1FBUA

Heat shock transcription factor dna binding domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK FACTOR PROTEIN
publication title Proline in alpha-helical kink is required for folding kinetics but not for kinked structure, function, or stability of heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
molecule tags Transcription
total genus 25
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fbuA00
1R5HA 4ENJA 2P6TA 2W85A 3IC7A 3ZMZA 1O57A 1STZA 4AIHA 3T8TA 3JSOA 3SZTA 3BPXA 4TV7A 3WGIA 6PAXA 2NNNA 2QYOA 3ISPA 3COAC 3KZYA 5HS9A 4EGZA 3LQRA 2FBKA 1B59A 3P7NA 4BHBA 3R60A 3WE3A 4KDPA 4BHPA 1TW3A 5E8GA 1R5GA 2LNBA 3HHHA 2OBPA 4MQVA 2XAQA 4M9XA 5DV5A 3NRVA 1WRJA 3I4PA 4LLGF 2ETHA 2GA2A 5JI6A 2DPDA 3TOAA 1YQAA 5AONA 1KA8A 2A07F 3E6BA 1XDSA 2EV6A 2UXNA 2QQ9A 1SFXA 2MA3A 5IT9K 1IXRC 4A6EA 1UHWA 3ZMUA 2JSCA 2XRNA 5DUKA 3Q9VA 2H09A 2FF4A 2ZMEB 1KQ9A 1W5SA 2OU2A 2D2WA 2VC0A 5CLSA 4QLCU 2PN6A 4HYEA 2ADUA 5LGTA 1W7PD 1QBJA 3HUGA 2OZ6A 3KLNA 2STTA 4YIFA 1TLHB 3WTVC 3IWZA 3ELKA 4HF0A 1ONVA 3KE2A 1MJBA 5ICFA 1OYWA 2XKPA 4HF1A 5D5XB 1O3SA 1J9IA 4S05A 1FWZA 3TGNA 1ZARA 1I6XA 1QPMA 2CW0F 1P4XA 1I1SA 4MEXF 2V1XA 4BAYA 4KNYA 3NQOA 4EJTA 2NRAC 5A2QZ 2DFIA 2KRFA 1J75A 2GQQA 1Z1DA 4OIQF 2FE3A 4ZYGA 4HV5A 2E1CA 1IXCA 3O6BB 5CVIA 1T6SA 5BMZA 3U9GA 1FSEA 4RS8A 3FXRA 4M72A 2X0LA 2IPQX 2PG4A 1USSA 2NYXA 4LFUA 4OIOF 3J80K 2YU3A 3OOPA 3ROUA 1SFUA 5LEJA 4WF2A 2HTJA 3F8FA 2R7DA 1QO0D 2CG4A 1Z6TA 3EDPA 1USTA 4UVBA 3CUQA 5D8KB 1ZGJA 2F5EA 5TJJA 3FF5A 2EV5A 2A6EF 3TO6A 4P9FA 1B4AA 1EV7A 5LGNA 4N9HA 1UB9A 1H9GA 3M1EA 2IT0A 2WWYA 4L5IA 1XN7A 4BXUA 3GUDA 4U0VA 3KP2A 3VB2A 3HRSA 1DPRA 3BP8A 2L4AA 2DK8A 4PZJA 2HGCA 3HHGA 1CGPA 3SQNA 4UVCA 2HOEA 1ODDA 2LF7A 2JPBA 3K1PA 3FMSA 3KEQA 4KMFA 1REPC 1EH7A 4JK1X 3ML6A 2YX7A 2OZUA 2CGPA 5L3EA 3RKWA 4Z2YA 2VE9A 5TRDA 3RKYA 4EJWA 5DEQA 4UVAA 2XV4S 3RPUA 4CICA 5JR3A 4IHSA 3W6JB 5D4SA 3QU3A 4Y13A 2QBYB 2Z9OA 4U7BA 4LB6B 3IKVA 4U0WA 2BBYA 4M73A 1KQ0A 2V9VA 1BIAA 2HFHA 4UV8A 1XSVA 2P5VA 1R1VA 1K78A 2GXBA 3WTUC 3GO5A 3FXQA 4L9TA 3LAJA 1IUYA 3FZVA 2YX4A 2VBZA 4LB5A 2A69F 4OINF 3E6DA 3F8NA 1WSUA 2OQGA 1HBXG 3E97A 2L02A 2G9WA 2JT1A 3RYPA 1RZ4A 4HZFA 1ZRFA 2CO5A 3I5UA 1XGSA 4EGYA 3L9FA 3MZHA 3E5XA 4OU0A 3I64A 2DQLA 3C1DA 1DPUA 2PJPA 3EETA 3B02A 2CQKA 3KEOA 2QQAA 4CO8A 2EK5A 2FQ3A 2EWNA 3GX4X 1KQ8A 3OV8A 2XASA 2O03A 2F5DA 1RUOA 1U5TC 5BS6A 2YR2A 2K4BA 1V3FA 4I0BA 1YIOA 3EYYA 1BBYA 2RQPA 1PP7U 3IWFA 2DW4A 4IHTA 3T0YA 1XDUA 3LAPA 4WXDA 4KFCA 5D8LB 1IN8A 4PCQA 3I59B 5AIQA 4M6YA 2STWA 1FZPB 3R0JA 3R4KA 3ZMDA 1P2FA 4LK0F 3L00A 1P4AA 1MD0A 5FLXK 2QUFA 4ENNA 1G3YA 2G7UA 3H3ZA 3HIFA 3TOBA 5K5OA 1T39A 2VODA 5F1RA 1HSJA 3I54A 1D8JA 5HDGA 4MGRA 4DQ2A 3IRQA 1BI2A 3O3KA 4OIRF 1G3SA 2OD5A 4B09A 1C0WA 1IN4A 4NB5A 3KLOA 3HRMA 4O3MA 2IVMA 3F8MA 4KN4X 2P6SA 1JGSA 2PQ8A 2DO7A 1A04A 4Q5SF 3DPLC 4ASNA 3O2PE 5FD5A 3TQNA 1J7KA 1OMIA 4LLNA 2Q2EA 4NQWA 2XVCA 1R1UA 2QWWA 2MC3A 4LG0A 1HW2A 3BY6A 1YTYA 3L2CA 2VOPA 1R22A 5DCMB 3F22A 4OMZA 3RJPA 1ULYA 4A6DA 2DAOA 4HX4A 1XD7A 4HLYA 1RIOH 3E3VA 3PQJA 4GGGA 5HLGA 4KT5C 1GVJA 4LLLA 3KP3A 2P7VB 2A61A 4ZYHA 5DD4A 1HW5A 5LGUA 3WTSC 2TDXA 1YLFA 4YG2F 3QAHA 2KJBA 3SZPA 2FEZA 2YPRA 1U3EM 4ZZLA 3TDUC 4QWQA 2FMYA 5KVRA 1MDMB 3ZP5A 3K0LA 3GYHX 2WTEA 1TQMA 3CO7C 2KJCA 2H6CA 2ZFWA 5CVVA 3M8EA 2ISYA 3CUQC 2AXLA 2M1BA 1MJ9A 2UXXA 3VFZA 5FFXA 3GEZA 1PDNC 2RKHA 2HYGD 5H6QA 1WKMA 1BI3A 4AIJA 2LDUA 4G7OF 1U5TA 5LHIA 4KYWA 5E8IA 3FXUA 1FOKA 3IRRA 3ABUA 1EH8A 1O3RA 1IF1A 1L0OC 4GXOA 1ON2A 1BJAA 5FO5A 3C3WA 4P9UA 4JQFA 3G73A 3GZ5A 1R7JA 5D6FA 2M5WA 4KIGA 1S29A 1ZYRF 3JTHA 3F6VA 4MTDA 1BN5A 3BJAA 3M9AA 3GFMA 1R1TA 5F64A 3IKTA 2DT5A 2QM3A 5K5QA 4FT8A 1W4MA 1BC8C 2HKXA 2UZKA 1O7LA 4XBFA 3R0AA 3HOSA 1Z91A 1Z7UA 4Q4ZF 5HDNA 3WTXC 1DP7P 3GFLA 1K6OA 3BJOA 5LHHA 1SD4A 2MLGA 4CGZA 3IL2A 1ZAOA 4EM1A 2Z3YA 1F4KA 3FMRA 1JE8A 4E70A 4L18B 3U2RA 2LF8A 4EM0B 1UFMA 1PP8F 1HKSA 1B6AA 3HSRA 3LQQA 3RTRA 5FD6A 4EJUA 4I0AA 4AWXB 5HVQC 4M6XA 1D8KA 2IW5A 3TDZC 3K69A 2ZKZA 3D0SA 5K5RA 1KU3A 1QZZA 2KKOA 1FBUA 3K9TA 2RDPA 1FY7A 5L3DA 2Y75A 3ZPLA 1YS7A 3LFKA 3KCCA 5IT9Z 1JHFA 3GXOA 2ZNZA 4WXCA 1T38A 2E1NA 1U6GA 3U1DA 3ZN0A 2MLKA 3TO7A 4I02A 2FXAA 3ABTA 4IVNA 5LLQA 1ZREA 1LVAA 4HQMA 4D0PA 1MKMA 2XUBA 4EM2A 4IF4A 5K1YA 3WGGA 2DI3A 3RYRA 3E5QA 1QGPA 1KGSA 2O8XA 3DKWA 2FNPA 4WXHA 1Q1HA 4G94A 4KIBA 5CJ9A 1FYKA 4OMYA 4CHUA 2RC4A 2XAHA 1YO5C 1YW8A 2QZ8A 1J5YA 3LA3A 4BYYA 1BI0A 5H20A 2ZNYA 1LDJA 3HTUA 4A0ZA 2RNJA 1SAXA 3VOEA 4IPAA 2OAZA 1XGNA 5BOXA 4P96A 2VBWA 3ZMVA 4ETSA 3RIRA 5E1WA 3Q5FA 1Z9CA 2W57A 3FHZA 2HYFA 4KA4A 1AOYA 1F5TA 1QZYA 2DTRA 2EFWA 2B0LA 2XGXA 1FC3A 1ZGAA 3ZMTA 2W24A 4G6DA 3HRUA 4G7ZF 2K86A 3KP6A 2WC2A 3E5UA 2YSRA 3ECHA 2RN7A 5HS8A 3FX3A 2E7WA 1KYZA 4BNCA 4L0YB 1LDDA 1G6NA 3J80Z 3C18A 1O7FA 2VBYA 2MD5A 2F2EA 3DP7A 1S3JA 1HW1A 4RAZA 2ZXJA 2KIMA 1TNSA 1LEBA 2P7CB 1FP2A 1B1BA 5LRRA 2BE5F 1FYLA 2PMUA 4I7HA 1OKRA 1UCRA 4RB1A 5CYVA 2MH9A 2M8EA 1BI1A 2F5CA 4Y17A 1T98A 1R00A 1IRGA 4EV0A 5BQTA 3MAJA 4EMSA 2EB7A 2ESNA 4HX8A 3FM3A 1P92A 3EYIA 4G8XA 4KICA 4A0XA 4HQEA 2DLLA 2DU9A 1HXDA 4CYDA 3WGHA 2DBBA 1YYVA 2PBIA 1LQ1A 1P6RA 1BM9A 1JHHA 2FBIA 1I5ZA 4WWCA 4UUVA 4LD5A 4R79A 4IRIA 3FMQA 4HOBA 4RGRA 1ZRDA 4A12A 2FBHA 3WTWC 3Q9SA 1LB2A 2OA4A 5FGMA 5KK1A 2WV0A 2COMA 2PLYA 4HV6A 3S2WA 3M7GA 5BPIA 1K79A 4I98B 2XIGA 4PGGA 2JZYA 3HTSB 1BC7C 3BOQA 3LA7A 4ENMA 2R3SA 1MJAA 2CWEA 3ZN1A 1G3WA 3V7CA 1XSXA 2L4MA 2R7FA 5EEHA 5ICEA 4MHGA 3BROA 4KN7X 1FX7A 5F6FA 3E6CC 5LHGA 3FM5A 4A5MA 2JRTA 3LSTA 1WWXA 2FA5A 2L3DA 2LSOA 2Z33A 4RB0A 4WX9A 1RNLA 1CF7A 2M87A 3CO6C 2EA4A 2VT2A 1W7PA 3DQVC 2XAJA 1YW7A 4EQQA 3CLOA 4R8HA 2JTVA 3I58A 4RGSA 2J5OA 2W25A 3WTZA 5J6XA 4CDGA 5L3GA 5LEKA 1F1ZA 1KU9A 1V4RA 3KP7A 4RB2C 2A68F 2EFNA 3MCZA 4BH9A 3J81K 3HRTA 2DK5A 2ISZA 1LDKB 1XCVA 2F5FA 2EJRA 2O3FA 3DPTA 4YFKF 3REOA 4XRFA 4U7DA 2FMLA 2VE8A 3VODA 1XGOA 5E20A 3N97A 1LEAA 4NHJA 4HW0A 1U5TB 2QLZA 2GZWA 1IZ1A 2BV6A 5HDKA 4CXFA 1U8RA 3GVAA 5FLXZ 2O61A 3JTGA 1SFEA 1B9MA 4K2EA 2OQRA 2P8TA 4UNOA 1G3TA 1VTNC 5ICGA 5HOOA 4IXAA 5D5VB 1ZRCA 1XMKA 1P4WA 3TO9A 2L01A 3LWFA 2K7LA 4WCGA 1R23A 2FSWA 4S04A 5JHUA 1FP1D 3RI4A 3ZQ7A 1TBXA 3D5LA 3VEPA 4L9JA 4HX7A 1JXSA 2A5YB 1KU2A 2Y48A 1O3TA 4GCVA 2J5PA 4ZYDA 1D3YA 1FSHA 2VT3A 3K1MA 2O6GE 3F21A 1FPQA 3E6MA 1R36A 1D5VA 1SD6A 2A6HF 4HDUA 3I59A 3V4GA 2HWVA 4IJAA 2QENA 3JAMK 4AD9A 4Y15A 2HKOA 1FNNA 3MZYA 4Q47A 3WU0A 2ELHA 1FBSA 3KETA 5DDGA 2M30A 1ZG5A 4H0EA 4U0YA 4R1HA 4HBLA 2A3SA 5J8CA 5ILVA 2LKPA 3HSFA 3C7JA 3EQLF 4LMYA 5E17F 1MGTA 1MZBA 4Q48A 4FHTA 1E17A 3CTAA 2HDCA 1X3UA 3JW4A 5DCFA 2NS0A 3JAMZ 5FB2A 2DPUA 2ZJ2A 3MQ0A 1J2XA 1FT9A 4ESJA 3ERED 1SMTA 4BQAA 4EJVA 2V6CA 3B73A 1ZLKA 4MNUA 3BJ6A 1ZN2A 2HQRA 3IHUA 4XLNF 1U78A 3R61A 1E2XA 3QU6A 4RGXA 4HLXA 2VN2A 2ACJA 1R58A 1XMAA 2BGCA 2Y0MA 5DCMA 3CUQB 5JVTA 1TW2A 3QP5A 4L9NA 1HKQA 3I71A 3DXJF 5CVJA 3WTTC 2CYYA 2V1UA 1NHAA 2NNYA 3QPHA 1OYIA 1OPCA 2PI0A 2W84A 4CZZA 3V8LA 1TQIA 4L0ZB 3NEUA 1K7AA 2VONA 2EFQA 4LK1F 3DFGA 2K27A 2K4JA 4UXNA 3BWGA 5IT3A 5A2QK 4A0YA 4A5NA 1T2KA 3WE2A 4WK8F 2GXGA 2HZTA 3GF2A 2UWMA 1BIBA 4MEYF 1WI9A 3LA2A 4ESBA 1MDMA 5DYMA 3K2ZA 3ZMSA 1HKTA 1OYYA 4P5OA 5CVRA 1YW9A 3QPTA 2DQRA 4N9IA 5BPDA 2RVCA 2VXZA 4ON0A 2QVOA 3FWEA 1KU7A 2EFPA 3R6SA 1Z05A 4AVPA 4B8XA 4GYGA 3H3UA 4I2OA 4ZYEA 4N0BA 2GAUA 4HF2A 5ILSA 2KIUA 3HSEA 1K78B 3L09A 2RV8A 1XSDA 1QNTA 2PEXA 3BPVA 4U88A 2IA1A 2V79A 2O0YA 2XHKA 3DV8A 2JPCA 4RB3C 1ZH5A 2ZBKA 2FRHA 3J7AO 1IW7F 1EH6A 5AIPA 1QQIA 4O5VA 5ICCA 2FOKA 4PGHA 3KP5A 2MH2A 3MWMA 1WQ2A 2P4WA 2V1DA 4UHTA 2HTSA 2ZMEA 2ZCWA 4A2UA 1O3QA 5CVUA 3QP6A 1HSTA 3WTYC 2NAZA 3DF8A 3CJNA 4GYIA 2D1VA 1J0RA 1H9TA 5J8FA 1CF7B 3GW2A 1W7PB 3KZZA 2VOOA 5E1XA 2D45A 3KFWX 4FX0A 4YFNF 3GFIA 2FNAA 3BZ6A 4XSZF 1BOAA 5D5UB 1FLIA 3AAFA 4M71A 1J59A 1S8NA 3V8KA 1DDNA 5E1ZB 4ZZDA 5L3BA 4JBAA 4P55A 2EFOA 4I01A 2GA1A 1B9NA 2XAGA 3CDHA 2PMHA 4OIPF 3H92A 4O6JA 1DUXC 2E7XA 3F8BA 3SHFA 1IRFA 2IP2A 4OOIA 3JSPA 5ILUA 3I53A 3WG9A 1SMYF 4YIIA 4MTEA 2H27A 4BHCA 3SXYA 2D1HA 2HQNA 2ESHA 4ESFA 5HLHA 1T0FA 1FBQA 4LG0B 1F9NA 3I0TA 4L5JA 3GWZA 3P9KA 3F72A 2Z5UA 4L9VA 3GFJA 2P5LC 1GXQA 2BEOA 5FFZA 2VC1A 2XAFA 3T1BA 1IAWA 1XGMA 4ZH4F 2IJLA 3KP4A 1HQCA 3GLXA 2BYVE 1S6LA 3MFKA 3PQKA 3W6KB 2FU4A 3HYIA 1SD7A 3RPQA 1Z6RA 5D6EA 1OR7A 1YFHA 1ON1A 3TKYA 5EEGA 3GZ6A 1I27A 5H6RA 3T5XA 3V7SA 1GXPA 2X4HA 3RDIA 1SD5A 2RGVA 1UHMA 2Q0OA 4IRHA 4GO1A 4I09A 4FX4A 3V7RA 5L3FA 4G7HF 2XKOA 2IRFG 5HLIA 4KUMA 2H6BA 1RUNA 1Y0UA 1L3LA 3DEUA 1PUEE 3V8JA 3QOPA 1YS6A 3ECOA 5HS7A 1XCBA 1GHCA 2QBYA 1XB4A 1I1GA 2IA0A 1IN7A 2G7HA 5D4RA 3L7WA 4M9ZA 2IA2A 2KIFA 5ERIA 4XLPF 2EA2A 1IN5A 1RI7A 3CUOA 3T8RA 1KYWA 1IXSB 4LJZF 1TNTA 4AIKA 3P9CA 1H0MA 2XROA 3M8FA 3MEXA 3J81Z 1W5TA 3F8CA 4M9SA 4MQ9F 2HEOA 2H94A 4HA8A 4IRGA 3K1NA 2QQBA 1ZG3A 4HAMA 2HR3A 5LBQA 1IN6A 1S7OA 5D5WB 5E18F 4F7ZA 2MBFA 2L54A 4PDKA 3F23A 1FYMA 1G4DA 5LRSA 2HS5A 4HDVA 4RAYA 5JFRA 1LJ9A 3N4MA 2P5KA 3QRFF 4EVIA 3WODF 1LNWA 1TTYA 3SFZA 4KIFA 1ZLJA 2M45A 4UV9A 3WU1B 4ENKA 3G3ZA 1ZHFA 4G6QA 3EUHA 2AS5F 5DUIA 3F3XA 4KMUX 4YFXF 3PFIA 2VBXA 4XSXF 1ZG1A 3F6OA 2PFBA 2Q8KA 1AWCA 1U2WA 3ULQB 3BDDA 5ED4A 2GWRA 1S7AA 4G9YA 4EJOA 4LGWA 1TQPA 2EV0A 2GIVA 2K02A 4DNCA 4M74A 3RKXA 3HOTA 3P9IA 2Z99A 2CSOA 2CFXA 1YG2A 5DD8A 5L3CA 2C6YA 4RGUA 2ZO4A
chains in the Genus database with same CATH superfamily
3LSRA 1R5HA 4ENJA 2VJJA 4D1QA 4PFOA 3ERMA 2P6TA 2W85A 3IC7A 3ZMZA 1O57A 1STZA 4AIHA 3T8TA 3JSOA 4C3JJ 1TC3C 3SZTA 3KPHA 5DM6F 3BPXA 4Y4RA 4TV7A 2DTZA 3WGIA 6PAXA 4IL6C 4RM2A 1APLC 1AHDP 2NNNA 2QYOA 3ISPA 1MBHA 3H5NA 2LY1A 3COAC 4RLFA 3KZYA 5HS9A 1U0JA 4XRSG 4G12A 4HPQA 1OCCH 4EGZA 3LQRA 3PIPF 2FBKA 1JUPA 3FBNB 2E2IJ 1B59A 3VYTB 3P7NA 1LPQA 4BHBA 3LSMA 5E3NA 3R60A 4OAYA 3WE3A 4KDPA 4BHPA 2HVRA 2DA4A 4X0GA 1YI2I 1TW3A 5E8GA 1R5GA 2LNBA 4BXXJ 4BDZA 2JWTA 3HHHA 1N75A 2OBPA 4MQVA 3MMYB 2VQLA 2XAQA 4M9XA 5DV5A 3OSFA 2DA1A 1K6YA 1HDPA 3CJTB 3NRVA 1WRJA 2PJRA 2XDVA 3GTLJ 2E1MC 3I4PA 4LLGF 2ETHA 2GA2A 5JI6A 2DPDA 3TOAA 1YQAA 2LH9A 1MBKA 5AONA 5IOYA 1KA8A 3HKZN 1X1PA 2A07F 1E3PA 2O7OA 3E6BA 1XDSA 1TL8A 2EV6A 2UXNA 3ZQFA 5GADJ 5B5EC 4C3IJ 2QQ9A 5GPCA 2R4GA 1SFXA 2MA3A 1N77A 2K85A 2XGCA 5IT9K 1IXRC 3QYFA 4XLHA 4A6EA 1UHWA 3ZMUA 4E7ZA 1VNDA 2L7KA 2CV2A 2JSCA 1DGRM 2XRNA 4GRIA 5DUKA 3Q9VA 4RBOA 2H09A 4DYQA 2FF4A 1ETVA 2ZMEB 1KQ9A 4CYCB 2M4KA 3DKYA 2VLAA 1R5ID 1W5SA 2OU2A 4B3AA 3KYLA 4H4KC 3BTJA 2D2WA 2VC0A 4M3BA 5CLSA 1MNEA 4QLCU 2PN6A 4HYEA 2ADUA 3OYCA 5LGTA 1W7PD 1QBJA 2KPMA 3HUGA 2OZ6A 2X6OA 3KLNA 2STTA 4YIFA 2R5ZB 1B8IA 1TLHB 3WTVC 3JRFA 3OIPA 2HOAA 3IWZA 3ELKA 2P81A 2BOLA 5EG0B 4HF0A 1FOXA 1AU7A 1ONVA 4IKFA 3PNYA 3KE2A 1MJBA 5ICFA 1OYWA 2XKPA 4HF1A 5DS9A 2DOEA 5D5XB 2NVQJ 1O3SA 1T0FC 1J9IA 2PMZN 2L0KA 4S05A 1FWZA 3TGNA 3OOUA 4FCYA 5J4YA 4KJZA 1ZARA 1I6XA 4KT6A 3C2GA 2KISA 1OCTC 4E7LA 1A36A 1QPMA 2CW0F 1P4XA 2CV0A 1I1SA 2F4OB 3DTIA 3BR1A 4MEXF 2R7XA 2MD0A 5B1AH 3ASNH 2V1XA 4BAYA 4KNYA 3NQOA 2HZDA 1XX5A 3OIQA 4BY7J 2HVQA 1QZEA 5A2QZ 2NRAC 2DFIA 4EJTA 2KRFA 4N4OB 1J75A 1VQ8I 2GQQA 1MH3A 2LMDA 1Z1DA 4OIQF 4RLQA 2FE3A 2OTLI 3MN2A 1JI8A 3KX2A 5TISC 4ZYGA 4HV5A 4A69C 3CD6I 3QYEA 2W4SA 2E1CA 1IXCA 5K7HA 3L1PA 3K7AJ 3O6BB 1JKPC 2Y9YA 1OCZH 4D5FA 5CVIA 1T6SA 5F0FA 1A35A 1Y1VJ 5BMZA 3PJRA 3U9GA 1ENHA 2BHYA 1HA8A 1FSEA 4RS8A 3F9KA 3FXRA 3EUAA 3SZGA 4M72A 5EGOA 2VKDA 2QSFX 2IBDA 1X1AA 3OYKA 2X0LA 5F1JA 2IPQX 5CPRB 2PG4A 1USSA 4LITA 2NYXA 4LFUA 3Q0UA 4XL9A 4OIOF 3J80K 2YU3A 3OOPA 5GPAA 4DZJA 2BY2A 3ROUA 1SFUA 4HNTA 1BA5A 4BXFA 2KP6A 2M2EA 5LEJA 1XMXA 4WF2A 2HTJA 2IGOA 3F8FA 3HOWJ 4I6ZA 4IHVA 5IYDJ 