1FBUA

Heat shock transcription factor dna binding domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proline in alpha-helical kink is required for folding kinetics but not for kinked structure, function, or stability of heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
molecule tags Transcription
molecule keywords HEAT SHOCK FACTOR PROTEIN
total genus 25
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fbuA00
3HIFA 4U7BA 4M6YA 2FOKA 2VC0A 4G6DA 1HXDA 1LVAA 1H9GA 3K1PA 3HYIA 3ZMTA 4WK8F 1JGSA 3C7JA 3OV8A 2CYYA 3I59A 4B8XA 1S29A 1ZRCA 1ZH5A 4UUVA 1HQCA 4ZYEA 1W4MA 2TDXA 5D5UB 1U6GA 5HLIA 5IT3A 2OAZA 1EV7A 2QQAA 1J59A 2P7CB 1ON1A 3TO7A 3CUQC 5DYMA 4M73A 2HR3A 2PQ8A 2HZTA 1Z9CA 3D5LA 4ZYDA 4L5IA 1ULYA 5BPDA 4A12A 3EQLF 3GLXA 1DUXC 3WU1B 3ZMUA 2FNPA 1B6AA 5DCMB 3CJNA 4L0ZB 5EEGA 4DQ2A 4EGYA 5EEHA 1RI7A 2DQLA 2XUBA 5L3BA 1USTA 2V1XA 5AONA 1F1ZA 1IRGA 4QWQA 5JI6A 1S7OA 2V1DA 5HOOA 3FXRA 4AWXB 4IF4A 1ZHFA 4LLGF 3F8BA 1FWZA 3KFWX 2CFXA 1K7AA 1WQ2A 3DKWA 1RZ4A 2FE3A 3I53A 1O7LA 2PG4A 4TV7A 2DLLA 4EM1A 2DK8A 1TQIA 3LA7A 4WXCA 2QBYB 1K78A 4ASNA 2BGCA 2MLKA 1YFHA 3HOSA 4EJOA 3IWFA 4I09A 3GO5A 2NRAC 4KFCA 3G73A 5E1XA 5AIQA 3SQNA 5FD5A 5ICGA 2GZWA 5DV5A 3EDPA 1TTYA 1OR7A 4M71A 1XDSA 1MKMA 5HLHA 3T1BA 2BBYA 1T0FA 2A6EF 4HYEA 3V7SA 4IRIA 2DTRA 2X0LA 4HQEA 3FMSA 4R79A 1MJ9A 3HRUA 3PQKA 1G3WA 1FZPB 1LNWA 3V8KA 4LG0B 2RKHA 1TW3A 1K78B 3U2RA 3CUQA 2L4AA 2HTJA 3K0LA 2VC1A 3GF2A 3I59B 3E97A 1D8KA 1B9NA 2VOPA 1ZAOA 4RGSA 3BOQA 1XB4A 2UWMA 3FM5A 5D6FA 5HS9A 3R0JA 1FBQA 3CLOA 1AOYA 4P96A 3FMQA 4KIFA 2JZYA 1O7FA 3H92A 2LF8A 5LHHA 3HRTA 3O2PE 3R61A 3QP5A 4XSXF 3J81K 3RI4A 2VOOA 4L0YB 2ZJ2A 4R8HA 2E7XA 1Z91A 4IHSA 2HOEA 3CDHA 1LEAA 3F6VA 1BBYA 2CQKA 1ZG5A 4HLXA 1KU2A 1RIOH 4CXFA 4IXAA 1IN5A 3L7WA 1R7JA 4EJTA 2GA1A 3DF8A 3MZHA 3M9AA 4LB5A 3FX3A 4EVIA 2ZNYA 4CHUA 4ESJA 5D5VB 1ZREA 3KCCA 4D0PA 4A0XA 2CWEA 1WI9A 4U0VA 4U7DA 1BI1A 2NNNA 1O3RA 2GA2A 2ESHA 1IN8A 2K4JA 4U88A 2NS0A 5BOXA 4PCQA 3GUDA 1IN7A 4PGGA 5LLQA 4NHJA 3COAC 1FC3A 2XGXA 2XV4S 5E20A 2C6YA 2OZUA 1YQAA 2XAJA 2XHKA 2QM3A 3DEUA 3GZ6A 1XGMA 3KETA 2WC2A 4MHGA 1LQ1A 2RC4A 4BYYA 1ZGAA 2VBWA 5DD4A 1FBSA 4OU0A 2ISZA 1UB9A 4FX0A 2HYFA 1KQ9A 2HKOA 4IPAA 1MJAA 2KJCA 2PJPA 3B73A 3QP6A 2V9VA 2DAOA 3V4GA 4ENMA 4LLLA 5FD6A 1KGSA 2MD5A 5CVVA 3CO6C 2M5WA 1J75A 5DEQA 2NAZA 2L54A 1H0MA 2UXXA 1T98A 4WXHA 3ZMZA 4I02A 3M1EA 3F21A 1Y0UA 2KIMA 1XDUA 4WCGA 4N0BA 3NEUA 5CVRA 1NHAA 2HEOA 3E5XA 6PAXA 4NB5A 1SFXA 4A6EA 4LFUA 1R00A 3RJPA 3LAPA 2A5YB 1YG2A 1E17A 3I58A 1JXSA 2IA0A 3MCZA 2E7WA 4CO8A 2XAQA 4Q48A 4HQMA 5ERIA 4JBAA 4HX7A 1L3LA 4I0BA 3F8FA 1VTNC 4I01A 3E6MA 3R60A 1P4AA 1I1SA 3L2CA 1J7KA 4OMYA 2JPCA 3REOA 4L9NA 3IHUA 2Q2EA 1YS7A 1R5HA 2ZKZA 2L01A 2FA5A 2AS5F 4XRFA 5F1RA 4MTEA 5LEKA 4N9HA 4MEXF 2V6CA 3L09A 2QYOA 1XGNA 3ABTA 5L3EA 3RDIA 3TOAA 1IXRC 1IAWA 4L18B 2V1UA 4BAYA 3HSRA 3KP4A 4WWCA 4HOBA 4UV8A 2IA2A 3KEQA 3KZZA 2IA1A 1XSXA 3K2ZA 4M6XA 5ICCA 2P8TA 2O6GE 3J80K 3WTUC 3NRVA 2BE5F 2FBIA 1W7PB 1BM9A 5LGNA 2P5LC 2HFHA 4O5VA 3LA2A 5BMZA 2F5FA 3F8NA 4HF0A 3JW4A 2ZBKA 3F6OA 1OKRA 5LGTA 4KN7X 1ZLJA 3P9KA 3SZPA 3E6CC 1U3EM 4KT5C 3ERED 2PI0A 3F72A 3JTHA 3WGHA 3DXJF 4KICA 2E1CA 2MH9A 2W24A 3KLNA 2RQPA 3HUGA 4G8XA 3BJOA 1QZYA 3L9FA 1LJ9A 1B9MA 3HRSA 5E1ZB 3BY6A 4XLPF 2GIVA 3GYHX 2F5CA 1MZBA 4Z2YA 2M87A 2OQGA 2FNAA 3O6BB 1KU3A 4LK0F 3KE2A 4P5OA 3K1NA 1IRFA 5L3DA 3J81Z 1UHWA 4I2OA 4ZZDA 4AIHA 2QENA 1L0OC 2DO7A 1KU9A 4Q4ZF 2VODA 2DT5A 2RGVA 2COMA 3GX4X 2R7FA 3M7GA 4NQWA 2OA4A 3CUOA 2IT0A 2D1VA 2PFBA 1PP7U 3H3ZA 2RNJA 5K5RA 4G94A 1HW2A 5HVQC 1X3UA 2K4BA 1G3TA 2XIGA 3E5UA 2FRHA 3WTWC 1WWXA 2BEOA 1R23A 1UFMA 2FU4A 2D45A 2A6HF 5A2QZ 1YO5C 3JSOA 4MNUA 1KQ0A 3CTAA 1P4WA 1ONVA 3ZPLA 5L3CA 3E6DA 2RN7A 3RPUA 3ZMSA 2R3SA 1EH6A 1U5TB 1FPQA 2IP2A 3QRFF 2O61A 1JHHA 4MQ9F 4MEYF 4EM2A 5TJJA 2EFQA 4GGGA 4RGUA 3MZYA 1SMTA 3ZN1A 2Z9OA 3MAJA 3ZN0A 1IF1A 1Z1DA 2XVCA 1KYZA 2XAGA 2LF7A 5BS6A 2XKOA 3EUHA 2JTVA 2STTA 2ELHA 3QOPA 4EJVA 1R5GA 3RIRA 2AXLA 3N97A 4HAMA 3K9TA 3WTSC 2VBYA 5LHGA 3I64A 1I27A 1FSEA 3IC7A 4HX8A 4ESFA 2GXBA 4ZYGA 2EV5A 2ACJA 1Z6TA 4FHTA 1IXCA 4Y15A 3TOBA 1LDKB 4OMZA 3RKYA 1SAXA 2K86A 3C18A 4XLNF 4YFXF 3PQJA 3NQOA 1EH8A 4WX9A 1K6OA 1ZLKA 2QBYA 2F2EA 5HS7A 1ZARA 1OYIA 3GVAA 3KP6A 1IUYA 3F8CA 2H27A 3MEXA 4I98B 1D3YA 4RGXA 4A6DA 1BI0A 1A04A 3VEPA 2ZO4A 3RYRA 1GVJA 2BV6A 3VODA 2FEZA 2HGCA 2PMUA 3LQRA 3HSFA 2CG4A 3ML6A 3KEOA 1G3SA 4I0AA 1UCRA 4OIOF 3DFGA 4IJAA 1F4KA 1FP1D 4WF2A 2PMHA 2DBBA 5CVIA 1U5TA 2Y0MA 1IN4A 3C3WA 2P5VA 2W57A 3ZP5A 2KKOA 3P9IA 3SFZA 1O57A 4FT8A 3QU3A 4QLCU 2YR2A 2F5EA 4G7ZF 4M9ZA 4CDGA 2A69F 4RB1A 1J5YA 4FX4A 5CYVA 5LRSA 1QQIA 1OPCA 4RB3C 1I5ZA 2XKPA 2EV0A 5BPIA 2NYXA 4E70A 5E18F 2FSWA 2FF4A 1STZA 4UXNA 2BYVE 2ETHA 3JTGA 2DPDA 3Q9VA 4LJZF 2A07F 1YS6A 1S6LA 5E8GA 3KP7A 2P6TA 5LRRA 2HS5A 5JVTA 1V3FA 2YSRA 3EETA 3JAMK 5J6XA 1IXSB 3IWZA 2WV0A 1KA8A 5DDGA 3GFLA 4OIRF 3IRRA 3RYPA 3SHFA 3VOEA 3IKTA 3ABUA 1R36A 1LDJA 4KMFA 3ZMDA 2UXNA 5DCFA 5ICEA 3DPLC 5KVRA 1K79A 2M8EA 2ESNA 5E8IA 5D5XB 1W5TA 2KJBA 2Y48A 3BPXA 2EFWA 2G7UA 1XSDA 1GHCA 3ROUA 3KP2A 4KIBA 3I4PA 2OQRA 1E2XA 1YTYA 1XCBA 2DFIA 1U78A 5IT9K 2A61A 4G7HF 5D4RA 1KQ8A 1EH7A 4B09A 1T6SA 1B1BA 3KLOA 3DPTA 3I54A 3WODF 1DPRA 3TDUC 3TGNA 3L00A 2G9WA 1FYKA 5F6FA 3LWFA 4IRHA 1P4XA 2M45A 3LQQA 5DCMA 1SFEA 3Q9SA 5FO5A 4MQVA 5HLGA 4M9SA 1D8JA 3DP7A 2H6BA 3KP5A 4OINF 2F5DA 3ECOA 2W85A 1DP7P 3ECHA 3C1DA 2CGPA 3HTSB 4M72A 2RDPA 2D1HA 1O3QA 5DUIA 4Q47A 1OYWA 4H0EA 3QPHA 1WRJA 3VFZA 2LKPA 1IW7F 2P5KA 2VE9A 3TO9A 1R1UA 1C0WA 1ZRFA 4G9YA 4ENNA 1USSA 2HTSA 2OBPA 4LMYA 3LA3A 1LDDA 1AWCA 1ZYRF 4ON0A 4EM0B 3ZMVA 1XGOA 1U5TC 4K2EA 2XAHA 2KIFA 3BPVA 4IVNA 2QQ9A 4UHTA 1YLFA 4CGZA 2ZFWA 4BHCA 4YIFA 1G3YA 2FMYA 1XN7A 1OMIA 1XMKA 2CSOA 2K27A 1TNSA 3BJAA 4A5NA 1TQPA 3V7RA 2EV6A 3E5QA 4BH9A 5H6RA 2O0YA 2ZCWA 2STWA 2KIUA 3FZVA 3M8FA 4AIKA 3LFKA 3BROA 2DI3A 3IKVA 2MC3A 3U9GA 1ZRDA 3FF5A 5DD8A 4ETSA 3BJ6A 2ZMEB 2CO5A 4CICA 2HQRA 1MD0A 4BHPA 4GCVA 1DPUA 4HV6A 3S2WA 2FBHA 1XCVA 2W84A 1ODDA 4M74A 3HHHA 4PZJA 4M9XA 5ILVA 4S05A 3WE3A 2HKXA 1QPMA 3W6JB 1YYVA 3QPTA 3GFIA 4HDUA 1QGPA 5E1WA 1FYMA 1W7PD 1TW2A 1T39A 4IHTA 4OOIA 3TQNA 4ZZLA 2A3SA 4LG0A 2IPQX 2H94A 3EYIA 4G7OF 1LEBA 4RB2C 3ULQB 2QWWA 4N9IA 2XAFA 3O3KA 4EJWA 3TKYA 4P9FA 3W6KB 1FT9A 4O6JA 4BXUA 2P6SA 4EQQA 3RTRA 2VT2A 1HW1A 4JK1X 2RV8A 2JRTA 2QQBA 3QU6A 4U0YA 1Z05A 2YPRA 5FLXZ 4MTDA 5FLXK 4OIPF 4L5JA 5JR3A 4EV0A 1O3SA 1GXQA 4HF1A 1QZZA 2K02A 4LLNA 2HQNA 3EYYA 2ZMEA 2D2WA 2EA4A 3E3VA 2ADUA 5FB2A 2H6CA 4G6QA 4L9TA 3WTXC 3BZ6A 2V79A 1ZG3A 3R0AA 2RVCA 5DUKA 5ICFA 3WE2A 1W7PA 4DNCA 3GFMA 4U0WA 1MGTA 1TLHB 2EFPA 1Z7UA 4LD5A 1FYLA 3GEZA 5KK1A 3GW2A 4GXOA 4AVPA 4I7HA 4A0ZA 1V4RA 3P7NA 2X4HA 1FP2A 1RNLA 2OZ6A 4HLYA 3H3UA 1FNNA 2VXZA 1F5TA 1XD7A 1P6RA 3WTVC 2EJRA 3WGIA 4HV5A 1SD6A 5K1YA 2W25A 1XGSA 2ZNZA 1T38A 2P7VB 3LSTA 1ZN2A 4KA4A 1FBUA 1SD5A 3F23A 2FMLA 2UZKA 1BI2A 3WU0A 3CUQB 1BJAA 3HTUA 2QLZA 4BNCA 4RB0A 5D8LB 1FOKA 2JSCA 3BWGA 5HDNA 1RUOA 2EK5A 3RKXA 1J0RA 4A5MA 3FWEA 3R4KA 5D5WB 2L3DA 1S7AA 3V8LA 2XRNA 1QNTA 5LHIA 1SMYF 3I5UA 4HZFA 1H9TA 1HKQA 1S3JA 3CO7C 1BI3A 4F7ZA 2PN6A 4HW0A 5HDGA 2Z5UA 2JT1A 3G3ZA 1MDMB 3DQVC 1HBXG 1BC7C 4KN4X 3MFKA 1GXPA 4HA8A 3LAJA 1FLIA 4L9JA 1IN6A 2PEXA 5JFRA 4KNYA 1ZGJA 3J80Z 2DU9A 2E1NA 2Q8KA 2M30A 2DPUA 3GWZA 2R7DA 2O03A 3HSEA 3BP8A 4LGWA 2O8XA 2O3FA 1XSVA 3R6SA 5ILUA 2DW4A 4YFNF 2NNYA 4UV9A 4UVBA 3KP3A 1TNTA 2VE8A 1REPC 4KYWA 4LK1F 3DV8A 2XROA 1XMAA 2Z99A 2VT3A 4P9UA 4EMSA 1SD7A 1BIAA 1DDNA 2DK5A 3WG9A 1BIBA 1U2WA 3SXYA 1YW9A 1Z6RA 2ISYA 3WGGA 5A2QK 4HBLA 2FBKA 5CLSA 4GYIA 2IRFG 4IRGA 1P2FA 2KRFA 1QBJA 2VBXA 4BQAA 4ENKA 1BC8C 2PBIA 5IT9Z 5K5QA 1PP8F 2MH2A 1IZ1A 5HDKA 3VB2A 2EWNA 2J5OA 2YX7A 1BN5A 4HX4A 4YG2F 4CZZA 1UHMA 4ZH4F 1G6NA 5FFXA 4Y13A 1HKTA 1R1TA 1MDMA 4YFKF 1S8NA 3ZQ7A 2WTEA 2M1BA 2VONA 2IW5A 3K1MA 3SZTA 1SFUA 4OIQF 3IRQA 3FMRA 4JQFA 4KUMA 2MA3A 3E6BA 3FXQA 2J5PA 4S04A 1FSHA 3QAHA 2IVMA 4RS8A 4ESBA 4UVAA 1HSTA 2GXGA 2WWYA 4RGRA 2P4WA 4YIIA 1CF7B 3N4MA 2QZ8A 1J9IA 2A68F 2EFNA 5CJ9A 3ISPA 1FX7A 1QO0D 2VN2A 3GFJA 2FXAA 2DQRA 1ON2A 4PGHA 4O3MA 4CYDA 3BDDA 1LB2A 4KDPA 1O3TA 5JHUA 4BHBA 3FM3A 1ZG1A 1Q1HA 3V8JA 4ZYHA 4XSZF 1U8RA 5AIPA 5FFZA 3T8RA 5ILSA 5K5OA 2EA2A 1R1VA 1R58A 2PLYA 5D6EA 1P92A 3TO6A 2L02A 1PDNC 4UVCA 3U1DA 5F64A 2G7HA 2K7LA 5D4SA 3Q5FA 4GO1A 2GAUA 5H6QA 1JE8A 1TBXA 3WTTC 4KMUX 3M8EA 3J7AO 3WTYC 2VBZA 3JAMZ 3T0YA 1CGPA 3MWMA 2XASA 1HW5A 1SD4A 4UNOA 2IJLA 3FHZA 4ENJA 3FXUA 5E17F 2B0LA 3HRMA 4Q5SF 3D0SA 4EGZA 1WKMA 3F22A 2Y75A 3AAFA 5BQTA 5TRDA 2LSOA 1YIOA 3T8TA 2QUFA 4A2UA 5LGUA 3JSPA 2OD5A 3ELKA 5ED4A 4HF2A 4PDKA 1I1GA 5L3FA 1MJBA 3OOPA 4A0YA 3HHGA 1I6XA 1F9NA 4P55A 1TQMA 2GWRA 5LEJA 5HS8A 4AIJA 3GXOA 3RKWA 2OU2A 1B4AA 4R1HA 5J8FA 2GQQA 1HSJA 1RUNA 2HYGD 2Z3YA 2Q0OA 5LBQA 5FGMA 2MBFA 2ZXJA 3KZYA 2JPBA 3K69A 5L3GA 1J2XA 4EJUA 4LB6B 1KU7A 3MQ0A 3RPQA 3GZ5A 4KIGA 3TDZC 2EB7A 3F3XA 4HDVA 1W5SA 3HOTA 2H09A 1B59A 2YU3A 3V7CA 1G4DA 1T2KA 2EFOA 5J8CA 1HKSA 1JHFA 1BOAA 4RAYA 1KYWA 1WSUA 1YW8A 2HWVA 4AD9A 4XBFA 2Z33A 3I71A 3P9CA 2CW0F 3WTZA 5H20A 1OYYA 4L9VA 2LDUA 3I0TA 5D8KB 2MLGA 4Y17A 5CVUA 2FQ3A 4GYGA 2HDCA 1R22A 2LNBA 4WXDA 2YX4A 3F8MA 1D5VA 4MGRA 2L4MA 1CF7A 2QVOA 1PUEE 3B02A 5CVJA 3IL2A 1YW7A 3T5XA 1FY7A 4RAZA 3PFIA
chains in the Genus database with same CATH superfamily
3HIFA 4U7BA 1RKWA 3M4OJ 4M6YA 2FOKA 4XOPA 2VC0A 3QYBA 4G6DA 3G6EI 1HXDA 1TZLA 2BHYA 2RQQA 1JJ6C 1LVAA 5HNFA 1H9GA 3E0JB 2FX0A 3K1PA 2V7FA 2A05A 3F0CA 3ZQGA 3Q3SA 2HOTA 4IHXA 3HYIA 3DWLE 3ZMTA 1QRYA 2BOLA 3BR5A 1YX5A 4WK8F 2CJJA 1JGSA 2CW7A 1JKPC 2GBYA 2V4JC 3C7JA 2QEXI 3N05A 3OV8A 2YU9J 1BOBA 3OYIA 3AG1H 2CYYA 3QOEA 3K4NA 1HDPA 3I59A 3OIOA 4MFDA 4B8XA 1S29A 2R5ZA 1ZRCA 3BG9A 1PUFA 1JKQC 2KRCA 1ZH5A 4UUVA 4IOCF 2CH0A 1HQCA 4RA2A 3BTCA 4ZYEA 1BR4A 1W4MA 1MMGA 2TDXA 5D5UB 4MFEA 1U6GA 1VI0A 2HVRA 5HLIA 2QKLB 5IT3A 2OAZA 1EV7A 3LMMA 2K9SA 3HOZJ 2DA6A 2R0QC 2JMWA 2QQAA 1ETVA 1J59A 4X6AJ 2P7CB 4JP0A 1ON1A 3TO7A 1LKXA 3CUQC 5DYMA 4M73A 2HR3A 2PQ8A 2HZTA 1Y1VJ 1MIJA 1Z9CA 3D5LA 3ZR8X 1OLTA 4ZYDA 4L5IA 3HOVJ 4ZDLA 1ULYA 4A12A 5BPDA 4I99C 3EQLF 3GLXA 4M3DA 1DUXC 3WU1B 3CDIA 3ZMUA 5DS9A 3HM5A 3JR9A 2F4OB 2FNPA 1B6AA 5DCMB 2FQ4A 3CJNA 4XIDA 4L0ZB 5EEGA 2AO9A 4DQ2A 4EGYA 5EEHA 3HOUJ 1LFPA 4IHWA 2Y0SN 3GTPJ 1RI7A 1PJRA 2DQLA 1OR7C 2XUBA 3BR1A 5L3BA 1USTA 4RMNA 2V1XA 2E36A 3DBHB 5AONA 1F1ZA 2HOAA 1IRGA 4QWQA 5M5YJ 5JI6A 2R7OA 1WH5A 2XF6A 1S7OA 2V1DA 4AUXA 3V42A 4F92B 5HOOA 3FXRA 4AWXB 2R7XA 2DJIA 4IF4A 2K9LA 1VQ5I 1ZHFA 2AHQA 4LLGF 3GTLJ 3F8BA 1FWZA 3KFWX 4KJZA 2CFXA 1K7AA 1WQ2A 3DKWA 1RZ4A 1X1AA 2FE3A 3L2QA 4AC0A 3I53A 3RPUD 2R7QA 3CMAI 1O7LA 2PG4A 4TV7A 2DLLA 1QPIA 2MFZA 4EM1A 4UUSA 2DK8A 1TQIA 3LA7A 4WXCA 4AYBA 2QBYB 2X6XA 1K78A 4ASNA 1ACIA 5EZGA 4ZTJA 3DU6A 2CMPA 3DTEA 2HOSA 2JA2A 2BGCA 1GDTA 2KDOA 4M3FA 5DM6F 2MLKA 2OV7A 2IS1A 1YFHA 2X48A 2VUMJ 3HOSA 4EJOA 4DW6A 3KEYA 2DA3A 3IWFA 4I09A 3GO5A 2NRAC 2IS6A 2Z16A 2HNHA 4ITVA 3IAM2 3VYUB 2BHZA 2W48A 4KFCA 3G73A 5E1XA 5AIQA 2VI6A 3SQNA 1B8IA 5FD5A 1SVMA 5ICGA 2GZWA 5DV5A 3EDPA 1S5LC 1TTYA 2M34A 1OR7A 4M71A 2F6CA 2E2IJ 4IQJA 2LREA 1BR1A 2HVQA 3BR6A 1XDSA 1MKMA 5HLHA 3T1BA 2VJ4A 3NARA 2BBYA 1T0FA 2A6EF 4HYEA 3V7SA 4IRIA 1Q1VA 2DTRA 2X0LA 4HQEA 3FMSA 4N4NB 1MJ9A 3HRUA 4R79A 1FJLA 1YIJI 3PQKA 3PO3J 1X3WB 1G3WA 3AG2H 3A03A 4BEHA 4ZDPA 1FZPB 1LNWA 3GTOJ 3V8KA 3H0DA 4LG0B 3O8HA 2RKHA 1TW3A 5M5WJ 1K78B 1WVRA 3PSIA 3U2RA 3CUQA 2L4AA 3OL3A 2CUFA 3WHCA 2HTJA 3K0LA 2I5UA 2VC1A 1E3OC 3GF2A 3I59B 1I3QJ 3K70D 4U87A 3E97A 1D8KA 2IGMA 1X2MA 1B9NA 