;  1J9I A;  4Y17 A;  1R58 A;  5HLG A;  2YPR A;  2CW0 F;  2QQ9 A;  2ACJ A;  1GXP A;  2VBY A;  2X0L A;  4UVC A;  1STZ A;  5J8F A;  5HDN A;  4LMY A;  4LG0 B;  2XAG A;  5ILS A;  2HR3 A;  3HOT A;  3BWG A;  1IN5 A;  3RYP A;  4GYI A;  4KIF A;  5DYM A;  4K2E A;  2G7U A;  5LHG A;  2G9W A;  1I6X A;  3T5X A;  4CGZ A;  1J59 A;  5DCF A;  1X3U A;  4M9S A;  2H09 A;  4EQQ A;  2Z99 A;  4RB0 A;  1S3J A;  4UVA A;  3I71 A;  3PQK A;  5L3B A;  2XVC A;  1T38 A;  1SD7 A;  2XAJ A;  2OQG A;  3OOP A;  3TKY A;  3R0J A;  2A69 F;  3VFZ A;  4B8X A;  5EEH A;  2CYY A;  1I27 A;  1SD4 A;  2ZBK A;  3U1D A;  1IUY A;  2W25 A;  4WCG A;  2EJR A;  2VE8 A;  2YX4 A;  2F5F A;  4EMS A;  3HTU A;  4IF4 A;  1FOK A;  1YG2 A;  2XAS A;  2HKX A;  1HQC A;  2O3F A;  1G3Y A;  2ZNY A;  3CO7 C;  4ZYH A;  5HLI A;  5DV5 A;  1FSE A;  2KRF A;  5E18 F;  1FBQ A;  4A12 A;  5JI6 A;  3E6C C;  3BPX A;  1W7P D;  2QVO A;  1FP2 A;  1WSU A;  2FA5 A;  2K7L A;  4I01 A;  3FXQ A;  1XSX A;  1Z7U A;  1U8R A;  1CGP A;  1ZRF A;  1MD0 A;  3EDP A;  4GCV A;  3M1E A;  2M5W A;  2VON A;  2JT1 A;  5FFZ A;  2O6G E;  5LEJ A;  4OMY A;  1ZAO A;  3H92 A;  3TDU C;  4KNY A;  4I2O A;  4IPA A;  2HYG D;  4L9V A;  1Z9C A;  3E6D A;  1ZRD A;  4MQV A;  3WTZ A;  3HTS B;  4LG0 A;  5L3D A;  4AD9 A;  3CTA A;  2IA1 A;  3LQQ A;  1LDD A;  2MD5 A;  1KYZ A;  2K4B A;  3T1B A;  2QZ8 A;  2G7H A;  1R1V A;  5JR3 A;  4F7Z A;  5E1Z B;  3V7S A;  1EH7 A;  5FLX K;  2FNP A;  2W24 A;  2FEZ A;  3I5U A;  5DUI A;  2IJL A;  5F1R A;  1QNT A;  3RI4 A;  4P9F A;  4CYD A;  1U2W A;  2QLZ A;  3H3U A;  5JVT A;  2EFQ A;  5LGN A;  3O2P E;  1G4D A;  4O5V A;  4YFN F;  5CYV A;  2EB7 A;  1W5S A;  3KP5 A;  1OYW A;  2XAQ A;  1TW3 A;  4UUV A;  3F6O A;  1HW1 A;  4HF1 A;  2V6C A;  4OOI A;  1HSJ A;  3LA3 A;  2KIU A;  2P4W A;  3CUO A;  4BHB A;  2BE5 F;  1Z91 A;  1XB4 A;  3QP5 A;  2P7V B;  3L09 A;  2AS5 F;  3QP6 A;  1A04 A;  3KLO A;  1FT9 A;  2JRT A;  2P5L C;  1XCB A;  2M8E A;  4AIK A;  1UCR A;  2OA4 A;  3ZMS A;  4LK0 F;  5CVR A;  3MFK A;  1OR7 A;  4KIB A;  1JHH A;  4KA4 A;  2Z5U A;  4UHT A;  1TBX A;  3T0Y A;  4OIQ F;  1FY7 A;  4UXN A;  2C6Y A;  4LB6 B;  3WTX C;  1G6N A;  4EJU A;  1F9N A;  5ERI A;  4AIJ A;  1IRF A;  3DFG A;  1O57 A;  5BMZ A;  2HDC A;  2E7W A;  1BI3 A;  4EJT A;  2L3D A;  5IT9 Z;  1EH8 A;  2GIV A;  4QLC U;  4BHP A;  5ILU A;  2P7C B;  4M6X A;  1U78 A;  1LB2 A;  1MJA A;  3LQR A;  2L4A A;  1T6S A;  3RKW A;  4WXC A;  1R5G A;  3QRF F;  2UXN A;  2BV6 A;  3BJ6 A;  3K0L A;  4RB2 C;  4IJA A;  2R3S A;  3TOA A;  2R7F A;  3TQN A;  2CFX A;  4O3M A;  2RKH A;  1RI7 A;  2FOK A;  3FWE A;  2PJP A;  2IW5 A;  1G3T A;  2IT0 A;  2DLL A;  4UV8 A;  4HF2 A;  4A5M A;  3R4K A;  4S05 A;  3HRU A;  3K1P A;  3E97 A;  4M74 A;  4R8H A;  3ZMZ A;  3BZ6 A;  3ZN0 A;  3V7R A;  5HDG A;  1IAW A;  1W7P B;  2KJB A;  2BGC A;  4LD5 A;  2YSR A;  2XKO A;  1P4A A;  4UNO A;  3VOE A;  3HSE A;  2L54 A;  1IF1 A;  1U5T C;  1O3R A;  1O7F A;  4FX4 A;  2XHK A;  3WTW C;  1P2F A;  4U0V A;  4PCQ A;  4KIG A;  1H0M A;  2PEX A;  1HW5 A;  4OIO F;  4IHS A;  1JGS A;  3J80 Z;  2QEN A;  3MQ0 A;  2W57 A;  4P96 A;  5K5R A;  4ZZL A;  1QO0 D;  4KMF A;  1K7A A;  2OZ6 A;  3FMS A;  5BS6 A;  2PQ8 A;  4MHG A;  2M87 A;  1R22 A;  3EYY A;  2F5D A;  4LLL A;  1ZLK A;  1FWZ A;  5K5O A;  1V4R A;  4NB5 A;  4GGG A;  1CF7 A;  1SMY F;  1P6R A;  4A6D A;  3RKY A;  2EA2 A;  1SMT A;  2UXX A;  3NRV A;  5KK1 A;  2NRA C;  3BJA A;  1LDK B;  3GLX A;  5ICF A;  3WG9 A;  2F2E A;  1G3W A;  5D5U B;  3L7W A;  2RN7 A;  1H9G A;  5TJJ A;  4WF2 A;  4LJZ F;  3HRM A;  2HWV A;  3RPQ A;  3F8C A;  1XDU A;  4I02 A;  5AIP A;  5H6R A;  2YX7 A;  4HX8 A;  4EGY A;  4Q4Z F;  3ZMU A;  2Z33 A;  2VBX A;  5E17 F;  4G8X A;  4OIN F;  5H20 A;  4PGH A;  2QBY A;  3JTH A;  1XMA A;  1DP7 P;  5CVJ A;  1BIA A;  1LJ9 A;  2FRH A;  1TW2 A;  3VB2 A;  2ISY A;  2Z3Y A;  1RIO H;  2HZT A;  2XGX A;  3H3Z A;  5D4S A;  2EA4 A;  3DEU A;  4A0Y A;  1ULY A;  2K4J A;  2E7X A;  2IRF G;  2GAU A;  3F6V A;  3L9F A;  3F3X A;  2DAO A;  2MH9 A;  2JPC A;  4JBA A;  3RPU A;  2R7D A;  1S8N A;  3FM3 A;  2EFP A;  2GQQ A;  4RGX A;  4I09 A;  4BYY A;  2M1B A;  4L5I A;  1IXS B;  1XGM A;  1FYK A;  3ML6 A;  1YW7 A;  3I64 A;  4EVI A;  2FSW A;  3C3W A;  1J7K A;  3E6B A;  3FXR A;  5TRD A;  3IWZ A;  1ON2 A;  5J6X A;  5D8L B;  1C0W A;  4IVN A;  3S2W A;  1QBJ A;  2GWR A;  2MBF A;  3BRO A;  2DQL A;  1L3L A;  1IXR C;  1ODD A;  4GYG A;  3I54 A;  3M8F A;  3REO A;  1BBY A;  5BQT A;  5HDK A;  4YG2 F;  5ICE A;  4N9H A;  4WWC A;  2QYO A;  3NQO A;  3VOD A;  1I1S A;  2KKO A;  3CJN A;  2FBK A;  4EM0 B;  4ESB A;  2FBI A;  3PQJ A;  4IRG A;  3F8M A;  2LF7 A;  3GFI A;  5D4R A;  1T98 A;  5DEQ A;  4O6J A;  5HLH A;  1O3Q A;  2XRN A;  3CUQ A;  4CDG A;  3CLO A;  2P6S A;  5JHU A;  2ETH A;  2NNN A;  3F22 A;  1OYI A;  2XIG A;  3W6K B;  1XCV A;  5CVI A;  1TNS A;  4HYE A;  2PBI A;  3R60 A;  2O61 A;  2PMU A;  3BPV A;  1ONV A;  4MGR A;  1SFX A;  4L18 B;  1GHC A;  3ECH A;  1KU2 A;  2Q0O A;  3V8L A;  1O3S A;  5HOO A;  5D6F A;  3J81 Z;  2V79 A;  2ZNZ A;  4R1H A;  1DDN A;  2QM3 A;  1DPU A;  3IRQ A;  2A3S A;  1FP1 D;  3ISP A;  3KP2 A;  4JK1 X;  1R36 A;  2MC3 A;  3E6M A;  2VN2 A;  2VT2 A;  4D0P A;  2EFW A;  3DV8 A;  5IT9 K;  4A0X A;  2XKP A;  2D1V A;  2EV6 A;  4HA8 A;  4M71 A;  4M6Y A;  4HDV A;  5BOX A;  4FX0 A;  1EV7 A;  4HBL A;  5J8C A;  2ZCW A;  2ELH A;  1MZB A;  1R5H A;  4EGZ A;  3RIR A;  4HOB A;  3CUQ C;  2YU3 A;  2DFI A;  2ZFW A;  3K2Z A;  2TDX A;  1HST A;  3M8E A;  3IWF A;  1E2X A;  2LDU A;  2QQA A;  4P55 A;  2GA1 A;  1BJA A;  1OYY A;  5ED4 A;  2LKP A;  2NAZ A;  3MCZ A;  1L0O C;  3SXY A;  1ZAR A;  1S7A A;  3PFI A;  2W84 A;  2HEO A;  1OKR A;  1JXS A;  3G3Z A;  3D5L A;  1FYL A;  3ROU A;  4RS8 A;  1E17 A;  4ENK A;  4OIP F;  3FMR A;  4P9U A;  1KQ8 A;  3GXO A;  2STT A;  2MLK A;  3IKV A;  4XBF A;  1YIO A;  4CZZ A;  2Q8K A;  3COA C;  4G6Q A;  2FBH A;  2K02 A;  2ESN A;  2EV5 A;  1B9M A;  1XSD A;  3TO9 A;  2L4M A;  1FBU A;  4L0Z B;  3F8B A;  4L9T A;  5K5Q A;  2HOE A;  2CQK A;  3WTU C;  2A68 F;  5BPD A;  2HKO A;  4KN7 X;  2PN6 A;  4KT5 C;  2ZJ2 A;  1MGT A;  1KU9 A;  3BOQ A;  3FZV A;  2DW4 A;  4MTE A;  4S04 A;  3U2R A;  2HTJ A;  3WGI A;  5ICG A;  3VEP A;  2JTV A;  5D5V B;  4UVB A;  4ZYG A;  3QU6 A;  1GXQ A;  4U7D A;  3FM5 A;  3WTS C;  2D45 A;  4OU0 A;  3KZY A;  1SD5 A;  1PUE E;  2H6B A;  3NEU A;  3V4G A;  1FSH A;  2KIF A;  3F72 A;  3I53 A;  1FYM A;  3QAH A;  4RAY A;  4RGU A;  1D8J A;  3GO5 A;  2VT3 A;  3RDI A;  3GYH X;  3HOS A;  4LLG F;  4Z2Y A;  2PI0 A;  4ZYD A;  3KP3 A;  1BOA A;  3EET A;  5E1X A;  2IVM A;  4AVP A;  1LVA A;  1QQI A;  4EJV A;  2A5Y B;  5LGU A;  2ZKZ A;  2DO7 A;  1UHW A;  1BC8 C;  2P8T A;  1IRG A;  5FFX