1FBUA

Heat shock transcription factor dna binding domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
b'PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK FACTOR PROTEIN
publication title Proline in alpha-helical kink is required for folding kinetics but not for kinked structure, function, or stability of heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
molecule tags Transcription
total genus 25
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fbuA00
1LEBA 2ZKZA 3GF2A 3ZN1A 1J5YA 2OAZA 3I58A 4YG2F 4IRGA 1XB4A 2STTA 4GCVA 5CVUA 3QOPA 4ENKA 4R8HA 2FMYA 2VE8A 4JQFA 3J80Z 2P8TA 1U8RA 3CDHA 2G7UA 3FM5A 1UHMA 1XGMA 4OIRF 1IXSB 2OD5A 5KVRA 5DCFA 2ZBKA 4ENJA 2X4HA 3R0JA 2DBBA 1H9TA 3CLOA 1J0RA 1ZLJA 6PAXA 3HYIA 3MQ0A 4U88A 3RYPA 2XVCA 2WV0A 3KEOA 4L18B 4UV8A 3C7JA 3IRRA 2XKPA 2HKXA 3V8LA 1S8NA 4KN7X 5LHGA 1DUXC 3QAHA 2YPRA 4M74A 4IVNA 1KU9A 5HLIA 3GVAA 2EFNA 1KQ8A 1GVJA 2HKOA 4MQVA 5E1XA 4I09A 1T38A 4O6JA 3VFZA 4MEYF 5E18F 3BY6A 3HTUA 3ERED 5AONA 2OBPA 4G8XA 2FBHA 2E1CA 1XDSA 3IHUA 1Q1HA 1QBJA 2VC0A 1R5HA 2O3FA 2B0LA 1XMAA 2EV0A 2FQ3A 2W57A 5LHIA 1USTA 1FT9A 2L02A 3BJAA 4HLXA 1V4RA 4EM1A 2VODA 1EH8A 1LVAA 1R1TA 4A0YA 1E2XA 3WTYC 1KYZA 4L9JA 3TOAA 2W25A 4H0EA 4WCGA 5J8CA 4HOBA 3FXRA 5LEKA 3N97A 2FSWA 2O0YA 1O7FA 2MH9A 2XIGA 1S7OA 2M30A 2ZJ2A 3WTUC 3NRVA 4EJOA 5HLGA 3WU0A 5K5OA 1OPCA 1P4AA 4HX4A 3ABUA 1FYKA 2P6SA 1K7AA 1WSUA 1P4XA 2H6CA 1A04A 4KIFA 4MTEA 4IJAA 3JAMZ 5FLXZ 2O6GE 1U5TA 3J7AO 3V4GA 2JT1A 3GFIA 2RDPA 1FBUA 1FWZA 2P5LC 2PMHA 1B1BA 2HQRA 3WTWC 4LLNA 2RVCA 5HLHA 4G7OF 4FX0A 3ZMTA 4KUMA 3EYIA 3WTTC 2F5FA 1YS6A 1ZRFA 4CDGA 4HLYA 1BM9A 1B4AA 3T1BA 1MZBA 3P9KA 4N9IA 1FNNA 1F1ZA 2QQBA 