2KISA 2VOPA 2QSHX 1ZAOA 2OF7A 4HG2A 4RGSA 3L2RA 3H36A 3BOQA 3FXOA 1XB4A 4D9JA 2UWMA 3FM5A 2M0MA 5D6FA 5HS9A 3R0JA 2R7TA 1FBQA 4BE2A 4XKVA 3CLOA 5JHFA 2WADA 3H0GJ 1AKHB 1AOYA 2M2EA 3B6AA 4IHYA 4P96A 1X4OA 3FMQA 4GRIA 4KIFA 5EJCA 2JZYA 1O7FA 2DFHA 3H92A 2BXYA 2LF8A 5LHHA 3HRTA 1X19A 3C2BA 3HC7A 3O2PE 3R61A 3QP5A 4L5EA 4XSXF 2HU9A 3J81K 3RI4A 2VOOA 1W36D 4L0YB 2ZJ2A 4B4CA 4R8HA 2G0EA 5JVGF 2E7XA 1Z0XA 1Z91A 4IHSA 2VIXA 2HOEA 4BBSJ 3CDHA 3OS1A 1LEAA 2GLOA 2F48A 3NAUA 3F6VA 3L2UA 1BBYA 2CQKA 3QYEA 2OCEA 3TP0A 1ZG5A 1RPWA 4RAGA 4HLXA 1KU2A 2DOFA 5B1AH 2E34A 1RIOH 2Y9YA 4CXFA 5FROA 1ETOA 4A3IJ 4IXAA 1IN5A 3BCBA 2AQEA 3L7WA 2WB1N 1R7JA 4EJTA 3Q0VA 1K83J 3DEWA 2GA1A 3AG4H 3DF8A 4OWRB 1HOMA 3MZHA 3M9AA 4LB5A 3ZQLA 3FX3A 4JX6A 4EVIA 2ZNYA 4CHUA 2KZVA 2LBFA 4ESJA 5D5VB 2QSGX 3KCCA 1ZREA 2O8KA 4XLEA 4D0PA 9ANTA 4A0XA 3BT9A 2CWEA 1WI9A 3OYHA 4U0VA 4U7DA 1BI1A 2NNNA 1O3RA 2GA2A 2EZHA 1T95A 2ESHA 1IN8A 3CCMI 2K4JA 4U88A 2KMUA 3JRAA 2NS0A 2LRDA 3MVPA 4Y52J 3OYLA 2E19A 1BR2A 3HPHA 4PCQA 5BOXA 3GUDA 1IN7A 3PNVA 1VQLI 4PGGA 5LLQA 4NHJA 3COAC 1FC3A 1ZK8A 2XGXA 2XPUA 2XV4S 5E20A 1B72B 2K3PA 3RZOJ 1ORKA 2C6YA 2OZUA 1YQAA 2XAJA 2DDAA 2LYCA 4E7JA 2XHKA 1EJ9A 1RKTA 2QM3A 1E0EA 2Y2ZA 4NUBA 2CQQA 3DEUA 3GZ6A 3W3CA 2MABA 2L7MP 1XGMA 3KETA 2WC2A 4MHGA 2IS4A 1U0JA 4KISA 1LQ1A 3FXMA 1ETQA 2RC4A 4BYYA 1ZGAA 2VBWA 3LFUA 1B8IB 5DD4A 4QTRA 1FBSA 4OU0A 4CCJA 2BY1A 3A4CA 3JRBA 5BNGA 2ISZA 2DYSH 2MG4A 1UB9A 4FX0A 5LD2C 2HYFA 3J7YJ 4BDZA 2VKVA 1KQ9A 1MBGA 4LIUA 2HKOA 5FKMA 2VJJA 4IPAA 3ZRGA 4ZTFA 2LLKA 1MJAA 4DYCA 2KJCA 1RR8C 2PJPA 1R49A 4ZC3A 3OSGA 2E60A 3B73A 2E1MC 1A36A 3QP6A 2V9VA 3I56I 2NOJB 3CMEI 2DAOA 1DU6A 3V4GA 4ENMA 2IS2A 4LLLA 5FD6A 1KGSA 2MD5A 3CCRI 2L7FP 2PMZN 3BQYA 2KZGA 5CVVA 3K7AJ 3CO6C 2M5WA 1J75A 1V55H 5DEQA 2NAZA 2L54A 4Y33A 3C2HA 1H0MA 1IV6A 1X4PA 2A6TA 2UXXA 1T98A 4WXHA 1I6HJ 3HB9A 3ZMZA 5GAGJ 3OYKA 4I02A 2ELJA 5CQGA 2E1MB 3K4MA 1UMQA 3M1EA 1RESA 4BXFA 1Z21A 1MNDA 5TISC 4DZJA 3F21A 3CC7I 4BJ5C 1Y0UA 2XB5A 2KIMA 3E7LA 1XDUA 4WCGA 2H8WA 2ZMEC 3OYEA 4N0BA 3NEUA 1AKHA 5CVRA 2M4GA 4QPOA 4HSTA 1NHAA 2E1OA 2F4IA 2Y31A 2VL8A 4AU7A 4XLAA 2HEOA 1X1DA 2KIQA 3E5XA 3OYJA 6PAXA 1D1CA 1DGRM 4OAYA 4NB5A 1SFXA 4A6EA 4LFUA 1R00A 3RJPA 3LAPA 2A5YB 2DA2A 2CU7A 1YG2A 1QA6A 3S15J 2XPWA 3K2AA 5FLVA 2IEKA 1IRZA 1E17A 3I58A 2R7SA 1JXSA 3UNGC 2IA0A 3MCZA 3KYLA 2E7WA 4CO8A 5FRNA 2NOGA 5E3OA 2JUGA 1N25A 2XAQA 4Q48A 4HQMA 5ERIA 4XOTA 5FKNA 4JBAA 4XKCA 2LOOA 4HX7A 1L3LA 4I0BA 3F8FA 2XRLA 1QHGA 2TRTA 4I01A 1VTNC 3E6MA 4XKWA 3EUHC 2MYSA 3R60A 4PJMA 1P4AA 5EEAA 1I1SA 3L2CA 1J7KA 4OMYA 4ZDOA 2JPCA 1QU3A 3REOA 5E3LA 2L7KA 4E7SA 5J47A 4L9NA 3IHUA 1SVLA 1GT0C 2Q2EA 1YS7A 3ZQFA 1R5HA 1X1CA 3HGGA 2NXNB 2ZKZA 2L01A 2FA5A 2AS5F 4XRFA 4J01A 3VPRA 5F1RA 4MTEA 3A1YA 3QWLA 5LEKA 4N9HA 1EKEA 2V6CA 4MEXF 4YELA 3L09A 2QYOA 1XGNA 2ID3A 3HL2A 2COBA 2LY1A 3ABTA 3RDIA 5L3EA 3TOAA 1IXRC 1WJCA 2EINH 4M3GA 3PNTA 1IAWA 2X1EA 2HPMA 4L18B 1J09A 1DP3A 3PM1A 2DTZA 2V1UA 4BAYA 1FOYA 2ZFUA 4NNJA 3HSRA 3KP4A 4WWCA 4HOBA 4UV8A 2IA2A 3OMYA 3KEQA 3K4LA 3KZZA 1JTXA 2IA1A 5F27A 1XSXA 3K2ZA 4M6XA 5ICCA 3GTQJ 3FXJA 2P8TA 4DBQA 2O6GE 3J80K 1W0UA 3WTUC 2VXDA 3NRVA 2R7UA 2BE5F 2WAQN 2FBIA 3OOUA 1W7PB 3KIOA 1BM9A 5LGNA 2P5LC 4Y4RA 2HFHA 4O5VA 3LA2A 1YJNI 1JKRC 5BMZA 2CQ7A 2CUJA 2F5FA 1PYVA 3CJRB 3F8NA 4HF0A 3JW4A 2LBFB 2ZBKA 3F6OA 1OKRA 5LGTA 4KN7X 4BKXA 1ZLJA 3P9KA 3SZPA 3E6CC 1U3EM 3FHNA 4KT5C 4IEJA 3HBLA 1AA7A 2KT0A 3KZIC 4XK4A 3ERED 1T8IA 2PI0A 3F72A 5KAIC 4BJ6C 2DT7B 3JTHA 4D1QA 3WGHA 3DXJF 4KICA 4ZYAA 2E1CA 2MH9A 2W24A 3H3VK 3KLNA 4RLQA 1GLNA 2RQPA 3HUGA 3HOWJ 4G8XA 3BJOA 1VF9A 2CQNA 1OCCH 3HXLA 1QZYA 1V5GA 3L9FA 1LJ9A 1B9MA 3HRSA 3MN2A 5E1ZB 3BY6A 4XLPF 3CP2A 1DQUA 2GIVA 3GYHX 2F5CA 1M1EB 2BVLA 1DGWY 1MZBA 4Z2YA 4A93J 2M87A 3MKYB 2XGCA 1QVUA 4UY8I 1W0TA 2OQGA 2FNAA 2WB1A 3O6BB 1G2HA 1KU3A 3PSFA 4LK0F 1G59A 3B6CA 3KE2A 4P5OA 3Q0UA 1Y39A 3K1NA 1U9NA 1IRFA 5L3DA 5GAHJ 3J81Z 4V2GA 2EIMH 3RKQA 1UHWA 1N75A 4I2OA 4ZZDA 4CYCB 4GFBA 2Q1ZB 1ETWA 4B48A 1TL8A 4AIHA 1ZKGA 2QENA 4UB8C 1L0OC 1SAUA 2D5VA 2DO7A 2GM4A 2CFOA 5GPCA 4B3XA 1KU9A 3UKGA 2Q2EB 3I3LA 1IG7A 3ABKH 1RRJA 4Q4ZF 2VODA 2DT5A 3BQZA 2WY8Q 2RGVA 2COMA 3GX4X 4IKFA 2R7FA 3AFHA 2M7BA 3M7GA 4NQWA 2OA4A 3CUOA 2O5RA 3W2AA 1LPQA 2IT0A 4F55A 2HXOA 4B44A 3OS0A 4CH7A 3WU2C 3CESA 2D1VA 2PFBA 3H3ZA 2V26A 2RNJA 5GAEJ 5K5RA 1PP7U 4E7ZA 4G94A 1HW2A 1P9QC 3SZGA 5HVQC 1X3UA 2K4BA 1G3TA 3W2VA 4BGDA 2XSDC 3S2HJ 2XIGA 3E5UA 2FRHA 1R71A 3WTWC 1WWXA 2BEOA 1R23A 2DMQA 2OTJI 5IP6A 1UFMA 2FU4A 2P0WA 3NWTA 2D45A 3OYMA 2A6HF 5A2QZ 1VQPI 1R4MB 2ECBA 2VKDA 1YO5C 2HVSA 3JSOA 4MNUA 3HJEA 1I39A 1KQ0A 3CTAA 4JYKA 1P4WA 1XS9A 2OUMA 4M3BA 1ONVA 3ZPLA 3MMYB 3E6DA 2EIJH 5L3CA 5J40A 2RN7A 5FKOA 2WY7Q 3RPUA 2XAUA 3ZMSA 2VLAA 2AQFA 2R3SA 2CUZA 1EH6A 1U5TB 4UB6C 3MKZA 3BR0A 1FPQA 2ZSHB 2IP2A 3A01B 4IL6C 4FQGA 3QRFF 3QPSA 5HNHA 2O61A 1JHHA 4MQ9F 4MEYF 3HG9A 4EM2A 1ETXA 3CJQB 3FDYA 1HC8A 5TJJA 3ASOH 2EFQA 4GGGA 4RGUA 3MZYA 1NG6A 1SMTA 3ZN1A 2HDDA 2K85A 2R93J 2ME0A 1SFOJ 2Z9OA 2Z1DA 3MAJA 3ZN0A 1IF1A 4XL9A 4A3FJ 2NS7A 3S93A 2CUEA 4I6ZA 1Z1DA 2XVCA 5E3NA 1KYZA 1A6IA 2WAFA 2X6OA 1WGXA 1KZHA 2XAGA 2QCOA 2LF7A 5BS6A 3A02A 2XKOA 2XF5A 5IY5H 3EUHA 2JTVA 2STTA 2ELHA 3QOPA 4EJVA 1YI2I 1R5GA 3RIRA 2AXLA 2LD5A 3I4MJ 3CCSI 3N97A 3TMOA 4QIWN 4C3HJ 4HAMA 2DT6A 3CP8A 3K9TA 2JJ7A 3WTSC 2LH9A 2VBYA 5LHGA 3CJTB 3I64A 1FSEA 1I27A 3K4KA 5KHDA 3IC7A 4HX8A 4ESFA 2OC6A 3QYFA 4ZYGA 2GXBA 2EV5A 4MIMA 2IGOA 2ACJA 1UJ8A 1JKOC 4RM3A 2JA5J 1Z6TA 1E3HA 2VJ5A 2HPIA 4FHTA 4W97A 2V9PA 3SFIA 1IXCA 4Y15A 3TOBA 1LDKB 4OMZA 3RKYA 1SAXA 2K86A 1APLC 3C18A 4G6TB 4XLNF 4YFXF 3DKXA 2TCTA 3PQJA 3O8GA 3NQOA 1EH8A 4YRVA 4WX9A 1K6OA 1ZLKA 2VQCA 2VJIA 1JUPA 1MW7A 3S8PA 1POGA 3K4BA 2VQHA 2FUG2 3SEZA 1V54H 4FETA 2QBYA 3M3YJ 2F2EA 2VKEA 5HS7A 3H9GA 2GOMA 1ZARA 1OYIA 3GVAA 4D5CA 1XC5A 3KP6A 5KAFC 4PUSA 2DODA 4AVZA 1IUYA 3F8CA 2H27A 4HNVA 2JA8J 3MEXA 1TT0A 4I98B 1D3YA 2BY2A 2KPMA 4RGXA 4A6DA 4P1WA 5C3EJ 1BI0A 2X1DA 1A04A 3VEPA 4FASD 4BY1J 2ZO4A 3RYRA 1GVJA 2BV6A 3VODA 3FIWA 4A3LJ 2FEZA 2HGCA 2PMUA 3LQRA 3HSFA 2CG4A 3ML6A 3KEOA 1G3SA 4I0AA 1UCRA 2MW8A 2ZJPF 4OIOF 1T08B 1IO2A 2A5WA 3BLYA 4HNUA 3DFGA 4IJAA 1F4KA 1FP1D 4WF2A 2PMHA 4E7LA 1S72I 2DBBA 5CVIA 1U5TA 1MMSA 1XX5A 3MZ8A 1Y1WJ 2Y0MA 1RR7A 4PSWA 4XLCA 3EUKL 2DA4A 1Z67A 2XGDA 2WAQA 1IN4A 3C3WA 2P5VA 2UV1A 2W57A 5EGOA 3ZP5A 3VWBA 2KKOA 3OYDA 5IOYA 3P9IA 3H9QA 1WJBA 3SFZA 1UZCA 3CF2A 2QA4I 1O57A 4FT8A 1UG0A 3QU3A 5K7HA 4QLCU 4D7MA 3CZ6A 3EPZA 2X6WA 2YR2A 3HUGB 3LSIA 1TC3C 2F5EA 1U9OA 4G7ZF 5IYDJ 3SYTA 4M9ZA 4CDGA 3OWTA 4CCKA 2A69F 5J1YA 4RB1A 1J5YA 4FX4A 5CYVA 5LRSA 1VZ0A 2M9HA 4AIDA 4A3DJ 1QQIA 1OPCA 1BL0A 4RB3C 3ASNH 2JN6A 1A5JA 1I5ZA 2XKPA 4A3CJ 5B5EC 5F0HA 2EV0A 5IYBJ 5BPIA 3K4JA 2NYXA 2JQ7A 1MBFA 3K4CA 1WHUA 2BW3A 4E70A 5E18F 1V5FA 2L5QA 1O4XA 3FISA 2FSWA 2R4GA 3FK6A 2FF4A 1STZA 4UXNA 2H1LA 3KPHA 4D7NA 2BYVE 2ETHA 1EF4A 3KX2A 3JTGA 4C30A 1QVTA 2DPDA 4ANJA 4E7HA 2XC7A 3Q9VA 3LOCA 4LJZF 3S17J 1NK2P 3JRIA 2A07F 3H5RA 2V9KA 4IX7A 4C3IJ 3SDGA 1YS6A 2DFEA 3CQZJ 5LFAA 4S0HB 1S6LA 5E8GA 3KP7A 2K9QA 2P6TA 1XPXA 2L0KA 5LRRA 2HS5A 5JVTA 1V3FA 2YSRA 3EETA 3JAMK 4HRIA 5J6XA 2CV2A 3CD6I 1IXSB 1VQ8I 3IWZA 1E3PA 2WV0A 3WG7H 1BA5A 1LUJB 1KA8A 5DDGA 1YRNB 3GFLA 2DOAA 4OIRF 3IRRA 3OR1C 3RYPA 3SHFA 3G71I 4UUSB 3VOEA 4V19K 1ERDA 3IKTA 5IPAA 2B7EA 3CMMA 2K9MA 3ABUA 1R36A 1LDJA 4KMFA 1JT6A 2WV1A 3D5RC 1D0XA 2JUCA 4F3QA 4OAZA 3ZMDA 3E1SA 2UXNA 5DCFA 4CA0A 2MSYA 3CC4I 5ICEA 2RREA 3S1RJ 1TWAJ 3LSKA 5FKKA 3ABMH 3HKZA 3DPLC 5B66C 5KVRA 1K79A 2M8EA 2ESNA 2V1NA 3BTLA 5E8IA 1F43A 3GBGA 5D5XB 5IP9J 1W5TA 2KJBA 2Y48A 3IAS2 3BPXA 4A3JJ 2EFWA 2G7UA 1XSDA 3QQAA 1GHCA 1GV5A 3ROUA 3DEEA 3KP2A 1K4SA 2QGUA 3Q0WA 4KIBA 3I4PA 1IC8A 1VQ7I 2OQRA 3OYCA 4A3BJ 1E2XA 3TW6A 2KRHA 1YTYA 1XCBA 2DFIA 3H9JA 1U78A 4H4KC 3S1QJ 5IT9K 2ID6A 3OSFA 2A61A 4G7HF 1I3AA 3GCMA 5D4RA 3UR3C 1KQ8A 1EH7A 4B09A 1T6SA 3HOYJ 1B1BA 2X1CA 3TL4X 2LC2A 3KLOA 5GTHC 3DPTA 1XTAA 3I54A 3WODF 3S2DJ 1FIAA 1Y0NA 1DPRA 3GLLA 4A3GJ 1Z3YA 3TDUC 3TGNA 3L00A 2G9WA 3IUOA 1FYKA 5F6FA 1WPKA 5M5XJ 3LWFA 4IRHA 2JK3A 3I4NJ 1P4XA 2M45A 2X9DA 2L9NA 3LQQA 5DCMA 3X2QH 5M3FJ 1UELB 1SFEA 3Q9SA 1FMWA 3BZKA 5FO5A 1I50J 2MGQA 2R7ZJ 4MQVA 5HLGA 4M9SA 1D8JA 3DP7A 3CCYA 4E4HA 1FTZA 1R4NB 2H6BA 3KP5A 4OINF 2LR8A 1ZR4A 2F5DA 2LP0A 2VQGA 3K70C 1X58A 3ECOA 2W85A 2X51A 1DP7P 3JRFA 3ECHA 3J7ZI 3C1DA 2CGPA 3OY9A 2R5ZB 2O7OA 3HTSB 4M72A 2PMZA 1MSFC 2RDPA 2D1HA 4BACA 1O3QA 3VSKA 2HYJA 4IHVA 4XNFA 5DUIA 3OIPA 4Q47A 1OYWA 4M6VA 1MMDA 4H0EA 2XPVA 3QPHA 1WRJA 3S3OA 3VFZA 1UAAA 1BJZA 2LKPA 1ZELA 1IW7F 3ZQIA 3NWSA 2P5KA 3SEQA 2VE9A 1D5YA 3CC2I 3TO9A 3W6VA 2AXTC 1R1UA 4IQ4A 1C0WA 3H5NA 2BY0A 2L2OA 1ZRFA 4CCNA 4G9YA 4ENNA 1USSA 2M4KA 1JI8A 3ZGKA 4LIVA 5B1BH 2K9NA 1WCMJ 2HTSA 3CLQA 1LE8A 2OBPA 4LMYA 4G12A 1LVKA 2E5ZA 2OJED 3LA3A 1AU7A 1LDDA 1OCTC 1AWCA 1ZYRF 4ON0A 4EM0B 4XLHA 2RAEA 1WJFA 3S32A 2K3FA 3ZMVA 1XGOA 2CW8A 3JRCA 4KT6A 1U5TC 1PUFB 5E3MA 4K2EA 4C2UA 2XAHA 2KIFA 1YJWI 3BPVA 4IVNA 2KL4A 2QQ9A 4DGWB 4UHTA 1ZGWA 2HXIA 3PUBA 2VPLA 2WBMA 1YLFA 1VQKI 4CGZA 2ZFWA 4BHCA 4YIFA 1S7EA 1G3YA 2FMYA 1D0ZA 2M7AA 1XN7A 3CDLA 4XORA 1OMIA 1XMKA 2CSOA 2KDZA 3U21A 1VQ9I 2K27A 3SJMA 4F91B 1TNSA 3BTJA 3BJAA 4A5NA 3SDBA 1TQPA 3RQ4A 4DBRA 4XLFA 3V7RA 3L2VA 2EV6A 3E5QA 4BH9A 5H6RA 1T56A 2O0YA 2ZCWA 2KIUA 3FZVA 2STWA 4BU2A 3M8FA 3FBIB 3P5JA 3LFKA 2R7RA 3MKWB 3BROA 4AIKA 1JT0A 2JWTA 2W00A 1W1WE 2FJ1A 2DI3A 3IKVA 2MC3A 2E2HJ 3U9GA 1ZRDA 5M3MJ 3FF5A 5DD8A 4ETSA 3BJ6A 2ZMEB 2CO5A 4CICA 2UUZA 2HQRA 1MD0A 1OQYA 3IH3A 3GZNB 4GCVA 4BHPA 1DPUA 2DA5A 4HV6A 3S2WA 2FBHA 1XCVA 2W84A 3DBLB 1A35A 1K6YA 5HLTA 4FTHA 1ODDA 4M74A 2XB0X 1JUMA 4J19A 2JA7J 1TWFJ 3HHHA 4PZJA 1CQTA 4M9XA 3S3NA 1H8AC 1TWHJ 1HF0A 5ILVA 4S05A 3TW7A 1XMXA 4Y7NJ 1W36C 1T33A 3WE3A 2XSJC 4HPQA 1ETKA 3H5AA 3I55I 2HKXA 1QPMA 3W6JB 4JX5A 2E71A 1YYVA 3QPTA 2IBDA 4XN0A 3GFIA 4HDUA 2EILH 3GTMJ 1QGPA 5E1WA 3RZDJ 1FYMA 1D1AA 1W7PD 1X2NA 2H1KA 1TW2A 1T39A 3PJRA 2DMUA 4IHTA 4OOIA 3TQNA 1Z77A 4ZZLA 2A3SA 4B1RA 4LG0A 4V2FA 1N78A 4HNTA 2IPQX 1DU0A 1SFKA 4XKBA 2DOEA 2H94A 2Y69H 2R7WA 3EYIA 4G7OF 1LEBA 3JRGA 2L9SA 4RB2C 4BE0A 3FK7A 3ULQB 2QWWA 3RCOA 4CYCA 4N9IA 2XAFA 3O3KA 3HPGA 4EJWA 2ZC2A 3TKYA 3S14J 4P9FA 1U8BA 3W6KB 5J1RA 1B72A 1FT9A 2JVHA 4O6JA 5GP9A 3QPLA 4BXUA 2P6SA 4EQQA 3RTRA 2VT2A 2EBIA 2K40A 5J4YA 2VASA 1QHHD 1HW1A 4JK1X 2DDBA 2RV8A 3LL7A 2JRTA 2QQBA 3QU6A 3OYNA 4U0YA 1Z05A 2YPRA 5FLXZ 4MTDA 3CCQI 5FLXK 4OIPF 4L5JA 5JR3A 4EV0A 2N8GA 3MKLA 1MMNA 2M3AA 1O3SA 1GXQA 3OYGA 1A31A 1OISA 5GTIC 4HF1A 2KQRA 1QZZA 5EDNA 2K02A 2CQXA 4LLNA 1X3ZB 2HQNA 3H35A 3EYYA 2ZMEA 2D2WA 2EA4A 3E3VA 2ADUA 2E2JJ 5FB2A 1FOXA 1X1PA 2H6CA 4G6QA 1FEXA 2CV1A 2DA1A 2ZXWH 4L9TA 3WTXC 2ZSIB 4B47A 2DN0A 3BZ6A 3FKJA 5EG0A 2NVTJ 3C2GA 3BG7A 2V79A 2L9VA 1SANA 2LVSA 1ZG3A 4BS9A 2KFDA 3R0AA 4LG3A 2RVCA 1MBHA 3OR2C 2V6EA 3ABLH 2DA7A 5DUKA 5ICFA 3WE2A 1W7PA 4DNCA 3GFMA 4U0WA 4PSXA 1MGTA 1TLHB 2EFPA 4XRSG 1Z7UA 4LD5A 1FYLA 3GEZA 5KK1A 3GW2A 1WFXA 4GXOA 4AVPA 4I7HA 4XICA 4A0ZA 3DTKA 5H2FC 3ERMA 2FOWA 4C2TA 4FCYA 1V4RA 3P7NA 3PO2J 4PFPA 2X4HA 1FP2A 1RNLA 5EF6A 2OZ6A 4HLYA 1IRXA 1NTCA 5IOZA 2I8DA 3H3UA 2E35A 3IV5A 4E7IA 1TWGJ 3BG5A 1FNNA 2VXZA 4FE4A 4BQOA 2DYRH 2CS3A 1MBJA 1LE8B 4EEFG 1F5TA 1XD7A 4RM2A 1TWCJ 3OS2A 1P6RA 5EYRA 1A6QA 3WTVC 1Y6IA 2EJRA 3DCFA 2KHMA 4NDLA 1MH4A 5B3SH 3WGIA 4HV5A 4M3EA 1SD6A 3KYCB 4BDYA 4A3EJ 1HDDC 5K1YA 2W25A 1FOWA 2ZXHA 1XGSA 2ZNZA 3S3MA 1T38A 2P7VB 3S1MJ 1MNEA 3LSJA 1JUSA 1OCPA 3LSTA 1ZN2A 5C4XJ 4Z6YA 4KA4A 1PVEA 1FBUA 1SD5A 3F23A 2FMLA 3JCUC 2UZKA 1BI2A 