A;  4HW0 A;  3N97 A;  1MDM A;  4MNU A;  2XV4 S;  3MEX A;  2CG4 A;  3GFJ A;  3Q5F A;  1QZY A;  3K69 A;  4KUM A;  1P4X A;  1GVJ A;  3P9C A;  2PG4 A;  4LGW A;  1F5T A;  1ZRC A;  1YW9 A;  2LF8 A;  3L00 A;  4HLX A;  1BM9 A;  3EUH A;  3KP7 A;  3QOP A;  2FU4 A;  1F4K A;  4G94 A;  5ICC A;  4M73 A;  1YYV A;  2Y75 A;  3QPH A;  4BHC A;  5FB2 A;  2EK5 A;  2STW A;  2HFH A;  4L9N A;  5E20 A;  5ILV A;  4B09 A;  2LSO A;  1J0R A;  3F21 A;  4FHT A;  4ESJ A;  4G6D A;  1QPM A;  1Z05 A;  1R1U A;  1OMI A;  4WK8 F;  1U6G A;  3LA7 A;  4M72 A;  3K1N A;  2PMH A;  5F6F A;  1DUX C;  3JTG A;  2OQR A;  2RV8 A;  1WWX A;  3LST A;  3SZT A;  4XRF A;  2XUB A;  2EFN A;  2RGV A;  4OMZ A;  4N9I A;  2FF4 A;  4KN4 X;  4RAZ A;  5E1W A;  2PFB A;  5DDG A;  3FMQ A;  1IW7 F;  2DI3 A;  4WXD A;  4E70 A;  3E3V A;  3FHZ A;  4G9Y A;  1BI2 A;  3FX3 A;  1ZRE A;  4A0Z A;  2H94 A;  2D2W A;  2Q2E A;  1KA8 A;  1ZG5 A;  2MA3 A;  2M45 A;  1ON1 A;  3C18 A;  4KYW A;  3D0S A;  4EM2 A;  1ZYR F;  4R79 A;  2F5E A;  2JZY A;  1KYW A;  2EFO A;  2KJC A;  3IHU A;  5D5W B;  3WTT C;  3MWM A;  1VTN C;  2E1N A;  4HX7 A;  4XLP F;  2GZW A;  4U88 A;  3GF2 A;  5LLQ A;  3R0A A;  2WV0 A;  3I59 A;  2VOO A;  3WTY C;  1YW8 A;  5CJ9 A;  3SFZ A;  2FML A;  4XLN F;  2NYX A;  3BJO A;  1IZ1 A;  4NQW A;  1W5T A;  2M30 A;  1BC7 C;  4P5O A;  3QPT A;  3P9K A;  3ABT A;  4ZYE A;  5CVU A;  2ZO4 A;  1S6L A;  3ZP5 A;  4IRI A;  2HTS A;  3C7J A;  1KU7 A;  1LEA A;  5K1Y A;  5H6Q A;  1UST A;  1G3S A;  4TV7 A;  2NNY A;  2GA2 A;  2VC0 A;  2P5K A;  3ELK A;  1UFM A;  3FXU A;  3RJP A;  4EJW A;  4ENJ A;  2VBZ A;  3BY6 A;  1TQM A;  4WX9 A;  5FLX Z;  4KIC A;  3HSF A;  5EEG A;  1B9N A;  3JSP A;  1KGS A;  4HV5 A;  5D6E A;  2MLG A;  2AXL A;  2VE9 A;  1LNW A;  3LA2 A;  4HAM A;  3WGG A;  4MQ9 F;  1I1G A;  2XRO A;  2E1C A;  2DK8 A;  1DPR A;  3L2C A;  1UB9 A;  4FT8 A;  1ZLJ A;  3O3K A;  1D3Y A;  4YFK F;  2IP2 A;  3V8K A;  2OU2 A;  1BI0 A;  2EWN A;  2X4H A;  4U0W A;  4L0Y B;  1YO5 C;  3MZH A;  3GZ6 A;  3ZMD A;  1PDN C;  2O8X A;  1J75 A;  3J7A O;  3IKT A;  1XGO A;  3M7G A;  4ZH4 F;  3SZP A;  1AOY A;  3HHG A;  3I59 B;  1B59 A;  1Z6T A;  3HRS A;  4AWX B;  1K78 A;  1SFU A;  4Q48 A;  4DNC A;  4ZZD A;  2XAF A;  1YLF A;  2RVC A;  2DTR A;  4H0E A;  1HBX G;  3ZN1 A;  5CLS A;  1JE8 A;  5LGT A;  4CXF A;  2CSO A;  2H6C A;  1TTY A;  4MEX F;  1MKM A;  2CGP A;  3B73 A;  3ULQ B;  5LHH A;  1ZHF A;  2OZU A;  3DQV C;  2QQB A;  2RC4 A;  5DCM B;  2QUF A;  2HQR A;  3F23 A;  4YFX F;  1PP7 U;  3KEO A;  3E5X A;  4XSX F;  4L5J A;  1BN5 A;  4G7Z F;  4IRH A;  2HQN A;  3KP6 A;  2COM A;  2HS5 A;  4N0B A;  3CUQ B;  2KIM A;  1XMK A;  2VXZ A;  4I98 B;  2DT5 A;  3T8T A;  1ZH5 A;  2FQ3 A;  3KFW X;  2NS0 A;  1ZGA A;  4PGG A;  2B0L A;  2ISZ A;  2P6T A;  2BBY A;  1B6A A;  1ZN2 A;  3RYR A;  4ENM A;  3Q9S A;  1W7P A;  1YTY A;  5D8K B;  3IC7 A;  2W85 A;  1IN7 A;  2JPB A;  1MDM B;  1WI9 A;  3I58 A;  1S7O A;  1FBS A;  5JFR A;  3JAM K;  2VOD A;  1KU3 A;  2V1D A;  5LRR A;  3RTR A;  3LWF A;  5LEK A;  3HHH A;  5FD5 A;  5FGM A;  3MAJ A;  3TGN A;  1FC3 A;  1D8K A;  4HDU A;  4YII A;  1P92 A;  2D1H A;  3R61 A;  1RUO A;  4ON0 A;  1R00 A;  2A07 F;  1Y0U A;  4I0A A;  4CHU A;  1T39 A;  2WTE A;  1TNT A;  1WKM A;  3OV8 A;  1REP C;  3ZMV A;  2FE3 A;  1FNN A;  1BI1 A;  1YS6 A;  5E8G A;  2WWY A;  1PP8 F;  1HKQ A;  3LAJ A;  1IN4 A;  3MZY A;  2VOP A;  4A6E A;  3WE3 A;  3LAP A;  1KQ0 A;  3DPT A;  4MEY F;  1HKS A;  1NHA A;  2XAH A;  4CIC A;  1D5V A;  4Q5S F;  3N4M A;  4HZF A;  3V8J A;  2ZXJ A;  3T8R A;  1K79 A;  2J5O A;  4HLY A;  3WU1 B;  3ERE D;  4BH9 A;  3AAF A;  5AIQ A;  1SD6 A;  1XSV A;  5D5X B;  2K86 A;  2IPQ X;  3WGH A;  1XGN A;  6PAX A;  3SQN A;  2BYV E;  1O7L A;  3GWZ A;  3ZQ7 A;  1FX7 A;  1UHM A;  5L3G A;  4PZJ A;  3O6B B;  1O3T A;  5HVQ C;  2UZK A;  3TDZ C;  2RQP A;  3C1D A;  1JHF A;  1HXD A;  3KLN A;  4HV6 A;  3P7N A;  2OBP A;  4A5N A;  3DKW A;  1YQA A;  3GUD A;  4ASN A;  2J5P A;  2P5V A;  2ESH A;  3KET A;  2CO5 A;  3ECO A;  1T0F A;  5LBQ A;  1J2X A;  3J81 K;  1S29 A;  3W6J B;  5A2Q K;  1XGS A;  2ADU A;  4RB3 C;  3ZMT A;  3GVA A;  2A6H F;  1LEB A;  2A61 A;  3GZ5 A;  1MJB A;  3RKX A;  4U7B A;  4EJO A;  4RGR A;  2O0Y A;  3GFL A;  1V3F A;  3M9A A;  5L3F A;  3GX4 X;  4I7H A;  4DQ2 A;  1RUN A;  3EQL F;  2YR2 A;  2GXB A;  1SAX A;  1FLI A;  1T2K A;  3KEQ A;  4ETS A;  4U0Y A;  2DBB A;  5DD4 A;  2RDP A;  4Y15 A;  4WXH A;  4BXU A;  3WTV C;  5HS8 A;  1K78 B;  3WE2 A;  4GXO A;  3Q9V A;  3KZZ A;  2LNB A;  5F64 A;  3KP4 A;  3P9I A;  4KMU X;  2FXA A;  2OAZ A;  4KDP A;  1ZGJ A;  1ZG3 A;  3G73 A;  1CF7 B;  1Z1D A;  1RZ4 A;  5A2Q Z;  3JAM Z;  1HW2 A;  5DD8 A;  4IHT A;  3HSR A;  2FNA A;  4IXA A;  4LLN A;  4RGS A;  3JW4 A;  2O03 A;  3CO6 C;  4QWQ A;  1LQ1 A;  1EH6 A;  5HS9 A;  1TQI A;  1QZZ A;  3TO7 A;  5AON A;  3JSO A;  3HUG A;  2OD5 A;  1IN6 A;  5HS7 A;  4BNC A;  3BDD A;  2DPU A;  2K27 A;  3IL2 A;  3DP7 A;  3E5Q A;  2CWE A;  1P4W A;  4NHJ A;  1MJ9 A;  1TLH B;  1H9T A;  2QBY B;  3CDH A;  2IA0 A;  1R23 A;  5FO5 A;  1WQ2 A;  2ZME A;  1QGP A;  3K1M A;  5L3C A;  4CO8 A;  2V9V A;  3E5U A;  1YS7 A;  3DF8 A;  4XSZ F;  1FZP B;  3FF5 A;  1LDJ A;  1OPC A;  4HQE A;  3DPL C;  1U5T B;  4I0B A;  3B02 A;  5IT3 A;  4OIR F;  3BP8 A; 
#chains in the Genus database with same CATH topology
 4LB5 A;  3F8F A;  5H2F C;  3H9Q A;  4B3A A;  2RNJ A;  2L02 A;  2A6E F;  2DPD A;  1F1Z A;  2EIJ H;  2JUG A;  3I4P A;  3PNV A;  3WU0 A;  1CQT A;  2DU9 A;  2F4O B;  1U5T A;  2IAI A;  2E2H J;  2PMZ N;  1D0X A;  1XTA A;  4LG3 A;  3SJM A;  2R7X A;  5J1U A;  5KAI C;  4J19 A;  2DOE A;  4F52 A;  2JSC A;  1AU7 A;  5L3E A;  1YFH A;  3LFK A;  5DCM A;  1ACI A;  4JQF A;  1IN8 A;  4KFC A;  2WAQ A;  2VBW A;  1KQ9 A;  1VF9 A;  4AVZ A;  5E8I A;  2F5C A;  3JRF A;  2M0M A;  2L01 A;  2WB1 A;  3S2D J;  4NQW B;  4HNV A;  2UUZ A;  1FEX A;  3UR3 C;  4CYC A;  4GO1 A;  4BQA A;  3K4C A;  2HOS A;  3S17 J;  3HYI A;  3Q0W A;  5LRS A;  4EEF G;  1RPW A;  3QU3 A;  1N78 A;  1IXC A;  3QPL A;  2WC2 A;  4FET A;  4LK1 F;  3WOD F;  4BXF A;  1TQP A;  1NG7 A;  2ZSI B;  4RB1 A;  4E4H A;  3TOB A;  5IYC J;  2Y9Z A;  3OL4 A;  1W36 D;  2LRE A;  3I0T A;  4G7O F;  1B4A A;  2LK2 A;  4GDF A;  3TP3 A;  1W4M A;  2PLY A;  2H27 A;  4UV9 A;  1U3E M;  2BEO A;  1UG2 A;  2LG4 A;  5GPA A;  3VYU B;  2I10 A;  1Z21 A;  4ZTJ A;  4IOA F;  3GZN B;  4YEJ A;  4EM1 A;  4MTD A;  3UKG A;  2HGC A;  3E7L A;  1QA6 A;  3GEZ A;  1Z6R A;  3GW2 A;  4M9Z A;  5KAF C;  2LYC A;  4HF0 A;  2DYR H;  2DK5 A;  1LVK A;  2NS7 A;  3OSG A;  1USS A;  2DQR A;  4L9J A;  3WG7 H;  1JJ8 C;  2HYF A;  1IRZ A;  2M8G X;  1SFE A;  2UWM A;  3FXM A;  1B1B A;  3U9G A;  2EBI A;  4LFU A;  1S9H A;  1XDS A;  4PDK