3DQVC 5DYMA 1F9NA 1FYLA 2O61A 2KIMA 2K7LA 5H20A 1HBXG 2ZCWA 3F8MA 3SZPA 5EEGA 5ICCA 2ZFWA 3IWFA 2DLLA 3ZPLA 3ZMVA 3HHGA 1FZPB 2UZKA 1ZYRF 1I5ZA 1FC3A 2ISYA 3JSOA 2IP2A 2E1NA 1T2KA 1Z6RA 1HW5A 3DEUA 3JTHA 3RYRA 3PQJA 3E6DA 2QZ8A 1IXRC 4PDKA 2VC1A 2KJBA 3NQOA 4ESJA 4ON0A 3C18A 4EM0B 2K4JA 5D5XB 5JFRA 5IT9K 2PBIA 2H6BA 1YG2A 3T0YA 1XCBA 4UNOA 4Y15A 3BPXA 1O57A 1LB2A 3KP7A 3QU3A 1MKMA 2A6EF 3TO7A 4XLPF 5H6RA 1KGSA 3J81K 4L9TA 3ML6A 3I4PA 1HW1A 5CVVA 4A12A 1IRFA 3DKWA 3JSPA 4UXNA 1ZAOA 2KRFA 1BI0A 2ESNA 1S7AA 2PJPA 1IAWA 1R7JA 1XCVA 2PN6A 4L9VA 5DCMA 2P6TA 2M5WA 3QRFF 2VOOA 4OINF 4U0WA 4B09A 5D8LB 5D5WB 3GFMA 3V7CA 1RNLA 2PLYA 3QPTA 3BDDA 2LF7A 3CUOA 2Z99A 2JZYA 2VBYA 3QPHA 2GA1A 2ISZA 2VT3A 1ZREA 1RI7A 1STZA 3CO7C 2IRFG 1FYMA 5L3EA 5A2QK 1W7PA 4ASNA 1FPQA 3U9GA 3ECHA 3I59A 3ZMUA 1U6GA 3E3VA 2HR3A 3RKWA 2FF4A 5E1WA 3TDZC 2RNJA 3R6SA 1TNSA 3FF5A 3LFKA 1MDMB 4R1HA 4U7BA 2MC3A 2STWA 5FGMA 3C1DA 3GO5A 3GFLA 4FHTA 2NNYA 2ETHA 3S2WA 3B02A 4HF0A 4M9XA 1ZN2A 1DPUA 4RB0A 4U0VA 4E70A 4PGHA 3K2ZA 3M7GA 4QWQA 4AVPA 2WC2A 1YQAA 1S3JA 4BH9A 4D0PA 1T6SA 1Z7UA 3M8FA 3GWZA 4XSXF 4HV5A 1BN5A 2P7VB 5K5RA 1XSXA 1J2XA 1B59A 2DAOA 5BMZA 1XSDA 3FX3A 1YLFA 3F3XA 4LGWA 2QLZA 3F6VA 3KP2A 4LG0A 4EM2A 4G7ZF 2HYGD 4EJUA 2ELHA 4G7HF 2DPUA 2NRAC 3K0LA 2EK5A 3VEPA 2D1VA 4WXDA 3BJOA 4HZFA 4CICA 1Z1DA 1PP8F 4ETSA 1D8KA 1BIAA 1GHCA 2CW0F 4Q48A 5ILUA 2DQLA 1G4DA 2QM3A 4HF1A 4CHUA 1CGPA 2E7WA 4P5OA 2BV6A 2NAZA 2WTEA 3CUQA 1XN7A 4I98B 4IF4A 2DU9A 2EV6A 5KK1A 2MH2A 1TNTA 3GEZA 4HDVA 1BJAA 2V1XA 3CO6C 3IL2A 1X3UA 4N9HA 3F72A 5H6QA 2KJCA 1IN5A 1WI9A 5K5QA 4LB6B 3W6JB 3WTZA 3T8RA 1S29A 4FX4A 3LQQA 3VOEA 1J59A 4ZH4F 2XAFA 4ESBA 3HOSA 2M1BA 1ZGAA 5ICFA 