3WU0A 2Y9ZA 3U1KA 4BQNA 5C4JJ 3CUQB 1BJAA 3HTUA 2QLZA 1VQNI 4BNCA 2QQ8A 4RB0A 5D8LB 1HLVA 1V5EA 1FOKA 1FTTA 4DJAA 2JSCA 1K4TA 3BWGA 5HDNA 1RUOA 3M8JA 2EK5A 3RKXA 2LKXA 1J0RA 4A5MA 4BXXJ 4AYBN 2HI3A 5EGOB 3FWEA 3R4KA 3DU5A 4MO7A 5D5WB 2L3DA 1LFUP 4FE7A 1S7AA 3V8LA 5DM7F 2XRNA 1QNTA 5LHIA 1EA3A 3G1MA 2KLOA 1SMYF 2VPRA 2BW3B 4RDUA 3I5UA 3VYSB 4HZFA 4X0GA 2EZIA 4RAFA 1H9TA 3L1PA 2IAIA 1R9TJ 1HKQA 1S3JA 3CO7C 2VKHA 4NC7A 1BI3A 5IYCJ 2LMDA 4F7ZA 2PN6A 2QKMB 3DTIA 3VSLA 4Y3OA 4HW0A 5HDGA 3HKZN 4F93B 3LSPA 2Z5UA 2JT1A 2W4SA 2R7VA 3G3ZA 1MDMB 3CCJI 3DQVC 1HBXG 1YJ9I 3CMYA 1BC7C 3PFYA 2BVMA 4KN4X 3HDDA 3MFKA 1GXPA 2OCCH 4HA8A 3LAJA 3LSHA 1FLIA 4L9JA 1MSEC 1IN6A 2PEXA 5JFRA 5F0FA 4NC8A 3OL4A 1HA8A 3G1OA 4KNYA 1ZGJA 3J80Z 2DU9A 2E1NA 3DBRB 3FXLA 2OPTA 2Q8KA 1BW6A 2M30A 3JRDA 2DPUA 3GWZA 2R7DA 1NH3A 2R92J 2LY9A 2O03A 1YE9A 1D0YA 1WJ5A 3HSEA 4B3AA 2DJNA 2L7ZA 3BP8A 4LGWA 5EG0B 3A01A 3AL0C 2O8XA 3AL0B 2O9LA 4QSHA 3A0HC 2O3FA 1XSVA 3R6SA 5ILUA 2DW4A 4BL0B 4YFNF 1NG7A 4E6KG 2NNYA 1WI3A 2ZJQF 1WJEA 3GTKJ 5K7FA 4UV9A 4UVBA 3KP3A 1TNTA 2VE8A 3K10A 2LG4A 5F0CA 5JLXA 2HQ5A 1REPC 1VQ6I 4KYWA 4HEA2 4BUPA 4LK1F 3DV8A 2XROA 2FD5A 1IJWC 2BZTA 1XMAA 2Z99A 2VT3A 4UUTA 4P9UA 3OYFA 3MD2A 3M07A 4CUGA 4EMSA 1SD7A 2I10A 4IZZA 1BIAA 4II3A 1RETA 2DK5A 1DDNA 3WG9A 1BIBA 1U2WA 4DZPA 3G1LA 1YW9A 3SXYA 2B9SA 5CKTA 1Z6RA 3PL8A 1NK3P 2QSFX 2ISYA 3WGGA 2PX9A 4BEHB 1XG1A 5A2QK 3A2KA 4HBLA 2GOXB 2FBKA 5CLSA 1WJDA 4GYIA 4XRSA 1ZQ3P 2BXZA 2MC4A 2WAEA 2IRFG 4BY7J 5FLMJ 2XDVA 1Y8RB 2VB6A 4IRGA 3LSGA 2KP6A 1P2FA 2KRFA 1JTYA 1QBJA 2VBXA 4BQAA 3FBNB 1UG2A 2W1OA 4ENKA 1BC8C 2PBIA 3D1NI 5IT9Z 5K5QA 3IP4B 1PP8F 2MH2A 2GXAA 4GDFA 3BR3A 2P81A 4W1UA 1IZ1A 3J7AY 5HDKA 3JRHA 3VB2A 2EWNA 5IP7J 2YUSA 3CCUI 2M0CA 2J5OA 2DFFA 4XONA 2YX7A 1BN5A 3HEFA 4HX4A 4YG2F 4CZZA 1SEUA 1UHMA 2DMNA 1ZR2A 4XRMA 5C44J 5DTDA 3HOXJ 4ZH4F 5K7ZA 1G6NA 4XM3A 3ZQHA 4JX4A 5FFXA 4F52A 3VDXA 4BQQA 2NVYJ 5E79C 4Y13A 3ZQQA 1YX3A 3M1CA 4RLFA 3K6GA 1HKTA 2L9RA 1R1TA 1MDMA 1Z3XA 4YFKF 1MMAA 1MNMC 3FXKA 5JLWA 1TT5B 1S8NA 3BG3A 3ZQ7A 2ME6A 2WTEA 1ZTRA 3OIQA 2M1BA 2VONA 1D1BA 2IW5A 2LTPA 3K1MA 2W7NA 3SZTA 1SFUA 1VQOI 4C3JJ 4RBOA 4OIQF 5J1UA 5FRMA 3IRQA 4X1EA 3FMRA 4JQFA 4KUMA 5J4VA 2VQLA 2MA3A 3E6BA 4A69C 2LY2A 2IGKA 3FXQA 2J5PA 4S04A 1FSHA 3QAHA 3S1NJ 2IVMA 4RS8A 5CPRB 4ESBA 4UVAA 1HSTA 2GXGA 2LFBA 2WWYA 3IH2A 2P4WA 4RGRA 4YIIA 1CF7B 4ABZA 2QZ8A 4BBRJ 3N4MA 3AG3H 1J9IA 2A68F 2EFNA 4MLOA 5CJ9A 2JVGA 3ISPA 1FX7A 5GADJ 1QO0D 2VN2A 3GFJA 2EZKA 2FXAA 2DQRA 1OCZH 4XMYA 3GTJJ 4C9YA 1BW5A 1ON2A 1YRNA 4PGHA 4O3MA 2PJRB 4CYDA 3BDDA 4N4OB 4DYQA 3AKZA 1LB2A 1R6RA 1VQ4I 1OCOH 3DPUA 3EUAA 4JOMA 4KDPA 4NQWB 1OCRH 1O3TA 1MBKA 5JHUA 4BHBA 2H8RA 3FM3A 3DLAA 1T0FC 2NVUB 3HZJA 3W2WA 1ZG1A 3D5SC 1Q1HA 1UHSA 2R5YB 3V8JA 3ZCOA 2R5YA 4ZYHA 4XSZF 1U8RA 2JSPA 5AIPA 5FFZA 3A0BC 2XGEA 3T8RA 4E7KA 3ESWB 5ILSA 4PJNA 2EA2A 1R1VA 2HQAA 3BZCA 4DYRA 5K5OA 3ZQCA 3TP3A 1R58A 3L2WA 2PLYA 1Z7LA 5D6EA 1P92A 3TO6A 2L02A 5TGTA 1PDNC 5F08A 4UVCA 3U1DA 2DMTA 3TEDA 1IUFA 1MH3A 4FISA 5KNLA 1YOVB 5HODA 5F64A 3BCAA 2G7HA 4A3KJ 2K7LA 2X85A 5D4SA 3Q5FA 4GO1A 1W5CC 2GAUA 5H6QA 1JE8A 2DMPA 1TBXA 3WTTC 4KMUX 2HDWA 3FKIJ 3M8EA 3J7AO 2ICWG 3WTYC 2VBZA 3JAMZ 3T0YA 1CGPA 4B43A 4HSRA 3MWMA 2XASA 1HW5A 1SD4A 2MD0A 3GTGJ 4UNOA 2IJLA 3FHZA 1Y8QB 4PK4A 3FXUA 4ENJA 5E17F 4QPQA 3DLLF 2CV0A 2B0LA 3HRMA 4Q5SF 2F5VA 1S9HA 3D0SA 3F9KA 4EGZA 1VFCA 1WKMA 3F22A 2Y75A 3AAFA 4LITA 3PUFA 4PFOA 2DCEA 5BQTA 5TRDA 2LSOA 1YIOA 3DKYA 3T8TA 2IXSA 2DXIA 4XQFA 1IGNA 2QUFA 4A2UA 4DOZA 5LGUA 4A3MJ 1ITYA 5J3LA 3VYTB 3JSPA 3G4SI 1P7JA 2LK2A 2OD5A 3ZXSA 3ELKA 4ZJZA 2NVQJ 3PIPF 4J00A 4YEJA 1MBEA 5ED4A 2ECCA 1K61A 2IGNA 2LKSA 4HF2A 1GUUA 4PDKA 4CCLA 1WH7A 2GIZA 2EPFA 1TP4A 1RC9A 2JA6J 2CRGA 1I1GA 1JJ8C 5L3FA 1MJBA 1GVDA 3OOPA 4A0YA 3HHGA 2B63J 1I6XA 4I76A 1F9NA 2Y0SA 3PNYA 4P55A 1TQMA 2EIKH 2GWRA 5LEJA 1JGGA 1P7IA 5HS8A 4AIJA 3GXOA 3RKWA 4D5FA 2OU2A 4CCMA 1B4AA 5KCMA 1H88C 3QODA 4R1HA 4BJTA 3OYAA 5J8FA 2GQQA 2BY3A 1HSJA 1G8XA 3GMEA 2HYGD 2Z3YA 2Q0OA 4CSWA 5LBQA 1RUNA 5FGMA 3G2BA 2MBFA 2ZXJA 3IH4A 3KZYA 2JPBA 4IOAF 2ZB9A 3K69A 2ZXIA 4NC6A 5L3GA 1J2XA 4EJUA 1VNDA 4LB6B 2K5CA 3TBIA 3CCLI 4PJLA 1KU7A 2F4MB 3MQ0A 3RPQA 4KITB 5FKLA 1HCRA 3GZ5A 4KIGA 3TDZC 3BC8A 1ENHA 4CCOA 2NVXJ 1F36A 3CCVI 2JRMA 1OFCX 2EB7A 3F3XA 4HDVA 1W5SA 3HOTA 1FIPA 2H09A 1B59A 3BR2A 2YU3A 5FJ8J 3V7CA 1IV8A 1G4DA 1T2KA 2EFOA 2YS9A 1IDYA 2WA0A 3CF5F 3S16J 5J8CA 1HKSA 1IDZA 2EQRA 4C2MJ 4DIQA 2HZDA 1JHFA 1FMVA 1Y56A 5F1JA 1BOAA 4PJ0C 1N77A 4RAYA 1KYWA 2M8GX 1YHQI 1WSUA 1YW8A 4YIRX 2HWVA 1VQMI 4AD9A 1ETYA 4XBFA 2QF7A 2E5NA 3VYRB 3JREA 2Z33A 3HGYA 3I71A 3P9CA 1KONA 2RNGA 3I9V2 2OTLI 1GV2A 2CW0F 3WTZA 5H20A 2ELKA 1YITI 1OYYA 1H89C 1SVOA 2X6YA 4L9VA 2LDUA 3I0TA 5D8KB 5EZHA 2ZJRF 2MLGA 4IO9F 4PJJA 4Y17A 1QZEA 5CVUA 4CZCA 2PJRA 4XR6A 2FQ3A 4GYGA 2HDCA 3BTIA 3ONQA 1LFBA 1R22A 4BE1A 2LNBA 5GPAA 4WXDA 4II2A 2YX4A 3CCEI 3F8MA 4XN3A 1D5VA 2NS8A 3RQIA 1WZ2A 3ZOBA 3WHBA 4EATA 4MGRA 2L4MA 2EH3A 1AHDP 1WJAA 1CF7A 2QVOA 2Z2SB 1PUEE 1X1BA 3B02A 5CVJA 3LSRA 1SC7A 3H1CA 3PIOF 3IL2A 1YW7A 2EZLA 4AM3A 3RSNA 3LSMA 3KYDB 3T5XA 4LOCA 2XF7A 3BG6A 4NBQA 5CQEA 2W82A 3OYBA 1OJLA 1R5ID 1FY7A 2Y30A 4RAZA 3PFIA 3LNQA 5F04A
chains in the Genus database with same CATH topology
3HIFA 4U7BA 4M6YA 2FOKA 2VC0A 4G6DA 1HXDA 1LVAA 1H9GA 3K1PA 3HYIA 3ZMTA 4WK8F 1JGSA 3C7JA 3OV8A 2CYYA 3I59A 4B8XA 1S29A 1ZRCA 1ZH5A 4UUVA 1HQCA 4ZYEA 1W4MA 2TDXA 5D5UB 1U6GA 5HLIA 5IT3A 2OAZA 1EV7A 2QQAA 1J59A 2P7CB 1ON1A 3TO7A 3CUQC 5DYMA 4M73A 2HR3A 2PQ8A 2HZTA 1Z9CA 3D5LA 4ZYDA 4L5IA 1ULYA 5BPDA 4A12A 3EQLF 3GLXA 1DUXC 3WU1B 3ZMUA 2FNPA 1B6AA 5DCMB 3CJNA 4L0ZB 5EEGA 4DQ2A 4EGYA 5EEHA 1RI7A 2DQLA 2XUBA 5L3BA 1USTA 2V1XA 5AONA 1F1ZA 1IRGA 4QWQA 5JI6A 1S7OA 2V1DA 5HOOA 3FXRA 4AWXB 4IF4A 1ZHFA 4LLGF 3F8BA 1FWZA 3KFWX 2CFXA 1K7AA 1WQ2A 3DKWA 1RZ4A 2FE3A 3I53A 1O7LA 2PG4A 4TV7A 2DLLA 4EM1A 2DK8A 1TQIA 3LA7A 4WXCA 2QBYB 1K78A 4ASNA 2BGCA 2MLKA 1YFHA 3HOSA 4EJOA 3IWFA 4I09A 3GO5A 2NRAC 4KFCA 3G73A 5E1XA 5AIQA 3SQNA 5FD5A 5ICGA 2GZWA 5DV5A 3EDPA 1TTYA 1OR7A 4M71A 1XDSA 1MKMA 5HLHA 3T1BA 2BBYA 1T0FA 2A6EF 4HYEA 3V7SA 4IRIA 2DTRA 2X0LA 4HQEA 3FMSA 4R79A 1MJ9A 3HRUA 3PQKA 1G3WA 1FZPB 1LNWA 3V8KA 4LG0B 2RKHA 1TW3A 1K78B 3U2RA 3CUQA 2L4AA 2HTJA 3K0LA 2VC1A 3GF2A 3I59B 3E97A 1D8KA 1B9NA 2VOPA 1ZAOA 4RGSA 3BOQA 1XB4A 2UWMA 3FM5A 5D6FA 5HS9A 3R0JA 1FBQA 3CLOA 1AOYA 4P96A 3FMQA 4KIFA 2JZYA 1O7FA 3H92A 2LF8A 5LHHA 3HRTA 3O2PE 3R61A 3QP5A 4XSXF 3J81K 3RI4A 2VOOA 4L0YB 2ZJ2A 4R8HA 2E7XA 1Z91A 4IHSA 2HOEA 3CDHA 1LEAA 3F6VA 1BBYA 2CQKA 1ZG5A 4HLXA 1KU2A 1RIOH 4CXFA 4IXAA 1IN5A 3L7WA 1R7JA 4EJTA 2GA1A 3DF8A 3MZHA 3M9AA 4LB5A 3FX3A 4EVIA 2ZNYA 4CHUA 4ESJA 5D5VB 1ZREA 3KCCA 4D0PA 4A0XA 2CWEA 1WI9A 4U0VA 4U7DA 1BI1A 2NNNA 1O3RA 2GA2A 2ESHA 1IN8A 2K4JA 4U88A 2NS0A 5BOXA 4PCQA 3GUDA 1IN7A 4PGGA 5LLQA 4NHJA 3COAC 1FC3A 2XGXA 2XV4S 5E20A 2C6YA 2OZUA 1YQAA 2XAJA 2XHKA 2QM3A 3DEUA 3GZ6A 1XGMA 3KETA 2WC2A 4MHGA 1LQ1A 2RC4A 4BYYA 1ZGAA 2VBWA 5DD4A 1FBSA 4OU0A 2ISZA 1UB9A 4FX0A 2HYFA 1KQ9A 2HKOA 4IPAA 1MJAA 2KJCA 2PJPA 3B73A 3QP6A 2V9VA 2DAOA 3V4GA 4ENMA 4LLLA 5FD6A 1KGSA 2MD5A 5CVVA 3CO6C 2M5WA 1J75A 5DEQA 2NAZA 2L54A 1H0MA 2UXXA 1T98A 4WXHA 3ZMZA 4I02A 3M1EA 3F21A 1Y0UA 2KIMA 1XDUA 4WCGA 4N0BA 3NEUA 5CVRA 1NHAA 2HEOA 3E5XA 6PAXA 4NB5A 1SFXA 4A6EA 4LFUA 1R00A 3RJPA 3LAPA 2A5YB 1YG2A 1E17A 3I58A 1JXSA 2IA0A 3MCZA 2E7WA 4CO8A 2XAQA 4Q48A 4HQMA 5ERIA 4JBAA 4HX7A 1L3LA 4I0BA 3F8FA 1VTNC 4I01A 3E6MA 3R60A 1P4AA 1I1SA 3L2CA 1J7KA 4OMYA 2JPCA 3REOA 4L9NA 3IHUA 2Q2EA 1YS7A 1R5HA 2ZKZA 2L01A 2FA5A 2AS5F 4XRFA 5F1RA 4MTEA 5LEKA 4N9HA 4MEXF 2V6CA 3L09A 2QYOA 1XGNA 3ABTA 5L3EA 3RDIA 3TOAA 1IXRC 1IAWA 4L18B 2V1UA 4BAYA 3HSRA 3KP4A 4WWCA 4HOBA 4UV8A 2IA2A 3KEQA 3KZZA 2IA1A 1XSXA 3K2ZA 4M6XA 5ICCA 2P8TA 2O6GE 3J80K 3WTUC 3NRVA 2BE5F 2FBIA 1W7PB 1BM9A 5LGNA 2P5LC 2HFHA 4O5VA 3LA2A 5BMZA 2F5FA 3F8NA 4HF0A 3JW4A 2ZBKA 3F6OA 1OKRA 5LGTA 4KN7X 1ZLJA 3P9KA 3SZPA 3E6CC 1U3EM 4KT5C 3ERED 2PI0A 3F72A 3JTHA 3WGHA 3DXJF 4KICA 2E1CA 2MH9A 2W24A 3KLNA 2RQPA 3HUGA 4G8XA 3BJOA 1QZYA 3L9FA 1LJ9A 1B9MA 3HRSA 5E1ZB 3BY6A 4XLPF 2GIVA 3GYHX 2F5CA 1MZBA 4Z2YA 2M87A 2OQGA 2FNAA 3O6BB 1KU3A 4LK0F 3KE2A 4P5OA 3K1NA 1IRFA 5L3DA 3J81Z 1UHWA 4I2OA 4ZZDA 4AIHA 2QENA 1L0OC 2DO7A 1KU9A 4Q4ZF 2VODA 2DT5A 2RGVA 2COMA 3GX4X 2R7FA 3M7GA 4NQWA 2OA4A 3CUOA 2IT0A 2D1VA 2PFBA 1PP7U 3H3ZA 2RNJA 5K5RA 4G94A 1HW2A 5HVQC 1X3UA 2K4BA 1G3TA 2XIGA 3E5UA 2FRHA 3WTWC 1WWXA 2BEOA 1R23A 1UFMA 2FU4A 2D45A 2A6HF 5A2QZ 1YO5C 3JSOA 4MNUA 1KQ0A 3CTAA 1P4WA 1ONVA 3ZPLA 5L3CA 3E6DA 2RN7A 3RPUA 3ZMSA 2R3SA 1EH6A 1U5TB 1FPQA 2IP2A 3QRFF 2O61A 1JHHA 4MQ9F 4MEYF 4EM2A 5TJJA 2EFQA 4GGGA 4RGUA 3MZYA 1SMTA 3ZN1A 2Z9OA 3MAJA 3ZN0A 1IF1A 1Z1DA 2XVCA 1KYZA 2XAGA 2LF7A 5BS6A 2XKOA 3EUHA 2JTVA 2STTA 2ELHA 3QOPA 4EJVA 1R5GA 3RIRA 2AXLA 3N97A 4HAMA 3K9TA 3WTSC 2VBYA 5LHGA 3I64A 1I27A 1FSEA 3IC7A 4HX8A 4ESFA 2GXBA 4ZYGA 2EV5A 2ACJA 1Z6TA 4FHTA 1IXCA 4Y15A 3TOBA 1LDKB 4OMZA 3RKYA 1SAXA 2K86A 3C18A 4XLNF 4YFXF 3PQJA 3NQOA 1EH8A 4WX9A 1K6OA 1ZLKA 2QBYA 2F2EA 5HS7A 1ZARA 1OYIA 3GVAA 3KP6A 1IUYA 3F8CA 2H27A 3MEXA 4I98B 1D3YA 4RGXA 4A6DA 1BI0A 1A04A 3VEPA 2ZO4A 3RYRA 1GVJA 2BV6A 3VODA 2FEZA 2HGCA 2PMUA 3LQRA 3HSFA 2CG4A 3ML6A 3KEOA 1G3SA 4I0AA 1UCRA 4OIOF 3DFGA 4IJAA 1F4KA 1FP1D 4WF2A 2PMHA 2DBBA 5CVIA 1U5TA 2Y0MA 1IN4A 3C3WA 2P5VA 2W57A 3ZP5A 2KKOA 3P9IA 3SFZA 1O57A 4FT8A 3QU3A 4QLCU 2YR2A 2F5EA 4G7ZF 4M9ZA 4CDGA 2A69F 4RB1A 1J5YA 4FX4A 5CYVA 5LRSA 1QQIA 1OPCA 4RB3C 1I5ZA 2XKPA 2EV0A 5BPIA 2NYXA 4E70A 5E18F 2FSWA 2FF4A 1STZA 4UXNA 2BYVE 2ETHA 3JTGA 2DPDA 3Q9VA 4LJZF 2A07F 1YS6A 1S6LA 5E8GA 3KP7A 2P6TA 5LRRA 2HS5A 5JVTA 1V3FA 2YSRA 3EETA 3JAMK 5J6XA 1IXSB 3IWZA 2WV0A 1KA8A 5DDGA 3GFLA 4OIRF 3IRRA 3RYPA 3SHFA 3VOEA 3IKTA 3ABUA 1R36A 1LDJA 4KMFA 3ZMDA 2UXNA 5DCFA 5ICEA 3DPLC 5KVRA 1K79A 2M8EA 2ESNA 5E8IA 5D5XB 1W5TA 2KJBA 2Y48A 3BPXA 2EFWA 2G7UA 1XSDA 1GHCA 3ROUA 3KP2A 4KIBA 3I4PA 2OQRA 1E2XA 1YTYA 1XCBA 2DFIA 1U78A 5IT9K 2A61A 4G7HF 5D4RA 1KQ8A 1EH7A 4B09A 1T6SA 1B1BA 3KLOA 3DPTA 3I54A 3WODF 1DPRA 3TDUC 3TGNA 3L00A 2G9WA 1FYKA 5F6FA 3LWFA 4IRHA 1P4XA 2M45A 3LQQA 5DCMA 1SFEA 3Q9SA 5FO5A 4MQVA 5HLGA 4M9SA 1D8JA 3DP7A 2H6BA 3KP5A 4OINF 2F5DA 3ECOA 2W85A 1DP7P 3ECHA 3C1DA 2CGPA 3HTSB 4M72A 2RDPA 2D1HA 1O3QA 5DUIA 4Q47A 1OYWA 4H0EA 3QPHA 1WRJA 3VFZA 2LKPA 1IW7F 2P5KA 2VE9A 3TO9A 1R1UA 1C0WA 1ZRFA 4G9YA 4ENNA 1USSA 2HTSA 2OBPA 4LMYA 3LA3A 1LDDA 1AWCA 1ZYRF 4ON0A 4EM0B 3ZMVA 1XGOA 1U5TC 4K2EA 2XAHA 2KIFA 3BPVA 4IVNA 2QQ9A 4UHTA 1YLFA 4CGZA 2ZFWA 4BHCA 4YIFA 1G3YA 2FMYA 1XN7A 1OMIA 1XMKA 2CSOA 2K27A 1TNSA 3BJAA 4A5NA 1TQPA 3V7RA 2EV6A 3E5QA 4BH9A 5H6RA 2O0YA 2ZCWA 2STWA 2KIUA 3FZVA 3M8FA 4AIKA 3LFKA 3BROA 2DI3A 3IKVA 2MC3A 3U9GA 1ZRDA 3FF5A 5DD8A 4ETSA 3BJ6A 2ZMEB 2CO5A 4CICA 2HQRA 1MD0A 4BHPA 4GCVA 1DPUA 4HV6A 3S2WA 2FBHA 1XCVA 2W84A 1ODDA 4M74A 3HHHA 4PZJA 4M9XA 5ILVA 4S05A 3WE3A 2HKXA 1QPMA 3W6JB 1YYVA 3QPTA 3GFIA 4HDUA 1QGPA 5E1WA 1FYMA 1W7PD 1TW2A 1T39A 4IHTA 4OOIA 3TQNA 4ZZLA 2A3SA 4LG0A 2IPQX 2H94A 3EYIA 4G7OF 1LEBA 4RB2C 3ULQB 2QWWA 4N9IA 2XAFA 3O3KA 4EJWA 3TKYA 4P9FA 3W6KB 1FT9A 4O6JA 4BXUA 2P6SA 4EQQA 3RTRA 2VT2A 1HW1A 4JK1X 2RV8A 2JRTA 2QQBA 3QU6A 4U0YA 1Z05A 2YPRA 5FLXZ 4MTDA 5FLXK 4OIPF 4L5JA 5JR3A 4EV0A 1O3SA 1GXQA 4HF1A 1QZZA 2K02A 4LLNA 2HQNA 3EYYA 2ZMEA 2D2WA 2EA4A 3E3VA 2ADUA 5FB2A 2H6CA 4G6QA 4L9TA 3WTXC 3BZ6A 2V79A 1ZG3A 3R0AA 2RVCA 5DUKA 5ICFA 3WE2A 1W7PA 4DNCA 3GFMA 4U0WA 1MGTA 1TLHB 2EFPA 1Z7UA 4LD5A 1FYLA 3GEZA 5KK1A 3GW2A 4GXOA 4AVPA 4I7HA 4A0ZA 1V4RA 