2R7DA 1QO0D 2CG4A 1Z6TA 4LG3A 2VJ5A 3GMEA 3K10A 3EDPA 1USTA 2K3FA 4UVBA 3CUQA 2CMPA 5D8KB 2LD5A 1ZGJA 2F5EA 5TJJA 1H8AC 3FF5A 1VQPI 5FLMJ 2EV5A 2A6EF 3TO6A 4P9FA 1B4AA 1EV7A 5LGNA 4A3EJ 4N9HA 1LVKA 1UB9A 2OV7A 1H9GA 5EF6A 3S17J 3M1EA 2HOSA 2IT0A 2TCTA 2R7OA 3IAM2 2WWYA 4L5IA 1XPXA 1XN7A 2R7QA 3GUDA 4BXUA 3ZQCA 4U0VA 3HPHA 2X6WA 3KP2A 3VB2A 3HRSA 4J19A 1DPRA 3BR2A 3BP8A 2L4AA 3BR3A 3C2HA 2EILH 2DK8A 4UY8I 2M0CA 2XGEA 4DYCA 4PZJA 1V5GA 2LFBA 2HGCA 5TGTA 3S93A 3HHGA 3HKZA 2RNGA 1CGPA 3SQNA 5DTDA 4UVCA 1VFCA 2HOEA 1OFCX 1ODDA 2DA7A 1VQOI 2LF7A 5IP6A 3B6CA 2JPBA 3K1PA 3FMSA 1A6IA 3KEQA 1VQNI 4Z6YA 4KMFA 3BR0A 2K9MA 1MMSA 1REPC 2XAUA 1RKWA 1EH7A 3J7YJ 2DMPA 3RCOA 4JK1X 4UUSA 3ABLH 3ML6A 2YX7A 1RPWA 2OZUA 2CGPA 3A0BC 5L3EA 3RKWA 4Z2YA 3ZRGA 2W00A 2VE9A 1ETXA 1PVEA 4XM3A 5TRDA 4BBRJ 3RKYA 4EJWA 5DEQA 4BS9A 3RSNA 4UVAA 2XV4S 1UG0A 1Y56A 2H1LA 1JGGA 4A3LJ 2GIZA 3E0JB 3RPUA 3PSFA 4CICA 5JR3A 4IHSA 2E19A 3SJMA 2DA3A 3W6JB 3RZDJ 1E3HA 1KZHA 4X6AJ 5D4SA 2H8WA 4XKVA 3QU3A 3CP8A 2M0MA 2XF7A 4Y13A 2QBYB 2Z9OA 1ACIA 2JUCA 4U7BA 3IKVA 2BBYA 4U0WA 3HC7A 4M73A 1KQ0A 2V9VA 4LB6B 4F55A 1GLNA 3OYMA 1BIAA 4D9JA 2HFHA 2Y69H 4UV8A 4AVZA 3TW7A 1XSVA 2PMZA 4X1EA 1N25A 2P5VA 3H1CA 1WJCA 1R1VA 5E3LA 1IGNA 1D0YA 2CQQA 1K78A 2GXBA 3WTUC 3GO5A 3OYHA 3FXQA 3FXKA 4L9TA 5FROA 3LAJA 3H0GJ 1IUYA 1X2MA 3FZVA 3H9GA 4M3GA 2YX4A 2VBZA 3NWSA 3EUHC 2WA0A 4LB5A 4BEHB 2V9KA 3ZR8X 2X1DA 4IHYA 2A69F 1Y0NA 3OR2C 5LD2C 4OINF 3G1OA 3NARA 3E6DA 3F8NA 1WSUA 2OQGA 1HBXG 3E97A 2L02A 1BJZA 2G9WA 2JT1A 3RYPA 1YHQI 1OQYA 4ZC3A 1RZ4A 4HZFA 2VQHA 1FMWA 1ZRFA 3SDGA 2CO5A 3I5UA 1XGSA 4EGYA 3L9FA 3MZHA 3E5XA 4OU0A 2GOMA 1FIAA 1WGXA 2HXIA 4C2MJ 3I64A 2OC6A 3AFHA 2DQLA 3OWTA 3C1DA 2OJED 1DPUA 2PJPA 3OYJA 2JSPA 1FOWA 5KHDA 3H35A 4A3BJ 3M4OJ 4PK4A 3G6EI 3EETA 1GV2A 3B02A 3K4JA 3ASOH 2CQKA 3PM1A 3KEOA 2VKEA 2QQAA 4PJJA 2CUZA 5FKNA 4CO8A 2EK5A 3CESA 2FQ3A 2ICWG 4HNUA 2EWNA 3L2RA 4OWRB 3NWTA 3GX4X 4IX7A 1JJ8C 1KQ8A 4QIWN 3OV8A 2ZSHB 2XASA 2O03A 1X58A 3HPGA 3UKGA 2F5DA 1RUOA 1U5TC 5BS6A 2YR2A 2K4BA 3PNVA 3LSJA 3QPSA 2NS8A 1V3FA 4I0BA 1YIOA 3EYYA 1BBYA 2CV1A 2RQPA 5HNFA 1PP7U 3IWFA 2DXIA 4IO9F 2DW4A 4CCOA 4IHTA 3T0YA 1XDUA 3LAPA 2PX9A 3AG2H 3QWLA 1V54H 4WXDA 2E5NA 4W97A 4YRVA 4KFCA 1Z77A 1YX3A 5D8LB 1P7JA 4XN3A 4LIUA 1UELB 4AIDA 1IN8A 1GDTA 3K4LA 4PCQA 3I59B 1Z3YA 1NK2P 1W0TA 5EZGA 5AIQA 4M6YA 2MFZA 4F3QA 2STWA 1FZPB 1PYVA 3D5RC 4XKWA 2VJIA 3R0JA 3E1SA 3R4KA 3ZMDA 1P2FA 4LK0F 3L00A 1LE8A 1P4AA 1MD0A 2B63J 5FLXK 2QUFA 1UG2A 3G4SI 3M1CA 1X1CA 2VASA 4ENNA 4XOPA 1VQLI 1G3YA 2G7UA 3H3ZA 3HIFA 1D1BA 3TOBA 2BHZA 5K5OA 2CUJA 1T39A 2VODA 5F1RA 1HSJA 4PUSA 3I54A 1D8JA 4KITB 5HDGA 3DU5A 4YELA 4HSRA 4MGRA 4DQ2A 3IRQA 4XKBA 1BI2A 3O3KA 4OIRF 1G3SA 2OD5A 3CMMA 1T95A 2HYJA 1OLTA 2UV1A 2QQ8A 4B09A 1IN4A 4NB5A 3CMYA 1C0WA 4MO7A 3KLOA 3HRMA 4O3MA 1ERDA 2IVMA 1D0ZA 3F8MA 3LFUA 4KN4X 2WAFA 3OY9A 2LK2A 2P6SA 5DM7F 5C44J 1XS9A 2B7EA 1JGSA 2PQ8A 4U87A 2DO7A 3PL8A 4J00A 2X1EA 1A04A 4Q5SF 3DPLC 4ASNA 1PUFB 1UJ8A 4ZDLA 1XC5A 3O2PE 2DOFA 1W0UA 5FD5A 4XORA 1X2NA 5FKOA 3TQNA 3AL0B 1J7KA 3OYBA 2Z2SB 1OMIA 4LLNA 2Q2EA 5JLWA 4NQWA 3ONQA 3OYAA 1BOBA 2XVCA 1R1UA 4A3GJ 4XLAA 2QWWA 1BL0A 2MC3A 4LG0A 3ZGKA 1K83J 4XOTA 5HLTA 1HW2A 3BY6A 1WI3A 1YTYA 3L2CA 1TWCJ 2ZC2A 2VOPA 1FTTA 1D0XA 1U8BA 2B9SA 1R22A 5DCMB 3F22A 2WAEA 1ZELA 4OMZA 2CH0A 3RJPA 5KAFC 1ULYA 3I3LA 2DAOA 4A6DA 4HX4A 4E4HA 3S2DJ 3CMEI 4ZDPA 2M7BA 3CCLI 1XD7A 4HLYA 2ZXWH 2OF7A 3BZCA 1RIOH 5F08A 4D7MA 3E3VA 4C2UA 4BY1J 3PQJA 5FKKA 2R5YA 4GGGA 5EEAA 2KFDA 5HLGA 4KT5C 3Q3SA 4P1WA 1GVJA 3AKZA 2BY0A 2WADA 4FE4A 4LLLA 1MSEC 1D1AA 3KP3A 1I3QJ 2P7VB 2A61A 3LSHA 4BDYA 3HOXJ 1W5CC 3EPZA 4ZYHA 4CCLA 3CDLA 3OR1C 5DD4A 1HW5A 5LGUA 3WTSC 5F27A 2DMQA 5FLVA 2VQCA 2CUEA 2TDXA 1YLFA 3DKXA 4A3FJ 1PJRA 3K4KA 3HUGB 4A3IJ 2BY3A 2CUFA 3QAHA 4YG2F 2O9LA 2KJBA 3BTCA 3SZPA 1B8IB 2FEZA 2LG4A 2YPRA 2OUMA 4ZZLA 3TDUC 1U3EM 4QWQA 2FMYA 1VQ4I 5KVRA 1MDMB 4YEJA 1MBGA 3ZP5A 3K0LA 1FEXA 2QA4I 3GYHX 4BE1A 2WTEA 1TQMA 3CO7C 2LBFB 5FRMA 2KJCA 3S14J 2H6CA 5J1RA 2ZFWA 5CVVA 3M8EA 2ISYA 1RC9A 2OPTA 3CUQC 2AXLA 2M1BA 1MJ9A 2UXXA 3VFZA 5FFXA 3GEZA 1PDNC 1GVDA 2RKHA 2HYGD 5H6QA 1SEUA 3I55I 1WKMA 2QKLB 1BI3A 2EQRA 2ID3A 1QHGA 4AIJA 2DOAA 3TW6A 2LDUA 4G7OF 1U5TA 1IRXA 1DGWY 1WCMJ 2CRGA 2LTPA 5LHIA 5FJ8J 1RR8C 1MBEA 4KYWA 3G1LA 4II2A 5HODA 1YJNI 5E8IA 3HOUJ 3FXUA 2EZHA 3HGGA 1FOKA 1NG7A 3HZJA 1ZR2A 1VQ5I 2EH3A 1Y8RB 1X19A 3IRRA 2F4MB 4PJMA 3OS1A 4AM3A 1FMVA 3ABUA 3DCFA 1EH8A 1O3RA 3DU6A 1L0OC 1IF1A 4GXOA 2BY1A 1ON2A 3IH2A 1BJAA 3FISA 5FO5A 2GXAA 1TWAJ 3C3WA 4P9UA 2ZJQF 4JQFA 3G73A 1LFBA 3GZ5A 2KRCA 3GTJJ 1R7JA 5D6FA 2M5WA 4KIGA 4Y3OA 2R92J 1S29A 1ZYRF 2FD5A 2R7UA 3JTHA 3JRBA 3F6VA 4MTDA 1BN5A 5EGOB 3BJAA 3M9AA 3TL4X 2TRTA 4E7JA 3GFMA 1R1TA 4NC7A 5F64A 3IKTA 2MG4A 2LC2A 3L2VA 2DT5A 3HG9A 1OJLA 2NVUB 2QM3A 4XONA 5K5QA 4FT8A 1WZ2A 1W4MA 3SEQA 2FJ1A 2HKXA 2UZKA 1BC8C 1O7LA 1FIPA 4QSHA 4XBFA 1J09A 1GV5A 1Z91A 3R0AA 4BQOA 3HOSA 1Z7UA 2AQEA 4Q4ZF 5HDNA 4FTHA 3BG7A 3WTXC 3CJQB 1DP7P 3HOYJ 4M6VA 2E36A 1WFXA 3OMYA 3GFLA 1K6OA 3BJOA 5LHHA 3JRIA 4C2TA 1SD4A 5GAHJ 4IOAF 1MW7A 2COBA 2MLGA 2R0QC 4CGZA 1TP4A 3IL2A 1ZAOA 3CCEI 2CJJA 4EM1A 4FASD 2Z3YA 1F4KA 2NVTJ 3FMRA 3HM5A 4XICA 2LR8A 3BQYA 1JE8A 5JHFA 4E70A 2CW7A 4L18B 1BR1A 3U2RA 2LF8A 1WVRA 3PO2J 4EM0B 2X9DA 1UFMA 2ZB9A 1PP8F 1HKSA 1B6AA 1Y6IA 3GBGA 3HSRA 4N4NB 3LQQA 3RTRA 5FD6A 3H3VK 4EJUA 4I0AA 4AWXB 3O8GA 5HVQC 1JJ6C 4GDFA 4M6XA 1D8KA 2IW5A 3GZNB 1B72B 3UNGC 3TDZC 3K69A 2ZKZA 3D0SA 5K5RA 1KU3A 1QZZA 2MYSA 2KKOA 1FBUA 3K9TA 2RDPA 1YJWI 2BVLA 1FY7A 5L3DA 1JKRC 2WY7Q 2Y75A 3ZPLA 3FXLA 1YS7A 3D5SC 3GCMA 4JP0A 3RQ4A 3LFKA 2VUMJ 3KCCA 5IT9Z 2BW3A 2CQNA 3I56I 1JHFA 3GXOA 2ZNZA 3OS2A 4WXCA 1T38A 4LOCA 1Z3XA 2E1MB 4LIVA 4UUSB 1Q1VA 3FKJA 1GUUA 1EF4A 2E1NA 3CCSI 1W36C 2ZJRF 1U6GA 3U1DA 3ZN0A 2MLKA 3QYBA 3FHNA 3TO7A 4I02A 4A3CJ 1RESA 3G2BA 3ZOBA 2FXAA 5M5XJ 4Y52J 2HQ5A 2DT6A 2VJ4A 3ABTA 4IVNA 5LLQA 3CCQI 1ZREA 4YIRX 4XLCA 1LVAA 4HQMA 2EZIA 1MKMA 2XUBA 4D0PA 1RKTA 4EM2A 4IF4A 3GTGJ 4C30A 5K1YA 3WGGA 1T33A 2DI3A 3RYRA 3E5QA 3RZOJ 1QGPA 4NBQA 2K3PA 4XIDA 1KGSA 2O8XA 3BC8A 3SYTA 3FIWA 3DKWA 2ECBA 1U9NA 2FNPA 4FQGA 4WXHA 4B3XA 2E5ZA 3SDBA 3JRDA 1Q1HA 4G94A 3M07A 4KIBA 5CJ9A 5C4XJ 3BQZA 1FYKA 3H9QA 3K70D 4OMYA 4XK4A 5F0CA 1NG6A 4CZCA 2RC4A 4AUXA 4CHUA 2XAHA 3M3YJ 1YO5C 1YW8A 2QZ8A 1J5YA 3LA3A 2XPUA 3DBHB 4BYYA 3VSLA 1BI0A 2LKXA 5H20A 3S1RJ 2ZNYA 1LDJA 3HTUA 4A0ZA 3AG4H 2RNJA 4UUTA 2RREA 1SAXA 3VOEA 4IPAA 4BUPA 2OAZA 4IQ4A 1XGNA 2HI3A 4C3HJ 1NTCA 3RQIA 4XQFA 2JMWA 3MD2A 5BOXA 2DCEA 4P96A 2VBWA 1OCPA 4HEA2 3RIRA 1KONA 5E1WA 3ZMVA 4ETSA 3Q5FA 1Z9CA 2W57A 3FHZA 1X3ZB 2HYFA 5M3MJ 4E7HA 2DT7B 4KA4A 3QPLA 1AOYA 1F5TA 3VDXA 2LREA 3HDDA 1QZYA 2DTRA 2NXNB 2B0LA 4FISA 2EFWA 3HGYA 2VPRA 2E2JJ 2XGXA 1FC3A 5B66C 3L2UA 1ZGAA 3OYLA 3ZMTA 5E3OA 2W24A 4G6DA 2IS4A 3HRUA 4G7ZF 4ZTJA 2L9NA 2K86A 3KP6A 1R6RA 2ELJA 1TT5B 2M4GA 2WC2A 3E5UA 2YSRA 1X1DA 1JT6A 3ECHA 2RN7A 3FX3A 5HS8A 3GTKJ 2E7WA 1KYZA 3DLAA 3RKQA 4BNCA 4L0YB 1LDDA 1G6NA 3CDIA 5J3LA 3J80Z 3C18A 3WHCA 4EATA 2W7NA 3HXLA 1O7FA 2VBYA 2MD5A 3MKZA 2F2EA 3DP7A 3CJRB 1S3JA 1HW1A 3VYRB 3KYDB 4RAZA 1X3WB 2ZXJA 1IV6A 2KIMA 1TNSA 2I5UA 1LEBA 3N05A 3CCYA 2P7CB 1FP2A 1B1BA 2R5ZA 2R7SA 5LRRA 3NAUA 2BE5F 3LNQA 1FYLA 2PMUA 1T8IA 2AXTC 4I7HA 1DQUA 1SANA 5EG0A 1OKRA 3W2AA 3OYIA 3OL4A 5J40A 3CF2A 1UCRA 2DA5A 4RB1A 5CYVA 2MH9A 2M8EA 1BI1A 3F0CA 2F5CA 1IO2A 1YRNB 3QODA 3FXOA 4Y17A 1QRYA 1T98A 1R00A 1POGA 1IRGA 4EV0A 3TP3A 5BQTA 3MAJA 4EMSA 2EB7A 2QKMB 2ESNA 5GTIC 4HX8A 5M3FJ 5M5YJ 3FM3A 1SFOJ 4PJ0C 2IXSA 2IGNA 2KIQA 1P92A 3EYIA 4G8XA 1FTZA 4KICA 1D1CA 4A0XA 4HQEA 2LY9A 2DLLA 2DU9A 3CQZJ 2E2HJ 1HXDA 4XMYA 1ZR4A 2R7VA 3WGHA 2DBBA 1YYVA 4CYDA 3FXMA 1NK3P 4V19K 2PBIA 1LQ1A 2QCOA 3LMMA 1P6RA 1BM9A 3S2HJ 1JHHA 2FBIA 1I5ZA 4A3JJ 4WWCA 4UUVA 4LD5A 3S16J 4R79A 4IRIA 2Y31A 2VL8A 3IH3A 2YS9A 4OAZA 3DLLF 2X51A 1K4TA 3FMQA 1ZTRA 3DEWA 4HOBA 4FE7A 1WJBA 2XRLA 4BGDA 1WJFA 1X1BA 1IDZA 4RGRA 1WJAA 1ZRDA 1MMDA 2AHQA 3IAS2 3BLYA 2DDBA 4A12A 3S1NJ 1X4PA 2FQ4A 2FBHA 2MGQA 3VYUB 2E71A 4DJAA 4E6KG 1AKHA 2ME0A 3LSGA 4F52A 3JRAA 4B47A 3IUOA 3WTWC 3Q9SA 1LB2A 4ZDOA 1ORKA 4DBRA 2OA4A 5FGMA 3FK6A 5KK1A 2WV0A 2COMA 2PLYA 2A05A 1MMAA 4HV6A 2X6XA 3S2WA 3M7GA 5BPIA 2JVHA 1K79A 2R7TA 1FJLA 1HDDC 2KT0A 4I98B 1FOYA 4NQWB 4NUBA 3IV5A 2ZXIA 1I50J 4QTRA 2XIGA 4PGGA 2JZYA 5IP9J 3HTSB 1BC7C 5E79C 1HOMA 3BOQA 3QQAA 3WHBA 1OCRH 3LA7A 4ENMA 2I8DA 2QSGX 2R3SA 4KISA 1MJAA 2CWEA 2ME6A 3ZN1A 1G3WA 1WPKA 3V7CA 2KZVA 1XSXA 2L4MA 2R7FA 2E1OA 5EEHA 3ZQGA 5JVGF 5ICEA 3DTEA 1OISA 3W3CA 4MHGA 1YJ9I 2QEXI 2HU9A 3LSIA 3HB9A 2DYSH 1R4MB 5CQEA 1DP3A 3BROA 3S1MJ 4KN7X 4MLOA 1FX7A 5F6FA 3E6CC 5LHGA 3FM5A 2ID6A 4A5MA 2JRTA 3LSTA 1WWXA 2FA5A 2L3DA 2LSOA 2KMUA 2Z33A 4I99C 4RB0A 3S3OA 1JKQC 4WX9A 4CCJA 1RNLA 2EZKA 1CF7A 3A03A 2M87A 3CO6C 4XR6A 3U1KA 3LSPA 2EA4A 5C4JJ 3DBRB 2GBYA 2VT2A 1BR2A 1W7PA 3DQVC 2XAJA 1YW7A 4EQQA 3CLOA 4R8HA 2VB6A 2JTVA 3I58A 4RGSA 3FBIB 2J5OA 2W25A 3WTZA 5J6XA 4CDGA 5L3GA 1ZKGA 2CW8A 2K40A 3CP2A 1F1ZA 4BU2A 5LEKA 3PUFA 3Q0WA 1KU9A 2CU7A 1VQKI 3FK7A 1V4RA 2EINH 3JCUC 3KP7A 4RB2C 4IHWA 2A68F 2EFNA 1T56A 1R71A 3MCZA 5IP7J 3OYEA 4BH9A 3J81K 3HRTA 2DK5A 2ISZA 2KHMA 1LDKB 1XCVA 2BXZA 2CQXA 2VKVA 3JRGA 2F5FA 2EJRA 3BG6A 2O3FA 3HOVJ 3DPTA 1JT0A 4YFKF 1AA7A 3OYFA 1EJ9A 3REOA 4XRFA 1EA3A 3A2KA 4U7DA 2FMLA 2VE8A 3VODA 1XGOA 4XKCA 3B6AA 5E20A 4XNFA 5F0HA 3GTPJ 3N97A 1LEAA 4NHJA 1G8XA 2IS6A 2L5QA 1TZLA 4HW0A 1U5TB 2QLZA 2GZWA 1IZ1A 2L7ZA 2DJNA 2BV6A 5HDKA 4DOZA 4CXFA 2VIXA 1U8RA 4JOMA 4A3DJ 1JTXA 2F6CA 1A6QA 1SFKA 2LKSA 3GVAA 5FLXZ 2O61A 3JTGA 1LFPA 1SFEA 4BEHA 1B9MA 3HJEA 2R93J 1DU0A 2M8GX 4K2EA 2OQRA 3JRCA 2GOXB 2ZJPF 2P8TA 4DW6A 2HOTA 3J7AY 3S3MA 5KCMA 1G3TA 1VTNC 5ICGA 5HOOA 4UNOA 1WH5A 4IXAA 1I39A 5D5VB 1MNDA 1ZRCA 5J47A 1XMKA 3L2QA 4IOCF 2JA5J 3OYDA 3A01A 1P4WA 2PJRB 5CKTA 4B43A 4BE2A 3CCVI 3TO9A 2L01A 3LWFA 3AG3H 4J01A 1VI0A 1S7EA 3DWLE 2K7LA 4WCGA 4BQNA 4ZTFA 2XB0X 1R23A 3VWBA 2XF5A 2FSWA 4S04A 2W1OA 2G0EA 5JHUA 1FP1D 3RI4A 4ANJA 3ZQ7A 1H89C 2V9PA 2DJIA 3HL2A 1TBXA 3D5LA 1OCOH 3VEPA 4L9JA 4HX7A 1TT0A 1K4SA 1UMQA 2A5YB 2DMTA 4BQQA 1JXSA 1KU2A 3PNTA 2V4JC 3H5AA 2Y48A 2OCCH 1MSFC 1O3TA 4GCVA 2DA6A 2J5PA 1WJEA 4CCMA 3PSIA 4ZYDA 1D3YA 5K7ZA 1FSHA 2IS1A 2VT3A 3K1MA 3S3NA 3TBIA 1E3OC 2O6GE 1HCRA 2DMNA 3F21A 5M5WJ 1FPQA 1E0EA 3E6MA 1R36A 2YUSA 3ZXSA 3KYCB 1ITYA 1D5VA 4ITVA 1ETYA 1SD6A 2JA6J 2GLOA 2A6HF 2K9QA 2BZTA 1ETOA 4HDUA 3I59A 3V4GA 2HWVA 5E3MA 2IGMA 4IJAA 2QENA 3JAMK 4DYRA 3GTQJ 1Z7LA 3H5RA 3I9V2 5EJCA 4AD9A 4Y15A 2HKOA 2HDWA 4B48A 4BJ6C 3D1NI 2K9NA 2YU9J 1FNNA 3AG1H 1T08B 3MZYA 4Q47A 3WU0A 2BW3B 2ELHA 5FRNA 1FBSA 3BCAA 4S0HB 3RPUD 3KETA 4IHXA 5DDGA 3CCJI 3SEZA 2M30A 1ZG5A 4H0EA 2KDZA 4U0YA 4R1HA 4ZJZA 4HBLA 2A3SA 3G1MA 5J8CA 1S9HA 5ILVA 2LKPA 4B1RA 1G2HA 5GP9A 3HSFA 3C7JA 4IEJA 3EQLF 3K4CA 4LMYA 3BR5A 5E17F 3H0DA 1MGTA 1MZBA 4Q48A 4FHTA 4M3EA 2LOOA 3BG3A 1E17A 2XGDA 3CTAA 2WV1A 4CCKA 1XTAA 3JRHA 1VQ9I 2HDCA 5EZHA 2ZMEC 1X3UA 2NOJB 1VQMI 2WAQN 2UUZA 3JW4A 5DCFA 2NS0A 3JAMZ 5FB2A 3A02A 2DPUA 4JX6A 2ZJ2A 3MQ0A 1J2XA 1FT9A 5IYCJ 3SFIA 4ESJA 3ERED 1SMTA 4BQAA 9ANTA 4AC0A 1MMNA 3FKIJ 2V6CA 4EJVA 5IPAA 1PUFA 3GTMJ 3B73A 1ZLKA 2W48A 4MNUA 3BJ6A 1ZN2A 2DN0A 4BKXA 3A4CA 3ZQIA 2HQRA 3IHUA 2M7AA 4XLNF 2VI6A 5KAIC 1U78A 3R61A 1E2XA 3QU6A 4RGXA 4UB8C 1VQ7I 3IP4B 4HLXA 2VN2A 2I10A 1W36D 2ACJA 3DBLB 3Q0VA 4QPOA 1R58A 1TWGJ 4NC8A 1XMAA 2BGCA 2LRDA 1YE9A 2VPLA 2Y0MA 5DCMA 1UHSA 4CUGA 1P9QC 3CUQB 4RAGA 4B4CA 5JVTA 3K4BA 1TW2A 3QP5A 4L9NA 1HKQA 3M8JA 4IZZA 4PSXA 3DEEA 3I71A 4BL0B 2Y2ZA 