A;  4ESF A;  3DLL F;  4HQM A;  3KCC A;  3J80 K;  2VKD A;  4Q47 A;  3MVP A;  3DXJ F;  2AHQ A;  2W4S A;  5KVR A;  2GXG A;  3CES A;  2Y0M A;  1K6O A;  2H8W A;  2DJI A;  4IEJ A;  2K3F A;  1PUF B;  3GFM A;  2ZME B;  3F8N A;  3PUF A;  4Y3O A;  4IQ4 A;  4X6A J;  3LMM A;  3QOE A;  4G7H F;  2R5Z A;  4I6Z A;  1XD7 A;  4BUP A;  4YIF A;  1TP4 A;  1IJW C;  2IA2 A;  4BAY A;  4Y13 A;  1RNL A;  1HC8 A;  5FD6 A;  3HRT A;  4NC6 A;  2BXY A;  4CCO A;  2EV0 A;  1E3P A;  5FJ8 J;  3HIF A;  4A3F J;  1PUF A;  3EYI A;  2Y48 A;  3HGG A;  3KE2 A;  1HKT A;  3V7C A;  2MH2 A;  1TWF J;  4ENN A;  2V1U A;  4EV0 A;  4MFE A;  3DU5 A;  2VJI A;  4M9X A;  4ANJ A;  1I5Z A;  3AL0 C;  2R5Z B;  1A6Q A;  4G6T B;  3SHF A;  3TO6 A;  5IOZ A;  5BPI A;  2FMY A;  3K9T A;  3FXK A;  4OWR B;  2VC1 A;  4JOM A;  1TWH J;  4XMY A;  1R7J A;  2OC6 A;  2QWW A;  5CQG A;  3IRR A;  1BIB A;  2V1N A;  1FPQ A;  1Q1H A;  4BS9 A;  5J1Y A;  4A2U A;  1FOY A;  2M7B A;  3A03 A;  3TL4 X;  1JI8 A;  2CUF A;  1NG6 A;  3NWS A;  3K4N A;  4XNF A;  5F27 A;  3K4J A;  3M1C A;  1WRJ A;  4W97 A;  1XN7 A;  3ABU A;  5LHI A;  4BE1 A;  3ZPL A;  2Z9O A;  4HX4 A;  2V1X A;  3R6S A;  1J5Y A;  1AWC A;  4AIH A;  5CVV A;  5DUK A;  1GV5 A;  2R0Q C;  1ZG1 A;  4A3L J;  1R1T A;  1J9I A;  1ETY A;  1SEU A;  4Y17 A;  1R58 A;  5HLG A;  2YPR A;  2CW0 F;  2QQ9 A;  3S32 A;  2X48 A;  2ACJ A;  1GXP A;  2VBY A;  2X0L A;  4F3Q A;  4UVC A;  1STZ A;  3HOY J;  5J8F A;  5HDN A;  4LMY A;  5B5E C;  4LG0 B;  4X0G A;  2XAG A;  3DTI A;  4M3F A;  5ILS A;  3H5A A;  1HDD C;  2O5R A;  2HR3 A;  2OCC H;  1X19 A;  3HOT A;  1DU6 A;  3BWG A;  1IN5 A;  2XPU A;  3RYP A;  1ZKG A;  1OQY A;  3BCB A;  4GYI A;  4KIF A;  2DYS H;  5DYM A;  2LC2 A;  4K2E A;  2G7U A;  3DEW A;  1MMG A;  5LHG A;  3E1S A;  2IBD A;  3F0C A;  2VUM J;  2G9W A;  2ZFU A;  2IGM A;  3FIS A;  2WAE A;  1I6X A;  3T5X A;  3OYM A;  4CGZ A;  1ETW A;  1J59 A;  5DCF A;  1X3U A;  3JRA A;  5EJC A;  4M9S A;  2H09 A;  4EQQ A;  2LY1 A;  2LFB A;  2Z99 A;  4RB0 A;  2XC7 A;  1HDP A;  1S3J A;  4QSH A;  4UVA A;  3I71 A;  2NVQ J;  2X1C A;  3VSK A;  1I39 A;  3PQK A;  5B1B H;  3AL0 B;  3G4S I;  5L3B A;  2XVC A;  1T38 A;  1SD7 A;  2XAJ A;  2OQG A;  3OOP A;  4XOP A;  4IZZ A;  3BG9 A;  3TKY A;  3D5R C;  3R0J A;  2A69 F;  1P7J A;  2ZJP F;  1UJ8 A;  1MBK A;  2L7F P;  3VFZ A;  4B8X A;  2QEX I;  3HPH A;  5EEH A;  1VQP I;  4A3G J;  5FRO A;  1Y1W J;  1LFU P;  1POG A;  1Z3X A;  2BY2 A;  2CYY A;  4DYR A;  2CUZ A;  1I27 A;  1SD4 A;  2ZBK A;  1TZL A;  3U1D A;  4BE0 A;  1IUY A;  2W25 A;  2LLK A;  4D7N A;  3LSK A;  4WCG A;  1QZE A;  2CMP A;  2HZD A;  2EJR A;  1MH4 A;  2VE8 A;  2XB0 X;  3Q3S A;  1MH3 A;  2YX4 A;  2F5F A;  4EMS A;  3HTU A;  4IF4 A;  1Q1V A;  2QQ8 A;  1FOK A;  2L2O A;  1YG2 A;  2OJE D;  2XAS A;  1X1B A;  4BQQ A;  2HKX A;  1HQC A;  2O3F A;  4FTH A;  1G3Y A;  4XRS G;  2ZNY A;  3CO7 C;  4ZYH A;  5HLI A;  5DV5 A;  2ZXH A;  1FSE A;  2WY7 Q;  2KRF A;  5EDN A;  1WJB A;  5E18 F;  4ZJZ A;  1R49 A;  3CCS I;  1FBQ A;  4A12 A;  5JI6 A;  3E6C C;  2KL4 A;  3DU6 A;  3BPX A;  2W00 A;  2L7M P;  3ZQF A;  1W7P D;  1QHG A;  2MC4 A;  1VZ0 A;  1FP2 A;  2QVO A;  1WSU A;  2FA5 A;  1R6R A;  3K2A A;  5FLM J;  1GLN A;  3B6C A;  2KPM A;  2BY3 A;  1Z67 A;  1RES A;  2HDD A;  2MFZ A;  3GME A;  2K7L A;  4B48 A;  3L2V A;  3CP8 A;  4I01 A;  3FXQ A;  1XSX A;  1Z7U A;  1U8R A;  1CGP A;  1ZRF A;  1MD0 A;  3I9V 2;  4ZDL A;  5DTD A;  2Y9Y A;  3EDP A;  4IO9 F;  2CV1 A;  2HI3 A;  2X1E A;  2EQR A;  1LFP A;  4GCV A;  1MBF A;  3M1E A;  2M5W A;  1LPQ A;  2VON A;  2JT1 A;  2QSG X;  5FFZ A;  2EZK A;  2O6G E;  5LEJ A;  1ZAO A;  3H92 A;  3TDU C;  4OMY A;  4KNY A;  2E1M C;  1P7I A;  4I2O A;  4IPA A;  3FDY A;  2HYG D;  4RM2 A;  2JJ7 A;  2VXD A;  5B3S H;  4L9V A;  3OYF A;  1Z9C A;  3E6D A;  3BZK A;  4RA2 A;  1ZRD A;  4MQV A;  4ITV A;  2IS4 A;  3WTZ A;  3CCV I;  3HTS B;  4LG0 A;  4F55 A;  5L3D A;  4AD9 A;  4CCN A;  2AQF A;  3CTA A;  4C3J J;  2IA1 A;  1ETK A;  3LQQ A;  1LDD A;  5EYR A;  2MD5 A;  1KYZ A;  2K4B A;  1WCM J;  3H0D A;  2HPI A;  3T1B A;  3ERM A;  2DFH A;  2QZ8 A;  3ZGK A;  3S15 J;  3IH3 A;  2G7H A;  1R1V A;  3EUK L;  5JR3 A;  1XPX A;  4F7Z A;  1XG1 A;  5E1Z B;  1BA5 A;  5EG0 A;  2ME0 A;  4FIS A;  3HG9 A;  3V7S A;  3AG4 H;  1IG7 A;  2Y69 H;  1EH7 A;  5FLX K;  2FNP A;  3JRC A;  2W24 A;  2FEZ A;  3I5U A;  5F04 A;  4HSR A;  1WJD A;  2IJL A;  5F1R A;  5DUI A;  1QNT A;  3K4L A;  3CF2 A;  1T95 A;  2K9L A;  5LFA A;  3RI4 A;  4NNJ A;  4P9F A;  2VJ4 A;  4CYD A;  1U2W A;  3OS1 A;  1N75 A;  2JWT A;  2QLZ A;  2VQG A;  3H3U A;  4CCJ A;  4BBR J;  5JVT A;  2EFQ A;  4F93 B;  5LGN A;  5HNF A;  3O2P E;  1G4D A;  4O5V A;  4PK4 A;  4YFN F;  1QVU A;  1KON A;  5CYV A;  3HEF A;  4KJZ A;  2EB7 A;  4BQO A;  1YIJ I;  1W5S A;  3KP5 A;  1OYW A;  2BHZ A;  2XAQ A;  5FKM A;  4Y52 J;  1TW3 A;  3ABL H;  3DTK A;  4UUV A;  3F6O A;  1X4O A;  3M3Y J;  1YX5 A;  4IHW A;  1ETQ A;  1HW1 A;  1UG0 A;  2K40 A;  4HF1 A;  4KIS A;  3DPU A;  1A6I A;  2V6C A;  4OOI A;  1HSJ A;  4IX7 A;  4N4O B;  3LA3 A;  2KIU A;  1ORK A;  2P4W A;  2Z2S B;  3CMA I;  2UV1 A;  1ETV A;  3CUO A;  4BHB A;  5GAE J;  2BE5 F;  1Z91 A;  3H36 A;  4LOC A;  1YJW I;  5IP9 J;  3OYD A;  2DA7 A;  1MSF C;  1XB4 A;  3QP5 A;  2P7V B;  5FKN A;  3L09 A;  2AS5 F;  1X3W B;  3QP6 A;  3BG6 A;  1A04 A;  3KLO A;  1FT9 A;  3V42 A;  3D1N I;  2JRT A;  5EEA A;  4D1Q A;  2P5L C;  5EGO A;  2DA3 A;  1XCB A;  3S14 J;  2M8E A;  4AIK A;  1UCR A;  2DCE A;  3W2W A;  2OA4 A;  3ZMS A;  2Y0S N;  4LK0 F;  1G2H A;  1I3Q J;  2L9R A;  5CVR A;  4IKF A;  3MFK A;  1OR7 A;  2ZC2 A;  2ZJQ F;  4KIB A;  1JHH A;  2HQ5 A;  1WI3 A;  4RAG A;  3QYF A;  4KA4 A;  3GTM J;  2QF7 A;  2KRC A;  3U21 A;  2Z5U A;  2GBY A;  4UHT A;  1TBX A;  3FKI J;  5FKO A;  1APL C;  3T0Y A;  3N05 A;  4OIQ F;  3KYD B;  1FY7 A;  4UXN A;  2C6Y A;  2LKX A;  4LB6 B;  3WTX C;  1G6N A;  4EJU A;  1F9N A;  3K4K A;  3AG3 H;  3K70 C;  1U8B A;  2OTJ I;  5ERI A;  3OYI A;  1JUM A;  1MW7 A;  4AIJ A;  1IRF A;  3HOV J;  3QWL A;  2E1O A;  3DFG A;  1A36 A;  2F48 A;  1O57 A;  3OYL A;  3H3V K;  3BZC A;  4V2G A;  3ZQQ A;  5BMZ A;  3OWT A;  1A35 A;  2HDC A;  3J7Y J;  2E7W A;  4YIR X;  1SAU A;  1BI3 A;  3PO3 J;  4EJT A;  2L3D A;  5IT9 Z;  1EH8 A;  2R7Z J;  2GIV A;  2CUJ A;  4Y4R A;  4QLC U;  1FOX A;  2DOD A;  2M3A A;  3IUO A;  4BHP A;  4M3B A;  5ILU A;  3WHC A;  2P7C B;  4M6X A;  1U78 A;  2EPF A;  1LB2 A;  5C3E J;  1MJA A;  4CCL A;  3LQR A;  2L4A A;  1T6S A;  2VQL A;  3RKW A;  4WXC A;  1R5G A;  3B6A A;  3QRF F;  2UXN A;  2XGE A;  2BV6 A;  1OCO H;  4D5F A;  3BJ6 A;  3ASO H;  2VIX A;  3K0L A;  4RB2 C;  3IAM 2;  4IJA A;  5M3F J;  3PIO F;  2R3S A;  3TOA A;  2R7F A;  3TQN A;  2R7S A;  2CFX