3P7NA 2X4HA 1FP2A 1RNLA 2OZ6A 4HLYA 3H3UA 1FNNA 2VXZA 1F5TA 1XD7A 1P6RA 3WTVC 2EJRA 3WGIA 4HV5A 1SD6A 5K1YA 2W25A 1XGSA 2ZNZA 1T38A 2P7VB 3LSTA 1ZN2A 4KA4A 1FBUA 1SD5A 3F23A 2FMLA 2UZKA 1BI2A 3WU0A 3CUQB 1BJAA 3HTUA 2QLZA 4BNCA 4RB0A 5D8LB 1FOKA 2JSCA 3BWGA 5HDNA 1RUOA 2EK5A 3RKXA 1J0RA 4A5MA 3FWEA 3R4KA 5D5WB 2L3DA 1S7AA 3V8LA 2XRNA 1QNTA 5LHIA 1SMYF 3I5UA 4HZFA 1H9TA 1HKQA 1S3JA 3CO7C 1BI3A 4F7ZA 2PN6A 4HW0A 5HDGA 2Z5UA 2JT1A 3G3ZA 1MDMB 3DQVC 1HBXG 1BC7C 4KN4X 3MFKA 1GXPA 4HA8A 3LAJA 1FLIA 4L9JA 1IN6A 2PEXA 5JFRA 4KNYA 1ZGJA 3J80Z 2DU9A 2E1NA 2Q8KA 2M30A 2DPUA 3GWZA 2R7DA 2O03A 3HSEA 3BP8A 4LGWA 2O8XA 2O3FA 1XSVA 3R6SA 5ILUA 2DW4A 4YFNF 2NNYA 4UV9A 4UVBA 3KP3A 1TNTA 2VE8A 1REPC 4KYWA 4LK1F 3DV8A 2XROA 1XMAA 2Z99A 2VT3A 4P9UA 4EMSA 1SD7A 1BIAA 1DDNA 2DK5A 3WG9A 1BIBA 1U2WA 3SXYA 1YW9A 1Z6RA 2ISYA 3WGGA 5A2QK 4HBLA 2FBKA 5CLSA 4GYIA 2IRFG 4IRGA 1P2FA 2KRFA 1QBJA 2VBXA 4BQAA 4ENKA 1BC8C 2PBIA 5IT9Z 5K5QA 1PP8F 2MH2A 1IZ1A 5HDKA 3VB2A 2EWNA 2J5OA 2YX7A 1BN5A 4HX4A 4YG2F 4CZZA 1UHMA 4ZH4F 1G6NA 5FFXA 4Y13A 1HKTA 1R1TA 1MDMA 4YFKF 1S8NA 3ZQ7A 2WTEA 2M1BA 2VONA 2IW5A 3K1MA 3SZTA 1SFUA 4OIQF 3IRQA 3FMRA 4JQFA 4KUMA 2MA3A 3E6BA 3FXQA 2J5PA 4S04A 1FSHA 3QAHA 2IVMA 4RS8A 4ESBA 4UVAA 1HSTA 2GXGA 2WWYA 4RGRA 2P4WA 4YIIA 1CF7B 3N4MA 2QZ8A 1J9IA 2A68F 2EFNA 5CJ9A 3ISPA 1FX7A 1QO0D 2VN2A 3GFJA 2FXAA 2DQRA 1ON2A 4PGHA 4O3MA 4CYDA 3BDDA 1LB2A 4KDPA 1O3TA 5JHUA 4BHBA 3FM3A 1ZG1A 1Q1HA 3V8JA 4ZYHA 4XSZF 1U8RA 5AIPA 5FFZA 3T8RA 5ILSA 5K5OA 2EA2A 1R1VA 1R58A 2PLYA 5D6EA 1P92A 3TO6A 2L02A 1PDNC 4UVCA 3U1DA 5F64A 2G7HA 2K7LA 5D4SA 3Q5FA 4GO1A 2GAUA 5H6QA 1JE8A 1TBXA 3WTTC 4KMUX 3M8EA 3J7AO 3WTYC 2VBZA 3JAMZ 3T0YA 1CGPA 3MWMA 2XASA 1HW5A 1SD4A 4UNOA 2IJLA 3FHZA 4ENJA 3FXUA 5E17F 2B0LA 3HRMA 4Q5SF 3D0SA 4EGZA 1WKMA 3F22A 2Y75A 3AAFA 5BQTA 5TRDA 2LSOA 1YIOA 3T8TA 2QUFA 4A2UA 5LGUA 3JSPA 2OD5A 3ELKA 5ED4A 4HF2A 4PDKA 1I1GA 5L3FA 1MJBA 3OOPA 4A0YA 3HHGA 1I6XA 1F9NA 4P55A 1TQMA 2GWRA 5LEJA 5HS8A 4AIJA 3GXOA 3RKWA 2OU2A 1B4AA 4R1HA 5J8FA 2GQQA 1HSJA 1RUNA 2HYGD 2Z3YA 2Q0OA 5LBQA 5FGMA 2MBFA 2ZXJA 3KZYA 2JPBA 3K69A 5L3GA 1J2XA 4EJUA 4LB6B 1KU7A 3MQ0A 3RPQA 3GZ5A 4KIGA 3TDZC 2EB7A 3F3XA 4HDVA 1W5SA 3HOTA 2H09A 1B59A 2YU3A 3V7CA 1G4DA 1T2KA 2EFOA 5J8CA 1HKSA 1JHFA 1BOAA 4RAYA 1KYWA 1WSUA 1YW8A 2HWVA 4AD9A 4XBFA 2Z33A 3I71A 3P9CA 2CW0F 3WTZA 5H20A 1OYYA 4L9VA 2LDUA 3I0TA 5D8KB 2MLGA 4Y17A 5CVUA 2FQ3A 4GYGA 2HDCA 1R22A 2LNBA 4WXDA 2YX4A 3F8MA 1D5VA 4MGRA 2L4MA 1CF7A 2QVOA 1PUEE 3B02A 5CVJA 3IL2A 1YW7A 3T5XA 1FY7A 4RAZA 3PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIF A;  4U7B A;  4M6Y A;  2FOK A;  2VC0 A;  4G6D A;  1HXD A;  1LVA A;  1H9G A;  3K1P A;  3HYI A;  3ZMT A;  4WK8 F;  1JGS A;  3C7J A;  3OV8 A;  2CYY A;  3I59 A;  4B8X A;  1S29 A;  1ZRC A;  1ZH5 A;  4UUV A;  1HQC A;  4ZYE A;  1W4M A;  2TDX A;  5D5U B;  1U6G A;  5HLI A;  5IT3 A;  2OAZ A;  1EV7 A;  2QQA A;  1J59 A;  2P7C B;  1ON1 A;  3TO7 A;  3CUQ C;  5DYM A;  4M73 A;  2HR3 A;  2PQ8 A;  2HZT A;  1Z9C A;  3D5L A;  4ZYD A;  4L5I A;  1ULY A;  5BPD A;  4A12 A;  3EQL F;  3GLX A;  1DUX C;  3WU1 B;  3ZMU A;  2FNP A;  1B6A A;  5DCM B;  3CJN A;  4L0Z B;  5EEG A;  4DQ2 A;  4EGY A;  5EEH A;  1RI7 A;  2DQL A;  2XUB A;  5L3B A;  1UST A;  2V1X A;  5AON A;  1F1Z A;  1IRG A;  4QWQ A;  5JI6 A;  1S7O A;  2V1D A;  5HOO A;  3FXR A;  4AWX B;  4IF4 A;  1ZHF A;  4LLG F;  3F8B A;  1FWZ A;  3KFW X;  2CFX A;  1K7A A;  1WQ2 A;  3DKW A;  1RZ4 A;  2FE3 A;  3I53 A;  1O7L A;  2PG4 A;  4TV7 A;  2DLL A;  4EM1 A;  2DK8 A;  1TQI A;  3LA7 A;  4WXC A;  2QBY B;  1K78 A;  4ASN A;  2BGC A;  2MLK A;  1YFH A;  3HOS A;  4EJO A;  3IWF A;  4I09 A;  3GO5 A;  2NRA C;  4KFC A;  3G73 A;  5E1X A;  5AIQ A;  3SQN A;  5FD5 A;  5ICG A;  2GZW A;  5DV5 A;  3EDP A;  1TTY A;  1OR7 A;  4M71 A;  1XDS A;  1MKM A;  5HLH A;  3T1B A;  2BBY A;  1T0F A;  2A6E F;  4HYE A;  3V7S A;  4IRI A;  2DTR A;  2X0L A;  4HQE A;  3FMS A;  4R79 A;  1MJ9 A;  3HRU A;  3PQK A;  1G3W A;  1FZP B;  1LNW A;  3V8K A;  4LG0 B;  2RKH A;  1TW3 A;  1K78 B;  3U2R A;  3CUQ A;  2L4A A;  2HTJ A;  3K0L A;  2VC1 A;  3GF2 A;  3I59 B;  3E97 A;  1D8K A;  1B9N A;  2VOP A;  1ZAO A;  4RGS A;  3BOQ A;  1XB4 A;  2UWM A;  3FM5 A;  5D6F A;  5HS9 A;  3R0J A;  1FBQ A;  3CLO A;  1AOY A;  4P96 A;  3FMQ A;  4KIF A;  2JZY A;  1O7F A;  3H92 A;  2LF8 A;  5LHH A;  3HRT A;  3O2P E;  3R61 A;  3QP5 A;  4XSX F;  3J81 K;  3RI4 A;  2VOO A;  4L0Y B;  2ZJ2 A;  4R8H A;  2E7X A;  1Z91 A;  4IHS A;  2HOE A;  3CDH A;  1LEA A;  3F6V A;  1BBY A;  2CQK A;  1ZG5 A;  4HLX A;  1KU2 A;  1RIO H;  4CXF A;  4IXA A;  1IN5 A;  3L7W A;  1R7J A;  4EJT A;  2GA1 A;  3DF8 A;  3MZH A;  3M9A A;  4LB5 A;  3FX3 A;  4EVI A;  2ZNY A;  4CHU A;  4ESJ A;  5D5V B;  1ZRE A;  3KCC A;  4D0P A;  4A0X A;  2CWE A;  1WI9 A;  4U0V A;  4U7D A;  1BI1 A;  2NNN A;  1O3R A;  2GA2 A;  2ESH A;  1IN8 A;  2K4J A;  4U88 A;  2NS0 A;  5BOX A;  4PCQ A;  3GUD A;  1IN7 A;  4PGG A;  5LLQ A;  4NHJ A;  3COA C;  1FC3 A;  2XGX A;  2XV4 S;  5E20 A;  2C6Y A;  2OZU A;  1YQA A;  2XAJ A;  2XHK A;  2QM3 A;  3DEU A;  3GZ6 A;  1XGM A;  3KET A;  2WC2 A;  4MHG A;  1LQ1 A;  2RC4 A;  4BYY A;  1ZGA A;  2VBW A;  5DD4 A;  1FBS A;  4OU0 A;  2ISZ A;  1UB9 A;  4FX0 A;  2HYF A;  1KQ9 A;  2HKO A;  4IPA A;  1MJA A;  2KJC A;  2PJP A;  3B73 A;  3QP6 A;  2V9V A;  2DAO A;  3V4G A;  4ENM A;  4LLL A;  5FD6 A;  1KGS A;  2MD5 A;  5CVV A;  3CO6 C;  2M5W A;  1J75 A;  5DEQ A;  2NAZ A;  2L54 A;  1H0M A;  2UXX A;  1T98 A;  4WXH A;  3ZMZ A;  4I02 A;  3M1E A;  3F21 A;  1Y0U A;  2KIM A;  1XDU A;  4WCG A;  4N0B A;  3NEU A;  5CVR A;  1NHA A;  2HEO A;  3E5X A;  6PAX A;  4NB5 A;  1SFX A;  4A6E A;  4LFU A;  1R00 A;  3RJP A;  3LAP A;  2A5Y B;  1YG2 A;  1E17 A;  3I58 A;  1JXS A;  2IA0 A;  3MCZ A;  2E7W A;  4CO8 A;  2XAQ A;  4Q48 A;  4HQM A;  5ERI A;  4JBA A;  4HX7 A;  1L3L A;  4I0B A;  3F8F A;  1VTN C;  4I01 A;  3E6M A;  3R60 A;  1P4A A;  1I1S A;  3L2C A;  1J7K A;  4OMY A;  2JPC A;  3REO A;  4L9N A;  3IHU A;  2Q2E A;  1YS7 A;  1R5H A;  2ZKZ A;  2L01 A;  2FA5 A;  2AS5 F;  4XRF A;  5F1R A;  4MTE A;  5LEK A;  4N9H A;  4MEX F;  2V6C A;  3L09 A;  2QYO A;  1XGN A;  3ABT A;  5L3E A;  3RDI A;  3TOA A;  1IXR C;  1IAW A;  4L18 B;  2V1U A;  4BAY A;  3HSR A;  3KP4 A;  4WWC A;  4HOB A;  4UV8 A;  2IA2 A;  3KEQ A;  3KZZ A;  2IA1 A;  1XSX A;  3K2Z A;  4M6X A;  5ICC A;  2P8T A;  2O6G E;  3J80 K;  3WTU C;  3NRV A;  2BE5 F;  2FBI A;  1W7P B;  1BM9 A;  5LGN A;  2P5L C;  2HFH A;  4O5V A;  3LA2 A;  5BMZ A;  2F5F A;  3F8N A;  4HF0 A;  3JW4 A;  2ZBK A;  3F6O A;  1OKR A;  5LGT A;  4KN7 X;  1ZLJ A;  3P9K A;  3SZP A;  3E6C C;  1U3E M;  4KT5 C;  3ERE D;  2PI0 A;  3F72 A;  3JTH A;  3WGH A;  3DXJ F;  4KIC A;  2E1C A;  2MH9 A;  2W24 A;  3KLN A;  2RQP A;  3HUG A;  4G8X A;  3BJO A;  1QZY A;  3L9F A;  1LJ9 A;  1B9M A;  3HRS A;  5E1Z B;  3BY6 A;  4XLP F;  2GIV A;  3GYH X;  2F5C A;  1MZB A;  4Z2Y A;  2M87 A;  2OQG A;  2FNA A;  3O6B B;  1KU3 A;  4LK0 F;  3KE2 A;  4P5O A;  3K1N A;  1IRF A;  5L3D A;  3J81 Z;  1UHW A;  4I2O A;  4ZZD A;  4AIH A;  2QEN A;  1L0O C;  2DO7 A;  1KU9 A;  4Q4Z F;  2VOD A;  2DT5 A;  2RGV A;  2COM A;  3GX4 X;  2R7F A;  3M7G A;  4NQW A;  2OA4 A;  3CUO A;  2IT0 A;  2D1V A;  2PFB A;  1PP7 U;  3H3Z A;  2RNJ A;  5K5R A;  4G94 A;  1HW2 A;  5HVQ C;  1X3U A;  2K4B A;  1G3T A;  2XIG A;  3E5U A;  2FRH A;  3WTW C;  1WWX A;  2BEO A;  1R23 A;  1UFM A;  2FU4 A;  2D45 A;  2A6H F;  5A2Q Z;  1YO5 C;  3JSO A;  4MNU A;  1KQ0 A;  3CTA A;  1P4W A;  1ONV A;  3ZPL A;  5L3C A;  3E6D A;  2RN7 A;  3RPU A;  3ZMS A;  2R3S A;  1EH6 A;  1U5T B;  1FPQ A;  2IP2 A;  3QRF F;  2O61 A;  1JHH A;  4MQ9 F;  4MEY F;  4EM2 A;  5TJJ A;  2EFQ A;  4GGG A;  4RGU A;  3MZY A;  1SMT A;  3ZN1 A;  2Z9O A;  3MAJ A;  3ZN0 A;  1IF1 A;  1Z1D A;  2XVC A;  1KYZ A;  2XAG A;  2LF7 A;  5BS6 A;  2XKO A;  3EUH A;  2JTV A;  2STT A;  2ELH A;  3QOP A;  4EJV A;  1R5G A;  3RIR A;  2AXL A;  3N97 A;  4HAM A;  3K9T A;  3WTS C;  2VBY A;  5LHG A;  3I64 A;  1I27 A;  1FSE A;  3IC7 A;  4HX8 A;  4ESF A;  2GXB A;  4ZYG A;  2EV5 A;  2ACJ A;  1Z6T A;  4FHT A;  1IXC A;  4Y15 A;  3TOB A;  1LDK B;  4OMZ A;  3RKY A;  1SAX A;  2K86 A;  3C18 A;  4XLN F;  4YFX F;  3PQJ A;  3NQO A;  1EH8 A;  4WX9 A;  1K6O A;  1ZLK A;  2QBY A;  2F2E A;  5HS7 A;  1ZAR A;  1OYI A;  3GVA A;  3KP6 A;  1IUY A;  3F8C A;  2H27 A;  3MEX A;  4I98 B;  1D3Y A;  4RGX A;  4A6D A;  1BI0 A;  1A04 A;  3VEP A;  2ZO4 A;  3RYR A;  1GVJ A;  2BV6 A;  3VOD A;  2FEZ A;  2HGC A;  2PMU A;  3LQR A;  3HSF A;  2CG4 A;  3ML6 A;  3KEO A;  1G3S A;  4I0A A;  1UCR A;  4OIO F;  3DFG A;  4IJA A;  1F4K A;  1FP1 D;  4WF2 A;  2PMH A;  2DBB A;  5CVI A;  1U5T A;  2Y0M A;  1IN4 A;  3C3W A;  2P5V A;  2W57 A;  3ZP5 A;  2KKO A;  3P9I A;  3SFZ A;  1O57 A;  4FT8 A;  3QU3 A;  4QLC U;  2YR2 A;  2F5E A;  4G7Z F;  4M9Z A;  4CDG A;  2A69 F;  4RB1 A;  1J5Y A;  4FX4 A;  5CYV A;  5LRS A;  1QQI A;  1OPC A;  4RB3 C;  1I5Z A;  2XKP A;  2EV0 A;  5BPI A;  2NYX A;  4E70 A;  5E18 F;  2FSW A;  2FF4 A;  1STZ A;  4UXN A;  2BYV E;  2ETH A;  3JTG A;  2DPD A;  3Q9V A;  4LJZ F;  2A07 F;  1YS6 A;  1S6L A;  5E8G A;  3KP7 A;  2P6T A;  5LRR A;  2HS5 A;  5JVT A;  1V3F A;  2YSR A;  3EET A;  3JAM K;  5J6X A;  1IXS B;  3IWZ A;  2WV0 A;  1KA8 A;  5DDG A;  3GFL A;  4OIR F;  3IRR A;  3RYP A;  3SHF A;  3VOE A;  3IKT A;  3ABU A;  1R36 A;  1LDJ A;  4KMF A;  3ZMD A;  2UXN A;  5DCF A;  5ICE A;  3DPL C;  5KVR A;  1K79 A;  2M8E A;  2ESN A;  5E8I A;  5D5X B;  1W5T A;  2KJB A;  2Y48 A;  3BPX A;  2EFW A;  2G7U A;  1XSD A;  1GHC A;  3ROU A;  3KP2 A;  4KIB A;  3I4P A;  2OQR A;  1E2X A;  1YTY A;  1XCB A;  2DFI A;  1U78 A;  5IT9 K;  2A61 A;  4G7H F;  5D4R A;  1KQ8 A;  1EH7 A;  4B09 A;  1T6S A;  1B1B A;  3KLO A;  3DPT A;  3I54 A;  3WOD F;  1DPR A;  3TDU C;  3TGN A;  3L00 A;  2G9W A;  1FYK A;  5F6F A;  3LWF A;  4IRH A;  1P4X A;  2M45 A;  3LQQ A;  5DCM A;  1SFE A;  3Q9S A;  5FO5 A;  4MQV A;  5HLG A;  4M9S A;  1D8J A;  3DP7 A;  2H6B A;  3KP5 A;  4OIN F;  2F5D A;  3ECO A;  2W85 A;  1DP7 P;  3ECH A;  3C1D A;  2CGP A;  3HTS B;  4M72 A;  2RDP A;  2D1H A;  1O3Q A;  5DUI A;  4Q47 A;  1OYW A;  4H0E A;  3QPH A;  1WRJ A;  3VFZ A;  2LKP A;  1IW7 F;  2P5K A;  2VE9 A;  3TO9 A;  1R1U A;  1C0W A;  1ZRF A;  4G9Y A;  4ENN A;  1USS A;  2HTS A;  2OBP A;  4LMY A;  3LA3 A;  1LDD A;  1AWC A;  1ZYR F;  4ON0 A;  4EM0 B;  3ZMV A;  1XGO A;  1U5T C;  4K2E A;  2XAH A;  2KIF A;  3BPV A;  4IVN A;  2QQ9 A;  4UHT A;  1YLF A;  4CGZ A;  2ZFW A;  4BHC A;  4YIF A;  1G3Y A;  2FMY A;  1XN7 A;  1OMI A;  1XMK A;  2CSO A;  2K27 A;  1TNS A;  3BJA A;  4A5N A;  1TQP A;  3V7R A;  2EV6 A;  3E5Q A;  4BH9 A;  5H6R A;  2O0Y A;  2ZCW A;  2STW A;  2KIU A;  3FZV A;  3M8F A;  4AIK A;  3LFK A;  3BRO A;  2DI3 A;  3IKV A;  2MC3 A;  3U9G A;  1ZRD A;  3FF5 A;  5DD8 A;  4ETS A;  3BJ6 A;  2ZME B;  2CO5 A;  4CIC A;  2HQR A;  1MD0 A;  4BHP A;  4GCV A;  1DPU A;  4HV6 A;  3S2W A;  2FBH A;  1XCV A;  2W84 A;  1ODD A;  4M74 A;  3HHH A;  4PZJ A;  4M9X A;  5ILV A;  4S05 A;  3WE3 A;  2HKX A;  1QPM A;  3W6J B;  1YYV A;  3QPT A;  3GFI A;  4HDU A;  1QGP A;  5E1W A;  1FYM A;  1W7P D;  1TW2 A;  1T39 A;  4IHT A;  4OOI A;  3TQN A;  4ZZL A;  2A3S A;  4LG0 A;  2IPQ X;  2H94 A;  3EYI A;  4G7O F;  1LEB A;  4RB2 C;  3ULQ B;  2QWW A;  4N9I A;  2XAF A;  3O3K A;  4EJW A;  3TKY A;  4P9F A;  3W6K B;  1FT9 A;  4O6J A;  4BXU A;  2P6S A;  4EQQ A;  3RTR A;  2VT2 A;  1HW1 A;  4JK1 X;  2RV8 A;  2JRT A;  2QQB A;  3QU6 A;  4U0Y A;  1Z05 A;  2YPR A;  5FLX Z;  4MTD A;  