1R4NB 3DXJF 5CVJA 2CYYA 3WTTC 2ECCA 2V1UA 1NHAA 2NNYA 2JA2A 5LFAA 3QPHA 1WHUA 1OYIA 1OPCA 3CCUI 1I3AA 2PI0A 2W84A 4CZZA 2VXDA 2JN6A 2L9SA 1TQIA 3O8HA 3V8LA 4L0ZB 3NEUA 2V1NA 5EYRA 1K7AA 3W2WA 2VONA 2EFQA 4II3A 2DFEA 2R7WA 4LK1F 3DFGA 4BJ5C 5C3EJ 2CFOA 2X48A 1D5YA 5B1BH 2K27A 2K4JA 4UXNA 4C9YA 3BWGA 5IT3A 5A2QK 4A0YA 1V55H 2XPVA 4A5NA 3UR3C 1T2KA 3WE2A 4WK8F 1Y39A 5IYBJ 1IG7A 3WG7H 2GXGA 2HZTA 3GF2A 2UWMA 1BIBA 2FOWA 2XB5A 1HLVA 1IJWC 4D7NA 4E7KA 3CC4I 4MEYF 1WI9A 3LA2A 4ESBA 1MDMA 5DYMA 3K2ZA 4BE0A 1A5JA 1RETA 3ZMSA 3I4NJ 3S8PA 4XLEA 2LBFA 1HKTA 1OYYA 2DMUA 4P5OA 5CVRA 1DU6A 2XPWA 5J4VA 4CA0A 2VKHA 1YW9A 3QPTA 2DQRA 2M34A 3ZCOA 4N9IA 5BPDA 2RVCA 4BACA 2VXZA 4ON0A 1N78A 4JX5A 2QVOA 4XRSA 3FWEA 4Y33A 1KU7A 2EFPA 2KLOA 3CF5F 3R6SA 1IV8A 1Z05A 4AVPA 4B8XA 4A93J 4CCNA 4GYGA 4AYBN 1YIJI 3OS0A 1Z67A 5HNHA 3H3UA 3BG5A 4I2OA 5GAGJ 4ZYEA 1A31A 4N0BA 2GAUA 2GM4A 4HF2A 2DFHA 2RQQA 3LL7A 4XN0A 5ILSA 2KIUA 2IGKA 3MKLA 1W1WE 2NVYJ 3HSEA 4CSWA 1K78B 3L09A 2RV8A 4M3DA 3MKYB 4QPQA 1QVUA 4BBSJ 2LVSA 1OR7C 1TWFJ 3KEYA 4W1UA 1XSDA 1QNTA 3VYSB 4PSWA 3ESWB 1ZQ3P 3U21A 2PEXA 2LLKA 3BPVA 2DA2A 2EIKH 3ABMH 4U88A 2IA1A 1AKHB 2V79A 3JREA 4DZPA 3J7ZI 2Y9ZA 2O0YA 1QU3A 2XSDC 3BZKA 2XHKA 1YITI 2WAQA 4MFDA 4PFPA 3DV8A 1JUSA 2N8GA 4DBQA 3TEDA 2JPCA 4RB3C 4HNVA 1F36A 1ZH5A 1MBJA 2NS7A 2ZBKA 2FRHA 3J7AO 1IW7F 1EH6A 3BCBA 5AIPA 1QQIA 4O5VA 2MW8A 2FOKA 4PGHA 5ICCA 1NH3A 3KP5A 2MH2A 3MWMA 1WQ2A 2P4WA 1HF0A 4RM3A 3VPRA 3P5JA 2V1DA 1SVOA 1EKEA 1MH4A 5K7FA 3GTOJ 4UHTA 5BNGA 2HTSA 1VQ6I 2ZMEA 2ZCWA 2JUGA 4A2UA 4CYCA 1TWHJ 2E34A 1O3QA 5EDNA 1BW5A 3I4MJ 5CVUA 2ELKA 3QP6A 2KRHA 3ZQQA 1HSTA 2CS3A 2NAZA 3WTYC 2O5RA 3DF8A 3CJNA 3EUKL 3LSKA 4GYIA 1X4OA 2HXOA 3DTKA 1QPIA 2D5VA 2IS2A 2D1VA 1MBFA 1M1EB 1B72A 1J0RA 1H9TA 5J8FA 2HVSA 1CF7B 3GW2A 1ETWA 4RAFA 3K70C 2V26A 4IQJA 1W7PB 2CQ7A 3KZZA 5JLXA 2VOOA 5E1XA 2D45A 2MC4A 1VF9A 1S72I 3KFWX 4FX0A 4YFNF 3GFIA 1LE8B 3ZQLA 2M3AA 2NVXJ 2FNAA 1SAUA 3BZ6A 4XSZF 1BOAA 5D5UB 1FLIA 4F93B 2HNHA 2V7FA 3AAFA 4M71A 1J59A 2EIJH 1S8NA 3V8KA 1DDNA 5E1ZB 2MSYA 2QGUA 4V2GA 2Z16A 4NC6A 3H36A 2ZSIB 2W82A 4RMNA 4ZZDA 4NNJA 5L3BA 4JBAA 5H2FC 3HOZJ 2FUG2 4P55A 2JRMA 2EFOA 4I01A 1R9TJ 2GA1A 1Y1WJ 1B9NA 2XAGA 3CDHA 2KDOA 2PMHA 4OIPF 4DGWB 3H92A 4O6JA 2P0WA 4HRIA 1DUXC 2E7XA 1V5FA 3F8BA 1ZGWA 3SHFA 1IRFA 2IP2A 4OOIA 3JSPA 4F91B 1VZ0A 3MVPA 4D5CA 5ILUA 3I53A 1QVTA 3WG9A 1SMYF 4YIIA 4MTEA 2DFFA 4AYBA 2H27A 2JQ7A 4L5EA 4BHCA 3V42A 3CLQA 2LP0A 3SXYA 1SC7A 4ZYAA 3S15J 2HPIA 2D1HA 3IH4A 5IOZA 2Q2EB 3S32A 4GFBA 1QA6A 2HQNA 2ESHA 2DYRH 4ESFA 1T0FA 5HLHA 1MIJA 3PO3J 1S5LC 2NOGA 2ZXHA 1UAAA 1FBQA 4LG0B 1F9NA 1IDYA 4Y7NJ 2Y0SN 3W6VA 3CZ6A 1Z0XA 3I0TA 1IUFA 2ZFUA 3A01B 4L5JA 3GWZA 3P9KA 4HG2A 2WB1N 2MABA 3F72A 1XG1A 1UZCA 2Z5UA 2X85A 1ZK8A 1R49A 4L9VA 3OIOA 3GFJA 5J1UA 2IAIA 4RDUA 3OYGA 5FKLA 3ABKH 3CMAI 2P5LC 3JR9A 1GXQA 2BEOA 5FFZA 1BR4A 2VC1A 2XAFA 2V6EA 2F48A 3FDYA 3T1BA 1IAWA 1XGMA 3WU2C 4ZH4F 2R5YB 2IJLA 3KP4A 1HQCA 3GLXA 1QHHD 1WJDA 2BYVE 1S6LA 5IY5H 3MFKA 3PQKA 2EBIA 2XSJC 3FXJA 1I6HJ 3W6KB 2FU4A 3HYIA 1SD7A 3RPQA 1Z6RA 5D6EA 1OR7A 1V5EA 2X6YA 1YFHA 1ON1A 2OCEA 4I76A 3TKYA 2O8KA 3DPUA 5EEGA 2L9RA 1I27A 3GZ6A 5H6RA 2H8RA 3T5XA 1RRJA 1K61A 1F43A 3V7SA 2OTJI 1GXPA 3C2BA 1YOVB 3OSGA 2X4HA 2X1CA 3RDIA 1GT0C 1SD5A 2RGVA 1UHMA 2Q0OA 4IRHA 5FKMA 4E7SA 3AL0C 2R7RA 4GO1A 3S1QJ 2A6TA 2EZLA 2M9HA 3GLLA 3HBLA 2XC7A 4I09A 3BTIA 4FX4A 3V7RA 5L3FA 2DODA 4G7HF 2XKOA 3G71I 4A3KJ 1YRNA 2IRFG 4RA2A 1JKOC 5HLIA 4KUMA 2H6BA 1JTYA 4PJLA 1RUNA 3K4MA 3H9JA 3W2VA 2Y30A 4EEFG 1Y0UA 1L3LA 3DEUA 1PUEE 3V8JA 3QOPA 1YS6A 3ECOA 5HS7A 3LOCA 1XCBA 1GHCA 3BR6A 2QBYA 1Y8QB 1XB4A 1I1GA 4ABZA 2IA0A 1O4XA 1IN7A 4XRMA 2KL4A 3BTLA 5GTHC 3KZIC 2R7ZJ 2G7HA 5D4RA 1YX5A 3BT9A 3VSKA 3L7WA 4M9ZA 2QF7A 2IA2A 2KIFA 5ERIA 4XLPF 2EA2A 1IN5A 1RI7A 3CUOA 3T8RA 1KYWA 1IXSB 2WY8Q 4G6TB 4LJZF 3MKWB 3K4NA 4MIMA 1TNTA 2L9VA 4AIKA 4M3FA 3P9CA 1H0MA 4JX4A 2XROA 2L7FP 2XF6A 2IEKA 3M8FA 3MEXA 1WJ5A 3J81Z 1W5TA 5J1YA 2FX0A 4B44A 4MFEA 2L2OA 2VQGA 3F8CA 4M9SA 1G59A 1RR7A 2F4IA 4MQ9F 2HEOA 4PJNA 3OL3A 2H94A 4HA8A 4IRGA 4A3MJ 3K6GA 1ETQA 5KNLA 1MMGA 3K1NA 2LY2A 1LKXA 2QQBA 1ZG3A 3CCMI 1SVMA 3E7LA 4HSTA 4HAMA 1LUJB 2JJ7A 1WH7A 2HR3A 5LBQA 1IN6A 1S7OA 3KIOA 1IRZA 2H1KA 3PUBA 5D5WB 3TP0A 3A0HC 2A5WA 5E18F 4F7ZA 2MBFA 3OYNA 3PFYA 2L54A 4PDKA 3F23A 3BG9A 4AU7A 1FYMA 1G4DA 5LRSA 2HS5A 2K9LA 2BVMA 3CC7I 4HDVA 3CC2I 5CQGA 3MZ8A 3ZQHA 4RAYA 2AO9A 5JFRA 1LJ9A 2E35A 1LFUP 2JA8J 2F5VA 4CH7A 2AQFA 5F04A 3N4MA 2P5KA 3QRFF 3QOEA 4XLFA 3WODF 4EVIA 1LNWA 1TTYA 2EIMH 3SFZA 4KIFA 3X2QH 1ZLJA 2M45A 5GAEJ 4UB6C 4UV9A 2Y0SA 3WU1B 2KQRA 4ENKA 3TMOA 3G3ZA 1ZHFA 1ETKA 2WB1A 4G6QA 1IC8A 2EPFA 2E60A 3A1YA 1H88C 3EUHA 2AS5F 5DUIA 3F3XA 1CQTA 4KMUX 4YFXF 3CCRI 3PFIA 2VBXA 4BJTA 4XSXF 2DDAA 1ZG1A 3F6OA 2K9SA 2LYCA 2L7MP 4V2FA 2PFBA 2KZGA 4NDLA 2HQAA 2Q8KA 2Q1ZB 1AWCA 2JA7J 3HEFA 1U2WA 3ULQB 3BDDA 2WBMA 5ED4A 2GWRA 1S7AA 2K5CA 2QSHX 2JK3A 4G9YA 2JVGA 4EJOA 1JUMA 4LGWA 1BW6A 1MNMC 1TQPA 2EV0A 2GIVA 2K02A 4DNCA 4M74A 3L2WA 3RKXA 4F92B 4JYKA 3HOTA 3P9IA 2Z1DA 2Z99A 2CSOA 1Z21A 1P7IA 1SVLA 2BXYA 2HPMA 4DIQA 2CFXA 1YG2A 3PIOF 5DD8A 1U9OA 2HDDA 5B3SH 5L3CA 4E7IA 2C6YA 1HC8A 2RAEA 4RGUA 4FETA 2ZO4A 3K2AA
chains in the Genus database with same CATH topology
1R5HA 4ENJA 2P6TA 2W85A 3IC7A 3ZMZA 1O57A 1STZA 4AIHA 3T8TA 3JSOA 3SZTA 3BPXA 4TV7A 3WGIA 6PAXA 2NNNA 2QYOA 3ISPA 3COAC 3KZYA 5HS9A 4EGZA 3LQRA 2FBKA 1B59A 3P7NA 4BHBA 3R60A 3WE3A 4KDPA 4BHPA 1TW3A 5E8GA 1R5GA 2LNBA 3HHHA 2OBPA 4MQVA 2XAQA 4M9XA 5DV5A 3NRVA 1WRJA 3I4PA 4LLGF 2ETHA 2GA2A 5JI6A 2DPDA 3TOAA 1YQAA 5AONA 1KA8A 2A07F 3E6BA 1XDSA 2EV6A 2UXNA 2QQ9A 1SFXA 2MA3A 5IT9K 1IXRC 4A6EA 1UHWA 3ZMUA 2JSCA 2XRNA 5DUKA 3Q9VA 2H09A 2FF4A 2ZMEB 1KQ9A 1W5SA 2OU2A 2D2WA 2VC0A 5CLSA 4QLCU 2PN6A 4HYEA 2ADUA 5LGTA 1W7PD 1QBJA 3HUGA 2OZ6A 3KLNA 2STTA 4YIFA 1TLHB 3WTVC 3IWZA 3ELKA 4HF0A 1ONVA 3KE2A 1MJBA 5ICFA 1OYWA 2XKPA 4HF1A 5D5XB 1O3SA 1J9IA 4S05A 1FWZA 3TGNA 1ZARA 1I6XA 1QPMA 2CW0F 1P4XA 1I1SA 4MEXF 2V1XA 4BAYA 4KNYA 3NQOA 4EJTA 2NRAC 5A2QZ 2DFIA 2KRFA 1J75A 2GQQA 1Z1DA 4OIQF 2FE3A 4ZYGA 4HV5A 2E1CA 1IXCA 3O6BB 5CVIA 1T6SA 5BMZA 3U9GA 1FSEA 4RS8A 3FXRA 4M72A 2X0LA 2IPQX 2PG4A 1USSA 2NYXA 4LFUA 4OIOF 3J80K 2YU3A 3OOPA 3ROUA 1SFUA 5LEJA 4WF2A 2HTJA 3F8FA 2R7DA 1QO0D 2CG4A 1Z6TA 3EDPA 1USTA 4UVBA 3CUQA 5D8KB 1ZGJA 2F5EA 5TJJA 3FF5A 2EV5A 2A6EF 3TO6A 4P9FA 1B4AA 1EV7A 5LGNA 4N9HA 1UB9A 1H9GA 3M1EA 2IT0A 2WWYA 4L5IA 1XN7A 4BXUA 3GUDA 4U0VA 3KP2A 3VB2A 3HRSA 1DPRA 3BP8A 2L4AA 2DK8A 4PZJA 2HGCA 3HHGA 1CGPA 3SQNA 4UVCA 2HOEA 1ODDA 2LF7A 2JPBA 3K1PA 3FMSA 3KEQA 4KMFA 1REPC 1EH7A 4JK1X 3ML6A 2YX7A 2OZUA 2CGPA 5L3EA 3RKWA 4Z2YA 2VE9A 5TRDA 3RKYA 4EJWA 5DEQA 4UVAA 2XV4S 3RPUA 4CICA 5JR3A 4IHSA 3W6JB 5D4SA 3QU3A 4Y13A 2QBYB 2Z9OA 4U7BA 4LB6B 3IKVA 4U0WA 2BBYA 4M73A 1KQ0A 2V9VA 1BIAA 2HFHA 4UV8A 1XSVA 2P5VA 1R1VA 1K78A 2GXBA 3WTUC 3GO5A 3FXQA 4L9TA 3LAJA 1IUYA 3FZVA 2YX4A 2VBZA 4LB5A 2A69F 4OINF 3E6DA 3F8NA 1WSUA 2OQGA 1HBXG 3E97A 2L02A 2G9WA 2JT1A 3RYPA 1RZ4A 4HZFA 1ZRFA 2CO5A 3I5UA 1XGSA 4EGYA 3L9FA 3MZHA 3E5XA 4OU0A 3I64A 2DQLA 3C1DA 1DPUA 2PJPA 3EETA 3B02A 2CQKA 3KEOA 2QQAA 4CO8A 2EK5A 2FQ3A 2EWNA 3GX4X 1KQ8A 3OV8A 2XASA 2O03A 2F5DA 1RUOA 1U5TC 5BS6A 2YR2A 2K4BA 1V3FA 4I0BA 1YIOA 3EYYA 1BBYA 2RQPA 1PP7U 3IWFA 2DW4A 4IHTA 3T0YA 1XDUA 3LAPA 4WXDA 4KFCA 5D8LB 1IN8A 4PCQA 3I59B 5AIQA 4M6YA 2STWA 1FZPB 3R0JA 3R4KA 3ZMDA 1P2FA 4LK0F 3L00A 1P4AA 1MD0A 5FLXK 2QUFA 4ENNA 1G3YA 2G7UA 3H3ZA 3HIFA 3TOBA 5K5OA 1T39A 2VODA 5F1RA 1HSJA 3I54A 1D8JA 5HDGA 4MGRA 4DQ2A 3IRQA 1BI2A 3O3KA 4OIRF 1G3SA 2OD5A 4B09A 1C0WA 1IN4A 4NB5A 3KLOA 3HRMA 4O3MA 2IVMA 3F8MA 4KN4X 2P6SA 1JGSA 2PQ8A 2DO7A 1A04A 4Q5SF 3DPLC 4ASNA 3O2PE 5FD5A 3TQNA 1J7KA 1OMIA 4LLNA 2Q2EA 4NQWA 2XVCA 1R1UA 2QWWA 2MC3A 4LG0A 1HW2A 3BY6A 1YTYA 3L2CA 2VOPA 1R22A 5DCMB 3F22A 4OMZA 3RJPA 1ULYA 4A6DA 2DAOA 4HX4A 1XD7A 4HLYA 1RIOH 3E3VA 3PQJA 4GGGA 5HLGA 4KT5C 1GVJA 4LLLA 3KP3A 2P7VB 2A61A 4ZYHA 5DD4A 1HW5A 5LGUA 3WTSC 2TDXA 1YLFA 4YG2F 3QAHA 2KJBA 3SZPA 2FEZA 2YPRA 1U3EM 4ZZLA 3TDUC 4QWQA 2FMYA 5KVRA 1MDMB 3ZP5A 3K0LA 3GYHX 2WTEA 1TQMA 3CO7C 2KJCA 2H6CA 2ZFWA 5CVVA 3M8EA 2ISYA 3CUQC 2AXLA 2M1BA 1MJ9A 2UXXA 3VFZA 5FFXA 3GEZA 1PDNC 2RKHA 2HYGD 5H6QA 1WKMA 1BI3A 4AIJA 2LDUA 4G7OF 1U5TA 5LHIA 4KYWA 5E8IA 3FXUA 1FOKA 3IRRA 3ABUA 1EH8A 1O3RA 1IF1A 1L0OC 4GXOA 1ON2A 1BJAA 5FO5A 3C3WA 4P9UA 4JQFA 3G73A 3GZ5A 1R7JA 5D6FA 2M5WA 4KIGA 1S29A 1ZYRF 3JTHA 3F6VA 4MTDA 1BN5A 3BJAA 3M9AA 3GFMA 1R1TA 5F64A 3IKTA 2DT5A 2QM3A 5K5QA 4FT8A 1W4MA 1BC8C 2HKXA 2UZKA 1O7LA 4XBFA 3R0AA 3HOSA 1Z91A 1Z7UA 4Q4ZF 5HDNA 3WTXC 1DP7P 3GFLA 1K6OA 3BJOA 5LHHA 1SD4A 2MLGA 4CGZA 3IL2A 1ZAOA 4EM1A 2Z3YA 1F4KA 3FMRA 1JE8A 4E70A 4L18B 3U2RA 2LF8A 4EM0B 1UFMA 1PP8F 1HKSA 1B6AA 3HSRA 3LQQA 3RTRA 5FD6A 4EJUA 4I0AA 4AWXB 5HVQC 4M6XA 1D8KA 2IW5A 3TDZC 3K69A 2ZKZA 3D0SA 5K5RA 1KU3A 1QZZA 2KKOA 1FBUA 3K9TA 2RDPA 1FY7A 5L3DA 2Y75A 3ZPLA 1YS7A 3LFKA 3KCCA 5IT9Z 1JHFA 3GXOA 2ZNZA 4WXCA 1T38A 2E1NA 1U6GA 3U1DA 3ZN0A 2MLKA 3TO7A 4I02A 2FXAA 3ABTA 4IVNA 5LLQA 1ZREA 1LVAA 4HQMA 4D0PA 1MKMA 2XUBA 4EM2A 4IF4A 5K1YA 3WGGA 2DI3A 3RYRA 3E5QA 1QGPA 1KGSA 2O8XA 3DKWA 2FNPA 4WXHA 1Q1HA 4G94A 4KIBA 5CJ9A 1FYKA 4OMYA 4CHUA 2RC4A 2XAHA 1YO5C 1YW8A 2QZ8A 1J5YA 3LA3A 4BYYA 1BI0A 5H20A 2ZNYA 1LDJA 3HTUA 4A0ZA 2RNJA 1SAXA 3VOEA 4IPAA 2OAZA 1XGNA 5BOXA 4P96A 2VBWA 3ZMVA 4ETSA 3RIRA 5E1WA 3Q5FA 1Z9CA 2W57A 3FHZA 2HYFA 4KA4A 1AOYA 1F5TA 1QZYA 2DTRA 2EFWA 2B0LA 2XGXA 1FC3A 1ZGAA 3ZMTA 2W24A 4G6DA 3HRUA 4G7ZF 2K86A 3KP6A 2WC2A 3E5UA 2YSRA 3ECHA 2RN7A 5HS8A 3FX3A 2E7WA 1KYZA 4BNCA 4L0YB 1LDDA 1G6NA 3J80Z 3C18A 1O7FA 2VBYA 2MD5A 2F2EA 3DP7A 1S3JA 1HW1A 4RAZA 2ZXJA 2KIMA 1TNSA 1LEBA 2P7CB 1FP2A 1B1BA 5LRRA 2BE5F 1FYLA 2PMUA 4I7HA 1OKRA 1UCRA 4RB1A 5CYVA 2MH9A 2M8EA 1BI1A 2F5CA 4Y17A 1T98A 1R00A 1IRGA 4EV0A 5BQTA 3MAJA 4EMSA 2EB7A 2ESNA 4HX8A 3FM3A 1P92A 3EYIA 4G8XA 4KICA 4A0XA 4HQEA 2DLLA 2DU9A 1HXDA 4CYDA 3WGHA 2DBBA 1YYVA 2PBIA 1LQ1A 1P6RA 1BM9A 1JHHA 2FBIA 1I5ZA 4WWCA 4UUVA 4LD5A 4R79A 4IRIA 3FMQA 4HOBA 4RGRA 1ZRDA 4A12A 2FBHA 3WTWC 3Q9SA 1LB2A 2OA4A 5FGMA 5KK1A 2WV0A 2COMA 2PLYA 4HV6A 3S2WA 3M7GA 5BPIA 1K79A 4I98B 2XIGA 4PGGA 2JZYA 3HTSB 1BC7C 3BOQA 3LA7A 4ENMA 2R3SA 1MJAA 2CWEA 3ZN1A 1G3WA 3V7CA 1XSXA 2L4MA 2R7FA 5EEHA 5ICEA 4MHGA 3BROA 4KN7X 1FX7A 5F6FA 3E6CC 5LHGA 3FM5A 4A5MA 2JRTA 3LSTA 1WWXA 2FA5A 2L3DA 2LSOA 2Z33A 4RB0A 4WX9A 1RNLA 1CF7A 2M87A 3CO6C 2EA4A 2VT2A 1W7PA 3DQVC 2XAJA 1YW7A 4EQQA 3CLOA 4R8HA 2JTVA 3I58A 4RGSA 2J5OA 2W25A 3WTZA 5J6XA 4CDGA 5L3GA 5LEKA 1F1ZA 1KU9A 1V4RA 3KP7A 4RB2C 2A68F 2EFNA 3MCZA 4BH9A 3J81K 3HRTA 2DK5A 2ISZA 1LDKB 1XCVA 2F5FA 2EJRA 2O3FA 3DPTA 4YFKF 3REOA 4XRFA 4U7DA 2FMLA 2VE8A 3VODA 1XGOA 5E20A 3N97A 1LEAA 4NHJA 4HW0A 1U5TB 2QLZA 2GZWA 1IZ1A 2BV6A 5HDKA 4CXFA 1U8RA 3GVAA 5FLXZ 2O61A 3JTGA 1SFEA 1B9MA 4K2EA 2OQRA 2P8TA 4UNOA 1G3TA 1VTNC 5ICGA 5HOOA 4IXAA 5D5VB 1ZRCA 1XMKA 1P4WA 3TO9A 2L01A 3LWFA 2K7LA 4WCGA 1R23A 2FSWA 4S04A 5JHUA 1FP1D 3RI4A 3ZQ7A 1TBXA 3D5LA 3VEPA 4L9JA 4HX7A 1JXSA 2A5YB 1KU2A 2Y48A 1O3TA 4GCVA 2J5PA 4ZYDA 1D3YA 1FSHA 2VT3A 3K1MA 2O6GE 3F21A 1FPQA 3E6MA 1R36A 1D5VA 1SD6A 2A6HF 4HDUA 3I59A 3V4GA 2HWVA 4IJAA 2QENA 3JAMK 4AD9A 4Y15A 2HKOA 1FNNA 3MZYA 4Q47A 3WU0A 2ELHA 1FBSA 3KETA 5DDGA 2M30A 1ZG5A 4H0EA 4U0YA 4R1HA 4HBLA 2A3SA 5J8CA 5ILVA 2LKPA 3HSFA 3C7JA 3EQLF 4LMYA 5E17F 1MGTA 1MZBA 4Q48A 4FHTA 1E17A 3CTAA 2HDCA 1X3UA 3JW4A 5DCFA 2NS0A 3JAMZ 5FB2A 2DPUA 2ZJ2A 3MQ0A 1J2XA 1FT9A 4ESJA 3ERED 1SMTA 4BQAA 4EJVA 2V6CA 3B73A 1ZLKA 4MNUA 3BJ6A 1ZN2A 2HQRA 