A;  4O3M A;  4B47 A;  4XID A;  2RKH A;  1G59 A;  1RI7 A;  2DT7 B;  5EG0 B;  3OYH A;  3ZRG A;  4D9J A;  2FOK A;  3FWE A;  1VQK I;  3HC7 A;  2BW3 A;  3MMY B;  4UB8 C;  2E35 A;  4B44 A;  2PJP A;  2IW5 A;  1GVD A;  3WU2 C;  2DOF A;  3S3N A;  1G3T A;  2IT0 A;  5IP6 A;  2DLL A;  4UV8 A;  1R4N B;  2ZB9 A;  4HF2 A;  4A5M A;  3R4K A;  3G1L A;  4S05 A;  5C4X J;  3HRU A;  3K1P A;  3E97 A;  4M74 A;  4R8H A;  3ZMZ A;  3BZ6 A;  3ZN0 A;  1W5C C;  3V7R A;  1D1B A;  2G0E A;  3K70 D;  5HDG A;  1IAW A;  4AID A;  2MGQ A;  3DBR B;  1X58 A;  2Y0S A;  2EIL H;  5K7F A;  2NXN B;  3LSP A;  1W7P B;  2KJB A;  1V5G A;  3LNQ A;  3RZO J;  3MKZ A;  2BGC A;  2NOG A;  3MD2 A;  2YSR A;  4LD5 A;  2BY0 A;  2O7O A;  2XKO A;  3OL3 A;  4AYB N;  1P4A A;  1SVL A;  2DOA A;  3VOE A;  4UNO A;  3HSE A;  2L54 A;  1IF1 A;  4KT6 A;  1U5T C;  1O3R A;  2EZL A;  1O7F A;  4FX4 A;  2FQ4 A;  2XHK A;  4XLA A;  3WTW C;  1P2F A;  4U0V A;  3RPU D;  2EH3 A;  4PCQ A;  4DBQ A;  4KIG A;  1H0M A;  2PEX A;  3H35 A;  2V6E A;  2W7N A;  1HW5 A;  4OIO F;  2KIQ A;  4IHS A;  1JGS A;  3HB9 A;  1VQM I;  3J80 Z;  2QEN A;  1WJF A;  3MQ0 A;  1T0F C;  1MBJ A;  3U1K A;  2W57 A;  4P96 A;  2L7Z A;  4ZZL A;  5K5R A;  3MZ8 A;  2W82 A;  5J47 A;  1QO0 D;  2HVQ A;  4KMF A;  1K7A A;  1QRY A;  2OZ6 A;  3FMS A;  5BS6 A;  2PQ8 A;  3KEY A;  4MHG A;  2QKM B;  1P9Q C;  1YRN A;  2M87 A;  3BG3 A;  1R22 A;  3EYY A;  1R5I D;  2F5D A;  5E3M A;  1ZTR A;  4LLL A;  1IV6 A;  2L5Q A;  1UEL B;  3L2Q A;  1ZLK A;  2OTL I;  1FWZ A;  2QA4 I;  5K5O A;  2NS8 A;  1V4R A;  3ZQC A;  2YS9 A;  4NB5 A;  4GGG A;  1CF7 A;  1SMY F;  1VQ6 I;  2TCT A;  1P6R A;  4AYB A;  4A6D A;  3HOZ J;  3RKY A;  2EA2 A;  5FKK A;  1SMT A;  2UXX A;  3NRV A;  3AG2 H;  3C2G A;  2KRH A;  3CP2 A;  5KK1 A;  2CV2 A;  2AQE A;  2NRA C;  2K9Q A;  3H0G J;  3BJA A;  2CV0 A;  4UY8 I;  5IYB J;  3HKZ N;  2ZJR F;  3SDB A;  4CYC B;  1LDK B;  3GLX A;  4MLO A;  5ICF A;  2M9H A;  3WG9 A;  4CCK A;  5FRM A;  2F2E A;  3L2R A;  1G3W A;  1IUF A;  1YX3 A;  1S5L C;  4FE7 A;  1Z77 A;  5D5U B;  3L7W A;  2RN7 A;  4ZDO A;  2X6W A;  1B72 A;  2LH9 A;  1H9G A;  5TJJ A;  4WF2 A;  4LJZ F;  3HRM A;  1GDT A;  2HWV A;  3RPQ A;  1JT6 A;  3F8C A;  1XDU A;  2R7U A;  4I02 A;  5AIP A;  5H6R A;  2YX7 A;  4HX8 A;  4AU7 A;  4EGY A;  2NVT J;  4Q4Z F;  2JVG A;  5C44 J;  3QPS A;  3JRB A;  2WV1 A;  4UUS B;  2VBX A;  3ZMU A;  2Z33 A;  4XLE A;  5E17 F;  4G8X A;  4OIN F;  3G6E I;  5H20 A;  4PGH A;  3ASN H;  2QBY A;  4RLQ A;  3JTH A;  5F0C A;  4HEA 2;  1XMA A;  1DGW Y;  3FXO A;  3O8G A;  3IH2 A;  1DP7 P;  5CVJ A;  4YEL A;  1BIA A;  2PJR B;  1LJ9 A;  2XRL A;  2FRH A;  1TW2 A;  3TED A;  3KYC B;  3VB2 A;  2ISY A;  2Z3Y A;  5EF6 A;  2ELK A;  1RIO H;  3OR2 C;  5JHF A;  4DBR A;  5E3N A;  2HZT A;  3K4M A;  4IHV A;  2DT6 A;  4V19 K;  2XGX A;  3GBG A;  3CQZ J;  3H3Z A;  5D4S A;  3ZXS A;  2Z16 A;  3CMM A;  5B66 C;  2EA4 A;  3DEU A;  4A0Y A;  1ULY A;  2K4J A;  3VWB A;  2E7X A;  2IRF G;  2JA8 J;  2GAU A;  2XF6 A;  3F6V A;  3L9F A;  2R5Y A;  4A3I J;  1RR8 C;  4FCY A;  3F3X A;  1UMQ A;  3S8P A;  2LY2 A;  2DAO A;  4E7J A;  2MH9 A;  2JPC A;  4JBA A;  3RPU A;  3HM5 A;  3ZQI A;  1SAN A;  2R7D A;  1S8N A;  3JCU C;  4XLC A;  1H89 C;  2IXS A;  1ZR2 A;  3BTC A;  1V55 H;  2L9S A;  1MIJ A;  1X2M A;  3CLQ A;  1JGG A;  3JRD A;  2HYJ A;  3FM3 A;  4PJ0 C;  4RAF A;  3KX2 A;  2EFP A;  2WA0 A;  5GTH C;  2GQQ A;  2HU9 A;  4RGX A;  3EUA A;  2GOX B;  4I09 A;  4BYY A;  2M1B A;  4L5I A;  3VYR B;  3PIP F;  2LVS A;  5GAG J;  1IXS B;  1XGM A;  1FYK A;  2BOL A;  1MND A;  2JA7 J;  4II3 A;  2K9S A;  3ML6 A;  2I8D A;  5EGO B;  1YW7 A;  2XF5 A;  3I64 A;  4XKB A;  4EVI A;  2FSW A;  3C3W A;  2JVH A;  3C2B A;  1J7K A;  3H5R A;  2XGC A;  5IP7 J;  1MMS A;  3E6B A;  4D7M A;  3FXR A;  2ID6 A;  3KZI C;  4QPO A;  5TRD A;  3IWZ A;  4JYK A;  1IRX A;  1ON2 A;  5J6X A;  5D8L B;  1C0W A;  4IVN A;  3G2B A;  3S2W A;  1QBJ A;  3BTL A;  4ZDP A;  2GWR A;  3S3O A;  4B43 A;  3HGY A;  2FD5 A;  2MBF A;  3BRO A;  2DQL A;  5J4Y A;  1IXR C;  1L3L A;  1FTT A;  1ODD A;  3CCU I;  2YU9 J;  4GYG A;  1B72 B;  2LD5 A;  3I54 A;  3LSI A;  3M8F A;  3PNY A;  5F08 A;  4KIT B;  1JTX A;  2CQ7 A;  3REO A;  1BBY A;  3S1R J;  5BQT A;  3G1M A;  5F0H A;  5HDK A;  4A3B J;  3W6V A;  4YG2 F;  1WJE A;  5ICE A;  4N9H A;  3VPR A;  4WWC A;  2F4I A;  2QYO A;  1XX5 A;  3NQO A;  3VOD A;  3K10 A;  3TW6 A;  4J00 A;  1I1S A;  3FHN A;  4IHY A;  2BXZ A;  2KKO A;  2RQQ A;  3CZ6 A;  3CJN A;  4UUS A;  2FBK A;  4EM0 B;  4ESB A;  1BJZ A;  5BNG A;  2FBI A;  3PQJ A;  1ENH A;  4IRG A;  3F8M A;  2LF7 A;  2Y2Z A;  3HJE A;  2BHY A;  3GFI A;  3S2H J;  5D4R A;  1T98 A;  5DEQ A;  4Z6Y A;  2EIK H;  4J01 A;  4O6J A;  5HLH A;  1O3Q A;  2XRN A;  3GCM A;  3QYE A;  3CUQ A;  4CDG A;  1H8A C;  3CLO A;  2P6S A;  5JHU A;  2ETH A;  3AG1 H;  5HNH A;  2W1O A;  2NNN A;  3H5N A;  3SDG A;  3TMO A;  1ZR4 A;  1XS9 A;  3F22 A;  3SFI A;  1OYI A;  1GUU A;  2XIG A;  3W6K B;  1XCV A;  3OYC A;  1WZ2 A;  1F43 A;  5CVI A;  1TNS A;  4HYE A;  9ANT A;  2PBI A;  3R60 A;  2E34 A;  3HXL A;  3P5J A;  2PMU A;  2O61 A;  3BPV A;  1ONV A;  3IH4 A;  4BEH B;  4MGR A;  1SFX A;  4CCM A;  1QPI A;  2ECC A;  4L18 B;  3SEZ A;  1EF4 A;  3PSI A;  3NWT A;  1GHC A;  3ECH A;  1KU2 A;  3ZQG A;  5GAD J;  2Q0O A;  3V8L A;  1O3S A;  5HOO A;  4E7Z A;  3H9J A;  5D6F A;  5FLV A;  2LTP A;  2E71 A;  4IOC F;  2GXA A;  2KZV A;  2VJ5 A;  4Y33 A;  3J81 Z;  2V79 A;  2ZNZ A;  4R1H A;  3PNT A;  1DDN A;  2QM3 A;  2V9P A;  1R9T J;  4OAZ A;  1DPU A;  2IEK A;  3IRQ A;  3VSL A;  2A3S A;  1FP1 D;  3ISP A;  3LSJ A;  2N8G A;  3KP2 A;  4JK1 X;  2HXI A;  3G71 I;  1R36 A;  4CA0 A;  3LL7 A;  2MC3 A;  2FUG 2;  3E6M A;  2VN2 A;  2VT2 A;  4LIU A;  4H4K C;  3D5S C;  4D0P A;  3OIO A;  3I56 I;  4UUT A;  3GTK J;  2EFW A;  3DV8 A;  2A5W A;  4IQJ A;  1ERD A;  4DYC A;  5C4J J;  1JKP C;  2JQ7 A;  5IT9 K;  4BBS J;  3CJQ B;  4A0X A;  2XKP A;  3MKY B;  1FIP A;  2D1V A;  1HCR A;  4LIV A;  2EV6 A;  4HA8 A;  3BG7 A;  4M71 A;  4M6Y A;  4HDV A;  5BOX A;  4FX0 A;  1EV7 A;  1B8I A;  4XON A;  5KNL A;  2VKV A;  4HBL A;  3DBH B;  1TL8 A;  5JLW A;  1JJ6 C;  5J8C A;  2ZCW A;  2ELH A;  1MZB A;  1R5H A;  2IGO A;  2K9M A;  4EGZ A;  3RIR A;  4HOB A;  3CUQ C;  2YU3 A;  2DFI A;  4ABZ A;  2DMQ A;  4HPQ A;  4DIQ A;  1JTY A;  2ZFW A;  3K2Z A;  2TDX A;  1HST A;  2DMP A;  5F1J A;  1T56 A;  3M8E A;  3IWF A;  4F92 B;  3DTE A;  2KQR A;  1FMW A;  1E2X A;  2LDU A;  2QQA A;  4P55 A;  2GA1 A;  5HLT A;  1BJA A;  1OYY A;  5ED4 A;  2LKP A;  2NAZ A;  3MCZ A;  4NBQ A;  1L0O C;  3SXY A;  1ZAR A;  1S7A A;  3PFI A;  4HNU A;  1K4S A;  1SC7 A;  2JN6 A;  2W84 A;  5IOY A;  2HEO A;  1OKR A;  1EJ9 A;  1UZC A;  5GPC A;  1JXS