5FLX K;  4OIP F;  4L5J A;  5JR3 A;  4EV0 A;  1O3S A;  1GXQ A;  4HF1 A;  1QZZ A;  2K02 A;  4LLN A;  2HQN A;  3EYY A;  2ZME A;  2D2W A;  2EA4 A;  3E3V A;  2ADU A;  5FB2 A;  2H6C A;  4G6Q A;  4L9T A;  3WTX C;  3BZ6 A;  2V79 A;  1ZG3 A;  3R0A A;  2RVC A;  5DUK A;  5ICF A;  3WE2 A;  1W7P A;  4DNC A;  3GFM A;  4U0W A;  1MGT A;  1TLH B;  2EFP A;  1Z7U A;  4LD5 A;  1FYL A;  3GEZ A;  5KK1 A;  3GW2 A;  4GXO A;  4AVP A;  4I7H A;  4A0Z A;  1V4R A;  3P7N A;  2X4H A;  1FP2 A;  1RNL A;  2OZ6 A;  4HLY A;  3H3U A;  1FNN A;  2VXZ A;  1F5T A;  1XD7 A;  1P6R A;  3WTV C;  2EJR A;  3WGI A;  4HV5 A;  1SD6 A;  5K1Y A;  2W25 A;  1XGS A;  2ZNZ A;  1T38 A;  2P7V B;  3LST A;  1ZN2 A;  4KA4 A;  1FBU A;  1SD5 A;  3F23 A;  2FML A;  2UZK A;  1BI2 A;  3WU0 A;  3CUQ B;  1BJA A;  3HTU A;  2QLZ A;  4BNC A;  4RB0 A;  5D8L B;  1FOK A;  2JSC A;  3BWG A;  5HDN A;  1RUO A;  2EK5 A;  3RKX A;  1J0R A;  4A5M A;  3FWE A;  3R4K A;  5D5W B;  2L3D A;  1S7A A;  3V8L A;  2XRN A;  1QNT A;  5LHI A;  1SMY F;  3I5U A;  4HZF A;  1H9T A;  1HKQ A;  1S3J A;  3CO7 C;  1BI3 A;  4F7Z A;  2PN6 A;  4HW0 A;  5HDG A;  2Z5U A;  2JT1 A;  3G3Z A;  1MDM B;  3DQV C;  1HBX G;  1BC7 C;  4KN4 X;  3MFK A;  1GXP A;  4HA8 A;  3LAJ A;  1FLI A;  4L9J A;  1IN6 A;  2PEX A;  5JFR A;  4KNY A;  1ZGJ A;  3J80 Z;  2DU9 A;  2E1N A;  2Q8K A;  2M30 A;  2DPU A;  3GWZ A;  2R7D A;  2O03 A;  3HSE A;  3BP8 A;  4LGW A;  2O8X A;  2O3F A;  1XSV A;  3R6S A;  5ILU A;  2DW4 A;  4YFN F;  2NNY A;  4UV9 A;  4UVB A;  3KP3 A;  1TNT A;  2VE8 A;  1REP C;  4KYW A;  4LK1 F;  3DV8 A;  2XRO A;  1XMA A;  2Z99 A;  2VT3 A;  4P9U A;  4EMS A;  1SD7 A;  1BIA A;  1DDN A;  2DK5 A;  3WG9 A;  1BIB A;  1U2W A;  3SXY A;  1YW9 A;  1Z6R A;  2ISY A;  3WGG A;  5A2Q K;  4HBL A;  2FBK A;  5CLS A;  4GYI A;  2IRF G;  4IRG A;  1P2F A;  2KRF A;  1QBJ A;  2VBX A;  4BQA A;  4ENK A;  1BC8 C;  2PBI A;  5IT9 Z;  5K5Q A;  1PP8 F;  2MH2 A;  1IZ1 A;  5HDK A;  3VB2 A;  2EWN A;  2J5O A;  2YX7 A;  1BN5 A;  4HX4 A;  4YG2 F;  4CZZ A;  1UHM A;  4ZH4 F;  1G6N A;  5FFX A;  4Y13 A;  1HKT A;  1R1T A;  1MDM A;  4YFK F;  1S8N A;  3ZQ7 A;  2WTE A;  2M1B A;  2VON A;  2IW5 A;  3K1M A;  3SZT A;  1SFU A;  4OIQ F;  3IRQ A;  3FMR A;  4JQF A;  4KUM A;  2MA3 A;  3E6B A;  3FXQ A;  2J5P A;  4S04 A;  1FSH A;  3QAH A;  2IVM A;  4RS8 A;  4ESB A;  4UVA A;  1HST A;  2GXG A;  2WWY A;  4RGR A;  2P4W A;  4YII A;  1CF7 B;  3N4M A;  2QZ8 A;  1J9I A;  2A68 F;  2EFN A;  5CJ9 A;  3ISP A;  1FX7 A;  1QO0 D;  2VN2 A;  3GFJ A;  2FXA A;  2DQR A;  1ON2 A;  4PGH A;  4O3M A;  4CYD A;  3BDD A;  1LB2 A;  4KDP A;  1O3T A;  5JHU A;  4BHB A;  3FM3 A;  1ZG1 A;  1Q1H A;  3V8J A;  4ZYH A;  4XSZ F;  1U8R A;  5AIP A;  5FFZ A;  3T8R A;  5ILS A;  5K5O A;  2EA2 A;  1R1V A;  1R58 A;  2PLY A;  5D6E A;  1P92 A;  3TO6 A;  2L02 A;  1PDN C;  4UVC A;  3U1D A;  5F64 A;  2G7H A;  2K7L A;  5D4S A;  3Q5F A;  4GO1 A;  2GAU A;  5H6Q A;  1JE8 A;  1TBX A;  3WTT C;  4KMU X;  3M8E A;  3J7A O;  3WTY C;  2VBZ A;  3JAM Z;  3T0Y A;  1CGP A;  3MWM A;  2XAS A;  1HW5 A;  1SD4 A;  4UNO A;  2IJL A;  3FHZ A;  4ENJ A;  3FXU A;  5E17 F;  2B0L A;  3HRM A;  4Q5S F;  3D0S A;  4EGZ A;  1WKM A;  3F22 A;  2Y75 A;  3AAF A;  5BQT A;  5TRD A;  2LSO A;  1YIO A;  3T8T A;  2QUF A;  4A2U A;  5LGU A;  3JSP A;  2OD5 A;  3ELK A;  5ED4 A;  4HF2 A;  4PDK A;  1I1G A;  5L3F A;  1MJB A;  3OOP A;  4A0Y A;  3HHG A;  1I6X A;  1F9N A;  4P55 A;  1TQM A;  2GWR A;  5LEJ A;  5HS8 A;  4AIJ A;  3GXO A;  3RKW A;  2OU2 A;  1B4A A;  4R1H A;  5J8F A;  2GQQ A;  1HSJ A;  1RUN A;  2HYG D;  2Z3Y A;  2Q0O A;  5LBQ A;  5FGM A;  2MBF A;  2ZXJ A;  3KZY A;  2JPB A;  3K69 A;  5L3G A;  1J2X A;  4EJU A;  4LB6 B;  1KU7 A;  3MQ0 A;  3RPQ A;  3GZ5 A;  4KIG A;  3TDZ C;  2EB7 A;  3F3X A;  4HDV A;  1W5S A;  3HOT A;  2H09 A;  1B59 A;  2YU3 A;  3V7C A;  1G4D A;  1T2K A;  2EFO A;  5J8C A;  1HKS A;  1JHF A;  1BOA A;  4RAY A;  1KYW A;  1WSU A;  1YW8 A;  2HWV A;  4AD9 A;  4XBF A;  2Z33 A;  3I71 A;  3P9C A;  2CW0 F;  3WTZ A;  5H20 A;  1OYY A;  4L9V A;  2LDU A;  3I0T A;  5D8K B;  2MLG A;  4Y17 A;  5CVU A;  2FQ3 A;  4GYG A;  2HDC A;  1R22 A;  2LNB A;  4WXD A;  2YX4 A;  3F8M A;  1D5V A;  4MGR A;  2L4M A;  1CF7 A;  2QVO A;  1PUE E;  3B02 A;  5CVJ A;  3IL2 A;  1YW7 A;  3T5X A;  1FY7 A;  4RAZ A;  3PFI A; 
#chains in the Genus database with same CATH topology
 3HIF A;  4U7B A;  1RKW A;  3M4O J;  4M6Y A;  2FOK A;  4XOP A;  2VC0 A;  3QYB A;  4G6D A;  3G6E I;  1HXD A;  1TZL A;  2BHY A;  2RQQ A;  1JJ6 C;  1LVA A;  5HNF A;  1H9G A;  3E0J B;  2FX0 A;  3K1P A;  2V7F A;  2A05 A;  3F0C A;  3ZQG A;  3Q3S A;  2HOT A;  4IHX A;  3HYI A;  3DWL E;  3ZMT A;  1QRY A;  2BOL A;  3BR5 A;  1YX5 A;  4WK8 F;  2CJJ A;  1JGS A;  2CW7 A;  1JKP C;  2GBY A;  2V4J C;  3C7J A;  2QEX I;  3N05 A;  3OV8 A;  2YU9 J;  1BOB A;  3OYI A;  3AG1 H;  2CYY A;  3QOE A;  3K4N A;  1HDP A;  3I59 A;  3OIO A;  4MFD A;  4B8X A;  1S29 A;  2R5Z A;  1ZRC A;  3BG9 A;  1PUF A;  1JKQ C;  2KRC A;  1ZH5 A;  4UUV A;  4IOC F;  2CH0 A;  1HQC A;  4RA2 A;  3BTC A;  4ZYE A;  1BR4 A;  1W4M A;  1MMG A;  2TDX A;  5D5U B;  4MFE A;  1U6G A;  1VI0 A;  2HVR A;  5HLI A;  2QKL B;  5IT3 A;  2OAZ A;  1EV7 A;  3LMM A;  2K9S A;  3HOZ J;  2DA6 A;  2R0Q C;  2JMW A;  2QQA A;  1ETV A;  1J59 A;  4X6A J;  2P7C B;  4JP0 A;  1ON1 A;  3TO7 A;  1LKX A;  3CUQ C;  5DYM A;  4M73 A;  2HR3 A;  2PQ8 A;  2HZT A;  1Y1V J;  1MIJ A;  1Z9C A;  3D5L A;  3ZR8 X;  1OLT A;  4ZYD A;  4L5I A;  3HOV J;  4ZDL A;  1ULY A;  4A12 A;  5BPD A;  4I99 C;  3EQL F;  3GLX A;  4M3D A;  1DUX C;  3WU1 B;  3CDI A;  3ZMU A;  5DS9 A;  3HM5 A;  3JR9 A;  2F4O B;  2FNP A;  1B6A A;  5DCM B;  2FQ4 A;  3CJN A;  4XID A;  4L0Z B;  5EEG A;  2AO9 A;  4DQ2 A;  4EGY A;  5EEH A;  3HOU J;  1LFP A;  4IHW A;  2Y0S N;  3GTP J;  1RI7 A;  1PJR A;  2DQL A;  1OR7 C;  2XUB A;  3BR1 A;  5L3B A;  1UST A;  4RMN A;  2V1X A;  2E36 A;  3DBH B;  5AON A;  1F1Z A;  2HOA A;  1IRG A;  4QWQ A;  5M5Y J;  5JI6 A;  2R7O A;  1WH5 A;  2XF6 A;  1S7O A;  2V1D A;  4AUX A;  3V42 A;  4F92 B;  5HOO A;  3FXR A;  4AWX B;  2R7X A;  2DJI A;  4IF4 A;  2K9L A;  1VQ5 I;  1ZHF A;  2AHQ A;  4LLG F;  3GTL J;  3F8B A;  1FWZ A;  3KFW X;  4KJZ A;  2CFX A;  1K7A A;  1WQ2 A;  3DKW A;  1RZ4 A;  1X1A A;  2FE3 A;  3L2Q A;  4AC0 A;  3I53 A;  3RPU D;  2R7Q A;  3CMA I;  1O7L A;  2PG4 A;  4TV7 A;  2DLL A;  1QPI A;  2MFZ A;  4EM1 A;  4UUS A;  2DK8 A;  1TQI A;  3LA7 A;  4WXC A;  4AYB A;  2QBY B;  2X6X A;  1K78 A;  4ASN A;  1ACI A;  5EZG A;  4ZTJ A;  3DU6 A;  2CMP A;  3DTE A;  2HOS A;  2JA2 A;  2BGC A;  1GDT A;  2KDO A;  4M3F A;  5DM6 F;  2MLK A;  2OV7 A;  2IS1 A;  1YFH A;  2X48 A;  2VUM J;  3HOS A;  4EJO A;  4DW6 A;  3KEY A;  2DA3 A;  3IWF A;  4I09 A;  3GO5 A;  2NRA C;  2IS6 A;  2Z16 A;  2HNH A;  4ITV A;  3IAM 2;  3VYU B;  2BHZ A;  2W48 A;  4KFC A;  3G73 A;  5E1X A;  5AIQ A;  2VI6 A;  3SQN A;  1B8I A;  5FD5 A;  1SVM A;  5ICG A;  2GZW A;  5DV5 A;  3EDP A;  1S5L C;  1TTY A;  2M34 A;  1OR7 A;  4M71 A;  2F6C A;  2E2I J;  4IQJ A;  2LRE A;  1BR1 A;  2HVQ A;  3BR6 A;  1XDS A;  1MKM A;  5HLH A;  3T1B A;  2VJ4 A;  3NAR A;  2BBY A;  1T0F A;  2A6E F;  4HYE A;  3V7S A;  4IRI A;  1Q1V A;  2DTR A;  2X0L A;  4HQE A;  3FMS A;  4N4N B;  1MJ9 A;  3HRU A;  4R79 A;  1FJL A;  1YIJ I;  3PQK A;  3PO3 J;  1X3W B;  1G3W A;  3AG2 H;  3A03 A;  4BEH A;  4ZDP A;  1FZP B;  1LNW A;  3GTO J;  3V8K A;  3H0D A;  4LG0 B;  3O8H A;  2RKH A;  1TW3 A;  5M5W J;  1K78 B;  1WVR A;  3PSI A;  3U2R A;  3CUQ A;  2L4A A;  3OL3 A;  2CUF A;  3WHC A;  2HTJ A;  3K0L A;  2I5U A;  2VC1 A;  1E3O C;  3GF2 A;  3I59 B;  1I3Q J;  3K70 D;  4U87 A;  3E97 A;  1D8K A;  2IGM A;  1X2M A;  1B9N A;  2KIS A;  2VOP A;  2QSH X;  1ZAO A;  2OF7 A;  4HG2 A;  4RGS A;  3L2R A;  3H36 A;  3BOQ A;  3FXO A;  1XB4 A;  4D9J A;  2UWM A;  3FM5 A;  2M0M A;  5D6F A;  5HS9 A;  3R0J A;  2R7T A;  1FBQ A;  4BE2 A;  4XKV A;  3CLO A;  5JHF A;  2WAD A;  3H0G J;  1AKH B;  1AOY A;  2M2E A;  3B6A A;  4IHY A;  4P96 A;  1X4O A;  3FMQ A;  4GRI A;  4KIF A;  5EJC A;  2JZY A;  1O7F A;  2DFH A;  3H92 A;  2BXY A;  2LF8 A;  5LHH A;  3HRT A;  1X19 A;  3C2B A;  3HC7 A;  3O2P E;  3R61 A;  3QP5 A;  4L5E A;  4XSX F;  2HU9 A;  3J81 K;  3RI4 A;  2VOO A;  1W36 D;  4L0Y B;  2ZJ2 A;  4B4C A;  4R8H A;  2G0E A;  5JVG F;  2E7X A;  1Z0X A;  1Z91 A;  4IHS A;  2VIX A;  2HOE A;  4BBS J;  3CDH A;  3OS1 A;  1LEA A;  2GLO A;  2F48 A;  3NAU A;  3F6V A;  3L2U A;  1BBY A;  2CQK A;  3QYE A;  2OCE A;  3TP0 A;  1ZG5 A;  1RPW A;  4RAG A;  4HLX A;  1KU2 A;  2DOF A;  5B1A H;  2E34 A;  1RIO H;  2Y9Y A;  4CXF A;  5FRO A;  1ETO A;  4A3I J;  4IXA A;  1IN5 A;  3BCB A;  2AQE A;  3L7W A;  2WB1 N;  1R7J A;  4EJT A;  3Q0V A;  1K83 J;  3DEW A;  2GA1 A;  3AG4 H;  3DF8 A;  4OWR B;  1HOM A;  3MZH A;  3M9A A;  4LB5 A;  3ZQL A;  3FX3 A;  4JX6 A;  4EVI A;  2ZNY A;  4CHU A;  2KZV A;  2LBF A;  4ESJ A;  5D5V B;  2QSG X;  3KCC A;  1ZRE A;  2O8K A;  4XLE A;  4D0P A;  9ANT A;  4A0X A;  3BT9 A;  2CWE A;  1WI9 A;  3OYH A;  4U0V A;  4U7D A;  1BI1 A;  2NNN A;  1O3R A;  2GA2 A;  2EZH A;  1T95 A;  2ESH A;  1IN8 A;  3CCM I;  2K4J A;  4U88 A;  2KMU A;  3JRA A;  2NS0 A;  2LRD A;  3MVP A;  4Y52 J;  3OYL A;  2E19 A;  1BR2 A;  3HPH A;  4PCQ A;  5BOX A;  3GUD A;  1IN7 A;  3PNV A;  1VQL I;  4PGG A;  5LLQ A;  4NHJ A;  3COA C;  1FC3 A;  1ZK8 A;  2XGX A;  2XPU A;  2XV4 S;  5E20 A;  1B72 B;  2K3P A;  3RZO J;  1ORK A;  2C6Y A;  2OZU A;  1YQA A;  2XAJ A;  2DDA A;  2LYC A;  4E7J A;  2XHK A;  1EJ9 A;  1RKT A;  2QM3 A;  1E0E A;  2Y2Z A;  4NUB A;  2CQQ A;  3DEU A;  3GZ6 A;  3W3C A;  2MAB A;  2L7M P;  1XGM A;  3KET A;  2WC2 A;  4MHG A;  2IS4 A;  1U0J A;  4KIS A;  1LQ1 A;  3FXM A;  1ETQ A;  2RC4 A;  4BYY A;  1ZGA A;  2VBW A;  3LFU A;  1B8I B;  5DD4 A;  4QTR A;  1FBS A;  4OU0 A;  4CCJ A;  2BY1 A;  3A4C A;  3JRB A;  5BNG A;  2ISZ A;  2DYS H;  2MG4 A;  1UB9 A;  4FX0 A;  5LD2 C;  2HYF A;  3J7Y J;  4BDZ A;  2VKV A;  1KQ9 A;  1MBG A;  4LIU A;  2HKO A;  5FKM A;  2VJJ A;  4IPA A;  3ZRG A;  4ZTF A;  2LLK A;  1MJA A;  4DYC A;  2KJC A;  1RR8 C;  2PJP A;  1R49 A;  4ZC3 A;  3OSG A;  2E60 A;  3B73 A;  2E1M C;  1A36 A;  3QP6 A;  2V9V A;  3I56 I;  2NOJ B;  3CME I;  2DAO A;  1DU6 A;  3V4G A;  4ENM A;  2IS2 A;  4LLL A;  5FD6 A;  1KGS A;  2MD5 A;  3CCR I;  2L7F P;  2PMZ N;  3BQY A;  2KZG A;  5CVV A;  3K7A J;  3CO6 C;  2M5W A;  1J75 A;  1V55 H;  5DEQ A;  2NAZ A;  2L54 A;  4Y33 A;  3C2H A;  1H0M A;  1IV6 A;  1X4P A;  2A6T A;  2UXX A;  1T98 A;  4WXH A;  1I6H J;  3HB9 A;  3ZMZ A;  5GAG J;  3OYK A;  4I02 A;  2ELJ A;  5CQG A;  2E1M B;  3K4M A;  1UMQ A;  3M1E A;  1RES A;  4BXF A;  1Z21 A;  1MND A;  5TIS C;  4DZJ A;  3F21 A;  3CC7 I;  4BJ5 C;  1Y0U A;  2XB5 A;  2KIM A;  3E7L A;  1XDU A;  4WCG A;  2H8W A;  2ZME C;  3OYE A;  4N0B A;  3NEU A;  1AKH A;  5CVR A;  2M4G A;  4QPO A;  4HST A;  1NHA A;  2E1O A;  2F4I A;  2Y31 A;  2VL8 A;  4AU7 A;  4XLA A;  2HEO A;  1X1D A;  2KIQ A;  3E5X A;  3OYJ A;  6PAX A;  1D1C A;  1DGR M;  4OAY A;  4NB5 A;  1SFX A;  4A6E A;  4LFU A;  1R00 A;  3RJP A;  3LAP A;  2A5Y B;  2DA2 A;  2CU7 A;  1YG2 A;  1QA6 A;  3S15 J;  2XPW A;  3K2A A;  5FLV A;  2IEK A;  1IRZ A;  1E17 A;  3I58 A;  2R7S A;  1JXS A;  3UNG C;  2IA0 A;  3MCZ A;  3KYL A;  2E7W A;  4CO8 A;  5FRN A;  2NOG A;  5E3O A;  2JUG A;  1N25 A;  2XAQ A;  4Q48 A;  4HQM A;  5ERI A;  4XOT A;  5FKN A;  4JBA A;  4XKC A;  2LOO A;  4HX7 A;  1L3L A;  4I0B A;  3F8F A;  2XRL A;  1QHG A;  2TRT A;  4I01 A;  1VTN C;  3E6M A;  4XKW A;  3EUH C;  2MYS A;  3R60 A;  4PJM A;  1P4A A;  5EEA A;  