3IHUA 4XLNF 1U78A 3R61A 1E2XA 3QU6A 4RGXA 4HLXA 2VN2A 2ACJA 1R58A 1XMAA 2BGCA 2Y0MA 5DCMA 3CUQB 5JVTA 1TW2A 3QP5A 4L9NA 1HKQA 3I71A 3DXJF 5CVJA 3WTTC 2CYYA 2V1UA 1NHAA 2NNYA 3QPHA 1OYIA 1OPCA 2PI0A 2W84A 4CZZA 3V8LA 1TQIA 4L0ZB 3NEUA 1K7AA 2VONA 2EFQA 4LK1F 3DFGA 2K27A 2K4JA 4UXNA 3BWGA 5IT3A 5A2QK 4A0YA 4A5NA 1T2KA 3WE2A 4WK8F 2GXGA 2HZTA 3GF2A 2UWMA 1BIBA 4MEYF 1WI9A 3LA2A 4ESBA 1MDMA 5DYMA 3K2ZA 3ZMSA 1HKTA 1OYYA 4P5OA 5CVRA 1YW9A 3QPTA 2DQRA 4N9IA 5BPDA 2RVCA 2VXZA 4ON0A 2QVOA 3FWEA 1KU7A 2EFPA 3R6SA 1Z05A 4AVPA 4B8XA 4GYGA 3H3UA 4I2OA 4ZYEA 4N0BA 2GAUA 4HF2A 5ILSA 2KIUA 3HSEA 1K78B 3L09A 2RV8A 1XSDA 1QNTA 2PEXA 3BPVA 4U88A 2IA1A 2V79A 2O0YA 2XHKA 3DV8A 2JPCA 4RB3C 1ZH5A 2ZBKA 2FRHA 3J7AO 1IW7F 1EH6A 5AIPA 1QQIA 4O5VA 5ICCA 2FOKA 4PGHA 3KP5A 2MH2A 3MWMA 1WQ2A 2P4WA 2V1DA 4UHTA 2HTSA 2ZMEA 2ZCWA 4A2UA 1O3QA 5CVUA 3QP6A 1HSTA 3WTYC 2NAZA 3DF8A 3CJNA 4GYIA 2D1VA 1J0RA 1H9TA 5J8FA 1CF7B 3GW2A 1W7PB 3KZZA 2VOOA 5E1XA 2D45A 3KFWX 4FX0A 4YFNF 3GFIA 2FNAA 3BZ6A 4XSZF 1BOAA 5D5UB 1FLIA 3AAFA 4M71A 1J59A 1S8NA 3V8KA 1DDNA 5E1ZB 4ZZDA 5L3BA 4JBAA 4P55A 2EFOA 4I01A 2GA1A 1B9NA 2XAGA 3CDHA 2PMHA 4OIPF 3H92A 4O6JA 1DUXC 2E7XA 3F8BA 3SHFA 1IRFA 2IP2A 4OOIA 3JSPA 5ILUA 3I53A 3WG9A 1SMYF 4YIIA 4MTEA 2H27A 4BHCA 3SXYA 2D1HA 2HQNA 2ESHA 4ESFA 5HLHA 1T0FA 1FBQA 4LG0B 1F9NA 3I0TA 4L5JA 3GWZA 3P9KA 3F72A 2Z5UA 4L9VA 3GFJA 2P5LC 1GXQA 2BEOA 5FFZA 2VC1A 2XAFA 3T1BA 1IAWA 1XGMA 4ZH4F 2IJLA 3KP4A 1HQCA 3GLXA 2BYVE 1S6LA 3MFKA 3PQKA 3W6KB 2FU4A 3HYIA 1SD7A 3RPQA 1Z6RA 5D6EA 1OR7A 1YFHA 1ON1A 3TKYA 5EEGA 3GZ6A 1I27A 5H6RA 3T5XA 3V7SA 1GXPA 2X4HA 3RDIA 1SD5A 2RGVA 1UHMA 2Q0OA 4IRHA 4GO1A 4I09A 4FX4A 3V7RA 5L3FA 4G7HF 2XKOA 2IRFG 5HLIA 4KUMA 2H6BA 1RUNA 1Y0UA 1L3LA 3DEUA 1PUEE 3V8JA 3QOPA 1YS6A 3ECOA 5HS7A 1XCBA 1GHCA 2QBYA 1XB4A 1I1GA 2IA0A 1IN7A 2G7HA 5D4RA 3L7WA 4M9ZA 2IA2A 2KIFA 5ERIA 4XLPF 2EA2A 1IN5A 1RI7A 3CUOA 3T8RA 1KYWA 1IXSB 4LJZF 1TNTA 4AIKA 3P9CA 1H0MA 2XROA 3M8FA 3MEXA 3J81Z 1W5TA 3F8CA 4M9SA 4MQ9F 2HEOA 2H94A 4HA8A 4IRGA 3K1NA 2QQBA 1ZG3A 4HAMA 2HR3A 5LBQA 1IN6A 1S7OA 5D5WB 5E18F 4F7ZA 2MBFA 2L54A 4PDKA 3F23A 1FYMA 1G4DA 5LRSA 2HS5A 4HDVA 4RAYA 5JFRA 1LJ9A 3N4MA 2P5KA 3QRFF 4EVIA 3WODF 1LNWA 1TTYA 3SFZA 4KIFA 1ZLJA 2M45A 4UV9A 3WU1B 4ENKA 3G3ZA 1ZHFA 4G6QA 3EUHA 2AS5F 5DUIA 3F3XA 4KMUX 4YFXF 3PFIA 2VBXA 4XSXF 1ZG1A 3F6OA 2PFBA 2Q8KA 1AWCA 1U2WA 3ULQB 3BDDA 5ED4A 2GWRA 1S7AA 4G9YA 4EJOA 4LGWA 1TQPA 2EV0A 2GIVA 2K02A 4DNCA 4M74A 3RKXA 3HOTA 3P9IA 2Z99A 2CSOA 2CFXA 1YG2A 5DD8A 5L3CA 2C6YA 4RGUA 2ZO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5H A;  4ENJ A;  2P6T A;  2W85 A;  3IC7 A;  3ZMZ A;  1O57 A;  1STZ A;  4AIH A;  3T8T A;  3JSO A;  3SZT A;  3BPX A;  4TV7 A;  3WGI A;  6PAX A;  2NNN A;  2QYO A;  3ISP A;  3COA C;  3KZY A;  5HS9 A;  4EGZ A;  3LQR A;  2FBK A;  1B59 A;  3P7N A;  4BHB A;  3R60 A;  3WE3 A;  4KDP A;  4BHP A;  1TW3 A;  5E8G A;  1R5G A;  2LNB A;  3HHH A;  2OBP A;  4MQV A;  2XAQ A;  4M9X A;  5DV5 A;  3NRV A;  1WRJ A;  3I4P A;  4LLG F;  2ETH A;  2GA2 A;  5JI6 A;  2DPD A;  3TOA A;  1YQA A;  5AON A;  1KA8 A;  2A07 F;  3E6B A;  1XDS A;  2EV6 A;  2UXN A;  2QQ9 A;  1SFX A;  2MA3 A;  5IT9 K;  1IXR C;  4A6E A;  1UHW A;  3ZMU A;  2JSC A;  2XRN A;  5DUK A;  3Q9V A;  2H09 A;  2FF4 A;  2ZME B;  1KQ9 A;  1W5S A;  2OU2 A;  2D2W A;  2VC0 A;  5CLS A;  4QLC U;  2PN6 A;  4HYE A;  2ADU A;  5LGT A;  1W7P D;  1QBJ A;  3HUG A;  2OZ6 A;  3KLN A;  2STT A;  4YIF A;  1TLH B;  3WTV C;  3IWZ A;  3ELK A;  4HF0 A;  1ONV A;  3KE2 A;  1MJB A;  5ICF A;  1OYW A;  2XKP A;  4HF1 A;  5D5X B;  1O3S A;  1J9I A;  4S05 A;  1FWZ A;  3TGN A;  1ZAR A;  1I6X A;  1QPM A;  2CW0 F;  1P4X A;  1I1S A;  4MEX F;  2V1X A;  4BAY A;  4KNY A;  3NQO A;  4EJT A;  2NRA C;  5A2Q Z;  2DFI A;  2KRF A;  1J75 A;  2GQQ A;  1Z1D A;  4OIQ F;  2FE3 A;  4ZYG A;  4HV5 A;  2E1C A;  1IXC A;  3O6B B;  5CVI A;  1T6S A;  5BMZ A;  3U9G A;  1FSE A;  4RS8 A;  3FXR A;  4M72 A;  2X0L A;  2IPQ X;  2PG4 A;  1USS A;  2NYX A;  4LFU A;  4OIO F;  3J80 K;  2YU3 A;  3OOP A;  3ROU A;  1SFU A;  5LEJ A;  4WF2 A;  2HTJ A;  3F8F A;  2R7D A;  1QO0 D;  2CG4 A;  1Z6T A;  3EDP A;  1UST A;  4UVB A;  3CUQ A;  5D8K B;  1ZGJ A;  2F5E A;  5TJJ A;  3FF5 A;  2EV5 A;  2A6E F;  3TO6 A;  4P9F A;  1B4A A;  1EV7 A;  5LGN A;  4N9H A;  1UB9 A;  1H9G A;  3M1E A;  2IT0 A;  2WWY A;  4L5I A;  1XN7 A;  4BXU A;  3GUD A;  4U0V A;  3KP2 A;  3VB2 A;  3HRS A;  1DPR A;  3BP8 A;  2L4A A;  2DK8 A;  4PZJ A;  2HGC A;  3HHG A;  1CGP A;  3SQN A;  4UVC A;  2HOE A;  1ODD A;  2LF7 A;  2JPB A;  3K1P A;  3FMS A;  3KEQ A;  4KMF A;  1REP C;  1EH7 A;  4JK1 X;  3ML6 A;  2YX7 A;  2OZU A;  2CGP A;  5L3E A;  3RKW A;  4Z2Y A;  2VE9 A;  5TRD A;  3RKY A;  4EJW A;  5DEQ A;  4UVA A;  2XV4 S;  3RPU A;  4CIC A;  5JR3 A;  4IHS A;  3W6J B;  5D4S A;  3QU3 A;  4Y13 A;  2QBY B;  2Z9O A;  4U7B A;  4LB6 B;  3IKV A;  4U0W A;  2BBY A;  4M73 A;  1KQ0 A;  2V9V A;  1BIA A;  2HFH A;  4UV8 A;  1XSV A;  2P5V A;  1R1V A;  1K78 A;  2GXB A;  3WTU C;  3GO5 A;  3FXQ A;  4L9T A;  3LAJ A;  1IUY A;  3FZV A;  2YX4 A;  2VBZ A;  4LB5 A;  2A69 F;  4OIN F;  3E6D A;  3F8N A;  1WSU A;  2OQG A;  1HBX G;  3E97 A;  2L02 A;  2G9W A;  2JT1 A;  3RYP A;  1RZ4 A;  4HZF A;  1ZRF A;  2CO5 A;  3I5U A;  1XGS A;  4EGY A;  3L9F A;  3MZH A;  3E5X A;  4OU0 A;  3I64 A;  2DQL A;  3C1D A;  1DPU A;  2PJP A;  3EET A;  3B02 A;  2CQK A;  3KEO A;  2QQA A;  4CO8 A;  2EK5 A;  2FQ3 A;  2EWN A;  3GX4 X;  1KQ8 A;  3OV8 A;  2XAS A;  2O03 A;  2F5D A;  1RUO A;  1U5T C;  5BS6 A;  2YR2 A;  2K4B A;  1V3F A;  4I0B A;  1YIO A;  3EYY A;  1BBY A;  2RQP A;  1PP7 U;  3IWF A;  2DW4 A;  4IHT A;  3T0Y A;  1XDU A;  3LAP A;  4WXD A;  4KFC A;  5D8L B;  1IN8 A;  4PCQ A;  3I59 B;  5AIQ A;  4M6Y A;  2STW A;  1FZP B;  3R0J A;  3R4K A;  3ZMD A;  1P2F A;  4LK0 F;  3L00 A;  1P4A A;  1MD0 A;  5FLX K;  2QUF A;  4ENN A;  1G3Y A;  2G7U A;  3H3Z A;  3HIF A;  3TOB A;  5K5O A;  1T39 A;  2VOD A;  5F1R A;  1HSJ A;  3I54 A;  1D8J A;  5HDG A;  4MGR A;  4DQ2 A;  3IRQ A;  1BI2 A;  3O3K A;  4OIR F;  1G3S A;  2OD5 A;  4B09 A;  1C0W A;  1IN4 A;  4NB5 A;  3KLO A;  3HRM A;  4O3M A;  2IVM A;  3F8M A;  4KN4 X;  2P6S A;  1JGS A;  2PQ8 A;  2DO7 A;  1A04 A;  4Q5S F;  3DPL C;  4ASN A;  3O2P E;  5FD5 A;  3TQN A;  1J7K A;  1OMI A;  4LLN A;  2Q2E A;  4NQW A;  2XVC A;  1R1U A;  2QWW A;  2MC3 A;  4LG0 A;  1HW2 A;  3BY6 A;  1YTY A;  3L2C A;  2VOP A;  1R22 A;  5DCM B;  3F22 A;  4OMZ A;  3RJP A;  1ULY A;  4A6D A;  2DAO A;  4HX4 A;  1XD7 A;  4HLY A;  1RIO H;  3E3V A;  3PQJ A;  4GGG A;  5HLG A;  4KT5 C;  1GVJ A;  4LLL A;  3KP3 A;  2P7V B;  2A61 A;  4ZYH A;  5DD4 A;  1HW5 A;  5LGU A;  3WTS C;  2TDX A;  1YLF A;  4YG2 F;  3QAH A;  2KJB A;  3SZP A;  2FEZ A;  2YPR A;  1U3E M;  4ZZL A;  3TDU C;  4QWQ A;  2FMY A;  5KVR A;  1MDM B;  3ZP5 A;  3K0L A;  3GYH X;  2WTE A;  1TQM A;  3CO7 C;  2KJC A;  2H6C A;  2ZFW A;  5CVV A;  3M8E A;  2ISY A;  3CUQ C;  2AXL A;  2M1B A;  1MJ9 A;  2UXX A;  3VFZ A;  5FFX A;  3GEZ A;  1PDN C;  2RKH A;  2HYG D;  5H6Q A;  1WKM A;  1BI3 A;  4AIJ A;  2LDU A;  4G7O F;  1U5T A;  5LHI A;  4KYW A;  5E8I A;  3FXU A;  1FOK A;  3IRR A;  3ABU A;  1EH8 A;  1O3R A;  1IF1 A;  1L0O C;  4GXO A;  1ON2 A;  1BJA A;  5FO5 A;  3C3W A;  4P9U A;  4JQF A;  3G73 A;  3GZ5 A;  1R7J A;  5D6F A;  2M5W A;  4KIG A;  1S29 A;  1ZYR F;  3JTH A;  3F6V A;  4MTD A;  1BN5 A;  3BJA A;  3M9A A;  3GFM A;  1R1T A;  5F64 A;  3IKT A;  2DT5 A;  2QM3 A;  5K5Q A;  4FT8 A;  1W4M A;  1BC8 C;  2HKX A;  2UZK A;  1O7L A;  4XBF A;  3R0A A;  3HOS A;  1Z91 A;  1Z7U A;  4Q4Z F;  5HDN A;  3WTX C;  1DP7 P;  3GFL A;  1K6O A;  3BJO A;  5LHH A;  1SD4 A;  2MLG A;  4CGZ A;  3IL2 A;  1ZAO A;  4EM1 A;  2Z3Y A;  1F4K A;  3FMR A;  1JE8 A;  4E70 A;  4L18 B;  3U2R A;  2LF8 A;  4EM0 B;  1UFM A;  1PP8 F;  1HKS A;  1B6A A;  3HSR A;  3LQQ A;  3RTR A;  5FD6 A;  4EJU A;  4I0A A;  4AWX B;  5HVQ C;  4M6X A;  1D8K A;  2IW5 A;  3TDZ C;  3K69 A;  2ZKZ A;  3D0S A;  5K5R A;  1KU3 A;  1QZZ A;  2KKO A;  1FBU A;  3K9T A;  2RDP A;  1FY7 A;  5L3D A;  2Y75 A;  3ZPL A;  1YS7 A;  3LFK A;  3KCC A;  5IT9 Z;  1JHF A;  3GXO A;  2ZNZ A;  4WXC A;  1T38 A;  2E1N A;  1U6G A;  3U1D A;  3ZN0 A;  2MLK A;  3TO7 A;  4I02 A;  2FXA A;  3ABT A;  4IVN A;  5LLQ A;  1ZRE A;  1LVA A;  4HQM A;  4D0P A;  1MKM A;  2XUB A;  4EM2 A;  4IF4 A;  5K1Y A;  3WGG A;  2DI3 A;  3RYR A;  3E5Q A;  1QGP A;  1KGS A;  2O8X A;  3DKW A;  2FNP A;  4WXH A;  1Q1H A;  4G94 A;  4KIB A;  5CJ9 A;  1FYK A;  4OMY A;  4CHU A;  2RC4 A;  2XAH A;  1YO5 C;  1YW8 A;  2QZ8 A;  1J5Y A;  3LA3 A;  4BYY A;  1BI0 A;  5H20 A;  2ZNY A;  1LDJ A;  3HTU A;  4A0Z A;  2RNJ A;  1SAX A;  3VOE A;  4IPA A;  2OAZ A;  1XGN A;  5BOX A;  4P96 A;  2VBW A;  3ZMV A;  4ETS A;  3RIR A;  5E1W A;  3Q5F A;  1Z9C A;  2W57 A;  3FHZ A;  2HYF A;  4KA4 A;  1AOY A;  1F5T A;  1QZY A;  2DTR A;  2EFW A;  2B0L A;  2XGX A;  1FC3 A;  1ZGA A;  3ZMT A;  2W24 A;  4G6D A;  3HRU A;  4G7Z F;  2K86 A;  3KP6 A;  2WC2 A;  3E5U A;  2YSR A;  3ECH A;  2RN7 A;  5HS8 A;  3FX3 A;  2E7W A;  1KYZ A;  4BNC A;  4L0Y B;  1LDD A;  1G6N A;  3J80 Z;  3C18 A;  1O7F A;  2VBY A;  2MD5 A;  2F2E A;  3DP7 A;  1S3J A;  1HW1 A;  4RAZ A;  2ZXJ A;  2KIM A;  1TNS A;  1LEB A;  2P7C B;  1FP2 A;  1B1B A;  5LRR A;  2BE5 F;  1FYL A;  2PMU A;  4I7H A;  1OKR A;  1UCR A;  4RB1 A;  5CYV A;  2MH9 A;  2M8E A;  1BI1 A;  2F5C A;  4Y17 A;  1T98 A;  1R00 A;  1IRG A;  4EV0 A;  5BQT A;  3MAJ A;  4EMS A;  2EB7 A;  2ESN A;  4HX8 A;  3FM3 A;  1P92 A;  3EYI A;  4G8X A;  4KIC A;  4A0X A;  4HQE A;  2DLL A;  2DU9 A;  1HXD A;  4CYD A;  3WGH A;  2DBB A;  1YYV A;  2PBI A;  1LQ1 A;  1P6R A;  1BM9 A;  1JHH A;  2FBI A;  1I5Z A;  4WWC A;  4UUV A;  4LD5 A;  4R79 A;  4IRI A;  3FMQ A;  4HOB A;  4RGR A;  1ZRD A;  4A12 A;  2FBH A;  3WTW C;  3Q9S A;  1LB2 A;  2OA4 A;  5FGM A;  5KK1 A;  2WV0 A;  2COM A;  2PLY A;  4HV6 A;  3S2W A;  3M7G A;  5BPI A;  1K79 A;  4I98 B;  2XIG A;  4PGG A;  2JZY A;  3HTS B;  1BC7 C;  3BOQ A;  3LA7 A;  4ENM A;  2R3S A;  1MJA A;  2CWE A;  3ZN1 A;  1G3W A;  3V7C A;  1XSX A;  2L4M A;  2R7F A;  5EEH A;  5ICE A;  4MHG A;  3BRO A;  4KN7 X;  1FX7 A;  5F6F A;  3E6C C;  5LHG A;  3FM5 A;  4A5M A;  2JRT A;  3LST A;  1WWX A;  2FA5 A;  2L3D A;  2LSO A;  2Z33 A;  4RB0 A;  4WX9 A;  1RNL A;  1CF7 A;  2M87 A;  3CO6 C;  2EA4 A;  2VT2 A;  1W7P A;  3DQV C;  2XAJ A;  1YW7 A;  4EQQ A;  3CLO A;  4R8H A;  2JTV A;  3I58 A;  4RGS A;  2J5O A;  2W25 A;  3WTZ A;  5J6X A;  4CDG A;  5L3G A;  5LEK A;  1F1Z A;  1KU9 A;  1V4R A;  3KP7 A;  4RB2 C;  2A68 F;  2EFN A;  3MCZ A;  4BH9 A;  3J81 K;  3HRT A;  2DK5 A;  2ISZ A;  1LDK B;  1XCV A;  2F5F A;  2EJR A;  2O3F A;  3DPT A;  4YFK F;  3REO A;  4XRF A;  4U7D A;  2FML A;  2VE8 A;  3VOD A;  1XGO A;  5E20 A;  3N97 A;  1LEA A;  4NHJ A;  4HW0 A;  1U5T B;  2QLZ A;  2GZW A;  1IZ1 A;  2BV6 A;  5HDK A;  4CXF A;  1U8R A;  3GVA A;  5FLX Z;  2O61 A;  3JTG A;  1SFE A;  1B9M A;  4K2E A;  2OQR A;  2P8T A;  4UNO A;  1G3T A;  1VTN C;  5ICG A;  5HOO A;  4IXA A;  5D5V B;  1ZRC A;  1XMK A;  1P4W A;  3TO9 A;  2L01 A;  3LWF A;  2K7L A;  4WCG A;  1R23 A;  2FSW A;  4S04 A;  5JHU A;  1FP1 D;  3RI4 A;  3ZQ7 A;  1TBX A;  3D5L A;  3VEP A;  4L9J A;  4HX7 A;  1JXS A;  2A5Y B;  1KU2 A;  2Y48 A;  1O3T A;  4GCV A;  2J5P A;  4ZYD A;  1D3Y A;  1FSH A;  2VT3 A;  3K1M A;  2O6G E;  3F21 A;  1FPQ A;  3E6M A;  1R36 A;  1D5V A;  1SD6 A;  2A6H F;  4HDU A;  3I59 A;  3V4G A;  2HWV A;  4IJA A;  2QEN A;  3JAM K;  4AD9 A;  4Y15 A;  2HKO A;  1FNN A;  3MZY A;  4Q47 A;  3WU0 