4EQQA 4GXOA 3E6CC 4XLNF 3FM3A 5LEJA 4ENMA 2QBYB 2DI3A 3VODA 5LGTA 3ISPA 2VT2A 2CQKA 5CVJA 2DK5A 2IVMA 1W4MA 1ZRCA 5TJJA 5E8GA 4RB3C 3BZ6A 2EFOA 2DO7A 4OOIA 2JPCA 4WF2A 2G9WA 3ZN0A 3F22A 1ZRDA 3GYHX 1R58A 4LLGF 1YTYA 1DDNA 3I71A 2IPQX 4WX9A 4BHPA 4I2OA 2IA0A 4RB1A 5EEHA 3HSEA 3E97A 5IT9Z 1JXSA 4AWXB 4RS8A 3KE2A 1ULYA 2LSOA 4KMUX 1HQCA 3T8TA 1JGSA 1D5VA 5CVRA 4EMSA 3FMRA 2K02A 5FD5A 2OZ6A 3LAJA 5BPDA 4YFXF 2OU2A 3WU1B 2M8EA 1W5SA 5D5VB 1R00A 1LJ9A 1BOAA 3MFKA 2YR2A 4AIJA 3RKYA 1EV7A 3GW2A 2UWMA 1RZ4A 4BNCA 2XAJA 2GXGA 3R4KA 4YIIA 3FHZA 1IN4A 4TV7A 3I0TA 3MZHA 4JK1X 2ZMEB 2JTVA 2Q2EA 1ZG1A 1SD5A 2RGVA 2D2WA 3W6KB 2VBZA 4HQEA 1YFHA 5DD8A 1PDNC 5CLSA 5E1ZB 1P2FA 1U78A 3DV8A 4EJWA 5A2QZ 4IHSA 1G6NA 3DFGA 3OV8A 4U7DA 1MD0A 4IRIA 2JRTA 4M73A 3P9CA 3P9IA 3L00A 4RGXA 3PQKA 3EQLF 3F8BA 3MEXA 3N4MA 5D4SA 5HS7A 5L3GA 3V7RA 3MWMA 3KCCA 5L3FA 4LFUA 1H0MA 3WTSC 2QYOA 4S05A 2XRNA 1PP7U 1SD4A 1BC8C 2DK8A 4KDPA 2GXBA 2L54A 2W84A 3WE2A 3K1PA 2VOPA 3DP7A 4LD5A 2W24A 2EV5A 3M8EA 4ZZDA 1SMYF 1YYVA 4G9YA 5HOOA 1VTNC 2GQQA 3QP5A 2V1UA 1ONVA 3KP5A 3MAJA 1YO5C 1QQIA 4OMYA 2BYVE 5AIQA 3E6BA 2XKOA 4MHGA 2FNPA 2HZTA 2ESHA 4YFNF 4F7ZA 4B8XA 1R22A 1TQMA 3R0AA 4ZYGA 3U1DA 3WGHA 4LLLA 5LRRA 3KZZA 4M9SA 4HQMA 1XGOA 4Q5SF 3RPUA 2K86A 3EDPA 4BAYA 1GXPA 4MQ9F 2LF8A 2ZNZA 4WWCA 2A3SA 2NS0A 3BPVA 3REOA 4BXUA 5TRDA 5FFXA 4KMFA 2H09A 3MZYA 4R79A 3COAC 1FP1D 2GAUA 1MDMA 3RIRA 4M6YA 5DD4A 1KYWA 1H9GA 1LEAA 2QWWA 3Q9VA 3Q9SA 3HRSA 4DNCA 5LLQA 1REPC 3F8NA 3B73A 3D5LA 1EH7A 1SFUA 2LKPA 3SZTA 4UHTA 4L5JA 5FFZA 3JW4A 3F6OA 4RGRA 4Q47A 1SFEA 2XGXA 2PG4A 5HDNA 4KN4X 2PQ8A 3H3ZA 1G3TA 2G7HA 5CYVA 5E17F 1BI3A 3EYYA 2A61A 1MJAA 2PMUA 4A2UA 3K69A 2J5PA 1BI1A 