1I1S A;  3L2C A;  1J7K A;  4OMY A;  4ZDO A;  2JPC A;  1QU3 A;  3REO A;  5E3L A;  2L7K A;  4E7S A;  5J47 A;  4L9N A;  3IHU A;  1SVL A;  1GT0 C;  2Q2E A;  1YS7 A;  3ZQF A;  1R5H A;  1X1C A;  3HGG A;  2NXN B;  2ZKZ A;  2L01 A;  2FA5 A;  2AS5 F;  4XRF A;  4J01 A;  3VPR A;  5F1R A;  4MTE A;  3A1Y A;  3QWL A;  5LEK A;  4N9H A;  1EKE A;  2V6C A;  4MEX F;  4YEL A;  3L09 A;  2QYO A;  1XGN A;  2ID3 A;  3HL2 A;  2COB A;  2LY1 A;  3ABT A;  3RDI A;  5L3E A;  3TOA A;  1IXR C;  1WJC A;  2EIN H;  4M3G A;  3PNT A;  1IAW A;  2X1E A;  2HPM A;  4L18 B;  1J09 A;  1DP3 A;  3PM1 A;  2DTZ A;  2V1U A;  4BAY A;  1FOY A;  2ZFU A;  4NNJ A;  3HSR A;  3KP4 A;  4WWC A;  4HOB A;  4UV8 A;  2IA2 A;  3OMY A;  3KEQ A;  3K4L A;  3KZZ A;  1JTX A;  2IA1 A;  5F27 A;  1XSX A;  3K2Z A;  4M6X A;  5ICC A;  3GTQ J;  3FXJ A;  2P8T A;  4DBQ A;  2O6G E;  3J80 K;  1W0U A;  3WTU C;  2VXD A;  3NRV A;  2R7U A;  2BE5 F;  2WAQ N;  2FBI A;  3OOU A;  1W7P B;  3KIO A;  1BM9 A;  5LGN A;  2P5L C;  4Y4R A;  2HFH A;  4O5V A;  3LA2 A;  1YJN I;  1JKR C;  5BMZ A;  2CQ7 A;  2CUJ A;  2F5F A;  1PYV A;  3CJR B;  3F8N A;  4HF0 A;  3JW4 A;  2LBF B;  2ZBK A;  3F6O A;  1OKR A;  5LGT A;  4KN7 X;  4BKX A;  1ZLJ A;  3P9K A;  3SZP A;  3E6C C;  1U3E M;  3FHN A;  4KT5 C;  4IEJ A;  3HBL A;  1AA7 A;  2KT0 A;  3KZI C;  4XK4 A;  3ERE D;  1T8I A;  2PI0 A;  3F72 A;  5KAI C;  4BJ6 C;  2DT7 B;  3JTH A;  4D1Q A;  3WGH A;  3DXJ F;  4KIC A;  4ZYA A;  2E1C A;  2MH9 A;  2W24 A;  3H3V K;  3KLN A;  4RLQ A;  1GLN A;  2RQP A;  3HUG A;  3HOW J;  4G8X A;  3BJO A;  1VF9 A;  2CQN A;  1OCC H;  3HXL A;  1QZY A;  1V5G A;  3L9F A;  1LJ9 A;  1B9M A;  3HRS A;  3MN2 A;  5E1Z B;  3BY6 A;  4XLP F;  3CP2 A;  1DQU A;  2GIV A;  3GYH X;  2F5C A;  1M1E B;  2BVL A;  1DGW Y;  1MZB A;  4Z2Y A;  4A93 J;  2M87 A;  3MKY B;  2XGC A;  1QVU A;  4UY8 I;  1W0T A;  2OQG A;  2FNA A;  2WB1 A;  3O6B B;  1G2H A;  1KU3 A;  3PSF A;  4LK0 F;  1G59 A;  3B6C A;  3KE2 A;  4P5O A;  3Q0U A;  1Y39 A;  3K1N A;  1U9N A;  1IRF A;  5L3D A;  5GAH J;  3J81 Z;  4V2G A;  2EIM H;  3RKQ A;  1UHW A;  1N75 A;  4I2O A;  4ZZD A;  4CYC B;  4GFB A;  2Q1Z B;  1ETW A;  4B48 A;  1TL8 A;  4AIH A;  1ZKG A;  2QEN A;  4UB8 C;  1L0O C;  1SAU A;  2D5V A;  2DO7 A;  2GM4 A;  2CFO A;  5GPC A;  4B3X A;  1KU9 A;  3UKG A;  2Q2E B;  3I3L A;  1IG7 A;  3ABK H;  1RRJ A;  4Q4Z F;  2VOD A;  2DT5 A;  3BQZ A;  2WY8 Q;  2RGV A;  2COM A;  3GX4 X;  4IKF A;  2R7F A;  3AFH A;  2M7B A;  3M7G A;  4NQW A;  2OA4 A;  3CUO A;  2O5R A;  3W2A A;  1LPQ A;  2IT0 A;  4F55 A;  2HXO A;  4B44 A;  3OS0 A;  4CH7 A;  3WU2 C;  3CES A;  2D1V A;  2PFB A;  3H3Z A;  2V26 A;  2RNJ A;  5GAE J;  5K5R A;  1PP7 U;  4E7Z A;  4G94 A;  1HW2 A;  1P9Q C;  3SZG A;  5HVQ C;  1X3U A;  2K4B A;  1G3T A;  3W2V A;  4BGD A;  2XSD C;  3S2H J;  2XIG A;  3E5U A;  2FRH A;  1R71 A;  3WTW C;  1WWX A;  2BEO A;  1R23 A;  2DMQ A;  2OTJ I;  5IP6 A;  1UFM A;  2FU4 A;  2P0W A;  3NWT A;  2D45 A;  3OYM A;  2A6H F;  5A2Q Z;  1VQP I;  1R4M B;  2ECB A;  2VKD A;  1YO5 C;  2HVS A;  3JSO A;  4MNU A;  3HJE A;  1I39 A;  1KQ0 A;  3CTA A;  4JYK A;  1P4W A;  1XS9 A;  2OUM A;  4M3B A;  1ONV A;  3ZPL A;  3MMY B;  3E6D A;  2EIJ H;  5L3C A;  5J40 A;  2RN7 A;  5FKO A;  2WY7 Q;  3RPU A;  2XAU A;  3ZMS A;  2VLA A;  2AQF A;  2R3S A;  2CUZ A;  1EH6 A;  1U5T B;  4UB6 C;  3MKZ A;  3BR0 A;  1FPQ A;  2ZSH B;  2IP2 A;  3A01 B;  4IL6 C;  4FQG A;  3QRF F;  3QPS A;  5HNH A;  2O61 A;  1JHH A;  4MQ9 F;  4MEY F;  3HG9 A;  4EM2 A;  1ETX A;  3CJQ B;  3FDY A;  1HC8 A;  5TJJ A;  3ASO H;  2EFQ A;  4GGG A;  4RGU A;  3MZY A;  1NG6 A;  1SMT A;  3ZN1 A;  2HDD A;  2K85 A;  2R93 J;  2ME0 A;  1SFO J;  2Z9O A;  2Z1D A;  3MAJ A;  3ZN0 A;  1IF1 A;  4XL9 A;  4A3F J;  2NS7 A;  3S93 A;  2CUE A;  4I6Z A;  1Z1D A;  2XVC A;  5E3N A;  1KYZ A;  1A6I A;  2WAF A;  2X6O A;  1WGX A;  1KZH A;  2XAG A;  2QCO A;  2LF7 A;  5BS6 A;  3A02 A;  2XKO A;  2XF5 A;  5IY5 H;  3EUH A;  2JTV A;  2STT A;  2ELH A;  3QOP A;  4EJV A;  1YI2 I;  1R5G A;  3RIR A;  2AXL A;  2LD5 A;  3I4M J;  3CCS I;  3N97 A;  3TMO A;  4QIW N;  4C3H J;  4HAM A;  2DT6 A;  3CP8 A;  3K9T A;  2JJ7 A;  3WTS C;  2LH9 A;  2VBY A;  5LHG A;  3CJT B;  3I64 A;  1FSE A;  1I27 A;  3K4K A;  5KHD A;  3IC7 A;  4HX8 A;  4ESF A;  2OC6 A;  3QYF A;  4ZYG A;  2GXB A;  2EV5 A;  4MIM A;  2IGO A;  2ACJ A;  1UJ8 A;  1JKO C;  4RM3 A;  2JA5 J;  1Z6T A;  1E3H A;  2VJ5 A;  2HPI A;  4FHT A;  4W97 A;  2V9P A;  3SFI A;  1IXC A;  4Y15 A;  3TOB A;  1LDK B;  4OMZ A;  3RKY A;  1SAX A;  2K86 A;  1APL C;  3C18 A;  4G6T B;  4XLN F;  4YFX F;  3DKX A;  2TCT A;  3PQJ A;  3O8G A;  3NQO A;  1EH8 A;  4YRV A;  4WX9 A;  1K6O A;  1ZLK A;  2VQC A;  2VJI A;  1JUP A;  1MW7 A;  3S8P A;  1POG A;  3K4B A;  2VQH A;  2FUG 2;  3SEZ A;  1V54 H;  4FET A;  2QBY A;  3M3Y J;  2F2E A;  2VKE A;  5HS7 A;  3H9G A;  2GOM A;  1ZAR A;  1OYI A;  3GVA A;  4D5C A;  1XC5 A;  3KP6 A;  5KAF C;  4PUS A;  2DOD A;  4AVZ A;  1IUY A;  3F8C A;  2H27 A;  4HNV A;  2JA8 J;  3MEX A;  1TT0 A;  4I98 B;  1D3Y A;  2BY2 A;  2KPM A;  4RGX A;  4A6D A;  4P1W A;  5C3E J;  1BI0 A;  2X1D A;  1A04 A;  3VEP A;  4FAS D;  4BY1 J;  2ZO4 A;  3RYR A;  1GVJ A;  2BV6 A;  3VOD A;  3FIW A;  4A3L J;  2FEZ A;  2HGC A;  2PMU A;  3LQR A;  3HSF A;  2CG4 A;  3ML6 A;  3KEO A;  1G3S A;  4I0A A;  1UCR A;  2MW8 A;  2ZJP F;  4OIO F;  1T08 B;  1IO2 A;  2A5W A;  3BLY A;  4HNU A;  3DFG A;  4IJA A;  1F4K A;  1FP1 D;  4WF2 A;  2PMH A;  4E7L A;  1S72 I;  2DBB A;  5CVI A;  1U5T A;  1MMS A;  1XX5 A;  3MZ8 A;  1Y1W J;  2Y0M A;  1RR7 A;  4PSW A;  4XLC A;  3EUK L;  2DA4 A;  1Z67 A;  2XGD A;  2WAQ A;  1IN4 A;  3C3W A;  2P5V A;  2UV1 A;  2W57 A;  5EGO A;  3ZP5 A;  3VWB A;  2KKO A;  3OYD A;  5IOY A;  3P9I A;  3H9Q A;  1WJB A;  3SFZ A;  1UZC A;  3CF2 A;  2QA4 I;  1O57 A;  4FT8 A;  1UG0 A;  3QU3 A;  5K7H A;  4QLC U;  4D7M A;  3CZ6 A;  3EPZ A;  2X6W A;  2YR2 A;  3HUG B;  3LSI A;  1TC3 C;  2F5E A;  1U9O A;  4G7Z F;  5IYD J;  3SYT A;  4M9Z A;  4CDG A;  3OWT A;  4CCK A;  2A69 F;  5J1Y A;  4RB1 A;  1J5Y A;  4FX4 A;  5CYV A;  5LRS A;  1VZ0 A;  2M9H A;  4AID A;  4A3D J;  1QQI A;  1OPC A;  1BL0 A;  4RB3 C;  3ASN H;  2JN6 A;  1A5J A;  1I5Z A;  2XKP A;  4A3C J;  5B5E C;  5F0H A;  2EV0 A;  5IYB J;  5BPI A;  3K4J A;  2NYX A;  2JQ7 A;  1MBF A;  3K4C A;  1WHU A;  2BW3 A;  4E70 A;  5E18 F;  1V5F A;  2L5Q A;  1O4X A;  3FIS A;  2FSW A;  2R4G A;  3FK6 A;  2FF4 A;  1STZ A;  4UXN A;  2H1L A;  3KPH A;  4D7N A;  2BYV E;  2ETH A;  1EF4 A;  3KX2 A;  3JTG A;  4C30 A;  1QVT A;  2DPD A;  4ANJ A;  4E7H A;  2XC7 A;  3Q9V A;  3LOC A;  4LJZ F;  3S17 J;  1NK2 P;  3JRI A;  2A07 F;  3H5R A;  2V9K A;  4IX7 A;  4C3I J;  3SDG A;  1YS6 A;  2DFE A;  3CQZ J;  5LFA A;  4S0H B;  1S6L A;  5E8G A;  3KP7 A;  2K9Q A;  2P6T A;  1XPX A;  2L0K A;  5LRR A;  2HS5 A;  5JVT A;  1V3F A;  2YSR A;  3EET A;  3JAM K;  4HRI A;  5J6X A;  2CV2 A;  3CD6 I;  1IXS B;  1VQ8 I;  3IWZ A;  1E3P A;  2WV0 A;  3WG7 H;  1BA5 A;  1LUJ B;  1KA8 A;  5DDG A;  1YRN B;  3GFL A;  2DOA A;  4OIR F;  3IRR A;  3OR1 C;  3RYP A;  3SHF A;  3G71 I;  4UUS B;  3VOE A;  4V19 K;  1ERD A;  3IKT A;  5IPA A;  2B7E A;  3CMM A;  2K9M A;  3ABU A;  1R36 A;  1LDJ A;  4KMF A;  1JT6 A;  2WV1 A;  3D5R C;  1D0X A;  2JUC A;  4F3Q A;  4OAZ A;  3ZMD A;  3E1S A;  2UXN A;  5DCF A;  4CA0 A;  2MSY A;  3CC4 I;  5ICE A;  2RRE A;  3S1R J;  1TWA J;  3LSK A;  5FKK A;  3ABM H;  3HKZ A;  3DPL C;  5B66 C;  5KVR A;  1K79 A;  2M8E A;  2ESN A;  2V1N A;  3BTL A;  5E8I A;  1F43 A;  3GBG A;  5D5X B;  5IP9 J;  1W5T A;  2KJB A;  2Y48 A;  3IAS 2;  3BPX A;  4A3J J;  2EFW A;  2G7U A;  1XSD A;  3QQA A;  1GHC A;  1GV5 A;  3ROU A;  3DEE A;  3KP2 A;  1K4S A;  2QGU A;  3Q0W A;  4KIB A;  3I4P A;  1IC8 A;  1VQ7 I;  2OQR A;  3OYC A;  4A3B J;  1E2X A;  3TW6 A;  2KRH A;  1YTY A;  1XCB A;  2DFI A;  3H9J A;  1U78 A;  4H4K C;  3S1Q J;  5IT9 K;  2ID6 A;  3OSF A;  2A61 A;  4G7H F;  1I3A A;  3GCM A;  5D4R A;  3UR3 C;  1KQ8 A;  1EH7 A;  4B09 A;  1T6S A;  3HOY J;  1B1B A;  2X1C A;  3TL4 X;  2LC2 A;  3KLO A;  5GTH C;  3DPT A;  1XTA A;  3I54 A;  3WOD F;  3S2D J;  1FIA A;  1Y0N A;  1DPR A;  3GLL A;  4A3G J;  1Z3Y A;  3TDU C;  3TGN A;  3L00 A;  2G9W A;  3IUO A;  1FYK A;  5F6F A;  1WPK A;  5M5X J;  3LWF A;  4IRH A;  2JK3 A;  3I4N J;  1P4X A;  2M45 A;  2X9D A;  2L9N A;  3LQQ A;  5DCM A;  3X2Q H;  5M3F J;  1UEL B;  1SFE A;  3Q9S A;  1FMW A;  3BZK A;  5FO5 A;  1I50 J;  2MGQ A;  2R7Z J;  4MQV A;  5HLG A;  4M9S A;  1D8J A;  3DP7 A;  3CCY A;  4E4H A;  1FTZ A;  1R4N B;  2H6B A;  3KP5 A;  4OIN F;  2LR8 A;  1ZR4 A;  2F5D A;  2LP0 A;  2VQG A;  3K70 C;  1X58 A;  3ECO A;  2W85 A;  2X51 A;  1DP7 P;  3JRF A;  3ECH A;  3J7Z I;  3C1D A;  2CGP A;  3OY9 A;  2R5Z B;  2O7O A;  3HTS B;  4M72 A;  2PMZ A;  1MSF C;  2RDP A;  2D1H A;  4BAC A;  1O3Q A;  3VSK A;  2HYJ A;  4IHV A;  4XNF A;  5DUI A;  3OIP A;  4Q47 A;  1OYW A;  4M6V A;  1MMD A;  4H0E A;  2XPV A;  3QPH A;  1WRJ A;  3S3O A;  3VFZ A;  1UAA A;  1BJZ A;  2LKP A;  1ZEL A;  1IW7 F;  3ZQI A;  3NWS A;  2P5K A;  3SEQ A;  2VE9 A;  1D5Y A;  3CC2 I;  3TO9 A;  3W6V A;  2AXT C;  1R1U A;  4IQ4 A;  1C0W A;  3H5N A;  2BY0 A;  2L2O A;  1ZRF A;  4CCN A;  4G9Y A;  4ENN A;  1USS A;  2M4K A;  1JI8 A;  3ZGK A;  4LIV A;  5B1B H;  2K9N A;  1WCM J;  2HTS A;  3CLQ A;  1LE8 A;  2OBP A;  4LMY A;  4G12 A;  1LVK A;  2E5Z A;  2OJE D;  3LA3 A;  1AU7 A;  1LDD A;  1OCT C;  1AWC A;  1ZYR F;  4ON0 A;  4EM0 B;  4XLH A;  2RAE A;  1WJF A;  3S32 A;  2K3F A;  3ZMV A;  1XGO A;  2CW8 A;  3JRC A;  4KT6 A;  1U5T C;  1PUF B;  5E3M A;  4K2E A;  4C2U A;  2XAH A;  2KIF A;  1YJW I;  3BPV A;  4IVN A;  2KL4 A;  2QQ9 A;  4DGW B;  4UHT A;  1ZGW A;  2HXI A;  3PUB A;  2VPL A;  2WBM A;  1YLF A;  1VQK I;  4CGZ A;  2ZFW A;  4BHC A;  4YIF A;  1S7E A;  1G3Y A;  2FMY A;  1D0Z A;  2M7A A;  1XN7 A;  3CDL A;  4XOR A;  1OMI A;  1XMK A;  2CSO A;  2KDZ A;  3U21 A;  1VQ9 I;  2K27 A;  3SJM A;  4F91 B;  1TNS A;  3BTJ A;  3BJA A;  4A5N A;  3SDB A;  1TQP A;  3RQ4 A;  4DBR A;  4XLF A;  3V7R A;  3L2V A;  2EV6 A;  3E5Q A;  4BH9 A;  5H6R A;  1T56 A;  2O0Y A;  2ZCW A;  2KIU A;  3FZV A;  2STW A;  4BU2 A;  3M8F A;  3FBI B;  3P5J A;  3LFK A;  2R7R A;  3MKW B;  3BRO A;  4AIK A;  1JT0 A;  2JWT A;  2W00 A;  1W1W E;  2FJ1 A;  2DI3 A;  3IKV A;  2MC3 A;  2E2H J;  3U9G A;  1ZRD A;  5M3M J;  3FF5 A;  5DD8 A;  4ETS A;  3BJ6 A;  2ZME B;  2CO5 A;  4CIC A;  2UUZ A;  2HQR A;  1MD0 A;  1OQY A;  3IH3 A;  3GZN B;  4GCV A;  4BHP A;  1DPU A;  2DA5 A;  4HV6 A;  3S2W A;  2FBH A;  1XCV A;  2W84 A;  3DBL B;  1A35 A;  1K6Y A;  5HLT A;  4FTH A;  1ODD A;  4M74 A;  2XB0 X;  1JUM A;  4J19 A;  2JA7 J;  1TWF J;  3HHH A;  4PZJ A;  1CQT A;  4M9X A;  3S3N A;  1H8A C;  1TWH J;  1HF0 A;  5ILV A;  4S05 A;  3TW7 A;  1XMX A;  4Y7N J;  1W36 C;  1T33 A;  3WE3 A;  2XSJ C;  4HPQ A;  1ETK A;  3H5A A;  3I55 I;  2HKX A;  1QPM A;  3W6J B;  4JX5 A;  2E71 A;  1YYV A;  3QPT A;  2IBD A;  4XN0 A;  3GFI A;  4HDU A;  2EIL H;  3GTM J;  1QGP A;  5E1W A;  3RZD J;  1FYM A;  1D1A A;  1W7P D;  1X2N A;  2H1K A;  1TW2 A;  1T39 A;  3PJR A;  2DMU A;  4IHT A;  4OOI A;  3TQN A;  1Z77 A;  4ZZL A;  2A3S A;  4B1R A;  4LG0 A;  4V2F A;  1N78 A;  4HNT A;  2IPQ X;  1DU0 A;  1SFK A;  4XKB A;  2DOE A;  2H94 A;  2Y69 H;  2R7W A;  3EYI A;  4G7O F;  1LEB A;  3JRG A;  2L9S A;  4RB2 C;  4BE0 A;  3FK7 A;  3ULQ B;  2QWW A;  3RCO A;  4CYC A;  4N9I A;  2XAF A;  3O3K A;  3HPG A;  4EJW A;  2ZC2 A;  3TKY A;  3S14 J;  4P9F A;  1U8B A;  3W6K B;  5J1R A;  1B72 A;  1FT9 A;  2JVH A;  4O6J A;  5GP9 A;  3QPL A;  4BXU