A;  2ELH A;  1FBS A;  3KET A;  5DDG A;  2M30 A;  1ZG5 A;  4H0E A;  4U0Y A;  4R1H A;  4HBL A;  2A3S A;  5J8C A;  5ILV A;  2LKP A;  3HSF A;  3C7J A;  3EQL F;  4LMY A;  5E17 F;  1MGT A;  1MZB A;  4Q48 A;  4FHT A;  1E17 A;  3CTA A;  2HDC A;  1X3U A;  3JW4 A;  5DCF A;  2NS0 A;  3JAM Z;  5FB2 A;  2DPU A;  2ZJ2 A;  3MQ0 A;  1J2X A;  1FT9 A;  4ESJ A;  3ERE D;  1SMT A;  4BQA A;  4EJV A;  2V6C A;  3B73 A;  1ZLK A;  4MNU A;  3BJ6 A;  1ZN2 A;  2HQR A;  3IHU A;  4XLN F;  1U78 A;  3R61 A;  1E2X A;  3QU6 A;  4RGX A;  4HLX A;  2VN2 A;  2ACJ A;  1R58 A;  1XMA A;  2BGC A;  2Y0M A;  5DCM A;  3CUQ B;  5JVT A;  1TW2 A;  3QP5 A;  4L9N A;  1HKQ A;  3I71 A;  3DXJ F;  5CVJ A;  3WTT C;  2CYY A;  2V1U A;  1NHA A;  2NNY A;  3QPH A;  1OYI A;  1OPC A;  2PI0 A;  2W84 A;  4CZZ A;  3V8L A;  1TQI A;  4L0Z B;  3NEU A;  1K7A A;  2VON A;  2EFQ A;  4LK1 F;  3DFG A;  2K27 A;  2K4J A;  4UXN A;  3BWG A;  5IT3 A;  5A2Q K;  4A0Y A;  4A5N A;  1T2K A;  3WE2 A;  4WK8 F;  2GXG A;  2HZT A;  3GF2 A;  2UWM A;  1BIB A;  4MEY F;  1WI9 A;  3LA2 A;  4ESB A;  1MDM A;  5DYM A;  3K2Z A;  3ZMS A;  1HKT A;  1OYY A;  4P5O A;  5CVR A;  1YW9 A;  3QPT A;  2DQR A;  4N9I A;  5BPD A;  2RVC A;  2VXZ A;  4ON0 A;  2QVO A;  3FWE A;  1KU7 A;  2EFP A;  3R6S A;  1Z05 A;  4AVP A;  4B8X A;  4GYG A;  3H3U A;  4I2O A;  4ZYE A;  4N0B A;  2GAU A;  4HF2 A;  5ILS A;  2KIU A;  3HSE A;  1K78 B;  3L09 A;  2RV8 A;  1XSD A;  1QNT A;  2PEX A;  3BPV A;  4U88 A;  2IA1 A;  2V79 A;  2O0Y A;  2XHK A;  3DV8 A;  2JPC A;  4RB3 C;  1ZH5 A;  2ZBK A;  2FRH A;  3J7A O;  1IW7 F;  1EH6 A;  5AIP A;  1QQI A;  4O5V A;  5ICC A;  2FOK A;  4PGH A;  3KP5 A;  2MH2 A;  3MWM A;  1WQ2 A;  2P4W A;  2V1D A;  4UHT A;  2HTS A;  2ZME A;  2ZCW A;  4A2U A;  1O3Q A;  5CVU A;  3QP6 A;  1HST A;  3WTY C;  2NAZ A;  3DF8 A;  3CJN A;  4GYI A;  2D1V A;  1J0R A;  1H9T A;  5J8F A;  1CF7 B;  3GW2 A;  1W7P B;  3KZZ A;  2VOO A;  5E1X A;  2D45 A;  3KFW X;  4FX0 A;  4YFN F;  3GFI A;  2FNA A;  3BZ6 A;  4XSZ F;  1BOA A;  5D5U B;  1FLI A;  3AAF A;  4M71 A;  1J59 A;  1S8N A;  3V8K A;  1DDN A;  5E1Z B;  4ZZD A;  5L3B A;  4JBA A;  4P55 A;  2EFO A;  4I01 A;  2GA1 A;  1B9N A;  2XAG A;  3CDH A;  2PMH A;  4OIP F;  3H92 A;  4O6J A;  1DUX C;  2E7X A;  3F8B A;  3SHF A;  1IRF A;  2IP2 A;  4OOI A;  3JSP A;  5ILU A;  3I53 A;  3WG9 A;  1SMY F;  4YII A;  4MTE A;  2H27 A;  4BHC A;  3SXY A;  2D1H A;  2HQN A;  2ESH A;  4ESF A;  5HLH A;  1T0F A;  1FBQ A;  4LG0 B;  1F9N A;  3I0T A;  4L5J A;  3GWZ A;  3P9K A;  3F72 A;  2Z5U A;  4L9V A;  3GFJ A;  2P5L C;  1GXQ A;  2BEO A;  5FFZ A;  2VC1 A;  2XAF A;  3T1B A;  1IAW A;  1XGM A;  4ZH4 F;  2IJL A;  3KP4 A;  1HQC A;  3GLX A;  2BYV E;  1S6L A;  3MFK A;  3PQK A;  3W6K B;  2FU4 A;  3HYI A;  1SD7 A;  3RPQ A;  1Z6R A;  5D6E A;  1OR7 A;  1YFH A;  1ON1 A;  3TKY A;  5EEG A;  3GZ6 A;  1I27 A;  5H6R A;  3T5X A;  3V7S A;  1GXP A;  2X4H A;  3RDI A;  1SD5 A;  2RGV A;  1UHM A;  2Q0O A;  4IRH A;  4GO1 A;  4I09 A;  4FX4 A;  3V7R A;  5L3F A;  4G7H F;  2XKO A;  2IRF G;  5HLI A;  4KUM A;  2H6B A;  1RUN A;  1Y0U A;  1L3L A;  3DEU A;  1PUE E;  3V8J A;  3QOP A;  1YS6 A;  3ECO A;  5HS7 A;  1XCB A;  1GHC A;  2QBY A;  1XB4 A;  1I1G A;  2IA0 A;  1IN7 A;  2G7H A;  5D4R A;  3L7W A;  4M9Z A;  2IA2 A;  2KIF A;  5ERI A;  4XLP F;  2EA2 A;  1IN5 A;  1RI7 A;  3CUO A;  3T8R A;  1KYW A;  1IXS B;  4LJZ F;  1TNT A;  4AIK A;  3P9C A;  1H0M A;  2XRO A;  3M8F A;  3MEX A;  3J81 Z;  1W5T A;  3F8C A;  4M9S A;  4MQ9 F;  2HEO A;  2H94 A;  4HA8 A;  4IRG A;  3K1N A;  2QQB A;  1ZG3 A;  4HAM A;  2HR3 A;  5LBQ A;  1IN6 A;  1S7O A;  5D5W B;  5E18 F;  4F7Z A;  2MBF A;  2L54 A;  4PDK A;  3F23 A;  1FYM A;  1G4D A;  5LRS A;  2HS5 A;  4HDV A;  4RAY A;  5JFR A;  1LJ9 A;  3N4M A;  2P5K A;  3QRF F;  4EVI A;  3WOD F;  1LNW A;  1TTY A;  3SFZ A;  4KIF A;  1ZLJ A;  2M45 A;  4UV9 A;  3WU1 B;  4ENK A;  3G3Z A;  1ZHF A;  4G6Q A;  3EUH A;  2AS5 F;  5DUI A;  3F3X A;  4KMU X;  4YFX F;  3PFI A;  2VBX A;  4XSX F;  1ZG1 A;  3F6O A;  2PFB A;  2Q8K A;  1AWC A;  1U2W A;  3ULQ B;  3BDD A;  5ED4 A;  2GWR A;  1S7A A;  4G9Y A;  4EJO A;  4LGW A;  1TQP A;  2EV0 A;  2GIV A;  2K02 A;  4DNC A;  4M74 A;  3RKX A;  3HOT A;  3P9I A;  2Z99 A;  2CSO A;  2CFX A;  1YG2 A;  5DD8 A;  5L3C A;  2C6Y A;  4RGU A;  2ZO4 A; 
#chains in the Genus database with same CATH topology
 3LSR A;  1R5H A;  4ENJ A;  2VJJ A;  4D1Q A;  4PFO A;  3ERM A;  2P6T A;  2W85 A;  3IC7 A;  3ZMZ A;  1O57 A;  1STZ A;  4AIH A;  3T8T A;  3JSO A;  4C3J J;  1TC3 C;  3SZT A;  3KPH A;  5DM6 F;  3BPX A;  4Y4R A;  4TV7 A;  2DTZ A;  3WGI A;  6PAX A;  4IL6 C;  4RM2 A;  1APL C;  1AHD P;  2NNN A;  2QYO A;  3ISP A;  1MBH A;  3H5N A;  2LY1 A;  3COA C;  4RLF A;  3KZY A;  5HS9 A;  1U0J A;  4XRS G;  4G12 A;  4HPQ A;  1OCC H;  4EGZ A;  3LQR A;  3PIP F;  2FBK A;  1JUP A;  3FBN B;  2E2I J;  1B59 A;  3VYT B;  3P7N A;  1LPQ A;  4BHB A;  3LSM A;  5E3N A;  3R60 A;  4OAY A;  3WE3 A;  4KDP A;  4BHP A;  2HVR A;  2DA4 A;  4X0G A;  1YI2 I;  1TW3 A;  5E8G A;  1R5G A;  2LNB A;  4BXX J;  4BDZ A;  2JWT A;  3HHH A;  1N75 A;  2OBP A;  4MQV A;  3MMY B;  2VQL A;  2XAQ A;  4M9X A;  5DV5 A;  3OSF A;  2DA1 A;  1K6Y A;  1HDP A;  3CJT B;  3NRV A;  1WRJ A;  2PJR A;  2XDV A;  3GTL J;  2E1M C;  3I4P A;  4LLG F;  2ETH A;  2GA2 A;  5JI6 A;  2DPD A;  3TOA A;  1YQA A;  2LH9 A;  1MBK A;  5AON A;  5IOY A;  1KA8 A;  3HKZ N;  1X1P A;  2A07 F;  1E3P A;  2O7O A;  3E6B A;  1XDS A;  1TL8 A;  2EV6 A;  2UXN A;  3ZQF A;  5GAD J;  5B5E C;  4C3I J;  2QQ9 A;  5GPC A;  2R4G A;  1SFX A;  2MA3 A;  1N77 A;  2K85 A;  2XGC A;  5IT9 K;  1IXR C;  3QYF A;  4XLH A;  4A6E A;  1UHW A;  3ZMU A;  4E7Z A;  1VND A;  2L7K A;  2CV2 A;  2JSC A;  1DGR M;  2XRN A;  4GRI A;  5DUK A;  3Q9V A;  4RBO A;  2H09 A;  4DYQ A;  2FF4 A;  1ETV A;  2ZME B;  1KQ9 A;  4CYC B;  2M4K A;  3DKY A;  2VLA A;  1R5I D;  1W5S A;  2OU2 A;  4B3A A;  3KYL A;  4H4K C;  3BTJ A;  2D2W A;  2VC0 A;  4M3B A;  5CLS A;  1MNE A;  4QLC U;  2PN6 A;  4HYE A;  2ADU A;  3OYC A;  5LGT A;  1W7P D;  1QBJ A;  2KPM A;  3HUG A;  2OZ6 A;  2X6O A;  3KLN A;  2STT A;  4YIF A;  2R5Z B;  1B8I A;  1TLH B;  3WTV C;  3JRF A;  3OIP A;  2HOA A;  3IWZ A;  3ELK A;  2P81 A;  2BOL A;  5EG0 B;  4HF0 A;  1FOX A;  1AU7 A;  1ONV A;  4IKF A;  3PNY A;  3KE2 A;  1MJB A;  5ICF A;  1OYW A;  2XKP A;  4HF1 A;  5DS9 A;  2DOE A;  5D5X B;  2NVQ J;  1O3S A;  1T0F C;  1J9I A;  2PMZ N;  2L0K A;  4S05 A;  1FWZ A;  3TGN A;  3OOU A;  4FCY A;  5J4Y A;  4KJZ A;  1ZAR A;  1I6X A;  4KT6 A;  3C2G A;  2KIS A;  1OCT C;  4E7L A;  1A36 A;  1QPM A;  2CW0 F;  1P4X A;  2CV0 A;  1I1S A;  2F4O B;  3DTI A;  3BR1 A;  4MEX F;  2R7X A;  2MD0 A;  5B1A H;  3ASN H;  2V1X A;  4BAY A;  4KNY A;  3NQO A;  2HZD A;  1XX5 A;  3OIQ A;  4BY7 J;  2HVQ A;  1QZE A;  5A2Q Z;  2NRA C;  2DFI A;  4EJT A;  2KRF A;  4N4O B;  1J75 A;  1VQ8 I;  2GQQ A;  1MH3 A;  2LMD A;  1Z1D A;  4OIQ F;  4RLQ A;  2FE3 A;  2OTL I;  3MN2 A;  1JI8 A;  3KX2 A;  5TIS C;  4ZYG A;  4HV5 A;  4A69 C;  3CD6 I;  3QYE A;  2W4S A;  2E1C A;  1IXC A;  5K7H A;  3L1P A;  3K7A J;  3O6B B;  1JKP C;  2Y9Y A;  1OCZ H;  4D5F A;  5CVI A;  1T6S A;  5F0F A;  1A35 A;  1Y1V J;  5BMZ A;  3PJR A;  3U9G A;  1ENH A;  2BHY A;  1HA8 A;  1FSE A;  4RS8 A;  3F9K A;  3FXR A;  3EUA A;  3SZG A;  4M72 A;  5EGO A;  2VKD A;  2QSF X;  2IBD A;  1X1A A;  3OYK A;  2X0L A;  5F1J A;  2IPQ X;  5CPR B;  2PG4 A;  1USS A;  4LIT A;  2NYX A;  4LFU A;  3Q0U A;  4XL9 A;  4OIO F;  3J80 K;  2YU3 A;  3OOP A;  5GPA A;  4DZJ A;  2BY2 A;  3ROU A;  1SFU A;  4HNT A;  1BA5 A;  4BXF A;  2KP6 A;  2M2E A;  5LEJ A;  1XMX A;  4WF2 A;  2HTJ A;  2IGO A;  3F8F A;  3HOW J;  4I6Z A;  4IHV A;  5IYD J;  2R7D A;  1QO0 D;  2CG4 A;  1Z6T A;  4LG3 A;  2VJ5 A;  3GME A;  3K10 A;  3EDP A;  1UST A;  2K3F A;  4UVB A;  3CUQ A;  2CMP A;  5D8K B;  2LD5 A;  1ZGJ A;  2F5E A;  5TJJ A;  1H8A C;  3FF5 A;  1VQP I;  5FLM J;  2EV5 A;  2A6E F;  3TO6 A;  4P9F A;  1B4A A;  1EV7 A;  5LGN A;  4A3E J;  4N9H A;  1LVK A;  1UB9 A;  2OV7 A;  1H9G A;  5EF6 A;  3S17 J;  3M1E A;  2HOS A;  2IT0 A;  2TCT A;  2R7O A;  3IAM 2;  2WWY A;  4L5I A;  1XPX A;  1XN7 A;  2R7Q A;  3GUD A;  4BXU A;  3ZQC A;  4U0V A;  3HPH A;  2X6W A;  3KP2 A;  3VB2 A;  3HRS A;  4J19 A;  1DPR A;  3BR2 A;  3BP8 A;  2L4A A;  3BR3 A;  3C2H A;  2EIL H;  2DK8 A;  4UY8 I;  2M0C A;  2XGE A;  4DYC A;  4PZJ A;  1V5G A;  2LFB A;  2HGC A;  5TGT A;  3S93 A;  3HHG A;  3HKZ A;  2RNG A;  1CGP A;  3SQN A;  5DTD A;  4UVC A;  1VFC A;  2HOE A;  1OFC X;  1ODD A;  2DA7 A;  1VQO I;  2LF7 A;  5IP6 A;  3B6C A;  2JPB A;  3K1P A;  3FMS A;  1A6I A;  3KEQ A;  1VQN I;  4Z6Y A;  4KMF A;  3BR0 A;  2K9M A;  1MMS A;  1REP C;  2XAU A;  1RKW A;  1EH7 A;  3J7Y J;  2DMP A;  3RCO A;  4JK1 X;  4UUS A;  3ABL H;  3ML6 A;  2YX7 A;  1RPW A;  2OZU A;  2CGP A;  3A0B C;  5L3E A;  3RKW A;  4Z2Y A;  3ZRG A;  2W00 A;  2VE9 A;  1ETX A;  1PVE A;  4XM3 A;  5TRD A;  4BBR J;  3RKY A;  4EJW A;  5DEQ A;  4BS9 A;  3RSN A;  4UVA A;  2XV4 S;  1UG0 A;  1Y56 A;  2H1L A;  1JGG A;  4A3L J;  2GIZ A;  3E0J B;  3RPU A;  3PSF A;  4CIC A;  5JR3 A;  4IHS A;  2E19 A;  3SJM A;  2DA3 A;  3W6J B;  3RZD J;  1E3H A;  1KZH A;  4X6A J;  5D4S A;  2H8W A;  4XKV A;  3QU3 A;  3CP8 A;  2M0M A;  2XF7 A;  4Y13 A;  2QBY B;  2Z9O A;  1ACI A;  2JUC A;  4U7B A;  3IKV A;  2BBY A;  4U0W A;  3HC7 A;  4M73 A;  1KQ0 A;  2V9V A;  4LB6 B;  4F55 A;  1GLN A;  3OYM A;  1BIA A;  4D9J A;  2HFH A;  2Y69 H;  4UV8 A;  4AVZ A;  3TW7 A;  1XSV A;  2PMZ A;  4X1E A;  1N25 A;  2P5V A;  3H1C A;  1WJC A;  1R1V A;  5E3L A;  1IGN A;  1D0Y A;  2CQQ A;  1K78 A;  2GXB A;  3WTU C;  3GO5 A;  3OYH A;  3FXQ A;  3FXK A;  4L9T A;  5FRO A;  3LAJ A;  3H0G J;  1IUY A;  1X2M A;  3FZV A;  3H9G A;  4M3G A;  2YX4 A;  2VBZ A;  3NWS A;  3EUH C;  2WA0 A;  4LB5 A;  4BEH B;  2V9K A;  3ZR8 X;  2X1D A;  4IHY A;  2A69 F;  1Y0N A;  3OR2 C;  5LD2 C;  4OIN F;  3G1O A;  3NAR A;  3E6D A;  3F8N A;  1WSU A;  2OQG A;  1HBX G;  3E97 A;  2L02 A;  1BJZ A;  2G9W A;  2JT1 A;  3RYP A;  1YHQ I;  1OQY A;  4ZC3 A;  1RZ4 A;  4HZF A;  2VQH A;  1FMW A;  1ZRF A;  3SDG A;  2CO5 A;  3I5U A;  1XGS A;  4EGY A;  3L9F A;  3MZH A;  3E5X A;  4OU0 A;  2GOM A;  1FIA A;  1WGX A;  2HXI A;  4C2M J;  3I64 A;  2OC6 A;  3AFH A;  2DQL A;  3OWT A;  3C1D A;  2OJE D;  1DPU A;  2PJP A;  3OYJ A;  2JSP A;  1FOW A;  5KHD A;  3H35 A;  4A3B J;  3M4O J;  4PK4 A;  3G6E I;  3EET A;  1GV2 A;  3B02 A;  3K4J A;  3ASO H;  2CQK A;  3PM1 A;  3KEO A;  2VKE A;  2QQA A;  4PJJ A;  2CUZ A;  5FKN A;  4CO8 A;  2EK5 A;  3CES A;  2FQ3 A;  2ICW G;  4HNU A;  2EWN A;  3L2R A;  4OWR B;  3NWT A;  3GX4 X;  4IX7 A;  1JJ8 C;  1KQ8 A;  4QIW N;  3OV8 A;  2ZSH B;  2XAS A;  2O03 A;  1X58 A;  3HPG A;  3UKG A;  2F5D A;  1RUO A;  1U5T C;  5BS6 A;  2YR2 A;  2K4B A;  3PNV A;  3LSJ A;  3QPS A;  2NS8 A;  1V3F A;  4I0B A;  1YIO A;  3EYY A;  1BBY A;  2CV1 A;  2RQP A;  5HNF A;  1PP7 U;  3IWF A;  2DXI A;  4IO9 F;  2DW4 A;  4CCO A;  4IHT A;  3T0Y A;  1XDU A;  3LAP A;  2PX9 A;  3AG2 H;  3QWL A;  1V54 H;  4WXD A;  2E5N A;  4W97 A;  4YRV A;  4KFC A;  1Z77 A;  1YX3 A;  5D8L B;  1P7J A;  4XN3 A;  4LIU A;  1UEL B;  4AID A;  1IN8 A;  1GDT A;  3K4L A;  4PCQ A;  3I59 B;  1Z3Y A;  1NK2 P;  1W0T A;  5EZG A;  5AIQ A;  4M6Y A;  2MFZ A;  4F3Q A;  2STW A;  1FZP B;  1PYV A;  3D5R C;  4XKW A;  2VJI A;  3R0J A;  3E1S A;  3R4K A;  3ZMD A;  1P2F A;  4LK0 F;  3L00 A;  1LE8 A;  1P4A A;  1MD0 A;  2B63 J;  5FLX K;  2QUF A;  1UG2 A;  3G4S I;  3M1C A;  1X1C A;  2VAS A;  4ENN A;  4XOP A;  1VQL I;  1G3Y A;  2G7U