A;  4C9Y A;  3GLL A;  3G3Z A;  4RBO A;  1OCR H;  3D5L A;  1AKH A;  4PJM A;  1FYL A;  3ROU A;  4RS8 A;  1E17 A;  1E3H A;  4ENK A;  1I6H J;  1WH5 A;  4XKW A;  4OIP F;  3FMR A;  2R7Q A;  2L0K A;  4P9U A;  1KQ8 A;  3GXO A;  2STT A;  1LUJ B;  2MLK A;  1V5E A;  3IKV A;  3QYB A;  4XBF A;  1YIO A;  3BTI A;  3LSG A;  4CZZ A;  1FTZ A;  3O8H A;  1WGX A;  2Q8K A;  2VPL A;  1ZQ3 P;  1A5J A;  3COA C;  2LMD A;  3H9G A;  1BR2 A;  1OFC X;  4PJJ A;  4G6Q A;  2FBH A;  2BY1 A;  3DEE A;  3HOW J;  2K02 A;  3DLA A;  4XR6 A;  2ESN A;  2EV5 A;  1B9M A;  2TRT A;  2DFF A;  1T33 A;  2ZME C;  1ITY A;  3L1P A;  4BQN A;  1XSD A;  3TO9 A;  2A05 A;  1RET A;  1U0J A;  2L4M A;  1FBU A;  4E7S A;  1LFB A;  4A93 J;  3UNG C;  4CZC A;  4L0Z B;  3F8B A;  1OCC H;  4L9T A;  2K5C A;  1RKW A;  1VI0 A;  5K5Q A;  2HOE A;  2CQK A;  2BZT A;  1S72 I;  2QCO A;  3WTU C;  2R5Y B;  3ESW B;  2EIN H;  2A68 F;  5IY5 H;  5BPD A;  2DXI A;  2HKO A;  2XF7 A;  2XDV A;  4KN7 X;  2KHM A;  2PN6 A;  2M4G A;  2V9K A;  2ZJ2 A;  1MGT A;  4KT5 C;  3OS2 A;  1KU9 A;  4GFB A;  3BOQ A;  3FZV A;  1DQU A;  2DW4 A;  3S1M J;  2DFE A;  4MTE A;  5KCM A;  4S04 A;  3U2R A;  2HTJ A;  3TP0 A;  3PUB A;  2E5N A;  3WGI A;  1X4P A;  3VEP A;  5ICG A;  3KPH A;  3DCF A;  4E6K G;  2JTV A;  2X6Y A;  5D5V B;  1VQ8 I;  4C2U A;  4UVB A;  2R93 J;  4ZYG A;  3QU6 A;  2X9D A;  3BLY A;  3OYA A;  2VLA A;  1HLV A;  1GXQ A;  4U7D A;  3FM5 A;  3A0B C;  3SEQ A;  3WTS C;  2D45 A;  2COB A;  1MSE C;  1Y6I A;  4OU0 A;  3KZY A;  3EPZ A;  3LSM A;  1SD5 A;  2GIZ A;  1PUE E;  2H6B A;  3A1Y A;  3NEU A;  3W3C A;  1VQL I;  3V4G A;  1YJN I;  3S3M A;  1FSH A;  2KIF A;  3ZQL A;  4UB6 C;  3GTQ J;  3F72 A;  2Z1D A;  3I53 A;  3OIP A;  3M4O J;  1FYM A;  1WFX A;  4ZTF A;  3QAH A;  1QVT A;  4RAY A;  4RGU A;  4N4N B;  5J1R A;  5IPA A;  3C2H A;  1D8J A;  3GO5 A;  4PJN A;  2VT3 A;  5E3O A;  2ME6 A;  3RDI A;  3GYH X;  4BY1 J;  3HOS A;  2IS6 A;  4LLG F;  4Z2Y A;  2PI0 A;  4RMN A;  5B1A H;  2LKS A;  4ZYD A;  3KP3 A;  2D5V A;  3OYG A;  2FJ1 A;  1A31 A;  1BOA A;  3EET A;  5E1X A;  4B4C A;  2IVM A;  4AVP A;  1LVA A;  4IL6 C;  1O4X A;  2OUM A;  4JX6 A;  3QOD A;  1AKH B;  1QQI A;  2F6C A;  4C2M J;  3HUG B;  1U9N A;  4E7L A;  4EJV A;  2M7A A;  4XRM A;  2A5Y B;  5LGU A;  2ZKZ A;  1D1A A;  2DO7 A;  1UHW A;  1BC8 C;  1Y1V J;  1XC5 A;  2P8T A;  1JUP A;  2WBM A;  1Y39 A;  1IRG A;  4HW0 A;  5FFX A;  3MKL A;  3N97 A;  2HPM A;  3SZG A;  1MDM A;  4MNU A;  2H8R A;  2XV4 S;  2Y31 A;  1MNE A;  2MSY A;  1YIT I;  3MEX A;  2MYS A;  2CG4 A;  1SVM A;  3GFJ A;  3Q5F A;  1QZY A;  1IV8 A;  3K69 A;  4KUM A;  2QKL B;  2WB1 N;  1I50 J;  1P4X A;  3S1N J;  4HG2 A;  2WAQ N;  3FIW A;  2ID3 A;  1GVJ A;  4BDZ A;  3P9C A;  2PG4 A;  4E7K A;  4LGW A;  1F5T A;  3KIO A;  1ZRC A;  1VQ7 I;  1X3Z B;  2X6O A;  4PUS A;  4AC0 A;  1YW9 A;  3QQA A;  4HNT A;  2LF8 A;  4EAT A;  4A3D J;  2BVM A;  3L00 A;  1KZH A;  4HLX A;  1BM9 A;  3EUH A;  1VQO I;  3KP7 A;  1VQ5 I;  3QOP A;  4C30 A;  2FU4 A;  2HQA A;  1F4K A;  1DU0 A;  3CJT B;  4G94 A;  3CF5 F;  5ICC A;  4M73 A;  1YYV A;  1T8I A;  2Y75 A;  4ZC3 A;  3QPH A;  3CC7 I;  4BHC A;  5FB2 A;  2LY9 A;  3DBL B;  2QSF X;  2EK5 A;  3A01 B;  2CW7 A;  1NK3 P;  2STW A;  2VAS A;  2DA2 A;  3HOU J;  2M34 A;  3PO2 J;  2HFH A;  4L9N A;  5GAH J;  5E20 A;  1YRN B;  5ILV A;  2HDW A;  3VYT B;  4B09 A;  4C3I J;  2LSO A;  1FOW A;  1J0R A;  3F21 A;  3OOU A;  4FHT A;  4ESJ A;  1W1W E;  4G6D A;  1QPM A;  1Z05 A;  1R1U A;  1PJR A;  1OMI A;  4WK8 F;  1U6G A;  3LA7 A;  4HRI A;  4M72 A;  3K1N A;  4M3E A;  2PMH A;  5E3L A;  1UAA A;  5F6F A;  3HZJ A;  1DUX C;  3TW7 A;  3JTG A;  2OQR A;  2RV8 A;  1M1E B;  1WWX A;  2R4G A;  4CUG A;  4BJT A;  2KIS A;  3LST A;  3SZT A;  4XRF A;  2XUB A;  2EFN A;  2RGV A;  1T08 B;  4OMZ A;  4N9I A;  4YRV A;  2M0C A;  3JRI A;  2FF4 A;  3BR2 A;  4KN4 X;  1D5Y A;  1TWG J;  4RAZ A;  3OIQ A;  5E1W A;  5GTI C;  2PFB A;  5DDG A;  3FK7 A;  4XRS A;  3S16 J;  5TIS C;  2JK3 A;  3FMQ A;  3OYK A;  1IW7 F;  2Q2E B;  5J3L A;  2DI3 A;  4MIM A;  4WXD A;  3OS0 A;  4E70 A;  2WY8 Q;  3E3V A;  4XKV A;  3FHZ A;  1TT0 A;  2RAE A;  4G9Y A;  1RRJ A;  1BI2 A;  2OF7 A;  2HOT A;  3FX3 A;  4U87 A;  5FRN A;  2VKE A;  1ZRE A;  3DWL E;  4A0Z A;  4DYQ A;  4CSW A;  4RDU A;  2H94 A;  2D2W A;  2Q2E A;  1KA8 A;  5IYD J;  5J40 A;  1RC9 A;  1ZG5 A;  2LRD A;  2JA6 J;  2DMT A;  2P81 A;  3ABM H;  2MA3 A;  2M45 A;  1ON1 A;  3C18 A;  3VDX A;  4KYW A;  3D0S A;  4EM2 A;  1ZYR F;  1TWC J;  4R79 A;  2F5E A;  2JZY A;  4BGD A;  4XQF A;  1KYW A;  2E5Z A;  3BQZ A;  4HST A;  2EFO A;  3TBI A;  1ETO A;  3CCL I;  4BAC A;  1VQ4 I;  2KJC A;  3H1C A;  3IHU A;  5D5W B;  3WTT C;  3MWM A;  3RSN A;  1VTN C;  2E1N A;  4HX7 A;  4II2 A;  4DGW B;  4XLP F;  2GZW A;  4U88 A;  3GF2 A;  5LLQ A;  3GTG J;  3R0A A;  2WV0 A;  1MBG A;  2DA5 A;  4X1E A;  3MKW B;  1TT5 B;  3I59 A;  4B1R A;  2VOO A;  3CD6 I;  3WTY C;  1YW8 A;  2FX0 A;  5CJ9 A;  3SFZ A;  2FML A;  4XLN F;  1X2N A;  3BG5 A;  2NYX A;  3BJO A;  1IZ1 A;  4NQW A;  1W5T A;  2M30 A;  3BQY A;  4P5O A;  3RKQ A;  4A3E J;  1BC7 C;  3QPT A;  3P9K A;  3ABT A;  4E7I A;  3I55 I;  4ZYE A;  5CVU A;  3CMY A;  4NDL A;  3G1O A;  3GTP J;  4PFO A;  2ZO4 A;  2FOW A;  1S6L A;  5M5X J;  1WJA A;  3ZP5 A;  4XKC A;  1K83 J;  3A4C A;  4IRI A;  2CQN A;  3CCM I;  2HTS A;  3C7J A;  1KU7 A;  1LEA A;  3W2V A;  1X1P A;  1X1D A;  5K1Y A;  5H6Q A;  1UST A;  1G3S A;  4TV7 A;  4XIC A;  3FK6 A;  2DTZ A;  2CW8 A;  2NNY A;  2GA2 A;  2VC0 A;  3I4N J;  2L7K A;  2P5K A;  3ELK A;  1UFM A;  1BW5 A;  3FXU A;  1WVR A;  3E0J B;  3MN2 A;  5CKT A;  2VB6 A;  4XOT A;  4BJ6 C;  1DP3 A;  4XN0 A;  3RJP A;  1NTC A;  4EJW A;  4ENJ A;  1N77 A;  4XN3 A;  1MBE A;  2VBZ A;  2B7E A;  3S93 A;  3BY6 A;  1TQM A;  4A69 C;  4WX9 A;  5FLX Z;  4KIC A;  2W48 A;  3HSF A;  2E1M B;  3LOC A;  5EEG A;  1B9N A;  3JSP A;  2DA6 A;  2XGD A;  2MD0 A;  1KGS A;  4HV5 A;  3CJR B;  4C3H J;  5GP9 A;  4I99 C;  4XK4 A;  5D6E A;  1NK2 P;  2MLG A;  2AXL A;  2VE9 A;  1LNW A;  2ELJ A;  3CCE I;  3LA2 A;  1EKE A;  3OYJ A;  1VND A;  4HAM A;  3WGG A;  4MQ9 F;  1MNM C;  1I1G A;  2XRO A;  2Q1Z B;  3J7A Y;  2LBF B;  5J4V A;  2E1C A;  5DM7 F;  3RQI A;  2OPT A;  2DK8 A;  1DPR A;  2LP0 A;  3L2C A;  1Y0N A;  1UB9 A;  2AXT C;  4FT8 A;  1YHQ I;  4BXX J;  1ZLJ A;  3O3K A;  3BR5 A;  1D3Y A;  3ZQH A;  1N25 A;  4YFK F;  4Y7N J;  4DZJ A;  2IP2 A;  2F5V A;  2K85 A;  5LD2 C;  3V8K A;  2OU2 A;  1BI0 A;  2EWN A;  2X4H A;  3BR1 A;  4U0W A;  3CCY A;  2HVR A;  1WPK A;  4L0Y B;  1YO5 C;  3MZH A;  3A2K A;  3GZ6 A;  1YE9 A;  2X6X A;  2DMN A;  3ZMD A;  2O8X A;  3IV5 A;  1J75 A;  1PDN C;  2HVS A;  3J7A O;  3IKT A;  2EIM H;  1XGO A;  5TGT A;  2R92 J;  2B9S