A;  2P6S A;  4EQQ A;  3RTR A;  2VT2 A;  2EBI A;  2K40 A;  5J4Y A;  2VAS A;  1QHH D;  1HW1 A;  4JK1 X;  2DDB A;  2RV8 A;  3LL7 A;  2JRT A;  2QQB A;  3QU6 A;  3OYN A;  4U0Y A;  1Z05 A;  2YPR A;  5FLX Z;  4MTD A;  3CCQ I;  5FLX K;  4OIP F;  4L5J A;  5JR3 A;  4EV0 A;  2N8G A;  3MKL A;  1MMN A;  2M3A A;  1O3S A;  1GXQ A;  3OYG A;  1A31 A;  1OIS A;  5GTI C;  4HF1 A;  2KQR A;  1QZZ A;  5EDN A;  2K02 A;  2CQX A;  4LLN A;  1X3Z B;  2HQN A;  3H35 A;  3EYY A;  2ZME A;  2D2W A;  2EA4 A;  3E3V A;  2ADU A;  2E2J J;  5FB2 A;  1FOX A;  1X1P A;  2H6C A;  4G6Q A;  1FEX A;  2CV1 A;  2DA1 A;  2ZXW H;  4L9T A;  3WTX C;  2ZSI B;  4B47 A;  2DN0 A;  3BZ6 A;  3FKJ A;  5EG0 A;  2NVT J;  3C2G A;  3BG7 A;  2V79 A;  2L9V A;  1SAN A;  2LVS A;  1ZG3 A;  4BS9 A;  2KFD A;  3R0A A;  4LG3 A;  2RVC A;  1MBH A;  3OR2 C;  2V6E A;  3ABL H;  2DA7 A;  5DUK A;  5ICF A;  3WE2 A;  1W7P A;  4DNC A;  3GFM A;  4U0W A;  4PSX A;  1MGT A;  1TLH B;  2EFP A;  4XRS G;  1Z7U A;  4LD5 A;  1FYL A;  3GEZ A;  5KK1 A;  3GW2 A;  1WFX A;  4GXO A;  4AVP A;  4I7H A;  4XIC A;  4A0Z A;  3DTK A;  5H2F C;  3ERM A;  2FOW A;  4C2T A;  4FCY A;  1V4R A;  3P7N A;  3PO2 J;  4PFP A;  2X4H A;  1FP2 A;  1RNL A;  5EF6 A;  2OZ6 A;  4HLY A;  1IRX A;  1NTC A;  5IOZ A;  2I8D A;  3H3U A;  2E35 A;  3IV5 A;  4E7I A;  1TWG J;  3BG5 A;  1FNN A;  2VXZ A;  4FE4 A;  4BQO A;  2DYR H;  2CS3 A;  1MBJ A;  1LE8 B;  4EEF G;  1F5T A;  1XD7 A;  4RM2 A;  1TWC J;  3OS2 A;  1P6R A;  5EYR A;  1A6Q A;  3WTV C;  1Y6I A;  2EJR A;  3DCF A;  2KHM A;  4NDL A;  1MH4 A;  5B3S H;  3WGI A;  4HV5 A;  4M3E A;  1SD6 A;  3KYC B;  4BDY A;  4A3E J;  1HDD C;  5K1Y A;  2W25 A;  1FOW A;  2ZXH A;  1XGS A;  2ZNZ A;  3S3M A;  1T38 A;  2P7V B;  3S1M J;  1MNE A;  3LSJ A;  1JUS A;  1OCP A;  3LST A;  1ZN2 A;  5C4X J;  4Z6Y A;  4KA4 A;  1PVE A;  1FBU A;  1SD5 A;  3F23 A;  2FML A;  3JCU C;  2UZK A;  1BI2 A;  3WU0 A;  2Y9Z A;  3U1K A;  4BQN A;  5C4J J;  3CUQ B;  1BJA A;  3HTU A;  2QLZ A;  1VQN I;  4BNC A;  2QQ8 A;  4RB0 A;  5D8L B;  1HLV A;  1V5E A;  1FOK A;  1FTT A;  4DJA A;  2JSC A;  1K4T A;  3BWG A;  5HDN A;  1RUO A;  3M8J A;  2EK5 A;  3RKX A;  2LKX A;  1J0R A;  4A5M A;  4BXX J;  4AYB N;  2HI3 A;  5EGO B;  3FWE A;  3R4K A;  3DU5 A;  4MO7 A;  5D5W B;  2L3D A;  1LFU P;  4FE7 A;  1S7A A;  3V8L A;  5DM7 F;  2XRN A;  1QNT A;  5LHI A;  1EA3 A;  3G1M A;  2KLO A;  1SMY F;  2VPR A;  2BW3 B;  4RDU A;  3I5U A;  3VYS B;  4HZF A;  4X0G A;  2EZI A;  4RAF A;  1H9T A;  3L1P A;  2IAI A;  1R9T J;  1HKQ A;  1S3J A;  3CO7 C;  2VKH A;  4NC7 A;  1BI3 A;  5IYC J;  2LMD A;  4F7Z A;  2PN6 A;  2QKM B;  3DTI A;  3VSL A;  4Y3O A;  4HW0 A;  5HDG A;  3HKZ N;  4F93 B;  3LSP A;  2Z5U A;  2JT1 A;  2W4S A;  2R7V A;  3G3Z A;  1MDM B;  3CCJ I;  3DQV C;  1HBX G;  1YJ9 I;  3CMY A;  1BC7 C;  3PFY A;  2BVM A;  4KN4 X;  3HDD A;  3MFK A;  1GXP A;  2OCC H;  4HA8 A;  3LAJ A;  3LSH A;  1FLI A;  4L9J A;  1MSE C;  1IN6 A;  2PEX A;  5JFR A;  5F0F A;  4NC8 A;  3OL4 A;  1HA8 A;  3G1O A;  4KNY A;  1ZGJ A;  3J80 Z;  2DU9 A;  2E1N A;  3DBR B;  3FXL A;  2OPT A;  2Q8K A;  1BW6 A;  2M30 A;  3JRD A;  2DPU A;  3GWZ A;  2R7D A;  1NH3 A;  2R92 J;  2LY9 A;  2O03 A;  1YE9 A;  1D0Y A;  1WJ5 A;  3HSE A;  4B3A A;  2DJN A;  2L7Z A;  3BP8 A;  4LGW A;  5EG0 B;  3A01 A;  3AL0 C;  2O8X A;  3AL0 B;  2O9L A;  4QSH A;  3A0H C;  2O3F A;  1XSV A;  3R6S A;  5ILU A;  2DW4 A;  4BL0 B;  4YFN F;  1NG7 A;  4E6K G;  2NNY A;  1WI3 A;  2ZJQ F;  1WJE A;  3GTK J;  5K7F A;  4UV9 A;  4UVB A;  3KP3 A;  1TNT A;  2VE8 A;  3K10 A;  2LG4 A;  5F0C A;  5JLX A;  2HQ5 A;  1REP C;  1VQ6 I;  4KYW A;  4HEA 2;  4BUP A;  4LK1 F;  3DV8 A;  2XRO A;  2FD5 A;  1IJW C;  2BZT A;  1XMA A;  2Z99 A;  2VT3 A;  4UUT A;  4P9U A;  3OYF A;  3MD2 A;  3M07 A;  4CUG A;  4EMS A;  1SD7 A;  2I10 A;  4IZZ A;  1BIA A;  4II3 A;  1RET A;  2DK5 A;  1DDN A;  3WG9 A;  1BIB A;  1U2W A;  4DZP A;  3G1L A;  1YW9 A;  3SXY A;  2B9S A;  5CKT A;  1Z6R A;  3PL8 A;  1NK3 P;  2QSF X;  2ISY A;  3WGG A;  2PX9 A;  4BEH B;  1XG1 A;  5A2Q K;  3A2K A;  4HBL A;  2GOX B;  2FBK A;  5CLS A;  1WJD A;  4GYI A;  4XRS A;  1ZQ3 P;  2BXZ A;  2MC4 A;  2WAE A;  2IRF G;  4BY7 J;  5FLM J;  2XDV A;  1Y8R B;  2VB6 A;  4IRG A;  3LSG A;  2KP6 A;  1P2F A;  2KRF A;  1JTY A;  1QBJ A;  2VBX A;  4BQA A;  3FBN B;  1UG2 A;  2W1O A;  4ENK A;  1BC8 C;  2PBI A;  3D1N I;  5IT9 Z;  5K5Q A;  3IP4 B;  1PP8 F;  2MH2 A;  2GXA A;  4GDF A;  3BR3 A;  2P81 A;  4W1U A;  1IZ1 A;  3J7A Y;  5HDK A;  3JRH A;  3VB2 A;  2EWN A;  5IP7 J;  2YUS A;  3CCU I;  2M0C A;  2J5O A;  2DFF A;  4XON A;  2YX7 A;  1BN5 A;  3HEF A;  4HX4 A;  4YG2 F;  4CZZ A;  1SEU A;  1UHM A;  2DMN A;  1ZR2 A;  4XRM A;  5C44 J;  5DTD A;  3HOX J;  4ZH4 F;  5K7Z A;  1G6N A;  4XM3 A;  3ZQH A;  4JX4 A;  5FFX A;  4F52 A;  3VDX A;  4BQQ A;  2NVY J;  5E79 C;  4Y13 A;  3ZQQ A;  1YX3 A;  3M1C A;  4RLF A;  3K6G A;  1HKT A;  2L9R A;  1R1T A;  1MDM A;  1Z3X A;  4YFK F;  1MMA A;  1MNM C;  3FXK A;  5JLW A;  1TT5 B;  1S8N A;  3BG3 A;  3ZQ7 A;  2ME6 A;  2WTE A;  1ZTR A;  3OIQ A;  2M1B A;  2VON A;  1D1B A;  2IW5 A;  2LTP A;  3K1M A;  2W7N A;  3SZT A;  1SFU A;  1VQO I;  4C3J J;  4RBO A;  4OIQ F;  5J1U A;  5FRM A;  3IRQ A;  4X1E A;  3FMR A;  4JQF A;  4KUM A;  5J4V A;  2VQL A;  2MA3 A;  3E6B A;  4A69 C;  2LY2 A;  2IGK A;  3FXQ A;  2J5P A;  4S04 A;  1FSH A;  3QAH A;  3S1N J;  2IVM A;  4RS8 A;  5CPR B;  4ESB A;  4UVA A;  1HST A;  2GXG A;  2LFB A;  2WWY A;  3IH2 A;  2P4W A;  4RGR A;  4YII A;  1CF7 B;  4ABZ A;  2QZ8 A;  4BBR J;  3N4M A;  3AG3 H;  1J9I A;  2A68 F;  2EFN A;  4MLO A;  5CJ9 A;  2JVG A;  3ISP A;  1FX7 A;  5GAD J;  1QO0 D;  2VN2 A;  3GFJ A;  2EZK A;  2FXA A;  2DQR A;  1OCZ H;  4XMY A;  3GTJ J;  4C9Y A;  1BW5 A;  1ON2 A;  1YRN A;  4PGH A;  4O3M A;  2PJR B;  4CYD A;  3BDD A;  4N4O B;  4DYQ A;  3AKZ A;  1LB2 A;  1R6R A;  1VQ4 I;  1OCO H;  3DPU A;  3EUA A;  4JOM A;  4KDP A;  4NQW B;  1OCR H;  1O3T A;  1MBK A;  5JHU A;  4BHB A;  2H8R A;  3FM3 A;  3DLA A;  1T0F C;  2NVU B;  3HZJ A;  3W2W A;  1ZG1 A;  3D5S C;  1Q1H A;  1UHS A;  2R5Y B;  3V8J A;  3ZCO A;  2R5Y A;  4ZYH A;  4XSZ F;  1U8R A;  2JSP A;  5AIP A;  5FFZ A;  3A0B C;  2XGE A;  3T8R A;  4E7K A;  3ESW B;  5ILS A;  4PJN A;  2EA2 A;  1R1V A;  2HQA A;  3BZC A;  4DYR A;  5K5O A;  3ZQC A;  3TP3 A;  1R58 A;  3L2W A;  2PLY A;  1Z7L A;  5D6E A;  1P92 A;  3TO6 A;  2L02 A;  5TGT A;  1PDN C;  5F08 A;  4UVC A;  3U1D A;  2DMT A;  3TED A;  1IUF A;  1MH3 A;  4FIS A;  5KNL A;  1YOV B;  5HOD A;  5F64 A;  3BCA A;  2G7H A;  4A3K J;  2K7L A;  2X85 A;  5D4S A;  3Q5F A;  4GO1 A;  1W5C C;  2GAU A;  5H6Q A;  1JE8 A;  2DMP A;  1TBX A;  3WTT C;  4KMU X;  2HDW A;  3FKI J;  3M8E A;  3J7A O;  2ICW G;  3WTY C;  2VBZ A;  3JAM Z;  3T0Y A;  1CGP A;  4B43 A;  4HSR A;  3MWM A;  2XAS A;  1HW5 A;  1SD4 A;  2MD0 A;  3GTG J;  4UNO A;  2IJL A;  3FHZ A;  1Y8Q B;  4PK4 A;  3FXU A;  4ENJ A;  5E17 F;  4QPQ A;  3DLL F;  2CV0 A;  2B0L A;  3HRM A;  4Q5S F;  2F5V A;  1S9H A;  3D0S A;  3F9K A;  4EGZ A;  1VFC A;  1WKM A;  3F22 A;  2Y75 A;  3AAF A;  4LIT A;  3PUF A;  4PFO A;  2DCE A;  5BQT A;  5TRD A;  2LSO A;  1YIO A;  3DKY A;  3T8T A;  2IXS A;  2DXI A;  4XQF A;  1IGN A;  2QUF A;  4A2U A;  4DOZ A;  5LGU A;  4A3M J;  1ITY A;  5J3L A;  3VYT B;  3JSP A;  3G4S I;  1P7J A;  2LK2 A;  2OD5 A;  3ZXS A;  3ELK A;  4ZJZ A;  2NVQ J;  3PIP F;  4J00 A;  4YEJ A;  1MBE A;  5ED4 A;  2ECC A;  1K61 A;  2IGN A;  2LKS A;  4HF2 A;  1GUU A;  4PDK A;  4CCL A;  1WH7 A;  2GIZ A;  2EPF A;  1TP4 A;  1RC9 A;  2JA6 J;  2CRG A;  1I1G A;  1JJ8 C;  5L3F A;  1MJB A;  1GVD A;  3OOP A;  4A0Y A;  3HHG A;  2B63 J;  1I6X A;  4I76 A;  1F9N A;  2Y0S A;  3PNY A;  4P55 A;  1TQM A;  2EIK H;  2GWR A;  5LEJ A;  1JGG A;  1P7I A;  5HS8 A;  4AIJ A;  3GXO A;  3RKW A;  4D5F A;  2OU2 A;  4CCM A;  1B4A A;  5KCM A;  1H88 C;  3QOD A;  4R1H A;  4BJT A;  3OYA A;  5J8F A;  2GQQ A;  2BY3 A;  1HSJ A;  1G8X A;  3GME A;  2HYG D;  2Z3Y A;  2Q0O A;  4CSW A;  5LBQ A;  1RUN A;  5FGM A;  3G2B A;  2MBF A;  2ZXJ A;  3IH4 A;  3KZY A;  2JPB A;  4IOA F;  2ZB9 A;  3K69 A;  2ZXI A;  4NC6 A;  5L3G A;  1J2X A;  4EJU A;  1VND A;  4LB6 B;  2K5C A;  3TBI A;  3CCL I;  4PJL A;  1KU7 A;  2F4M B;  3MQ0 A;  3RPQ A;  4KIT B;  5FKL A;  1HCR A;  3GZ5 A;  4KIG A;  3TDZ C;  3BC8 A;  1ENH A;  4CCO A;  2NVX J;  1F36 A;  3CCV I;  2JRM A;  1OFC X;  2EB7 A;  3F3X A;  4HDV A;  1W5S A;  3HOT A;  1FIP A;  2H09 A;  1B59 A;  3BR2 A;  2YU3 A;  5FJ8 J;  3V7C A;  1IV8 A;  1G4D A;  1T2K A;  2EFO A;  2YS9 A;  1IDY A;  2WA0 A;  3CF5 F;  3S16 J;  5J8C A;  1HKS A;  1IDZ A;  2EQR A;  4C2M J;  4DIQ A;  2HZD A;  1JHF A;  1FMV A;  1Y56 A;  5F1J A;  1BOA A;  4PJ0 C;  1N77 A;  4RAY A;  1KYW A;  2M8G X;  1YHQ I;  1WSU A;  1YW8 A;  4YIR X;  2HWV A;  1VQM I;  4AD9 A;  1ETY A;  4XBF A;  2QF7 A;  2E5N A;  3VYR B;  3JRE A;  2Z33 A;  3HGY A;  3I71 A;  3P9C A;  1KON A;  2RNG A;  3I9V 2;  2OTL I;  1GV2 A;  2CW0 F;  3WTZ A;  5H20 A;  2ELK A;  1YIT I;  1OYY A;  1H89 C;  1SVO A;  2X6Y A;  4L9V A;  2LDU A;  3I0T A;  5D8K B;  5EZH A;  2ZJR F;  2MLG A;  4IO9 F;  4PJJ A;  4Y17 A;  1QZE A;  5CVU A;  4CZC A;  2PJR A;  4XR6 A;  2FQ3 A;  4GYG A;  2HDC A;  3BTI A;  3ONQ A;  1LFB A;  1R22 A;  4BE1 A;  2LNB A;  5GPA A;  4WXD A;  4II2 A;  2YX4 A;  3CCE I;  3F8M A;  4XN3 A;  1D5V A;  2NS8 A;  3RQI A;  1WZ2 A;  3ZOB A;  3WHB A;  4EAT A;  4MGR A;  2L4M A;  2EH3 A;  1AHD P;  1WJA A;  1CF7 A;  2QVO A;  2Z2S B;  1PUE E;  1X1B A;  3B02 A;  5CVJ A;  3LSR A;  1SC7 A;  3H1C A;  3PIO F;  3IL2 A;  1YW7 A;  2EZL A;  4AM3 A;  3RSN A;  3LSM A;  3KYD B;  3T5X A;  4LOC A;  2XF7 A;  3BG6 A;  4NBQ A;  5CQE A;  2W82 A;  3OYB A;  1OJL A;  1R5I D;  1FY7 A;  2Y30 A;  4RAZ A;  3PFI A;  3LNQ A;  5F04 A; 
#chains in the Genus database with same CATH homology
 3HIF A;  4U7B A;  4M6Y A;  2FOK A;  2VC0 A;  4G6D A;  1HXD A;  1LVA A;  1H9G A;  3K1P A;  3HYI A;  3ZMT A;  4WK8 F;  1JGS A;  3C7J A;  3OV8 A;  2CYY A;  3I59 A;  4B8X A;  1S29 A;  1ZRC A;  1ZH5 A;  4UUV A;  1HQC A;  4ZYE A;  1W4M A;  2TDX A;  5D5U B;  1U6G A;  5HLI A;  5IT3 A;  2OAZ A;  1EV7 A;  2QQA A;  1J59 A;  2P7C B;  1ON1 A;  3TO7 A;  3CUQ C;  5DYM A;  4M73 A;  2HR3 A;  2PQ8 A;  2HZT A;  1Z9C A;  3D5L A;  4ZYD A;  4L5I A;  1ULY A;  5BPD A;  4A12 A;  3EQL F;  3GLX A;  1DUX C;  3WU1 B;  3ZMU A;  2FNP A;  1B6A A;  5DCM B;  3CJN A;  4L0Z B;  5EEG A;  4DQ2 A;  4EGY A;  5EEH A;  1RI7 A;  2DQL A;  2XUB A;  5L3B A;  1UST A;  2V1X A;  5AON A;  1F1Z A;  1IRG A;  4QWQ A;  5JI6 A;  1S7O A;  2V1D A;  5HOO A;  3FXR A;  4AWX B;  4IF4 A;  1ZHF A;  4LLG F;  3F8B A;  1FWZ A;  3KFW X;  2CFX A;  1K7A A;  1WQ2 A;  3DKW A;  1RZ4 A;  2FE3 A;  3I53 A;  1O7L A;  2PG4 A;  4TV7 A;  2DLL A;  4EM1 A;  2DK8 A;  1TQI A;  3LA7 A;  4WXC A;  2QBY B;  1K78 A;  4ASN A;  2BGC A;  2MLK A;  1YFH A;  3HOS A;  4EJO A;  3IWF A;  4I09 A;  3GO5 A;  2NRA C;  4KFC A;  3G73 A;  5E1X A;  5AIQ A;  3SQN A;  5FD5 A;  5ICG A;  2GZW A;  5DV5 A;  3EDP A;  1TTY A;  1OR7 A;  4M71 A;  1XDS A;  1MKM A;  5HLH A;  3T1B A;  2BBY A;  1T0F A;  2A6E F;  4HYE A;  3V7S A;  4IRI A;  2DTR A;  2X0L A;  4HQE A;  3FMS A;  4R79 A;  1MJ9 A;  3HRU A;  3PQK A;  1G3W A;  1FZP B;  1LNW A;  3V8K A;  4LG0 B;  2RKH A;  1TW3 A;  1K78 B;  3U2R A;  3CUQ A;  2L4A A;  2HTJ A;  3K0L A;  2VC1 A;  3GF2 A;  3I59 B;  3E97 A;  1D8K A;  1B9N A;  2VOP A;  1ZAO A;  4RGS A;  3BOQ A;  1XB4 A;  2UWM A;  3FM5 A;  5D6F A;  5HS9 A;  3R0J A;  1FBQ A;  3CLO A;  1AOY A;  4P96 A;  3FMQ A;  4KIF A;  2JZY A;  1O7F A;  3H92 A;  2LF8 