A;  3H3Z A;  3HIF A;  1D1B A;  3TOB A;  2BHZ A;  5K5O A;  2CUJ A;  1T39 A;  2VOD A;  5F1R A;  1HSJ A;  4PUS A;  3I54 A;  1D8J A;  4KIT B;  5HDG A;  3DU5 A;  4YEL A;  4HSR A;  4MGR A;  4DQ2 A;  3IRQ A;  4XKB A;  1BI2 A;  3O3K A;  4OIR F;  1G3S A;  2OD5 A;  3CMM A;  1T95 A;  2HYJ A;  1OLT A;  2UV1 A;  2QQ8 A;  4B09 A;  1IN4 A;  4NB5 A;  3CMY A;  1C0W A;  4MO7 A;  3KLO A;  3HRM A;  4O3M A;  1ERD A;  2IVM A;  1D0Z A;  3F8M A;  3LFU A;  4KN4 X;  2WAF A;  3OY9 A;  2LK2 A;  2P6S A;  5DM7 F;  5C44 J;  1XS9 A;  2B7E A;  1JGS A;  2PQ8 A;  4U87 A;  2DO7 A;  3PL8 A;  4J00 A;  2X1E A;  1A04 A;  4Q5S F;  3DPL C;  4ASN A;  1PUF B;  1UJ8 A;  4ZDL A;  1XC5 A;  3O2P E;  2DOF A;  1W0U A;  5FD5 A;  4XOR A;  1X2N A;  5FKO A;  3TQN A;  3AL0 B;  1J7K A;  3OYB A;  2Z2S B;  1OMI A;  4LLN A;  2Q2E A;  5JLW A;  4NQW A;  3ONQ A;  3OYA A;  1BOB A;  2XVC A;  1R1U A;  4A3G J;  4XLA A;  2QWW A;  1BL0 A;  2MC3 A;  4LG0 A;  3ZGK A;  1K83 J;  4XOT A;  5HLT A;  1HW2 A;  3BY6 A;  1WI3 A;  1YTY A;  3L2C A;  1TWC J;  2ZC2 A;  2VOP A;  1FTT A;  1D0X A;  1U8B A;  2B9S A;  1R22 A;  5DCM B;  3F22 A;  2WAE A;  1ZEL A;  4OMZ A;  2CH0 A;  3RJP A;  5KAF C;  1ULY A;  3I3L A;  2DAO A;  4A6D A;  4HX4 A;  4E4H A;  3S2D J;  3CME I;  4ZDP A;  2M7B A;  3CCL I;  1XD7 A;  4HLY A;  2ZXW H;  2OF7 A;  3BZC A;  1RIO H;  5F08 A;  4D7M A;  3E3V A;  4C2U A;  4BY1 J;  3PQJ A;  5FKK A;  2R5Y A;  4GGG A;  5EEA A;  2KFD A;  5HLG A;  4KT5 C;  3Q3S A;  4P1W A;  1GVJ A;  3AKZ A;  2BY0 A;  2WAD A;  4FE4 A;  4LLL A;  1MSE C;  1D1A A;  3KP3 A;  1I3Q J;  2P7V B;  2A61 A;  3LSH A;  4BDY A;  3HOX J;  1W5C C;  3EPZ A;  4ZYH A;  4CCL A;  3CDL A;  3OR1 C;  5DD4 A;  1HW5 A;  5LGU A;  3WTS C;  5F27 A;  2DMQ A;  5FLV A;  2VQC A;  2CUE A;  2TDX A;  1YLF A;  3DKX A;  4A3F J;  1PJR A;  3K4K A;  3HUG B;  4A3I J;  2BY3 A;  2CUF A;  3QAH A;  4YG2 F;  2O9L A;  2KJB A;  3BTC A;  3SZP A;  1B8I B;  2FEZ A;  2LG4 A;  2YPR A;  2OUM A;  4ZZL A;  3TDU C;  1U3E M;  4QWQ A;  2FMY A;  1VQ4 I;  5KVR A;  1MDM B;  4YEJ A;  1MBG A;  3ZP5 A;  3K0L A;  1FEX A;  2QA4 I;  3GYH X;  4BE1 A;  2WTE A;  1TQM A;  3CO7 C;  2LBF B;  5FRM A;  2KJC A;  3S14 J;  2H6C A;  5J1R A;  2ZFW A;  5CVV A;  3M8E A;  2ISY A;  1RC9 A;  2OPT A;  3CUQ C;  2AXL A;  2M1B A;  1MJ9 A;  2UXX A;  3VFZ A;  5FFX A;  3GEZ A;  1PDN C;  1GVD A;  2RKH A;  2HYG D;  5H6Q A;  1SEU A;  3I55 I;  1WKM A;  2QKL B;  1BI3 A;  2EQR A;  2ID3 A;  1QHG A;  4AIJ A;  2DOA A;  3TW6 A;  2LDU A;  4G7O F;  1U5T A;  1IRX A;  1DGW Y;  1WCM J;  2CRG A;  2LTP A;  5LHI A;  5FJ8 J;  1RR8 C;  1MBE A;  4KYW A;  3G1L A;  4II2 A;  5HOD A;  1YJN I;  5E8I A;  3HOU J;  3FXU A;  2EZH A;  3HGG A;  1FOK A;  1NG7 A;  3HZJ A;  1ZR2 A;  1VQ5 I;  2EH3 A;  1Y8R B;  1X19 A;  3IRR A;  2F4M B;  4PJM A;  3OS1 A;  4AM3 A;  1FMV A;  3ABU A;  3DCF A;  1EH8 A;  1O3R A;  3DU6 A;  1L0O C;  1IF1 A;  4GXO A;  2BY1 A;  1ON2 A;  3IH2 A;  1BJA A;  3FIS A;  5FO5 A;  2GXA A;  1TWA J;  3C3W A;  4P9U A;  2ZJQ F;  4JQF A;  3G73 A;  1LFB A;  3GZ5 A;  2KRC A;  3GTJ J;  1R7J A;  5D6F A;  2M5W A;  4KIG A;  4Y3O A;  2R92 J;  1S29 A;  1ZYR F;  2FD5 A;  2R7U A;  3JTH A;  3JRB A;  3F6V A;  4MTD A;  1BN5 A;  5EGO B;  3BJA A;  3M9A A;  3TL4 X;  2TRT A;  4E7J A;  3GFM A;  1R1T A;  4NC7 A;  5F64 A;  3IKT A;  2MG4 A;  2LC2 A;  3L2V A;  2DT5 A;  3HG9 A;  1OJL A;  2NVU B;  2QM3 A;  4XON A;  5K5Q A;  4FT8 A;  1WZ2 A;  1W4M A;  3SEQ A;  2FJ1 A;  2HKX A;  2UZK A;  1BC8 C;  1O7L A;  1FIP A;  4QSH A;  4XBF A;  1J09 A;  1GV5 A;  1Z91 A;  3R0A A;  4BQO A;  3HOS A;  1Z7U A;  2AQE A;  4Q4Z F;  5HDN A;  4FTH A;  3BG7 A;  3WTX C;  3CJQ B;  1DP7 P;  3HOY J;  4M6V A;  2E36 A;  1WFX A;  3OMY A;  3GFL A;  1K6O A;  3BJO A;  5LHH A;  3JRI A;  4C2T A;  1SD4 A;  5GAH J;  4IOA F;  1MW7 A;  2COB A;  2MLG A;  2R0Q C;  4CGZ A;  1TP4 A;  3IL2 A;  1ZAO A;  3CCE I;  2CJJ A;  4EM1 A;  4FAS D;  2Z3Y A;  1F4K A;  2NVT J;  3FMR A;  3HM5 A;  4XIC A;  2LR8 A;  3BQY A;  1JE8 A;  5JHF A;  4E70 A;  2CW7 A;  4L18 B;  1BR1 A;  3U2R A;  2LF8 A;  1WVR A;  3PO2 J;  4EM0 B;  2X9D A;  1UFM A;  2ZB9 A;  1PP8 F;  1HKS A;  1B6A A;  1Y6I A;  3GBG A;  3HSR A;  4N4N B;  3LQQ A;  3RTR A;  5FD6 A;  3H3V K;  4EJU A;  4I0A A;  4AWX B;  3O8G A;  5HVQ C;  1JJ6 C;  4GDF A;  4M6X A;  1D8K A;  2IW5 A;  3GZN B;  1B72 B;  3UNG C;  3TDZ C;  3K69 A;  2ZKZ A;  3D0S A;  5K5R A;  1KU3 A;  1QZZ A;  2MYS A;  2KKO A;  1FBU A;  3K9T A;  2RDP A;  1YJW I;  2BVL A;  1FY7 A;  5L3D A;  1JKR C;  2WY7 Q;  2Y75 A;  3ZPL A;  3FXL A;  1YS7 A;  3D5S C;  3GCM A;  4JP0 A;  3RQ4 A;  3LFK A;  2VUM J;  3KCC A;  5IT9 Z;  2BW3 A;  2CQN A;  3I56 I;  1JHF A;  3GXO A;  2ZNZ A;  3OS2 A;  4WXC A;  1T38 A;  4LOC A;  1Z3X A;  2E1M B;  4LIV A;  4UUS B;  1Q1V A;  3FKJ A;  1GUU A;  1EF4 A;  2E1N A;  3CCS I;  1W36 C;  2ZJR F;  1U6G A;  3U1D A;  3ZN0 A;  2MLK A;  3QYB A;  3FHN A;  3TO7 A;  4I02 A;  4A3C J;  1RES A;  3G2B A;  3ZOB A;  2FXA A;  5M5X J;  4Y52 J;  2HQ5 A;  2DT6 A;  2VJ4 A;  3ABT A;  4IVN A;  5LLQ A;  3CCQ I;  1ZRE A;  4YIR X;  4XLC A;  1LVA A;  4HQM A;  2EZI A;  1MKM A;  2XUB A;  4D0P A;  1RKT A;  4EM2 A;  4IF4 A;  3GTG J;  4C30 A;  5K1Y A;  3WGG A;  1T33 A;  2DI3 A;  3RYR A;  3E5Q A;  3RZO J;  1QGP A;  4NBQ A;  2K3P A;  4XID A;  1KGS A;  2O8X A;  3BC8 A;  3SYT A;  3FIW A;  3DKW A;  2ECB A;  1U9N A;  2FNP A;  4FQG A;  4WXH A;  4B3X A;  2E5Z A;  3SDB A;  3JRD A;  1Q1H A;  4G94 A;  3M07 A;  4KIB A;  5CJ9 A;  5C4X J;  3BQZ A;  1FYK A;  3H9Q A;  3K70 D;  4OMY A;  4XK4 A;  5F0C A;  1NG6 A;  4CZC A;  2RC4 A;  4AUX A;  4CHU A;  2XAH A;  3M3Y J;  1YO5 C;  1YW8 A;  2QZ8 A;  1J5Y A;  3LA3 A;  2XPU A;  3DBH B;  4BYY A;  3VSL A;  1BI0 A;  2LKX A;  5H20 A;  3S1R J;  2ZNY A;  1LDJ A;  3HTU A;  4A0Z A;  3AG4 H;  2RNJ A;  4UUT A;  2RRE A;  1SAX A;  3VOE A;  4IPA A;  4BUP A;  2OAZ A;  4IQ4 A;  1XGN A;  2HI3 A;  4C3H J;  1NTC A;  3RQI A;  4XQF A;  2JMW A;  3MD2 A;  5BOX A;  2DCE A;  4P96 A;  2VBW A;  1OCP A;  4HEA 2;  3RIR A;  1KON A;  5E1W A;  3ZMV A;  4ETS A;  3Q5F A;  1Z9C A;  2W57 A;  3FHZ A;  1X3Z B;  2HYF A;  5M3M J;  4E7H A;  2DT7 B;  4KA4 A;  3QPL A;  1AOY A;  1F5T A;  3VDX A;  2LRE A;  3HDD A;  1QZY A;  2DTR A;  2NXN B;  2B0L A;  4FIS A;  2EFW A;  3HGY A;  2VPR A;  2E2J J;  2XGX A;  1FC3 A;  5B66 C;  3L2U A;  1ZGA A;  3OYL A;  3ZMT A;  5E3O A;  2W24 A;  4G6D A;  2IS4 A;  3HRU A;  4G7Z F;  4ZTJ A;  2L9N A;  2K86 A;  3KP6 A;  1R6R A;  2ELJ A;  1TT5 B;  2M4G A;  2WC2 A;  3E5U A;  2YSR A;  1X1D A;  1JT6 A;  3ECH A;  2RN7 A;  3FX3 A;  5HS8 A;  3GTK J;  2E7W A;  1KYZ A;  3DLA A;  3RKQ A;  4BNC A;  4L0Y B;  1LDD A;  1G6N A;  3CDI A;  5J3L A;  3J80 Z;  3C18 A;  3WHC A;  4EAT A;  2W7N A;  3HXL A;  1O7F A;  2VBY A;  2MD5 A;  3MKZ A;  2F2E A;  3DP7 A;  3CJR B;  1S3J A;  1HW1 A;  3VYR B;  3KYD B;  4RAZ A;  1X3W B;  2ZXJ A;  1IV6 A;  2KIM A;  1TNS A;  2I5U A;  1LEB A;  3N05 A;  3CCY A;  2P7C B;  1FP2 A;  1B1B A;  2R5Z A;  2R7S A;  5LRR A;  3NAU A;  2BE5 F;  3LNQ A;  1FYL A;  2PMU A;  1T8I A;  2AXT C;  4I7H A;  1DQU A;  1SAN A;  5EG0 A;  1OKR A;  3W2A A;  3OYI A;  3OL4 A;  5J40 A;  3CF2 A;  1UCR A;  2DA5 A;  4RB1 A;  5CYV A;  2MH9 A;  2M8E A;  1BI1 A;  3F0C A;  2F5C A;  1IO2 A;  1YRN B;  3QOD A;  3FXO A;  4Y17 A;  1QRY A;  1T98 A;  1R00 A;  1POG A;  1IRG A;  4EV0 A;  3TP3 A;  5BQT A;  3MAJ A;  4EMS A;  2EB7 A;  2QKM B;  2ESN A;  5GTI C;  4HX8 A;  5M3F J;  5M5Y J;  3FM3 A;  1SFO J;  4PJ0 C;  2IXS A;  2IGN A;  2KIQ A;  1P92 A;  3EYI A;  4G8X A;  1FTZ A;  4KIC A;  1D1C A;  4A0X A;  4HQE A;  2LY9 A;  2DLL A;  2DU9 A;  3CQZ J;  2E2H J;  1HXD A;  4XMY A;  1ZR4 A;  2R7V A;  3WGH A;  2DBB A;  1YYV A;  4CYD A;  3FXM A;  1NK3 P;  4V19 K;  2PBI A;  1LQ1 A;  2QCO A;  3LMM A;  1P6R A;  1BM9 A;  3S2H J;  1JHH A;  2FBI A;  1I5Z A;  4A3J J;  4WWC A;  4UUV A;  4LD5 A;  3S16 J;  4R79 A;  4IRI A;  2Y31 A;  2VL8 A;  3IH3 A;  2YS9 A;  4OAZ A;  3DLL F;  2X51 A;  1K4T A;  3FMQ A;  1ZTR A;  3DEW A;  4HOB A;  4FE7 A;  1WJB A;  2XRL A;  4BGD A;  1WJF A;  1X1B A;  1IDZ A;  4RGR A;  1WJA A;  1ZRD A;  1MMD A;  2AHQ A;  3IAS 2;  3BLY A;  2DDB A;  4A12 A;  3S1N J;  1X4P A;  2FQ4 A;  2FBH A;  2MGQ A;  3VYU B;  2E71 A;  4DJA A;  4E6K G;  1AKH A;  2ME0 A;  3LSG A;  4F52 A;  3JRA A;  4B47 A;  3IUO A;  3WTW C;  3Q9S A;  1LB2 A;  4ZDO A;  1ORK A;  4DBR A;  2OA4 A;  5FGM A;  3FK6 A;  5KK1 A;  2WV0 A;  2COM A;  2PLY A;  2A05 A;  1MMA A;  4HV6 A;  2X6X A;  3S2W A;  3M7G A;  5BPI A;  2JVH A;  1K79 A;  2R7T A;  1FJL A;  1HDD C;  2KT0 A;  4I98 B;  1FOY A;  4NQW B;  4NUB A;  3IV5 A;  2ZXI A;  1I50 J;  4QTR A;  2XIG A;  4PGG A;  2JZY A;  5IP9 J;  3HTS B;  1BC7 C;  5E79 C;  1HOM A;  3BOQ A;  3QQA A;  3WHB A;  1OCR H;  3LA7 A;  4ENM A;  2I8D A;  2QSG X;  2R3S A;  4KIS A;  1MJA A;  2CWE A;  2ME6 A;  3ZN1 A;  1G3W A;  1WPK A;  3V7C A;  2KZV A;  1XSX A;  2L4M A;  2R7F A;  2E1O A;  5EEH A;  3ZQG A;  5JVG F;  5ICE A;  3DTE A;  1OIS A;  3W3C A;  4MHG A;  1YJ9 I;  2QEX I;  2HU9 A;  3LSI A;  3HB9 A;  2DYS H;  1R4M B;  5CQE A;  1DP3 A;  3BRO A;  3S1M J;  4KN7 X;  4MLO A;  1FX7 A;  5F6F A;  3E6C C;  5LHG A;  3FM5 A;  2ID6 A;  4A5M A;  2JRT A;  3LST A;  1WWX A;  2FA5 A;  2L3D A;  2LSO A;  2KMU A;  2Z33 A;  4I99 C;  4RB0 A;  3S3O A;  1JKQ C;  4WX9 A;  4CCJ A;  1RNL A;  2EZK A;  1CF7 A;  3A03 A;  2M87 A;  3CO6 C;  4XR6 A;  3U1K A;  3LSP A;  2EA4 A;  5C4J J;  3DBR B;  2GBY A;  2VT2 A;  1BR2 A;  1W7P A;  3DQV C;  2XAJ A;  1YW7 A;  4EQQ A;  3CLO A;  4R8H A;  2VB6 A;  2JTV A;  3I58 A;  4RGS A;  3FBI B;  2J5O A;  2W25 A;  3WTZ A;  5J6X A;  4CDG A;  5L3G A;  1ZKG A;  2CW8 A;  2K40 A;  3CP2 A;  1F1Z A;  4BU2 A;  5LEK A;  3PUF A;  3Q0W A;  1KU9 A;  2CU7 A;  1VQK I;  3FK7 A;  1V4R A;  2EIN H;  3JCU C;  3KP7 A;  4RB2 C;  4IHW A;  2A68 F;  2EFN A;  1T56 A;  1R71 A;  3MCZ A;  5IP7 J;  3OYE A;  4BH9 A;  3J81 K;  3HRT A;  2DK5 A;  2ISZ A;  2KHM A;  1LDK B;  1XCV A;  2BXZ A;  2CQX A;  2VKV A;  3JRG A;  2F5F A;  2EJR A;  3BG6 A;  2O3F A;  3HOV J;  3DPT A;  1JT0 A;  4YFK F;  1AA7 A;  3OYF A;  1EJ9 A;  3REO A;  4XRF A;  1EA3 A;  3A2K A;  4U7D A;  2FML A;  2VE8 A;  3VOD A;  1XGO A;  4XKC A;  3B6A A;  5E20 A;  4XNF A;  5F0H A;  3GTP J;  3N97 A;  1LEA A;  4NHJ A;  1G8X A;  2IS6 A;  2L5Q A;  1TZL A;  4HW0 A;  1U5T B;  2QLZ A;  2GZW A;  1IZ1 A;  2L7Z A;  2DJN A;  2BV6 A;  5HDK A;  4DOZ A;  4CXF A;  2VIX A;  1U8R A;  4JOM A;  4A3D J;  1JTX A;  2F6C A;  1A6Q A;  1SFK A;  2LKS A;  3GVA A;  5FLX Z;  2O61 A;  3JTG A;  1LFP A;  1SFE A;  4BEH A;  1B9M A;  3HJE A;  2R93 J;  1DU0 A;  2M8G X;  4K2E A;  2OQR A;  3JRC A;  2GOX B;  2ZJP F;  2P8T A;  4DW6 A;  2HOT A;  3J7A Y;  3S3M A;  5KCM A;  1G3T A;  1VTN C;  5ICG A;  5HOO A;  4UNO A;  1WH5 A;  4IXA A;  1I39 A;  5D5V B;  1MND A;  1ZRC A;  5J47 A;  1XMK A;  3L2Q A;  4IOC F;  2JA5 J;  3OYD A;  3A01 A;  1P4W A;  2PJR B;  5CKT A;  4B43 A;  4BE2 A;  3CCV I;  3TO9 A;  2L01 A;  3LWF A;  3AG3 H;  4J01 A;  1VI0 A;  1S7E A;  3DWL E;  2K7L A;  4WCG A;  4BQN A;  4ZTF A;  2XB0 X;  1R23 A;  3VWB A;  2XF5 A;  2FSW A;  4S04 A;  2W1O A;  2G0E A;  5JHU A;  1FP1 D;  3RI4 A;  4ANJ A;  3ZQ7 A;  1H89 C;  2V9P A;  2DJI A;  3HL2 A;  1TBX A;  3D5L A;  1OCO H;  3VEP A;  4L9J A;  4HX7 A;  1TT0 A;  1K4S A;  1UMQ A;  2A5Y B;  2DMT A;  4BQQ A;  1JXS A;  1KU2 A;  3PNT A;  2V4J C;  3H5A A;  2Y48 A;  2OCC H;  1MSF C;  1O3T A;  4GCV A;  2DA6 A;  2J5P A;  1WJE A;  4CCM A;  3PSI A;  4ZYD A;  1D3Y A;  5K7Z A;  1FSH A;  2IS1 A;  2VT3 A;  3K1M A;  3S3N A;  3TBI A;  1E3O