A;  3JR9 A;  3M7G A;  1IDZ A;  4ZH4 F;  4BEH A;  4JX4 A;  2VQC A;  5KHD A;  3FBI B;  1AHD P;  1U9O A;  3OY9 A;  2V26 A;  1OCZ H;  3SZP A;  1AOY A;  3HHG A;  2CQX A;  3DKY A;  4QPQ A;  1HA8 A;  3I59 B;  1B59 A;  1Z6T A;  3FXJ A;  3HRS A;  4AWX B;  3CCQ I;  1K78 A;  1OJL A;  1SFU A;  1JKO C;  4Q48 A;  2ZXW H;  2XB5 A;  3K7A J;  3NAU A;  2R7V A;  3Q0V A;  4DNC A;  3PL8 A;  4ZZD A;  1BR4 A;  2CU7 A;  4JP0 A;  2V4J C;  2KLO A;  2XAF A;  1YLF A;  2RVC A;  2DTR A;  4H0E A;  1HBX G;  4AM3 A;  3PJR A;  1WJ5 A;  3FXL A;  3ZN1 A;  5CLS A;  1V5F A;  4OAY A;  1JE8 A;  1BR1 A;  5LGT A;  4XM3 A;  2BVL A;  4CXF A;  4BY7 J;  2CSO A;  2H6C A;  4AUX A;  1TTY A;  4MEX F;  2IS1 A;  1MKM A;  4A3M J;  2CGP A;  3B73 A;  2DDB A;  3ULQ B;  5LHH A;  1ZHF A;  2AO9 A;  2OZU A;  3HL2 A;  2EZH A;  3L2U A;  2JA2 A;  2QQB A;  2RC4 A;  3DQV C;  5M5Y J;  5DCM B;  5JVG F;  1MMN A;  4W1U A;  4E7H A;  2QUF A;  3CCR I;  3ONQ A;  3ZR8 X;  3K6G A;  1Z7L A;  1IO2 A;  2HQR A;  1IC8 A;  3F23 A;  4YFX F;  2V7F A;  1PP7 U;  3KEO A;  3PM1 A;  3E5X A;  4XSX F;  4L5J A;  1BN5 A;  4G7Z F;  4IRH A;  4V2F A;  2HQN A;  1MBH A;  3CC2 I;  5DM6 F;  3KP6 A;  2COM A;  2VI6 A;  2XSD C;  2ECB A;  1PVE A;  2NVY J;  2HS5 A;  4N0B A;  2CS3 A;  2A6T A;  4A3K J;  1R71 A;  3CUQ B;  2KIM A;  1WJC A;  3BR0 A;  2BW3 B;  4XLH A;  2CJJ A;  1XMK A;  4NC7 A;  2GOM A;  2VXZ A;  5DS9 A;  4I98 B;  2DT5 A;  3HPG A;  3T8T A;  1ZH5 A;  3X2Q H;  2FQ3 A;  3KFW X;  2NVU B;  4C2T A;  2NS0 A;  1ZGA A;  2PMZ A;  2X85 A;  3LFU A;  2B0L A;  4PGG A;  2ISZ A;  3CDL A;  2P6T A;  2BBY A;  1B6A A;  1ZN2 A;  3LSR A;  2R7R A;  2CQQ A;  3RYR A;  5K7Z A;  2IGK A;  1LE8 B;  4ENM A;  1YI2 I;  3Q9S A;  1GV2 A;  2MAB A;  1JKQ C;  2E2J J;  1BOB A;  1VQ9 I;  1W7P A;  4PFP A;  1YTY A;  5M5W J;  5D8K B;  3IC7 A;  2W85 A;  2JMW A;  1IN7 A;  2JPB A;  1MDM B;  1TWA J;  1WI9 A;  4F91 B;  3BR6 A;  3I58 A;  2JA5 J;  1S7O A;  1FBS A;  5JFR A;  3JAM K;  2VOD A;  2XAU A;  5JLX A;  1KU3 A;  2EZI A;  3J7Z I;  2KFD A;  2V1D A;  4M3G A;  5LRR A;  3RTR A;  3LWF A;  1JT0 A;  1OCT C;  3GTO J;  5LEK A;  3HHH A;  5FD5 A;  2I5U A;  5FGM A;  3MAJ A;  3S1Q J;  3TGN A;  3L2W A;  1FC3 A;  1D8K A;  4HDU A;  1BW6 A;  4YII A;  5CQE A;  4DOZ A;  1QU3 A;  1P92 A;  2D1H A;  2DN0 A;  3R61 A;  2R7O A;  1RUO A;  4ON0 A;  2DDA A;  1MMD A;  1R00 A;  1W0T A;  2A07 F;  2KT0 A;  1Y0U A;  3OMY A;  1OIS A;  4I0A A;  4CHU A;  3BCA A;  1T39 A;  1WHU A;  1E3O C;  2WTE A;  1TNT A;  4A3C J;  3CC4 I;  1FJL A;  1SFK A;  1WKM A;  2XPW A;  2MG4 A;  3OV8 A;  2VL8 A;  2P0W A;  1REP C;  3ZMV A;  4BKX A;  4RLF A;  3M8J A;  1J09 A;  2FE3 A;  1FNN A;  1BI1 A;  1YS6 A;  5E8G A;  2WWY A;  1UHS A;  1PP8 F;  2R7T A;  1HKQ A;  3LAJ A;  1IN4 A;  3MZY A;  2GLO A;  2VOP A;  3WE3 A;  4A6E A;  3LAP A;  2XPV A;  1E0E A;  1KQ0 A;  2B63 J;  4JX5 A;  1K6Y A;  3DPT A;  2KDZ A;  2QSH X;  1ETX A;  2CH0 A;  1K61 A;  3I4M J;  3VYS B;  4MEY F;  1HKS A;  1NHA A;  1B8I B;  1ZEL A;  4RM3 A;  1D0Y A;  3JRG A;  3NAR A;  3BTJ A;  3PSF A;  2XAH A;  3RZD J;  1OR7 C;  4CIC A;  1BL0 A;  1D5V A;  4Q5S F;  3N4M A;  3LSH A;  4L5E A;  1X1A A;  4HZF A;  3V8J A;  5EZG A;  4DW6 A;  2ZXJ A;  2IGN A;  4PSW A;  3T8R A;  1K79 A;  2NOJ B;  2J5O A;  4HLY A;  3OYE A;  2OV7 A;  3WU1 B;  2VKH A;  3ERE D;  2YUS A;  4M3D A;  3GTL J;  4BH9 A;  3AAF A;  2M2E A;  5AIQ A;  1SD6 A;  1XSV A;  5D5X B;  2K86 A;  2IPQ X;  3WHB A;  2KP6 A;  3WGH A;  1XGN A;  2JSP A;  3CCJ I;  2NVX J;  6PAX A;  3SQN A;  2BYV E;  1O7L A;  3GWZ A;  3ZQ7 A;  1FX7 A;  1UHM A;  3DKX A;  5L3G A;  4PZJ A;  3IAS 2;  3O6B B;  1O3T A;  3AFH A;  2OCE A;  5HVQ C;  2UZK A;  1SFO J;  4LIT A;  1V54 H;  3TDZ C;  1I3A A;  2PJR A;  4IHX A;  2JRM A;  1LE8 A;  3HKZ A;  2RQP A;  2KMU A;  5EZH A;  3C1D A;  1JHF A;  1LKX A;  3W2A A;  1HOM A;  1JUS A;  4P1W A;  1HXD A;  2LR8 A;  1F36 A;  2RNG A;  2M4K A;  3KLN A;  4HV6 A;  3P7N A;  2OBP A;  2L9N A;  4A5N A;  4FAS D;  1S7E A;  3DKW A;  2VPR A;  1YQA A;  3GUD A;  2O8K A;  4BL0 B;  2CFO A;  4ASN A;  2J5P A;  2HXO A;  2VJJ A;  2P5V A;  2ESH A;  3OYB A;  3KET A;  1D0Z A;  2CO5 A;  4BJ5 C;  1RKT A;  1Z3Y A;  3RQ4 A;  2LOO A;  4G12 A;  3ECO A;  1T0F A;  3RCO A;  5LBQ A;  1DGR M;  1J2X A;  1JKR C;  4BE2 A;  4PJL A;  4BDY A;  3J81 K;  1S29 A;  3W6J B;  5A2Q K;  1XGS A;  2E60 A;  2ADU A;  1R4M B;  4ZYA A;  4RB3 C;  3ZMT A;  4A3J J;  3F9K A;  4D5C A;  3GVA A;  3OSF A;  2A6H F;  2HOA A;  2DMU A;  1LEB A;  4CH7 A;  2A61 A;  3GZ5 A;  2PX9 A;  1MJB A;  2HNH A;  3RKX A;  4U7B A;  4EJO A;  4DJA A;  3OYN A;  4RGR A;  2O0Y A;  1W36 C;  3GFL A;  2CRG A;  2ICW G;  1V3F A;  1Y56 A;  3M9A A;  5L3F A;  3GX4 X;  2DJN A;  4I7H A;  2E2I J;  3BC8 A;  1VFC A;  3SYT A;  2Y30 A;  1SVO A;  4XL9 A;  4DQ2 A;  1RUN A;  3EQL F;  2YR2 A;  2CUE A;  2GXB A;  1SAX A;  1FLI A;  5F0F A;  5FKL A;  1T2K A;  2E19 A;  1OLT A;  3KEQ A;  3GTJ J;  4ETS A;  4U0Y A;  2DBB A;  4MO7 A;  4B3X A;  1EA3 A;  5DD4 A;  1OCP A;  2RDP A;  3FBN B;  4XOR A;  4Y15 A;  4WXH A;  5K7H A;  4BXU A;  3WTV C;  2O9L A;  5HS8 A;  1K78 B;  1TC3 C;  1AA7 A;  1NH3 A;  3M07 A;  3HDD A;  3WE2 A;  4GXO A;  3Q9V A;  1MMA A;  3KZZ A;  3BR3 A;  2LNB A;  5F64 A;  2VQH A;  3KP4 A;  3Q0U A;  3P9I A;  1YJ9 I;  4KMU X;  2FXA A;  2OAZ A;  4KDP A;  1ZGJ A;  4BU2 A;  1Y8Q B;  2JUC A;  2X1D A;  2ZSH B;  1D1C A;  3A0H C;  4M6V A;  1ZG3 A;  2GM4 A;  3ABK H;  1GT0 C;  3G73 A;  1QHH D;  1FIA A;  3A01 A;  4NC8 A;  3KYL A;  1CF7 B;  1Z1D A;  3ZOB A;  2H1K A;  1RZ4 A;  2X51 A;  4QIW N;  5A2Q Z;  2F4M B;  2RRE A;  3JAM Z;  1Z0X A;  1HW2 A;  3CDI A;  1WH7 A;  5DD8 A;  2K3P A;  3OR1 C;  2ZXI A;  4QTR A;  1G8X A;  3IP4 B;  1VQN I;  4IHT A;  3HSR A;  2FNA A;  4IXA A;  4LLN A;  3HBL A;  4RGS A;  3JW4 A;  3JRE A;  2O03 A;  2XSJ C;  3CO6 C;  4QWQ A;  1HF0 A;  1LQ1 A;  4MFD A;  2MW8 A;  3HOX J;  3A02 A;  1EH6 A;  2LBF A;  4GRI A;  5HOD A;  3PFY A;  5HS9 A;  3BT9 A;  1TQI A;  1QZZ A;  3K4B A;  3TO7 A;  5AON A;  2H1L A;  3JSO A;  2KDO A;  3HUG A;  2E36 A;  3FKJ A;  2OD5 A;  5CPR B;  1Y8R B;  1FMV A;  1XMX A;  1IN6 A;  5HS7 A;  2WAF A;  4BNC A;  3ZCO A;  4DZP A;  3BDD A;  4NUB A;  2DPU A;  2K27 A;  1IGN A;  4FQG A;  3IL2 A;  3DP7 A;  3E5Q A;  2CWE A;  3CME I;  1ZK8 A;  4FE4 A;  1P4W A;  4NHJ A;  1MJ9 A;  3EUH C;  1TLH B;  2R7W A;  2WAD A;  1H9T A;  2QBY B;  3CDH A;  1X1C A;  3I3L A;  2IA0 A;  1R23 A;  2QGU A;  5FO5 A;  1W0U A;  1WQ2 A;  4I76 A;  2ZME A;  1QGP A;  4S0H B;  3K1M A;  5M3M J;  1RR7 A;  5L3C A;  1YOV B;  1ZGW A;  2IS2 A;  2K9N A;  2V9V A;  2L9V A;  3E5U A;  4CO8 A;  1YS7 A;  2KZG A;  3DF8 A;  4XSZ F;  1FZP B;  1K4T A;  3AKZ A;  3FF5 A;  1LDJ A;  1H88 C;  1IDY A;  1OPC A;  2DA4 A;  4HQE A;  3DPL C;  4PSX A;  1U5T B;  4I0B A;  5E79 C;  2DA1 A;  3B02 A;  5IT3 A;  3JRH A;  4XLF A;  4OIR F;  1PYV A;  3BP8 A; 