A;  5LHH A;  3HRT A;  3O2P E;  3R61 A;  3QP5 A;  4XSX F;  3J81 K;  3RI4 A;  2VOO A;  4L0Y B;  2ZJ2 A;  4R8H A;  2E7X A;  1Z91 A;  4IHS A;  2HOE A;  3CDH A;  1LEA A;  3F6V A;  1BBY A;  2CQK A;  1ZG5 A;  4HLX A;  1KU2 A;  1RIO H;  4CXF A;  4IXA A;  1IN5 A;  3L7W A;  1R7J A;  4EJT A;  2GA1 A;  3DF8 A;  3MZH A;  3M9A A;  4LB5 A;  3FX3 A;  4EVI A;  2ZNY A;  4CHU A;  4ESJ A;  5D5V B;  1ZRE A;  3KCC A;  4D0P A;  4A0X A;  2CWE A;  1WI9 A;  4U0V A;  4U7D A;  1BI1 A;  2NNN A;  1O3R A;  2GA2 A;  2ESH A;  1IN8 A;  2K4J A;  4U88 A;  2NS0 A;  5BOX A;  4PCQ A;  3GUD A;  1IN7 A;  4PGG A;  5LLQ A;  4NHJ A;  3COA C;  1FC3 A;  2XGX A;  2XV4 S;  5E20 A;  2C6Y A;  2OZU A;  1YQA A;  2XAJ A;  2XHK A;  2QM3 A;  3DEU A;  3GZ6 A;  1XGM A;  3KET A;  2WC2 A;  4MHG A;  1LQ1 A;  2RC4 A;  4BYY A;  1ZGA A;  2VBW A;  5DD4 A;  1FBS A;  4OU0 A;  2ISZ A;  1UB9 A;  4FX0 A;  2HYF A;  1KQ9 A;  2HKO A;  4IPA A;  1MJA A;  2KJC A;  2PJP A;  3B73 A;  3QP6 A;  2V9V A;  2DAO A;  3V4G A;  4ENM A;  4LLL A;  5FD6 A;  1KGS A;  2MD5 A;  5CVV A;  3CO6 C;  2M5W A;  1J75 A;  5DEQ A;  2NAZ A;  2L54 A;  1H0M A;  2UXX A;  1T98 A;  4WXH A;  3ZMZ A;  4I02 A;  3M1E A;  3F21 A;  1Y0U A;  2KIM A;  1XDU A;  4WCG A;  4N0B A;  3NEU A;  5CVR A;  1NHA A;  2HEO A;  3E5X A;  6PAX A;  4NB5 A;  1SFX A;  4A6E A;  4LFU A;  1R00 A;  3RJP A;  3LAP A;  2A5Y B;  1YG2 A;  1E17 A;  3I58 A;  1JXS A;  2IA0 A;  3MCZ A;  2E7W A;  4CO8 A;  2XAQ A;  4Q48 A;  4HQM A;  5ERI A;  4JBA A;  4HX7 A;  1L3L A;  4I0B A;  3F8F A;  1VTN C;  4I01 A;  3E6M A;  3R60 A;  1P4A A;  1I1S A;  3L2C A;  1J7K A;  4OMY A;  2JPC A;  3REO A;  4L9N A;  3IHU A;  2Q2E A;  1YS7 A;  1R5H A;  2ZKZ A;  2L01 A;  2FA5 A;  2AS5 F;  4XRF A;  5F1R A;  4MTE A;  5LEK A;  4N9H A;  4MEX F;  2V6C A;  3L09 A;  2QYO A;  1XGN A;  3ABT A;  5L3E A;  3RDI A;  3TOA A;  1IXR C;  1IAW A;  4L18 B;  2V1U A;  4BAY A;  3HSR A;  3KP4 A;  4WWC A;  4HOB A;  4UV8 A;  2IA2 A;  3KEQ A;  3KZZ A;  2IA1 A;  1XSX A;  3K2Z A;  4M6X A;  5ICC A;  2P8T A;  2O6G E;  3J80 K;  3WTU C;  3NRV A;  2BE5 F;  2FBI A;  1W7P B;  1BM9 A;  5LGN A;  2P5L C;  2HFH A;  4O5V A;  3LA2 A;  5BMZ A;  2F5F A;  3F8N A;  4HF0 A;  3JW4 A;  2ZBK A;  3F6O A;  1OKR A;  5LGT A;  4KN7 X;  1ZLJ A;  3P9K A;  3SZP A;  3E6C C;  1U3E M;  4KT5 C;  3ERE D;  2PI0 A;  3F72 A;  3JTH A;  3WGH A;  3DXJ F;  4KIC A;  2E1C A;  2MH9 A;  2W24 A;  3KLN A;  2RQP A;  3HUG A;  4G8X A;  3BJO A;  1QZY A;  3L9F A;  1LJ9 A;  1B9M A;  3HRS A;  5E1Z B;  3BY6 A;  4XLP F;  2GIV A;  3GYH X;  2F5C A;  1MZB A;  4Z2Y A;  2M87 A;  2OQG A;  2FNA A;  3O6B B;  1KU3 A;  4LK0 F;  3KE2 A;  4P5O A;  3K1N A;  1IRF A;  5L3D A;  3J81 Z;  1UHW A;  4I2O A;  4ZZD A;  4AIH A;  2QEN A;  1L0O C;  2DO7 A;  1KU9 A;  4Q4Z F;  2VOD A;  2DT5 A;  2RGV A;  2COM A;  3GX4 X;  2R7F A;  3M7G A;  4NQW A;  2OA4 A;  3CUO A;  2IT0 A;  2D1V A;  2PFB A;  1PP7 U;  3H3Z A;  2RNJ A;  5K5R A;  4G94 A;  1HW2 A;  5HVQ C;  1X3U A;  2K4B A;  1G3T A;  2XIG A;  3E5U A;  2FRH A;  3WTW C;  1WWX A;  2BEO A;  1R23 A;  1UFM A;  2FU4 A;  2D45 A;  2A6H F;  5A2Q Z;  1YO5 C;  3JSO A;  4MNU A;  1KQ0 A;  3CTA A;  1P4W A;  1ONV A;  3ZPL A;  5L3C A;  3E6D A;  2RN7 A;  3RPU A;  3ZMS A;  2R3S A;  1EH6 A;  1U5T B;  1FPQ A;  2IP2 A;  3QRF F;  2O61 A;  1JHH A;  4MQ9 F;  4MEY F;  4EM2 A;  5TJJ A;  2EFQ A;  4GGG A;  4RGU A;  3MZY A;  1SMT A;  3ZN1 A;  2Z9O A;  3MAJ A;  3ZN0 A;  1IF1 A;  1Z1D A;  2XVC A;  1KYZ A;  2XAG A;  2LF7 A;  5BS6 A;  2XKO A;  3EUH A;  2JTV A;  2STT A;  2ELH A;  3QOP A;  4EJV A;  1R5G A;  3RIR A;  2AXL A;  3N97 A;  4HAM A;  3K9T A;  3WTS C;  2VBY A;  5LHG A;  3I64 A;  1I27 A;  1FSE A;  3IC7 A;  4HX8 A;  4ESF A;  2GXB A;  4ZYG A;  2EV5 A;  2ACJ A;  1Z6T A;  4FHT A;  1IXC A;  4Y15 A;  3TOB A;  1LDK B;  4OMZ A;  3RKY A;  1SAX A;  2K86 A;  3C18 A;  4XLN F;  4YFX F;  3PQJ A;  3NQO A;  1EH8 A;  4WX9 A;  1K6O A;  1ZLK A;  2QBY A;  2F2E A;  5HS7 A;  1ZAR A;  1OYI A;  3GVA A;  3KP6 A;  1IUY A;  3F8C A;  2H27 A;  3MEX A;  4I98 B;  1D3Y A;  4RGX A;  4A6D A;  1BI0 A;  1A04 A;  3VEP A;  2ZO4 A;  3RYR A;  1GVJ A;  2BV6 A;  3VOD A;  2FEZ A;  2HGC A;  2PMU A;  3LQR A;  3HSF A;  2CG4 A;  3ML6 A;  3KEO A;  1G3S A;  4I0A A;  1UCR A;  4OIO F;  3DFG A;  4IJA A;  1F4K A;  1FP1 D;  4WF2 A;  2PMH A;  2DBB A;  5CVI A;  1U5T A;  2Y0M A;  1IN4 A;  3C3W A;  2P5V A;  2W57 A;  3ZP5 A;  2KKO A;  3P9I A;  3SFZ A;  1O57 A;  4FT8 A;  3QU3 A;  4QLC U;  2YR2 A;  2F5E A;  4G7Z F;  4M9Z A;  4CDG A;  2A69 F;  4RB1 A;  1J5Y A;  4FX4 A;  5CYV A;  5LRS A;  1QQI A;  1OPC A;  4RB3 C;  1I5Z A;  2XKP A;  2EV0 A;  5BPI A;  2NYX A;  4E70 A;  5E18 F;  2FSW A;  2FF4 A;  1STZ A;  4UXN A;  2BYV E;  2ETH A;  3JTG A;  2DPD A;  3Q9V A;  4LJZ F;  2A07 F;  1YS6 A;  1S6L A;  5E8G A;  3KP7 A;  2P6T A;  5LRR A;  2HS5 A;  5JVT A;  1V3F A;  2YSR A;  3EET A;  3JAM K;  5J6X A;  1IXS B;  3IWZ A;  2WV0 A;  1KA8 A;  5DDG A;  3GFL A;  4OIR F;  3IRR A;  3RYP A;  3SHF A;  3VOE A;  3IKT A;  3ABU A;  1R36 A;  1LDJ A;  4KMF A;  3ZMD A;  2UXN A;  5DCF A;  5ICE A;  3DPL C;  5KVR A;  1K79 A;  2M8E A;  2ESN A;  5E8I A;  5D5X B;  1W5T A;  2KJB A;  2Y48 A;  3BPX A;  2EFW A;  2G7U A;  1XSD A;  1GHC A;  3ROU A;  3KP2 A;  4KIB A;  3I4P A;  2OQR A;  1E2X A;  1YTY A;  1XCB A;  2DFI A;  1U78 A;  5IT9 K;  2A61 A;  4G7H F;  5D4R A;  1KQ8 A;  1EH7 A;  4B09 A;  1T6S A;  1B1B A;  3KLO A;  3DPT A;  3I54 A;  3WOD F;  1DPR A;  3TDU C;  3TGN A;  3L00 A;  2G9W A;  1FYK A;  5F6F A;  3LWF A;  4IRH A;  1P4X A;  2M45 A;  3LQQ A;  5DCM A;  1SFE A;  3Q9S A;  5FO5 A;  4MQV A;  5HLG A;  4M9S A;  1D8J A;  3DP7 A;  2H6B A;  3KP5 A;  4OIN F;  2F5D A;  3ECO A;  2W85 A;  1DP7 P;  3ECH A;  3C1D A;  2CGP A;  3HTS B;  4M72 A;  2RDP A;  2D1H A;  1O3Q A;  5DUI A;  4Q47 A;  1OYW A;  4H0E A;  3QPH A;  1WRJ A;  3VFZ A;  2LKP A;  1IW7 F;  2P5K A;  2VE9 A;  3TO9 A;  1R1U A;  1C0W A;  1ZRF A;  4G9Y A;  4ENN A;  1USS A;  2HTS A;  2OBP A;  4LMY A;  3LA3 A;  1LDD A;  1AWC A;  1ZYR F;  4ON0 A;  4EM0 B;  3ZMV A;  1XGO A;  1U5T C;  4K2E A;  2XAH A;  2KIF A;  3BPV A;  4IVN A;  2QQ9 A;  4UHT A;  1YLF A;  4CGZ A;  2ZFW A;  4BHC A;  4YIF A;  1G3Y A;  2FMY A;  1XN7 A;  1OMI A;  1XMK A;  2CSO A;  2K27 A;  1TNS A;  3BJA A;  4A5N A;  1TQP A;  3V7R A;  2EV6 A;  3E5Q A;  4BH9 A;  5H6R A;  2O0Y A;  2ZCW A;  2STW A;  2KIU A;  3FZV A;  3M8F A;  4AIK A;  3LFK A;  3BRO A;  2DI3 A;  3IKV A;  2MC3 A;  3U9G A;  1ZRD A;  3FF5 A;  5DD8 A;  4ETS A;  3BJ6 A;  2ZME B;  2CO5 A;  4CIC A;  2HQR A;  1MD0 A;  4BHP A;  4GCV A;  1DPU A;  4HV6 A;  3S2W A;  2FBH A;  1XCV A;  2W84 A;  1ODD A;  4M74 A;  3HHH A;  4PZJ A;  4M9X A;  5ILV A;  4S05 A;  3WE3 A;  2HKX A;  1QPM A;  3W6J B;  1YYV A;  3QPT A;  3GFI A;  4HDU A;  1QGP A;  5E1W A;  1FYM A;  1W7P D;  1TW2 A;  1T39 A;  4IHT A;  4OOI A;  3TQN A;  4ZZL A;  2A3S A;  4LG0 A;  2IPQ X;  2H94 A;  3EYI A;  4G7O F;  1LEB A;  4RB2 C;  3ULQ B;  2QWW A;  4N9I A;  2XAF A;  3O3K A;  4EJW A;  3TKY A;  4P9F A;  3W6K B;  1FT9 A;  4O6J A;  4BXU A;  2P6S A;  4EQQ A;  3RTR A;  2VT2 A;  1HW1 A;  4JK1 X;  2RV8 A;  2JRT A;  2QQB A;  3QU6 A;  4U0Y A;  1Z05 A;  2YPR A;  5FLX Z;  4MTD A;  5FLX K;  4OIP F;  4L5J A;  5JR3 A;  4EV0 A;  1O3S A;  1GXQ A;  4HF1 A;  1QZZ A;  2K02 A;  4LLN A;  2HQN A;  3EYY A;  2ZME A;  2D2W A;  2EA4 A;  3E3V A;  2ADU A;  5FB2 A;  2H6C A;  4G6Q A;  4L9T A;  3WTX C;  3BZ6 A;  2V79 A;  1ZG3 A;  3R0A A;  2RVC A;  5DUK A;  5ICF A;  3WE2 A;  1W7P A;  4DNC A;  3GFM A;  4U0W A;  1MGT A;  1TLH B;  2EFP A;  1Z7U A;  4LD5 A;  1FYL A;  3GEZ A;  5KK1 A;  3GW2 A;  4GXO A;  4AVP A;  4I7H A;  4A0Z A;  1V4R A;  3P7N A;  2X4H A;  1FP2 A;  1RNL A;  2OZ6 A;  4HLY A;  3H3U A;  1FNN A;  2VXZ A;  1F5T A;  1XD7 A;  1P6R A;  3WTV C;  2EJR A;  3WGI A;  4HV5 A;  1SD6 A;  5K1Y A;  2W25 A;  1XGS A;  2ZNZ A;  1T38 A;  2P7V B;  3LST A;  1ZN2 A;  4KA4 A;  1FBU A;  1SD5 A;  3F23 A;  2FML A;  2UZK A;  1BI2 A;  3WU0 A;  3CUQ B;  1BJA A;  3HTU A;  2QLZ A;  4BNC A;  4RB0 A;  5D8L B;  1FOK A;  2JSC A;  3BWG A;  5HDN A;  1RUO A;  2EK5 A;  3RKX A;  1J0R A;  4A5M A;  3FWE A;  3R4K A;  5D5W B;  2L3D A;  1S7A A;  3V8L A;  2XRN A;  1QNT A;  5LHI A;  1SMY F;  3I5U A;  4HZF A;  1H9T A;  1HKQ A;  1S3J A;  3CO7 C;  1BI3 A;  4F7Z A;  2PN6 A;  4HW0 A;  5HDG A;  2Z5U A;  2JT1 A;  3G3Z A;  1MDM B;  3DQV C;  1HBX G;  1BC7 C;  4KN4 X;  3MFK A;  1GXP A;  4HA8 A;  3LAJ A;  1FLI A;  4L9J A;  1IN6 A;  2PEX A;  5JFR A;  4KNY A;  1ZGJ A;  3J80 Z;  2DU9 A;  2E1N A;  2Q8K A;  2M30 A;  2DPU A;  3GWZ A;  2R7D A;  2O03 A;  3HSE A;  3BP8 A;  4LGW A;  2O8X A;  2O3F A;  1XSV A;  3R6S A;  5ILU A;  2DW4 A;  4YFN F;  2NNY A;  4UV9 A;  4UVB A;  3KP3 A;  1TNT A;  2VE8 A;  1REP C;  4KYW A;  4LK1 F;  3DV8 A;  2XRO A;  1XMA A;  2Z99 A;  2VT3 A;  4P9U A;  4EMS A;  1SD7 A;  1BIA A;  1DDN A;  2DK5 A;  3WG9 A;  1BIB A;  1U2W A;  3SXY A;  1YW9 A;  1Z6R A;  2ISY A;  3WGG A;  5A2Q K;  4HBL A;  2FBK A;  5CLS A;  4GYI A;  2IRF G;  4IRG A;  1P2F A;  2KRF A;  1QBJ A;  2VBX A;  4BQA A;  4ENK A;  1BC8 C;  2PBI A;  5IT9 Z;  5K5Q A;  1PP8 F;  2MH2 A;  1IZ1 A;  5HDK A;  3VB2 A;  2EWN A;  2J5O A;  2YX7 A;  1BN5 A;  4HX4 A;  4YG2 F;  4CZZ A;  1UHM A;  4ZH4 F;  1G6N A;  5FFX A;  4Y13 A;  1HKT A;  1R1T A;  1MDM A;  4YFK F;  1S8N A;  3ZQ7 A;  2WTE A;  2M1B A;  2VON A;  2IW5 A;  3K1M A;  3SZT A;  1SFU A;  4OIQ F;  3IRQ A;  3FMR A;  4JQF A;  4KUM A;  2MA3 A;  3E6B A;  3FXQ A;  2J5P A;  4S04 A;  1FSH A;  3QAH A;  2IVM A;  4RS8 A;  4ESB A;  4UVA A;  1HST A;  2GXG A;  2WWY A;  4RGR A;  2P4W A;  4YII A;  1CF7 B;  3N4M A;  2QZ8 A;  1J9I A;  2A68 F;  2EFN A;  5CJ9 A;  3ISP A;  1FX7 A;  1QO0 D;  2VN2 A;  3GFJ A;  2FXA A;  2DQR A;  1ON2 A;  4PGH A;  4O3M A;  4CYD A;  3BDD A;  1LB2 A;  4KDP A;  1O3T A;  5JHU A;  4BHB A;  3FM3 A;  1ZG1 A;  1Q1H A;  3V8J A;  4ZYH A;  4XSZ F;  1U8R A;  5AIP A;  5FFZ A;  3T8R A;  5ILS A;  5K5O A;  2EA2 A;  1R1V A;  1R58 A;  2PLY A;  5D6E A;  1P92 A;  3TO6 A;  2L02 A;  1PDN C;  4UVC A;  3U1D A;  5F64 A;  2G7H A;  2K7L A;  5D4S A;  3Q5F A;  4GO1 A;  2GAU A;  5H6Q A;  1JE8 A;  1TBX A;  3WTT C;  4KMU X;  3M8E A;  3J7A O;  3WTY C;  2VBZ A;  3JAM Z;  3T0Y A;  1CGP A;  3MWM A;  2XAS A;  1HW5 A;  1SD4 A;  4UNO A;  2IJL A;  3FHZ A;  4ENJ A;  3FXU A;  5E17 F;  2B0L A;  3HRM A;  4Q5S F;  3D0S A;  4EGZ A;  1WKM A;  3F22 A;  2Y75 A;  3AAF A;  5BQT A;  5TRD A;  2LSO A;  1YIO A;  3T8T A;  2QUF A;  4A2U A;  5LGU A;  3JSP A;  2OD5 A;  3ELK A;  5ED4 A;  4HF2 A;  4PDK A;  1I1G A;  5L3F A;  1MJB A;  3OOP A;  4A0Y A;  3HHG A;  1I6X A;  1F9N A;  4P55 A;  1TQM A;  2GWR A;  5LEJ A;  5HS8 A;  4AIJ A;  3GXO A;  3RKW A;  2OU2 A;  1B4A A;  4R1H A;  5J8F A;  2GQQ A;  1HSJ A;  1RUN A;  2HYG D;  2Z3Y A;  2Q0O A;  5LBQ A;  5FGM A;  2MBF A;  2ZXJ A;  3KZY A;  2JPB A;  3K69 A;  5L3G A;  1J2X A;  4EJU A;  4LB6 B;  1KU7 A;  3MQ0 A;  3RPQ A;  3GZ5 A;  4KIG A;  3TDZ C;  2EB7 A;  3F3X A;  4HDV A;  1W5S A;  3HOT A;  2H09 A;  1B59 A;  2YU3 A;  3V7C A;  1G4D A;  1T2K A;  2EFO A;  5J8C A;  1HKS A;  1JHF A;  1BOA A;  4RAY A;  1KYW A;  1WSU A;  1YW8 A;  2HWV A;  4AD9 A;  4XBF A;  2Z33 A;  3I71 A;  3P9C A;  2CW0 F;  3WTZ A;  5H20 A;  1OYY A;  4L9V A;  2LDU A;  3I0T A;  5D8K B;  2MLG A;  4Y17 A;  5CVU A;  2FQ3 A;  4GYG A;  2HDC A;  1R22 A;  2LNB A;  4WXD A;  2YX4 A;  3F8M A;  1D5V A;  4MGR A;  2L4M A;  1CF7 A;  2QVO A;  1PUE E;  3B02 A;  5CVJ A;  3IL2 A;  1YW7 A;  3T5X A;  1FY7 A;  4RAZ A;  3PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...