C;  2O6G E;  1HCR A;  2DMN A;  3F21 A;  5M5W J;  1FPQ A;  1E0E A;  3E6M A;  1R36 A;  2YUS A;  3ZXS A;  3KYC B;  1ITY A;  1D5V A;  4ITV A;  1ETY A;  1SD6 A;  2JA6 J;  2GLO A;  2A6H F;  2K9Q A;  2BZT A;  1ETO A;  4HDU A;  3I59 A;  3V4G A;  2HWV A;  5E3M A;  2IGM A;  4IJA A;  2QEN A;  3JAM K;  4DYR A;  3GTQ J;  1Z7L A;  3H5R A;  3I9V 2;  5EJC A;  4AD9 A;  4Y15 A;  2HKO A;  2HDW A;  4B48 A;  4BJ6 C;  3D1N I;  2K9N A;  2YU9 J;  1FNN A;  3AG1 H;  1T08 B;  3MZY A;  4Q47 A;  3WU0 A;  2BW3 B;  2ELH A;  5FRN A;  1FBS A;  3BCA A;  4S0H B;  3RPU D;  3KET A;  4IHX A;  5DDG A;  3CCJ I;  3SEZ A;  2M30 A;  1ZG5 A;  4H0E A;  2KDZ A;  4U0Y A;  4R1H A;  4ZJZ A;  4HBL A;  2A3S A;  3G1M A;  5J8C A;  1S9H A;  5ILV A;  2LKP A;  4B1R A;  1G2H A;  5GP9 A;  3HSF A;  3C7J A;  4IEJ A;  3EQL F;  3K4C A;  4LMY A;  3BR5 A;  5E17 F;  3H0D A;  1MGT A;  1MZB A;  4Q48 A;  4FHT A;  4M3E A;  2LOO A;  3BG3 A;  1E17 A;  2XGD A;  3CTA A;  2WV1 A;  4CCK A;  1XTA A;  3JRH A;  1VQ9 I;  2HDC A;  5EZH A;  2ZME C;  1X3U A;  2NOJ B;  1VQM I;  2WAQ N;  2UUZ A;  3JW4 A;  5DCF A;  2NS0 A;  3JAM Z;  5FB2 A;  3A02 A;  2DPU A;  4JX6 A;  2ZJ2 A;  3MQ0 A;  1J2X A;  1FT9 A;  5IYC J;  3SFI A;  4ESJ A;  3ERE D;  1SMT A;  4BQA A;  9ANT A;  4AC0 A;  1MMN A;  3FKI J;  2V6C A;  4EJV A;  5IPA A;  1PUF A;  3GTM J;  3B73 A;  1ZLK A;  2W48 A;  4MNU A;  3BJ6 A;  1ZN2 A;  2DN0 A;  4BKX A;  3A4C A;  3ZQI A;  2HQR A;  3IHU A;  2M7A A;  4XLN F;  2VI6 A;  5KAI C;  1U78 A;  3R61 A;  1E2X A;  3QU6 A;  4RGX A;  4UB8 C;  1VQ7 I;  3IP4 B;  4HLX A;  2VN2 A;  2I10 A;  1W36 D;  2ACJ A;  3DBL B;  3Q0V A;  4QPO A;  1R58 A;  1TWG J;  4NC8 A;  1XMA A;  2BGC A;  2LRD A;  1YE9 A;  2VPL A;  2Y0M A;  5DCM A;  1UHS A;  4CUG A;  1P9Q C;  3CUQ B;  4RAG A;  4B4C A;  5JVT A;  3K4B A;  1TW2 A;  3QP5 A;  4L9N A;  1HKQ A;  3M8J A;  4IZZ A;  4PSX A;  3DEE A;  3I71 A;  4BL0 B;  2Y2Z A;  1R4N B;  3DXJ F;  5CVJ A;  2CYY A;  3WTT C;  2ECC A;  2V1U A;  1NHA A;  2NNY A;  2JA2 A;  5LFA A;  3QPH A;  1WHU A;  1OYI A;  1OPC A;  3CCU I;  1I3A A;  2PI0 A;  2W84 A;  4CZZ A;  2VXD A;  2JN6 A;  2L9S A;  1TQI A;  3O8H A;  3V8L A;  4L0Z B;  3NEU A;  2V1N A;  5EYR A;  1K7A A;  3W2W A;  2VON A;  2EFQ A;  4II3 A;  2DFE A;  2R7W A;  4LK1 F;  3DFG A;  4BJ5 C;  5C3E J;  2CFO A;  2X48 A;  1D5Y A;  5B1B H;  2K27 A;  2K4J A;  4UXN A;  4C9Y A;  3BWG A;  5IT3 A;  5A2Q K;  4A0Y A;  1V55 H;  2XPV A;  4A5N A;  3UR3 C;  1T2K A;  3WE2 A;  4WK8 F;  1Y39 A;  5IYB J;  1IG7 A;  3WG7 H;  2GXG A;  2HZT A;  3GF2 A;  2UWM A;  1BIB A;  2FOW A;  2XB5 A;  1HLV A;  1IJW C;  4D7N A;  4E7K A;  3CC4 I;  4MEY F;  1WI9 A;  3LA2 A;  4ESB A;  1MDM A;  5DYM A;  3K2Z A;  4BE0 A;  1A5J A;  1RET A;  3ZMS A;  3I4N J;  3S8P A;  4XLE A;  2LBF A;  1HKT A;  1OYY A;  2DMU A;  4P5O A;  5CVR A;  1DU6 A;  2XPW A;  5J4V A;  4CA0 A;  2VKH A;  1YW9 A;  3QPT A;  2DQR A;  2M34 A;  3ZCO A;  4N9I A;  5BPD A;  2RVC A;  4BAC A;  2VXZ A;  4ON0 A;  1N78 A;  4JX5 A;  2QVO A;  4XRS A;  3FWE A;  4Y33 A;  1KU7 A;  2EFP A;  2KLO A;  3CF5 F;  3R6S A;  1IV8 A;  1Z05 A;  4AVP A;  4B8X A;  4A93 J;  4CCN A;  4GYG A;  4AYB N;  1YIJ I;  3OS0 A;  1Z67 A;  5HNH A;  3H3U A;  3BG5 A;  4I2O A;  5GAG J;  4ZYE A;  1A31 A;  4N0B A;  2GAU A;  2GM4 A;  4HF2 A;  2DFH A;  2RQQ A;  3LL7 A;  4XN0 A;  5ILS A;  2KIU A;  2IGK A;  3MKL A;  1W1W E;  2NVY J;  3HSE A;  4CSW A;  1K78 B;  3L09 A;  2RV8 A;  4M3D A;  3MKY B;  4QPQ A;  1QVU A;  4BBS J;  2LVS A;  1OR7 C;  1TWF J;  3KEY A;  4W1U A;  1XSD A;  1QNT A;  3VYS B;  4PSW A;  3ESW B;  1ZQ3 P;  3U21 A;  2PEX A;  2LLK A;  3BPV A;  2DA2 A;  2EIK H;  3ABM H;  4U88 A;  2IA1 A;  1AKH B;  2V79 A;  3JRE A;  4DZP A;  3J7Z I;  2Y9Z A;  2O0Y A;  1QU3 A;  2XSD C;  3BZK A;  2XHK A;  1YIT I;  2WAQ A;  4MFD A;  4PFP A;  3DV8 A;  1JUS A;  2N8G A;  4DBQ A;  3TED A;  2JPC A;  4RB3 C;  4HNV A;  1F36 A;  1ZH5 A;  1MBJ A;  2NS7 A;  2ZBK A;  2FRH A;  3J7A O;  1IW7 F;  1EH6 A;  3BCB A;  5AIP A;  1QQI A;  4O5V A;  2MW8 A;  2FOK A;  4PGH A;  5ICC A;  1NH3 A;  3KP5 A;  2MH2 A;  3MWM A;  1WQ2 A;  2P4W A;  1HF0 A;  4RM3 A;  3VPR A;  3P5J A;  2V1D A;  1SVO A;  1EKE A;  1MH4 A;  5K7F A;  3GTO J;  4UHT A;  5BNG A;  2HTS A;  1VQ6 I;  2ZME A;  2ZCW A;  2JUG A;  4A2U A;  4CYC A;  1TWH J;  2E34 A;  1O3Q A;  5EDN A;  1BW5 A;  3I4M J;  5CVU A;  2ELK A;  3QP6 A;  2KRH A;  3ZQQ A;  1HST A;  2CS3 A;  2NAZ A;  3WTY C;  2O5R A;  3DF8 A;  3CJN A;  3EUK L;  3LSK A;  4GYI A;  1X4O A;  2HXO A;  3DTK A;  1QPI A;  2D5V A;  2IS2 A;  2D1V A;  1MBF A;  1M1E B;  1B72 A;  1J0R A;  1H9T A;  5J8F A;  2HVS A;  1CF7 B;  3GW2 A;  1ETW A;  4RAF A;  3K70 C;  2V26 A;  4IQJ A;  1W7P B;  2CQ7 A;  3KZZ A;  5JLX A;  2VOO A;  5E1X A;  2D45 A;  2MC4 A;  1VF9 A;  1S72 I;  3KFW X;  4FX0 A;  4YFN F;  3GFI A;  1LE8 B;  3ZQL A;  2M3A A;  2NVX J;  2FNA A;  1SAU A;  3BZ6 A;  4XSZ F;  1BOA A;  5D5U B;  1FLI A;  4F93 B;  2HNH A;  2V7F A;  3AAF A;  4M71 A;  1J59 A;  2EIJ H;  1S8N A;  3V8K A;  1DDN A;  5E1Z B;  2MSY A;  2QGU A;  4V2G A;  2Z16 A;  4NC6 A;  3H36 A;  2ZSI B;  2W82 A;  4RMN A;  4ZZD A;  4NNJ A;  5L3B A;  4JBA A;  5H2F C;  3HOZ J;  2FUG 2;  4P55 A;  2JRM A;  2EFO A;  4I01 A;  1R9T J;  2GA1 A;  1Y1W J;  1B9N A;  2XAG A;  3CDH A;  2KDO A;  2PMH A;  4OIP F;  4DGW B;  3H92 A;  4O6J A;  2P0W A;  4HRI A;  1DUX C;  2E7X A;  1V5F A;  3F8B A;  1ZGW A;  3SHF A;  1IRF A;  2IP2 A;  4OOI A;  3JSP A;  4F91 B;  1VZ0 A;  3MVP A;  4D5C A;  5ILU A;  3I53 A;  1QVT A;  3WG9 A;  1SMY F;  4YII A;  4MTE A;  2DFF A;  4AYB A;  2H27 A;  2JQ7 A;  4L5E A;  4BHC A;  3V42 A;  3CLQ A;  2LP0 A;  3SXY A;  1SC7 A;  4ZYA A;  3S15 J;  2HPI A;  2D1H A;  3IH4 A;  5IOZ A;  2Q2E B;  3S32 A;  4GFB A;  1QA6 A;  2HQN A;  2ESH A;  2DYR H;  4ESF A;  1T0F A;  5HLH A;  1MIJ A;  3PO3 J;  1S5L C;  2NOG A;  2ZXH A;  1UAA A;  1FBQ A;  4LG0 B;  1F9N A;  1IDY A;  4Y7N J;  2Y0S N;  3W6V A;  3CZ6 A;  1Z0X A;  3I0T A;  1IUF A;  2ZFU A;  3A01 B;  4L5J A;  3GWZ A;  3P9K A;  4HG2 A;  2WB1 N;  2MAB A;  3F72 A;  1XG1 A;  1UZC A;  2Z5U A;  2X85 A;  1ZK8 A;  1R49 A;  4L9V A;  3OIO A;  3GFJ A;  5J1U A;  2IAI A;  4RDU A;  3OYG A;  5FKL A;  3ABK H;  3CMA I;  2P5L C;  3JR9 A;  1GXQ A;  2BEO A;  5FFZ A;  1BR4 A;  2VC1 A;  2XAF A;  2V6E A;  2F48 A;  3FDY A;  3T1B A;  1IAW A;  1XGM A;  3WU2 C;  4ZH4 F;  2R5Y B;  2IJL A;  3KP4 A;  1HQC A;  3GLX A;  1QHH D;  1WJD A;  2BYV E;  1S6L A;  5IY5 H;  3MFK A;  3PQK A;  2EBI A;  2XSJ C;  3FXJ A;  1I6H J;  3W6K B;  2FU4 A;  3HYI A;  1SD7 A;  3RPQ A;  1Z6R A;  5D6E A;  1OR7 A;  1V5E A;  2X6Y A;  1YFH A;  1ON1 A;  2OCE A;  4I76 A;  3TKY A;  2O8K A;  3DPU A;  5EEG A;  2L9R A;  1I27 A;  3GZ6 A;  5H6R A;  2H8R A;  3T5X A;  1RRJ A;  1K61 A;  1F43 A;  3V7S A;  2OTJ I;  1GXP A;  3C2B A;  1YOV B;  3OSG A;  2X4H A;  2X1C A;  3RDI A;  1GT0 C;  1SD5 A;  2RGV A;  1UHM A;  2Q0O A;  4IRH A;  5FKM A;  4E7S A;  3AL0 C;  2R7R A;  4GO1 A;  3S1Q J;  2A6T A;  2EZL A;  2M9H A;  3GLL A;  3HBL A;  2XC7 A;  4I09 A;  3BTI A;  4FX4 A;  3V7R A;  5L3F A;  2DOD A;  4G7H F;  2XKO A;  3G71 I;  4A3K J;  1YRN A;  2IRF G;  4RA2 A;  1JKO C;  5HLI A;  4KUM A;  2H6B A;  1JTY A;  4PJL A;  1RUN A;  3K4M A;  3H9J A;  3W2V A;  2Y30 A;  4EEF G;  1Y0U A;  1L3L A;  3DEU A;  1PUE E;  3V8J A;  3QOP A;  1YS6 A;  3ECO A;  5HS7 A;  3LOC A;  1XCB A;  1GHC A;  3BR6 A;  2QBY A;  1Y8Q B;  1XB4 A;  1I1G A;  4ABZ A;  2IA0 A;  1O4X A;  1IN7 A;  4XRM A;  2KL4 A;  3BTL A;  5GTH C;  3KZI C;  2R7Z J;  2G7H A;  5D4R A;  1YX5 A;  3BT9 A;  3VSK A;  3L7W A;  4M9Z A;  2QF7 A;  2IA2 A;  2KIF A;  5ERI A;  4XLP F;  2EA2 A;  1IN5 A;  1RI7 A;  3CUO A;  3T8R A;  1KYW A;  1IXS B;  2WY8 Q;  4G6T B;  4LJZ F;  3MKW B;  3K4N A;  4MIM A;  1TNT A;  2L9V A;  4AIK A;  4M3F A;  3P9C A;  1H0M A;  4JX4 A;  2XRO A;  2L7F P;  2XF6 A;  2IEK A;  3M8F A;  3MEX A;  1WJ5 A;  3J81 Z;  1W5T A;  5J1Y A;  2FX0 A;  4B44 A;  4MFE A;  2L2O A;  2VQG A;  3F8C A;  4M9S A;  1G59 A;  1RR7 A;  2F4I A;  4MQ9 F;  2HEO A;  4PJN A;  3OL3 A;  2H94 A;  4HA8 A;  4IRG A;  4A3M J;  3K6G A;  1ETQ A;  5KNL A;  1MMG A;  3K1N A;  2LY2 A;  1LKX A;  2QQB A;  1ZG3 A;  3CCM I;  1SVM A;  3E7L A;  4HST A;  4HAM A;  1LUJ B;  2JJ7 A;  1WH7 A;  2HR3 A;  5LBQ A;  1IN6 A;  1S7O A;  3KIO A;  1IRZ A;  2H1K A;  3PUB A;  5D5W B;  3TP0 A;  3A0H C;  2A5W A;  5E18 F;  4F7Z A;  2MBF A;  3OYN A;  3PFY A;  2L54 A;  4PDK A;  3F23 A;  3BG9 A;  4AU7 A;  1FYM A;  1G4D A;  5LRS A;  2HS5 A;  2K9L A;  2BVM A;  3CC7 I;  4HDV A;  3CC2 I;  5CQG A;  3MZ8 A;  3ZQH A;  4RAY A;  2AO9 A;  5JFR A;  1LJ9 A;  2E35 A;  1LFU P;  2JA8 J;  2F5V A;  4CH7 A;  2AQF A;  5F04 A;  3N4M A;  2P5K A;  3QRF F;  3QOE A;  4XLF A;  3WOD F;  4EVI A;  1LNW A;  1TTY A;  2EIM H;  3SFZ A;  4KIF A;  3X2Q H;  1ZLJ A;  2M45 A;  5GAE J;  4UB6 C;  4UV9 A;  2Y0S A;  3WU1 B;  2KQR A;  4ENK A;  3TMO A;  3G3Z A;  1ZHF A;  1ETK A;  2WB1 A;  4G6Q A;  1IC8 A;  2EPF A;  2E60 A;  3A1Y A;  1H88 C;  3EUH A;  2AS5 F;  5DUI A;  3F3X A;  1CQT A;  4KMU X;  4YFX F;  3CCR I;  3PFI A;  2VBX A;  4BJT A;  4XSX F;  2DDA A;  1ZG1 A;  3F6O A;  2K9S A;  2LYC A;  2L7M P;  4V2F A;  2PFB A;  2KZG A;  4NDL A;  2HQA A;  2Q8K A;  2Q1Z B;  1AWC A;  2JA7 J;  3HEF A;  1U2W A;  3ULQ B;  3BDD A;  2WBM A;  5ED4 A;  2GWR A;  1S7A A;  2K5C A;  2QSH X;  2JK3 A;  4G9Y A;  2JVG A;  4EJO A;  1JUM A;  4LGW A;  1BW6 A;  1MNM C;  1TQP A;  2EV0 A;  2GIV A;  2K02 A;  4DNC A;  4M74 A;  3L2W A;  3RKX A;  4F92 B;  4JYK A;  3HOT A;  3P9I A;  2Z1D A;  2Z99 A;  2CSO A;  1Z21 A;  1P7I A;  1SVL A;  2BXY A;  2HPM A;  4DIQ A;  2CFX A;  1YG2 A;  3PIO F;  5DD8 A;  1U9O A;  2HDD A;  5B3S H;  5L3C A;  4E7I A;  2C6Y A;  1HC8 A;  2RAE A;  4RGU A;  4FET A;  2ZO4 A;  3K2A A; 
#chains in the Genus database with same CATH homology
 1R5H A;  4ENJ A;  2P6T A;  2W85 A;  3IC7 A;  3ZMZ A;  1O57 A;  1STZ A;  4AIH A;  3T8T A;  3JSO A;  3SZT A;  3BPX A;  4TV7 A;  3WGI A;  6PAX A;  2NNN A;  2QYO A;  3ISP A;  3COA C;  3KZY A;  5HS9 A;  4EGZ A;  3LQR A;  2FBK A;  1B59 A;  3P7N A;  4BHB A;  3R60 A;  3WE3 A;  4KDP A;  4BHP A;  1TW3 A;  5E8G A;  1R5G A;  2LNB A;  3HHH A;  2OBP A;  4MQV A;  2XAQ A;  4M9X A;  5DV5 A;  3NRV A;  1WRJ A;  3I4P A;  4LLG F;  2ETH A;  2GA2 A;  5JI6 A;  2DPD A;  3TOA A;  1YQA A;  5AON A;  1KA8 A;  2A07 F;  3E6B A;  1XDS A;  2EV6 A;  2UXN A;  2QQ9 A;  1SFX A;  2MA3 A;  5IT9 K;  1IXR C;  4A6E A;  1UHW A;  3ZMU A;  2JSC A;  2XRN A;  5DUK A;  3Q9V A;  2H09 A;  2FF4 A;  2ZME B;  1KQ9 A;  1W5S A;  2OU2 A;  2D2W A;  2VC0 A;  5CLS A;  4QLC U;  2PN6 A;  4HYE A;  2ADU A;  5LGT A;  1W7P D;  1QBJ A;  3HUG A;  2OZ6 A;  3KLN A;  2STT A;  4YIF A;  1TLH B;  3WTV C;  3IWZ A;  3ELK A;  4HF0 A;  1ONV A;  3KE2 A;  1MJB A;  5ICF A;  1OYW A;  2XKP A;  4HF1 A;  5D5X B;  1O3S A;  1J9I A;  4S05 A;  1FWZ A;  3TGN A;  1ZAR A;  1I6X A;  1QPM A;  2CW0 F;  1P4X A;  1I1S A;  4MEX F;  2V1X A;  4BAY A;  4KNY A;  3NQO A;  4EJT A;  2NRA C;  5A2Q Z;  2DFI A;  2KRF A;  1J75 A;  2GQQ A;  1Z1D A;  4OIQ F;  2FE3 A;  4ZYG A;  4HV5 A;  2E1C A;  1IXC A;  3O6B B;  5CVI A;  1T6S A;  5BMZ A;  3U9G A;  1FSE A;  4RS8 A;  3FXR A;  4M72 A;  2X0L A;  2IPQ X;  2PG4 A;  1USS A;  2NYX A;  4LFU A;  4OIO F;  3J80 K;  2YU3 A;  3OOP A;  3ROU A;  1SFU A;  5LEJ A;  4WF2 A;  2HTJ A;  3F8F A;  2R7D A;  1QO0 D;  2CG4 A;  1Z6T A;  3EDP A;  1UST A;  4UVB A;  3CUQ A;  5D8K B;  1ZGJ A;  2F5E A;  5TJJ A;  3FF5 A;  2EV5 A;  2A6E F;  3TO6 A;  4P9F A;  1B4A A;  1EV7 A;  5LGN A;  4N9H A;  1UB9 A;  1H9G A;  3M1E A;  2IT0 