3F8FA 4A5MA 1O3QA 2Y75A 2JPBA 1ZLKA 1JHFA 5DDGA 1EH6A 4P9UA 3ZMZA 2CSOA 4KNYA 3TO6A 3E5QA 2UXNA 1CF7A 1B9NA 3WTVC 3I54A 1F5TA 5DV5A 2L4MA 1W5TA 1J75A 4AIHA 1O7LA 5JHUA 3M9AA 1KA8A 4NQWA 1S6LA 3EUHA 4KA4A 1IZ1A 5BQTA 1K78A 3H3UA 3L09A 1LQ1A 3I5UA 5LHHA 1HKSA 1WQ2A 5LGNA 2CG4A 2HEOA 3GX4X 5JVTA 2Q8KA 1U5TC 2D45A 3G73A 2EFWA 4M71A 1BI2A 2DQRA 3L9FA 1FSHA 2MD5A 2FA5A 3R60A 1OYYA 1UCRA 3JAMK 1D8JA 1ON2A 3U2RA 2NYXA 2EJRA 3QU6A 4FT8A 5IT3A 1FLIA 2VBWA 1AOYA 2Z9OA 4IHTA 2XHKA 2QBYA 4OIQF 5LGUA 2H94A 1L0OC 4Y13A 4LK0F 1TBXA 2PFBA 3FXUA 3RPQA 2M45A 5AIPA 4I02A 4G94A 2F5CA 4L0ZB 1USSA 4LJZF 3DPTA 3GXOA 1UFMA 4AIKA 4EJVA 3L2CA 3LWFA 1BBYA 4ZYHA 2XROA 2QQAA 5CJ9A 4UV9A 4Y17A 4XBFA 5FB2A 1P92A 2HGCA 2RQPA 3HUGA 3V8KA 2P4WA 3KP6A 4I0BA 1J7KA 2ZNYA 3LQRA 1XD7A 3F23A 1YS7A 5DCMB 3KLOA 2XASA 1WKMA 3K1NA 4ESFA 3L7WA 4GGGA 5HVQC 2QUFA 4U0YA 4XSZF 1Z05A 2DFIA 2D1HA 2MA3A 2H27A 4JBAA 2F5DA 3GZ5A 4LMYA 3HRMA 3FXQA 5FO5A 1QO0D 3GUDA 1Y0UA 4HAMA 3WGIA 2P5VA 4KFCA 2EFPA 2XAGA 4KICA 4BQAA 4KT5C 2C6YA 2HTSA 5D4RA 4ZYDA 1BIBA 1SMTA 1QGPA 3DF8A 1P6RA 2MLKA 2FBIA 3K9TA 3I59B 1DPRA 2R3SA 1ZH5A 2NNNA 3GLXA 2O03A 4GYGA 1KQ9A 1U2WA 1UHWA 4KIBA 3TKYA 3JTGA 2IT0A 4RB2C 3MCZA 4GO1A 4L9NA 2IA1A 2K4BA 3G3ZA 2P5KA 2ZMEA 2MLGA 3AAFA 3ELKA 1OMIA 1FSEA 4HX7A 2V1DA 3ABTA 2EFQA 3IWZA 4UVAA 4EGZA 1G3WA 4PCQA 3I53A 1I1GA 1ODDA 3KLNA 3LAPA 2WWYA 3RKXA 4CYDA 2Q0OA 5J8FA 1SAXA 2P7CB 1O3SA 2LNBA 4MGRA 2EA2A 1OYIA 2CFXA 4WXCA 2KIUA 4RGUA 2BGCA 1XGNA 3DPLC 5J6XA 2V79A 1ZG5A 2QENA 1K78B 1L3LA 4L5IA 3GZ6A 1XSVA 1K79A 3KEQA 1D3YA 1BC7C 5D6FA 1KU2A 4LG0B 2XUBA 4HV6A 4N0BA 3O2PE 2IA2A 4YFKF 1JHHA 2VBXA 1HKQA 4A6EA 1IXCA 3QP6A 1WRJA 1SFXA 4I0AA 5HDGA 3RTRA 5HS9A 