#chains in the Genus database with same CATH homology
 4LB5 A;  3F8F A;  2RNJ A;  2L02 A;  2A6E F;  2DPD A;  1F1Z A;  3I4P A;  3WU0 A;  2DU9 A;  1U5T A;  2JSC A;  5L3E A;  1YFH A;  3LFK A;  5DCM A;  4JQF A;  1IN8 A;  4KFC A;  2VBW A;  1KQ9 A;  5E8I A;  2F5C A;  2L01 A;  4GO1 A;  4BQA A;  3HYI A;  5LRS A;  3QU3 A;  1IXC A;  2WC2 A;  4LK1 F;  3WOD F;  4RB1 A;  1TQP A;  3TOB A;  3I0T A;  4G7O F;  1B4A A;  1W4M A;  2PLY A;  2H27 A;  4UV9 A;  1U3E M;  2BEO A;  4EM1 A;  4MTD A;  2HGC A;  3GEZ A;  1Z6R A;  3GW2 A;  4M9Z A;  4HF0 A;  2DK5 A;  1USS A;  2DQR A;  4L9J A;  2HYF A;  1SFE A;  2UWM A;  1B1B A;  3U9G A;  4LFU A;  1XDS A;  4PDK A;  4ESF A;  4HQM A;  3KCC A;  3J80 K;  4Q47 A;  3DXJ F;  5KVR A;  2GXG A;  2Y0M A;  1K6O A;  3GFM A;  2ZME B;  3F8N A;  4G7H F;  1XD7 A;  4YIF A;  2IA2 A;  4BAY A;  4Y13 A;  1RNL A;  5FD6 A;  3HRT A;  2EV0 A;  3HIF A;  3EYI A;  2Y48 A;  3KE2 A;  1HKT A;  3V7C A;  2MH2 A;  4ENN A;  2V1U A;  4EV0 A;  4M9X A;  1I5Z A;  3SHF A;  3TO6 A;  5BPI A;  2FMY A;  3K9T A;  2VC1 A;  1R7J A;  2QWW A;  3IRR A;  1BIB A;  1FPQ A;  1Q1H A;  4A2U A;  1WRJ A;  1XN7 A;  3ABU A;  5LHI A;  3ZPL A;  2Z9O A;  4HX4 A;  2V1X A;  3R6S A;  1J5Y A;  1AWC A;  4AIH A;  5CVV A;  5DUK A;  1ZG1 A;  1R1T A;  1J9I A;  4Y17 A;  1R58 A;  5HLG A;  2YPR A;  2CW0 F;  2QQ9 A;  2ACJ A;  1GXP A;  2VBY A;  2X0L A;  4UVC A;  1STZ A;  5J8F A;  5HDN A;  4LMY A;  4LG0 B;  2XAG A;  5ILS A;  2HR3 A;  3HOT A;  3BWG A;  1IN5 A;  3RYP A;  4GYI A;  4KIF A;  5DYM A;  4K2E A;  2G7U A;  5LHG A;  2G9W A;  1I6X A;  3T5X A;  4CGZ A;  1J59 A;  5DCF A;  1X3U A;  4M9S A;  2H09 A;  4EQQ A;  2Z99 A;  4RB0 A;  1S3J A;  4UVA A;  3I71 A;  3PQK A;  5L3B A;  2XVC A;  1T38 A;  1SD7 A;  2XAJ A;  2OQG A;  3OOP A;  3TKY A;  3R0J A;  2A69 F;  3VFZ A;  4B8X A;  5EEH A;  2CYY A;  1I27 A;  1SD4 A;  2ZBK A;  3U1D A;  1IUY A;  2W25 A;  4WCG A;  2EJR A;  2VE8 A;  2YX4 A;  2F5F A;  4EMS A;  3HTU A;  4IF4 A;  1FOK A;  1YG2 A;  2XAS A;  2HKX A;  1HQC A;  2O3F A;  1G3Y A;  2ZNY A;  3CO7 C;  4ZYH A;  5HLI A;  5DV5 A;  1FSE A;  2KRF A;  5E18 F;  1FBQ A;  4A12 A;  5JI6 A;  3E6C C;  3BPX A;  1W7P D;  2QVO A;  1FP2 A;  1WSU A;  2FA5 A;  2K7L A;  4I01 A;  3FXQ A;  1XSX A;  1Z7U A;  1U8R A;  1CGP A;  1ZRF A;  1MD0 A;  3EDP A;  4GCV A;  3M1E A;  2M5W A;  2VON A;  2JT1 A;  5FFZ A;  2O6G E;  5LEJ A;  4OMY A;  1ZAO A;  3H92 A;  3TDU C;  4KNY A;  4I2O A;  4IPA A;  2HYG D;  4L9V A;  1Z9C A;  3E6D A;  1ZRD A;  4MQV A;  3WTZ A;  3HTS B;  4LG0 A;  5L3D A;  4AD9 A;  3CTA A;  2IA1 A;  3LQQ A;  1LDD A;  2MD5 A;  1KYZ A;  2K4B A;  3T1B A;  2QZ8 A;  2G7H A;  1R1V A;  5JR3 A;  4F7Z A;  5E1Z B;  3V7S A;  1EH7 A;  5FLX K;  2FNP A;  2W24 A;  2FEZ A;  3I5U A;  5DUI A;  2IJL A;  5F1R A;  1QNT A;  3RI4 A;  4P9F A;  4CYD A;  1U2W A;  2QLZ A;  3H3U A;  5JVT A;  2EFQ A;  5LGN A;  3O2P E;  1G4D A;  4O5V A;  4YFN F;  5CYV A;  2EB7 A;  1W5S A;  3KP5 A;  1OYW A;  2XAQ A;  1TW3 A;  4UUV A;  3F6O A;  1HW1 A;  4HF1 A;  2V6C A;  4OOI A;  1HSJ A;  3LA3 A;  2KIU A;  2P4W A;  3CUO A;  4BHB A;  2BE5 F;  1Z91 A;  1XB4 A;  3QP5 A;  2P7V B;  3L09 A;  2AS5 F;  3QP6 A;  1A04 A;  3KLO A;  1FT9 A;  2JRT A;  2P5L C;  1XCB A;  2M8E A;  4AIK A;  1UCR A;  2OA4 A;  3ZMS A;  4LK0 F;  5CVR A;  3MFK A;  1OR7 A;  4KIB A;  1JHH A;  4KA4 A;  2Z5U A;  4UHT A;  1TBX A;  3T0Y A;  4OIQ F;  1FY7 A;  4UXN A;  2C6Y A;  4LB6 B;  3WTX C;  1G6N A;  4EJU A;  1F9N A;  5ERI A;  4AIJ A;  1IRF A;  3DFG A;  1O57 A;  5BMZ A;  2HDC A;  2E7W A;  1BI3 A;  4EJT A;  2L3D A;  5IT9 Z;  1EH8 A;  2GIV A;  4QLC U;  4BHP A;  5ILU A;  2P7C B;  4M6X A;  1U78 A;  1LB2 A;  1MJA A;  3LQR A;  2L4A A;  1T6S A;  3RKW A;  4WXC A;  1R5G A;  3QRF F;  2UXN A;  2BV6 A;  3BJ6 A;  3K0L A;  4RB2 C;  4IJA A;  2R3S A;  3TOA A;  2R7F A;  3TQN A;  2CFX A;  4O3M A;  2RKH A;  1RI7 A;  2FOK A;  3FWE A;  2PJP A;  2IW5 A;  1G3T A;  2IT0 A;  2DLL A;  4UV8 A;  4HF2 A;  4A5M A;  3R4K A;  4S05 A;  3HRU A;  3K1P A;  3E97 A;  4M74 A;  4R8H A;  3ZMZ A;  3BZ6 A;  3ZN0 A;  3V7R A;  5HDG A;  1IAW A;  1W7P B;  2KJB A;  2BGC A;  4LD5 A;  2YSR A;  2XKO A;  1P4A A;  4UNO A;  3VOE A;  3HSE A;  2L54 A;  1IF1 A;  1U5T C;  1O3R A;  1O7F A;  4FX4 A;  2XHK A;  3WTW C;  1P2F A;  4U0V A;  4PCQ A;  4KIG A;  1H0M A;  2PEX A;  1HW5 A;  4OIO F;  4IHS A;  1JGS A;  3J80 Z;  2QEN A;  3MQ0 A;  2W57 A;  4P96 A;  5K5R A;  4ZZL A;  1QO0 D;  4KMF A;  1K7A A;  2OZ6 A;  3FMS A;  5BS6 A;  2PQ8 A;  4MHG A;  2M87 A;  1R22 A;  3EYY A;  2F5D A;  4LLL A;  1ZLK A;  1FWZ A;  5K5O A;  1V4R A;  4NB5 A;  4GGG A;  1CF7 A;  1SMY F;  1P6R A;  4A6D A;  3RKY A;  2EA2 A;  1SMT A;  2UXX A;  3NRV A;  5KK1 A;  2NRA C;  3BJA A;  1LDK B;  3GLX A;  5ICF A;  3WG9 A;  2F2E A;  1G3W A;  5D5U B;  3L7W A;  2RN7 A;  1H9G A;  5TJJ A;  4WF2 A;  4LJZ F;  3HRM A;  2HWV A;  3RPQ A;  3F8C A;  1XDU A;  4I02 A;  5AIP A;  5H6R A;  2YX7 A;  4HX8 A;  4EGY A;  4Q4Z F;  3ZMU A;  2Z33 A;  2VBX A;  5E17 F;  4G8X A;  4OIN F;  5H20 A;  4PGH A;  2QBY A;  3JTH A;  1XMA A;  1DP7 P;  5CVJ A;  1BIA A;  1LJ9 A;  2FRH A;  1TW2 A;  3VB2 A;  2ISY A;  2Z3Y A;  1RIO H;  2HZT A;  2XGX A;  3H3Z A;  5D4S A;  2EA4 A;  3DEU A;  4A0Y A;  1ULY A;  2K4J A;  2E7X A;  2IRF G;  2GAU A;  3F6V A;  3L9F A;  3F3X A;  2DAO A;  2MH9 A;  2JPC A;  4JBA A;  3RPU A;  2R7D A;  1S8N A;  3FM3 A;  2EFP A;  2GQQ A;  4RGX A;  4I09 A;  4BYY A;  2M1B A;  4L5I A;  1IXS B;  1XGM A;  1FYK A;  3ML6 A;  1YW7 A;  3I64 A;  4EVI A;  2FSW A;  3C3W A;  1J7K A;  3E6B A;  3FXR A;  5TRD A;  3IWZ A;  1ON2 A;  5J6X A;  5D8L B;  1C0W A;  4IVN A;  3S2W A;  1QBJ A;  2GWR A;  2MBF A;  3BRO A;  2DQL A;  1L3L A;  1IXR C;  1ODD A;  4GYG A;  3I54 A;  3M8F A;  3REO A;  1BBY A;  5BQT A;  5HDK A;  4YG2 F;  5ICE A;  4N9H A;  4WWC A;  2QYO A;  3NQO A;  3VOD A;  1I1S A;  2KKO A;  3CJN A;  2FBK A;  4EM0 B;  4ESB A;  2FBI A;  3PQJ A;  4IRG A;  3F8M A;  2LF7 A;  3GFI A;  5D4R A;  1T98 A;  5DEQ A;  4O6J A;  5HLH A;  1O3Q A;  2XRN A;  3CUQ A;  4CDG A;  3CLO A;  2P6S A;  5JHU A;  2ETH A;  2NNN A;  3F22 A;  1OYI A;  2XIG A;  3W6K B;  1XCV A;  5CVI A;  1TNS A;  4HYE A;  2PBI A;  3R60 A;  2O61 A;  2PMU A;  3BPV A;  1ONV A;  4MGR A;  1SFX A;  4L18 B;  1GHC A;  3ECH A;  1KU2 A;  2Q0O A;  3V8L A;  1O3S A;  5HOO A;  5D6F A;  3J81 Z;  2V79 A;  2ZNZ A;  4R1H A;  1DDN A;  2QM3 A;  1DPU A;  3IRQ A;  2A3S A;  1FP1 D;  3ISP A;  3KP2 A;  4JK1 X;  1R36 A;  2MC3 A;  3E6M A;  2VN2 A;  2VT2 A;  4D0P A;  2EFW A;  3DV8 A;  5IT9 K;  4A0X A;  2XKP A;  2D1V A;  2EV6 A;  4HA8 A;  4M71 A;  4M6Y A;  4HDV A;  5BOX A;  4FX0 