A;  2WWY A;  4L5I A;  1XN7 A;  4BXU A;  3GUD A;  4U0V A;  3KP2 A;  3VB2 A;  3HRS A;  1DPR A;  3BP8 A;  2L4A A;  2DK8 A;  4PZJ A;  2HGC A;  3HHG A;  1CGP A;  3SQN A;  4UVC A;  2HOE A;  1ODD A;  2LF7 A;  2JPB A;  3K1P A;  3FMS A;  3KEQ A;  4KMF A;  1REP C;  1EH7 A;  4JK1 X;  3ML6 A;  2YX7 A;  2OZU A;  2CGP A;  5L3E A;  3RKW A;  4Z2Y A;  2VE9 A;  5TRD A;  3RKY A;  4EJW A;  5DEQ A;  4UVA A;  2XV4 S;  3RPU A;  4CIC A;  5JR3 A;  4IHS A;  3W6J B;  5D4S A;  3QU3 A;  4Y13 A;  2QBY B;  2Z9O A;  4U7B A;  4LB6 B;  3IKV A;  4U0W A;  2BBY A;  4M73 A;  1KQ0 A;  2V9V A;  1BIA A;  2HFH A;  4UV8 A;  1XSV A;  2P5V A;  1R1V A;  1K78 A;  2GXB A;  3WTU C;  3GO5 A;  3FXQ A;  4L9T A;  3LAJ A;  1IUY A;  3FZV A;  2YX4 A;  2VBZ A;  4LB5 A;  2A69 F;  4OIN F;  3E6D A;  3F8N A;  1WSU A;  2OQG A;  1HBX G;  3E97 A;  2L02 A;  2G9W A;  2JT1 A;  3RYP A;  1RZ4 A;  4HZF A;  1ZRF A;  2CO5 A;  3I5U A;  1XGS A;  4EGY A;  3L9F A;  3MZH A;  3E5X A;  4OU0 A;  3I64 A;  2DQL A;  3C1D A;  1DPU A;  2PJP A;  3EET A;  3B02 A;  2CQK A;  3KEO A;  2QQA A;  4CO8 A;  2EK5 A;  2FQ3 A;  2EWN A;  3GX4 X;  1KQ8 A;  3OV8 A;  2XAS A;  2O03 A;  2F5D A;  1RUO A;  1U5T C;  5BS6 A;  2YR2 A;  2K4B A;  1V3F A;  4I0B A;  1YIO A;  3EYY A;  1BBY A;  2RQP A;  1PP7 U;  3IWF A;  2DW4 A;  4IHT A;  3T0Y A;  1XDU A;  3LAP A;  4WXD A;  4KFC A;  5D8L B;  1IN8 A;  4PCQ A;  3I59 B;  5AIQ A;  4M6Y A;  2STW A;  1FZP B;  3R0J A;  3R4K A;  3ZMD A;  1P2F A;  4LK0 F;  3L00 A;  1P4A A;  1MD0 A;  5FLX K;  2QUF A;  4ENN A;  1G3Y A;  2G7U A;  3H3Z A;  3HIF A;  3TOB A;  5K5O A;  1T39 A;  2VOD A;  5F1R A;  1HSJ A;  3I54 A;  1D8J A;  5HDG A;  4MGR A;  4DQ2 A;  3IRQ A;  1BI2 A;  3O3K A;  4OIR F;  1G3S A;  2OD5 A;  4B09 A;  1C0W A;  1IN4 A;  4NB5 A;  3KLO A;  3HRM A;  4O3M A;  2IVM A;  3F8M A;  4KN4 X;  2P6S A;  1JGS A;  2PQ8 A;  2DO7 A;  1A04 A;  4Q5S F;  3DPL C;  4ASN A;  3O2P E;  5FD5 A;  3TQN A;  1J7K A;  1OMI A;  4LLN A;  2Q2E A;  4NQW A;  2XVC A;  1R1U A;  2QWW A;  2MC3 A;  4LG0 A;  1HW2 A;  3BY6 A;  1YTY A;  3L2C A;  2VOP A;  1R22 A;  5DCM B;  3F22 A;  4OMZ A;  3RJP A;  1ULY A;  4A6D A;  2DAO A;  4HX4 A;  1XD7 A;  4HLY A;  1RIO H;  3E3V A;  3PQJ A;  4GGG A;  5HLG A;  4KT5 C;  1GVJ A;  4LLL A;  3KP3 A;  2P7V B;  2A61 A;  4ZYH A;  5DD4 A;  1HW5 A;  5LGU A;  3WTS C;  2TDX A;  1YLF A;  4YG2 F;  3QAH A;  2KJB A;  3SZP A;  2FEZ A;  2YPR A;  1U3E M;  4ZZL A;  3TDU C;  4QWQ A;  2FMY A;  5KVR A;  1MDM B;  3ZP5 A;  3K0L A;  3GYH X;  2WTE A;  1TQM A;  3CO7 C;  2KJC A;  2H6C A;  2ZFW A;  5CVV A;  3M8E A;  2ISY A;  3CUQ C;  2AXL A;  2M1B A;  1MJ9 A;  2UXX A;  3VFZ A;  5FFX A;  3GEZ A;  1PDN C;  2RKH A;  2HYG D;  5H6Q A;  1WKM A;  1BI3 A;  4AIJ A;  2LDU A;  4G7O F;  1U5T A;  5LHI A;  4KYW A;  5E8I A;  3FXU A;  1FOK A;  3IRR A;  3ABU A;  1EH8 A;  1O3R A;  1IF1 A;  1L0O C;  4GXO A;  1ON2 A;  1BJA A;  5FO5 A;  3C3W A;  4P9U A;  4JQF A;  3G73 A;  3GZ5 A;  1R7J A;  5D6F A;  2M5W A;  4KIG A;  1S29 A;  1ZYR F;  3JTH A;  3F6V A;  4MTD A;  1BN5 A;  3BJA A;  3M9A A;  3GFM A;  1R1T A;  5F64 A;  3IKT A;  2DT5 A;  2QM3 A;  5K5Q A;  4FT8 A;  1W4M A;  1BC8 C;  2HKX A;  2UZK A;  1O7L A;  4XBF A;  3R0A A;  3HOS A;  1Z91 A;  1Z7U A;  4Q4Z F;  5HDN A;  3WTX C;  1DP7 P;  3GFL A;  1K6O A;  3BJO A;  5LHH A;  1SD4 A;  2MLG A;  4CGZ A;  3IL2 A;  1ZAO A;  4EM1 A;  2Z3Y A;  1F4K A;  3FMR A;  1JE8 A;  4E70 A;  4L18 B;  3U2R A;  2LF8 A;  4EM0 B;  1UFM A;  1PP8 F;  1HKS A;  1B6A A;  3HSR A;  3LQQ A;  3RTR A;  5FD6 A;  4EJU A;  4I0A A;  4AWX B;  5HVQ C;  4M6X A;  1D8K A;  2IW5 A;  3TDZ C;  3K69 A;  2ZKZ A;  3D0S A;  5K5R A;  1KU3 A;  1QZZ A;  2KKO A;  1FBU A;  3K9T A;  2RDP A;  1FY7 A;  5L3D A;  2Y75 A;  3ZPL A;  1YS7 A;  3LFK A;  3KCC A;  5IT9 Z;  1JHF A;  3GXO A;  2ZNZ A;  4WXC A;  1T38 A;  2E1N A;  1U6G A;  3U1D A;  3ZN0 A;  2MLK A;  3TO7 A;  4I02 A;  2FXA A;  3ABT A;  4IVN A;  5LLQ A;  1ZRE A;  1LVA A;  4HQM A;  4D0P A;  1MKM A;  2XUB A;  4EM2 A;  4IF4 A;  5K1Y A;  3WGG A;  2DI3 A;  3RYR A;  3E5Q A;  1QGP A;  1KGS A;  2O8X A;  3DKW A;  2FNP A;  4WXH A;  1Q1H A;  4G94 A;  4KIB A;  5CJ9 A;  1FYK A;  4OMY A;  4CHU A;  2RC4 A;  2XAH A;  1YO5 C;  1YW8 A;  2QZ8 A;  1J5Y A;  3LA3 A;  4BYY A;  1BI0 A;  5H20 A;  2ZNY A;  1LDJ A;  3HTU A;  4A0Z A;  2RNJ A;  1SAX A;  3VOE A;  4IPA A;  2OAZ A;  1XGN A;  5BOX A;  4P96 A;  2VBW A;  3ZMV A;  4ETS A;  3RIR A;  5E1W A;  3Q5F A;  1Z9C A;  2W57 A;  3FHZ A;  2HYF A;  4KA4 A;  1AOY A;  1F5T A;  1QZY A;  2DTR A;  2EFW A;  2B0L A;  2XGX A;  1FC3 A;  1ZGA A;  3ZMT A;  2W24 A;  4G6D A;  3HRU A;  4G7Z F;  2K86 A;  3KP6 A;  2WC2 A;  3E5U A;  2YSR A;  3ECH A;  2RN7 A;  5HS8 A;  3FX3 A;  2E7W A;  1KYZ A;  4BNC A;  4L0Y B;  1LDD A;  1G6N A;  3J80 Z;  3C18 A;  1O7F A;  2VBY A;  2MD5 A;  2F2E A;  3DP7 A;  1S3J A;  1HW1 A;  4RAZ A;  2ZXJ A;  2KIM A;  1TNS A;  1LEB A;  2P7C B;  1FP2 A;  1B1B A;  5LRR A;  2BE5 F;  1FYL A;  2PMU A;  4I7H A;  1OKR A;  1UCR A;  4RB1 A;  5CYV A;  2MH9 A;  2M8E A;  1BI1 A;  2F5C A;  4Y17 A;  1T98 A;  1R00 A;  1IRG A;  4EV0 A;  5BQT A;  3MAJ A;  4EMS A;  2EB7 A;  2ESN A;  4HX8 A;  3FM3 A;  1P92 A;  3EYI A;  4G8X A;  4KIC A;  4A0X A;  4HQE A;  2DLL A;  2DU9 A;  1HXD A;  4CYD A;  3WGH A;  2DBB A;  1YYV A;  2PBI A;  1LQ1 A;  1P6R A;  1BM9 A;  1JHH A;  2FBI A;  1I5Z A;  4WWC A;  4UUV A;  4LD5 A;  4R79 A;  4IRI A;  3FMQ A;  4HOB A;  4RGR A;  1ZRD A;  4A12 A;  2FBH A;  3WTW C;  3Q9S A;  1LB2 A;  2OA4 A;  5FGM A;  5KK1 A;  2WV0 A;  2COM A;  2PLY A;  4HV6 A;  3S2W A;  3M7G A;  5BPI A;  1K79 A;  4I98 B;  2XIG A;  4PGG A;  2JZY A;  3HTS B;  1BC7 C;  3BOQ A;  3LA7 A;  4ENM A;  2R3S A;  1MJA A;  2CWE A;  3ZN1 A;  1G3W A;  3V7C A;  1XSX A;  2L4M A;  2R7F A;  5EEH A;  5ICE A;  4MHG A;  3BRO A;  4KN7 X;  1FX7 A;  5F6F A;  3E6C C;  5LHG A;  3FM5 A;  4A5M A;  2JRT A;  3LST A;  1WWX A;  2FA5 A;  2L3D A;  2LSO A;  2Z33 A;  4RB0 A;  4WX9 A;  1RNL A;  1CF7 A;  2M87 A;  3CO6 C;  2EA4 A;  2VT2 A;  1W7P A;  3DQV C;  2XAJ A;  1YW7 A;  4EQQ A;  3CLO A;  4R8H A;  2JTV A;  3I58 A;  4RGS A;  2J5O A;  2W25 A;  3WTZ A;  5J6X A;  4CDG A;  5L3G A;  5LEK A;  1F1Z A;  1KU9 A;  1V4R A;  3KP7 A;  4RB2 C;  2A68 F;  2EFN A;  3MCZ A;  4BH9 A;  3J81 K;  3HRT A;  2DK5 A;  2ISZ A;  1LDK B;  1XCV A;  2F5F A;  2EJR A;  2O3F A;  3DPT A;  4YFK F;  3REO A;  4XRF A;  4U7D A;  2FML A;  2VE8 A;  3VOD A;  1XGO A;  5E20 A;  3N97 A;  1LEA A;  4NHJ A;  4HW0 A;  1U5T B;  2QLZ A;  2GZW A;  1IZ1 A;  2BV6 A;  5HDK A;  4CXF A;  1U8R A;  3GVA A;  5FLX Z;  2O61 A;  3JTG A;  1SFE A;  1B9M A;  4K2E A;  2OQR A;  2P8T A;  4UNO A;  1G3T A;  1VTN C;  5ICG A;  5HOO A;  4IXA A;  5D5V B;  1ZRC A;  1XMK A;  1P4W A;  3TO9 A;  2L01 A;  3LWF A;  2K7L A;  4WCG A;  1R23 A;  2FSW A;  4S04 A;  5JHU A;  1FP1 D;  3RI4 A;  3ZQ7 A;  1TBX A;  3D5L A;  3VEP A;  4L9J A;  4HX7 A;  1JXS A;  2A5Y B;  1KU2 A;  2Y48 A;  1O3T A;  4GCV A;  2J5P A;  4ZYD A;  1D3Y A;  1FSH A;  2VT3 A;  3K1M A;  2O6G E;  3F21 A;  1FPQ A;  3E6M A;  1R36 A;  1D5V A;  1SD6 A;  2A6H F;  4HDU A;  3I59 A;  3V4G A;  2HWV A;  4IJA A;  2QEN A;  3JAM K;  4AD9 A;  4Y15 A;  2HKO A;  1FNN A;  3MZY A;  4Q47 A;  3WU0 A;  2ELH A;  1FBS A;  3KET A;  5DDG A;  2M30 A;  1ZG5 A;  4H0E A;  4U0Y A;  4R1H A;  4HBL A;  2A3S A;  5J8C A;  5ILV A;  2LKP A;  3HSF A;  3C7J A;  3EQL F;  4LMY A;  5E17 F;  1MGT A;  1MZB A;  4Q48 A;  4FHT A;  1E17 A;  3CTA A;  2HDC A;  1X3U A;  3JW4 A;  5DCF A;  2NS0 A;  3JAM Z;  5FB2 A;  2DPU A;  2ZJ2 A;  3MQ0 A;  1J2X A;  1FT9 A;  4ESJ A;  3ERE D;  1SMT A;  4BQA A;  4EJV A;  2V6C A;  3B73 A;  1ZLK A;  4MNU A;  3BJ6 A;  1ZN2 A;  2HQR A;  3IHU A;  4XLN F;  1U78 A;  3R61 A;  1E2X A;  3QU6 A;  4RGX A;  4HLX A;  2VN2 A;  2ACJ A;  1R58 A;  1XMA A;  2BGC A;  2Y0M A;  5DCM A;  3CUQ B;  5JVT A;  1TW2 A;  3QP5 A;  4L9N A;  1HKQ A;  3I71 A;  3DXJ F;  5CVJ A;  3WTT C;  2CYY A;  2V1U A;  1NHA A;  2NNY A;  3QPH A;  1OYI A;  1OPC A;  2PI0 A;  2W84 A;  4CZZ A;  3V8L A;  1TQI A;  4L0Z B;  3NEU A;  1K7A A;  2VON A;  2EFQ A;  4LK1 F;  3DFG A;  2K27 A;  2K4J A;  4UXN A;  3BWG A;  5IT3 A;  5A2Q K;  4A0Y A;  4A5N A;  1T2K A;  3WE2 A;  4WK8 F;  2GXG A;  2HZT A;  3GF2 A;  2UWM A;  1BIB A;  4MEY F;  1WI9 A;  3LA2 A;  4ESB A;  1MDM A;  5DYM A;  3K2Z A;  3ZMS A;  1HKT A;  1OYY A;  4P5O A;  5CVR A;  1YW9 A;  3QPT A;  2DQR A;  4N9I A;  5BPD A;  2RVC A;  2VXZ A;  4ON0 A;  2QVO A;  3FWE A;  1KU7 A;  2EFP A;  3R6S A;  1Z05 A;  4AVP A;  4B8X A;  4GYG A;  3H3U A;  4I2O A;  4ZYE A;  4N0B A;  2GAU A;  4HF2 A;  5ILS A;  2KIU A;  3HSE A;  1K78 B;  3L09 A;  2RV8 A;  1XSD A;  1QNT A;  2PEX A;  3BPV A;  4U88 A;  2IA1 A;  2V79 A;  2O0Y A;  2XHK A;  3DV8 A;  2JPC A;  4RB3 C;  1ZH5 A;  2ZBK A;  2FRH A;  3J7A O;  1IW7 F;  1EH6 A;  5AIP A;  1QQI A;  4O5V A;  5ICC A;  2FOK A;  4PGH A;  3KP5 A;  2MH2 A;  3MWM A;  1WQ2 A;  2P4W A;  2V1D A;  4UHT A;  2HTS A;  2ZME A;  2ZCW A;  4A2U A;  1O3Q A;  5CVU A;  3QP6 A;  1HST A;  3WTY C;  2NAZ A;  3DF8 A;  3CJN A;  4GYI A;  2D1V A;  1J0R A;  1H9T A;  5J8F A;  1CF7 B;  3GW2 A;  1W7P B;  3KZZ A;  2VOO A;  5E1X A;  2D45 A;  3KFW X;  4FX0 A;  4YFN F;  3GFI A;  2FNA A;  3BZ6 A;  4XSZ F;  1BOA A;  5D5U B;  1FLI A;  3AAF A;  4M71 A;  1J59 A;  1S8N A;  3V8K A;  1DDN A;  5E1Z B;  4ZZD A;  5L3B A;  4JBA A;  4P55 A;  2EFO A;  4I01 A;  2GA1 A;  1B9N A;  2XAG A;  3CDH A;  2PMH A;  4OIP F;  3H92 A;  4O6J A;  1DUX C;  2E7X A;  3F8B A;  3SHF A;  1IRF A;  2IP2 A;  4OOI A;  3JSP A;  5ILU A;  3I53 A;  3WG9 A;  1SMY F;  4YII A;  4MTE A;  2H27 A;  4BHC A;  3SXY A;  2D1H A;  2HQN A;  2ESH A;  4ESF A;  5HLH A;  1T0F A;  1FBQ A;  4LG0 B;  1F9N A;  3I0T A;  4L5J A;  3GWZ A;  3P9K A;  3F72 A;  2Z5U A;  4L9V A;  3GFJ A;  2P5L C;  1GXQ A;  2BEO A;  5FFZ A;  2VC1 A;  2XAF A;  3T1B A;  1IAW A;  1XGM A;  4ZH4 F;  2IJL A;  3KP4 A;  1HQC A;  3GLX A;  2BYV E;  1S6L A;  3MFK A;  3PQK A;  3W6K B;  2FU4 A;  3HYI A;  1SD7 A;  3RPQ A;  1Z6R A;  5D6E A;  1OR7 A;  1YFH A;  1ON1 A;  3TKY A;  5EEG A;  3GZ6 A;  1I27 A;  5H6R A;  3T5X A;  3V7S A;  1GXP A;  2X4H A;  3RDI A;  1SD5 A;  2RGV A;  1UHM A;  2Q0O A;  4IRH A;  4GO1 A;  4I09 A;  4FX4 A;  3V7R A;  5L3F A;  4G7H F;  2XKO A;  2IRF G;  5HLI A;  4KUM A;  2H6B A;  1RUN A;  1Y0U A;  1L3L A;  3DEU A;  1PUE E;  3V8J A;  3QOP A;  1YS6 A;  3ECO A;  5HS7 A;  1XCB A;  1GHC A;  2QBY A;  1XB4 A;  1I1G A;  2IA0 A;  1IN7 A;  2G7H A;  5D4R A;  3L7W A;  4M9Z A;  2IA2 A;  2KIF A;  5ERI A;  4XLP F;  2EA2 A;  1IN5 A;  1RI7 A;  3CUO A;  3T8R A;  1KYW A;  1IXS B;  4LJZ F;  1TNT A;  4AIK A;  3P9C A;  1H0M A;  2XRO A;  3M8F A;  3MEX A;  3J81 Z;  1W5T A;  3F8C A;  4M9S A;  4MQ9 F;  2HEO A;  2H94 A;  4HA8 A;  4IRG A;  3K1N A;  2QQB A;  1ZG3 A;  4HAM A;  2HR3 A;  5LBQ A;  1IN6 A;  1S7O A;  5D5W B;  5E18 F;  4F7Z A;  2MBF A;  2L54 A;  4PDK A;  3F23 A;  1FYM A;  1G4D A;  5LRS A;  2HS5 A;  4HDV A;  4RAY A;  5JFR A;  1LJ9 A;  3N4M A;  2P5K A;  3QRF F;  4EVI A;  3WOD F;  1LNW A;  1TTY A;  3SFZ A;  4KIF A;  1ZLJ A;  2M45 A;  4UV9 A;  3WU1 B;  4ENK A;  3G3Z A;  1ZHF A;  4G6Q A;  3EUH A;  2AS5 F;  5DUI A;  3F3X A;  4KMU X;  4YFX F;  3PFI A;  2VBX A;  4XSX F;  1ZG1 A;  3F6O A;  2PFB A;  2Q8K A;  1AWC A;  1U2W A;  3ULQ B;  3BDD A;  5ED4 A;  2GWR A;  1S7A A;  4G9Y A;  4EJO A;  4LGW A;  1TQP A;  2EV0 A;  2GIV A;  2K02 A;  4DNC A;  4M74 A;  3RKX A;  3HOT A;  3P9I A;  2Z99 A;  2CSO A;  2CFX A;  1YG2 A;  5DD8 A;  5L3C A;  2C6Y A;  4RGU A;  2ZO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...