A;  1EV7 A;  4HBL A;  5J8C A;  2ZCW A;  2ELH A;  1MZB A;  1R5H A;  4EGZ A;  3RIR A;  4HOB A;  3CUQ C;  2YU3 A;  2DFI A;  2ZFW A;  3K2Z A;  2TDX A;  1HST A;  3M8E A;  3IWF A;  1E2X A;  2LDU A;  2QQA A;  4P55 A;  2GA1 A;  1BJA A;  1OYY A;  5ED4 A;  2LKP A;  2NAZ A;  3MCZ A;  1L0O C;  3SXY A;  1ZAR A;  1S7A A;  3PFI A;  2W84 A;  2HEO A;  1OKR A;  1JXS A;  3G3Z A;  3D5L A;  1FYL A;  3ROU A;  4RS8 A;  1E17 A;  4ENK A;  4OIP F;  3FMR A;  4P9U A;  1KQ8 A;  3GXO A;  2STT A;  2MLK A;  3IKV A;  4XBF A;  1YIO A;  4CZZ A;  2Q8K A;  3COA C;  4G6Q A;  2FBH A;  2K02 A;  2ESN A;  2EV5 A;  1B9M A;  1XSD A;  3TO9 A;  2L4M A;  1FBU A;  4L0Z B;  3F8B A;  4L9T A;  5K5Q A;  2HOE A;  2CQK A;  3WTU C;  2A68 F;  5BPD A;  2HKO A;  4KN7 X;  2PN6 A;  4KT5 C;  2ZJ2 A;  1MGT A;  1KU9 A;  3BOQ A;  3FZV A;  2DW4 A;  4MTE A;  4S04 A;  3U2R A;  2HTJ A;  3WGI A;  5ICG A;  3VEP A;  2JTV A;  5D5V B;  4UVB A;  4ZYG A;  3QU6 A;  1GXQ A;  4U7D A;  3FM5 A;  3WTS C;  2D45 A;  4OU0 A;  3KZY A;  1SD5 A;  1PUE E;  2H6B A;  3NEU A;  3V4G A;  1FSH A;  2KIF A;  3F72 A;  3I53 A;  1FYM A;  3QAH A;  4RAY A;  4RGU A;  1D8J A;  3GO5 A;  2VT3 A;  3RDI A;  3GYH X;  3HOS A;  4LLG F;  4Z2Y A;  2PI0 A;  4ZYD A;  3KP3 A;  1BOA A;  3EET A;  5E1X A;  2IVM A;  4AVP A;  1LVA A;  1QQI A;  4EJV A;  2A5Y B;  5LGU A;  2ZKZ A;  2DO7 A;  1UHW A;  1BC8 C;  2P8T A;  1IRG A;  5FFX A;  4HW0 A;  3N97 A;  1MDM A;  4MNU A;  2XV4 S;  3MEX A;  2CG4 A;  3GFJ A;  3Q5F A;  1QZY A;  3K69 A;  4KUM A;  1P4X A;  1GVJ A;  3P9C A;  2PG4 A;  4LGW A;  1F5T A;  1ZRC A;  1YW9 A;  2LF8 A;  3L00 A;  4HLX A;  1BM9 A;  3EUH A;  3KP7 A;  3QOP A;  2FU4 A;  1F4K A;  4G94 A;  5ICC A;  4M73 A;  1YYV A;  2Y75 A;  3QPH A;  4BHC A;  5FB2 A;  2EK5 A;  2STW A;  2HFH A;  4L9N A;  5E20 A;  5ILV A;  4B09 A;  2LSO A;  1J0R A;  3F21 A;  4FHT A;  4ESJ A;  4G6D A;  1QPM A;  1Z05 A;  1R1U A;  1OMI A;  4WK8 F;  1U6G A;  3LA7 A;  4M72 A;  3K1N A;  2PMH A;  5F6F A;  1DUX C;  3JTG A;  2OQR A;  2RV8 A;  1WWX A;  3LST A;  3SZT A;  4XRF A;  2XUB A;  2EFN A;  2RGV A;  4OMZ A;  4N9I A;  2FF4 A;  4KN4 X;  4RAZ A;  5E1W A;  2PFB A;  5DDG A;  3FMQ A;  1IW7 F;  2DI3 A;  4WXD A;  4E70 A;  3E3V A;  3FHZ A;  4G9Y A;  1BI2 A;  3FX3 A;  1ZRE A;  4A0Z A;  2H94 A;  2D2W A;  2Q2E A;  1KA8 A;  1ZG5 A;  2MA3 A;  2M45 A;  1ON1 A;  3C18 A;  4KYW A;  3D0S A;  4EM2 A;  1ZYR F;  4R79 A;  2F5E A;  2JZY A;  1KYW A;  2EFO A;  2KJC A;  3IHU A;  5D5W B;  3WTT C;  3MWM A;  1VTN C;  2E1N A;  4HX7 A;  4XLP F;  2GZW A;  4U88 A;  3GF2 A;  5LLQ A;  3R0A A;  2WV0 A;  3I59 A;  2VOO A;  3WTY C;  1YW8 A;  5CJ9 A;  3SFZ A;  2FML A;  4XLN F;  2NYX A;  3BJO A;  1IZ1 A;  4NQW A;  1W5T A;  2M30 A;  1BC7 C;  4P5O A;  3QPT A;  3P9K A;  3ABT A;  4ZYE A;  5CVU A;  2ZO4 A;  1S6L A;  3ZP5 A;  4IRI A;  2HTS A;  3C7J A;  1KU7 A;  1LEA A;  5K1Y A;  5H6Q A;  1UST A;  1G3S A;  4TV7 A;  2NNY A;  2GA2 A;  2VC0 A;  2P5K A;  3ELK A;  1UFM A;  3FXU A;  3RJP A;  4EJW A;  4ENJ A;  2VBZ A;  3BY6 A;  1TQM A;  4WX9 A;  5FLX Z;  4KIC A;  3HSF A;  5EEG A;  1B9N A;  3JSP A;  1KGS A;  4HV5 A;  5D6E A;  2MLG A;  2AXL A;  2VE9 A;  1LNW A;  3LA2 A;  4HAM A;  3WGG A;  4MQ9 F;  1I1G A;  2XRO A;  2E1C A;  2DK8 A;  1DPR A;  3L2C A;  1UB9 A;  4FT8 A;  1ZLJ A;  3O3K A;  1D3Y A;  4YFK F;  2IP2 A;  3V8K A;  2OU2 A;  1BI0 A;  2EWN A;  2X4H A;  4U0W A;  4L0Y B;  1YO5 C;  3MZH A;  3GZ6 A;  3ZMD A;  1PDN C;  2O8X A;  1J75 A;  3J7A O;  3IKT A;  1XGO A;  3M7G A;  4ZH4 F;  3SZP A;  1AOY A;  3HHG A;  3I59 B;  1B59 A;  1Z6T A;  3HRS A;  4AWX B;  1K78 A;  1SFU A;  4Q48 A;  4DNC A;  4ZZD A;  2XAF A;  1YLF A;  2RVC A;  2DTR A;  4H0E A;  1HBX G;  3ZN1 A;  5CLS A;  1JE8 A;  5LGT A;  4CXF A;  2CSO A;  2H6C A;  1TTY A;  4MEX F;  1MKM A;  2CGP A;  3B73 A;  3ULQ B;  5LHH A;  1ZHF A;  2OZU A;  3DQV C;  2QQB A;  2RC4 A;  5DCM B;  2QUF A;  2HQR A;  3F23 A;  4YFX F;  1PP7 U;  3KEO A;  3E5X A;  4XSX F;  4L5J A;  1BN5 A;  4G7Z F;  4IRH A;  2HQN A;  3KP6 A;  2COM A;  2HS5 A;  4N0B A;  3CUQ B;  2KIM A;  1XMK A;  2VXZ A;  4I98 B;  2DT5 A;  3T8T A;  1ZH5 A;  2FQ3 A;  3KFW X;  2NS0 A;  1ZGA A;  4PGG A;  2B0L A;  2ISZ A;  2P6T A;  2BBY A;  1B6A A;  1ZN2 A;  3RYR A;  4ENM A;  3Q9S A;  1W7P A;  1YTY A;  5D8K B;  3IC7 A;  2W85 A;  1IN7 A;  2JPB A;  1MDM B;  1WI9 A;  3I58 A;  1S7O A;  1FBS A;  5JFR A;  3JAM K;  2VOD A;  1KU3 A;  2V1D A;  5LRR A;  3RTR A;  3LWF A;  5LEK A;  3HHH A;  5FD5 A;  5FGM A;  3MAJ A;  3TGN A;  1FC3 A;  1D8K A;  4HDU A;  4YII A;  1P92 A;  2D1H A;  3R61 A;  1RUO A;  4ON0 A;  1R00 A;  2A07 F;  1Y0U A;  4I0A A;  4CHU A;  1T39 A;  2WTE A;  1TNT A;  1WKM A;  3OV8 A;  1REP C;  3ZMV A;  2FE3 A;  1FNN A;  1BI1 A;  1YS6 A;  5E8G A;  2WWY A;  1PP8 F;  1HKQ A;  3LAJ A;  1IN4 A;  3MZY A;  2VOP A;  4A6E A;  3WE3 A;  3LAP A;  1KQ0 A;  3DPT A;  4MEY F;  1HKS A;  1NHA A;  2XAH A;  4CIC A;  1D5V A;  4Q5S F;  3N4M A;  4HZF A;  3V8J A;  2ZXJ A;  3T8R A;  1K79 A;  2J5O A;  4HLY A;  3WU1 B;  3ERE D;  4BH9 A;  3AAF A;  5AIQ A;  1SD6 A;  1XSV A;  5D5X B;  2K86 A;  2IPQ X;  3WGH A;  1XGN A;  6PAX A;  3SQN A;  2BYV E;  1O7L A;  3GWZ A;  3ZQ7 A;  1FX7 A;  1UHM A;  5L3G A;  4PZJ A;  3O6B B;  1O3T A;  5HVQ C;  2UZK A;  3TDZ C;  2RQP A;  3C1D A;  1JHF A;  1HXD A;  3KLN A;  4HV6 A;  3P7N A;  2OBP A;  4A5N A;  3DKW A;  1YQA A;  3GUD A;  4ASN A;  2J5P A;  2P5V A;  2ESH A;  3KET A;  2CO5 A;  3ECO A;  1T0F A;  5LBQ A;  1J2X A;  3J81 K;  1S29 A;  3W6J B;  5A2Q K;  1XGS A;  2ADU A;  4RB3 C;  3ZMT A;  3GVA A;  2A6H F;  1LEB A;  2A61 A;  3GZ5 A;  1MJB A;  3RKX A;  4U7B A;  4EJO A;  4RGR A;  2O0Y A;  3GFL A;  1V3F A;  3M9A A;  5L3F A;  3GX4 X;  4I7H A;  4DQ2 A;  1RUN A;  3EQL F;  2YR2 A;  2GXB A;  1SAX A;  1FLI A;  1T2K A;  3KEQ A;  4ETS A;  4U0Y A;  2DBB A;  5DD4 A;  2RDP A;  4Y15 A;  4WXH A;  4BXU A;  3WTV C;  5HS8 A;  1K78 B;  3WE2 A;  4GXO A;  3Q9V A;  3KZZ A;  2LNB A;  5F64 A;  3KP4 A;  3P9I A;  4KMU X;  2FXA A;  2OAZ A;  4KDP A;  1ZGJ A;  1ZG3 A;  3G73 A;  1CF7 B;  1Z1D A;  1RZ4 A;  5A2Q Z;  3JAM Z;  1HW2 A;  5DD8 A;  4IHT A;  3HSR A;  2FNA A;  4IXA A;  4LLN A;  4RGS A;  3JW4 A;  2O03 A;  3CO6 C;  4QWQ A;  1LQ1 A;  1EH6 A;  5HS9 A;  1TQI A;  1QZZ A;  3TO7 A;  5AON A;  3JSO A;  3HUG A;  2OD5 A;  1IN6 A;  5HS7 A;  4BNC A;  3BDD A;  2DPU A;  2K27 A;  3IL2 A;  3DP7 A;  3E5Q A;  2CWE A;  1P4W A;  4NHJ A;  1MJ9 A;  1TLH B;  1H9T A;  2QBY B;  3CDH A;  2IA0 A;  1R23 A;  5FO5 A;  1WQ2 A;  2ZME A;  1QGP A;  3K1M A;  5L3C A;  4CO8 A;  2V9V A;  3E5U A;  1YS7 A;  3DF8 A;  4XSZ F;  1FZP B;  3FF5 A;  1LDJ A;  1OPC A;  4HQE A;  3DPL C;  1U5T B;  4I0B A;  3B02 A;  5IT3 A;  4OIR F;  3BP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...