3J81Z 2BBYA 4LK1F 3F21A 3C3WA 3E5UA 4BYYA 2EA4A 1NHAA 2FOKA 4P9FA 1R1VA 2L01A 5D5UB 2UXXA 4G6QA 2GA2A 2Z33A 5E20A 2OQRA 1HKTA 4CZZA 4OIOF 4GYIA 3CUQB 2X0LA 2FEZA 4Q4ZF 1SD6A 2R7DA 2FRHA 2XAQA 3CTAA 1FP2A 5K1YA 1YW8A 2HQNA 4UVBA 3HSFA 2HOEA 1IN6A 4PZJA 1B9MA 2DT5A 2R7FA 2Z3YA 4K2EA 3H92A 3E5XA 5ICGA 1R36A 2FBKA 1TW2A 1MJ9A 5L3BA 3KFWX 4Z2YA 2RV8A 2OA4A 1DP7P 4RAZA 1XDUA 4RAYA 3SXYA 3LA3A 5DUIA 1OR7A 2EWNA 3FMSA 2FMLA 4P55A 2ADUA 1WWXA 5D6EA 1TW3A 1Z6TA 4IXAA 4RGSA 2ZO4A 1ZGJA 5L3CA 1LDKB 1HSTA 5FD6A 4IPAA 4UUVA 3FZVA 4HYEA 1O3TA 3D0SA 3ULQB 2QVOA 1OYWA 2FE3A 3HTSB 3CUQC 2BEOA 4LB5A 4A0XA 3SHFA 2RN7A 1YW9A 2FU4A 3BOQA 1Z91A 4ZZLA 1T39A 1RIOH 1LDJA 3KETA 3RI4A 4XRFA 5ERIA 3F8CA 3TQNA 4I01A 3ZQ7A 1IN7A 4EV0A 1TLHB 2GZWA 1O3RA 2CO5A 4NB5A 1RUOA 1GXQA 3LA2A 2PEXA 3HRTA 4P96A 4S04A 1QNTA 3R61A 3EETA 3V7SA 3HHHA 1KU3A 1FX7A 3ECOA 1T0FA 3J80K 1ZHFA 3WTXC 2Y0MA 4HBLA 2FXAA 3GFJA 3RDIA 4A5NA 4M6XA 4A0ZA 3ROUA 3FWEA 4CGZA 2YX4A 1I1SA 1TTYA 1F4KA 2XV4S 1T98A 1FBQA 2AS5F 2L4AA 1R1UA 2AXLA 5L3DA 4HW0A 1MGTA 4OMZA 4KYWA 5E8IA 1IN8A 2HFHA 2HDCA 3K1MA 4QLCU 3BROA 5CVIA 3KZYA 5F6FA 3IRQA 2F5EA 1IF1A 5LRSA 2A5YB 1HW2A 2LDUA 2VN2A 4L0YB 3WGGA 2CGPA 3V8JA 1QZYA 2OQGA 2M87A 2A07F 3KP3A 3NEUA 1RUNA 1E17A 2PI0A 3I64A 2A69F 4HDUA 1QZZA 2L3DA 4BHBA 5ICEA 2JSCA 4YIFA 3LSTA 1U5TB 1R5GA 4WXHA 4EJTA 1K6OA 4I7HA 2ZXJA 3T5XA 1XMKA 3DXJF 4IRHA 3PFIA 3Q5FA 3IKTA 2DTRA 1FBSA 2FNAA 1YW7A 2VXZA 3KP4A 2KKOA 3BP8A 3OOPA 4O5VA 5ILVA 4HX8A 2F2EA 2V6CA 3ZMDA 3E6MA 2OZUA 1KQ0A 2COMA 2TDXA 3O3KA 4OIPF 4CXFA 1MJBA 1UB9A 2E7XA 1FY7A 2RC4A 2YX7A 1C0WA 5ILSA 5BPIA 5ED4A 4G6DA 2CWEA 2Z5UA 3IKVA 3HRUA 1J9IA 4AD9A 5HDKA 2ACJA 3SFZA 2J5OA 4EGYA 3WODF 2IJLA 1B6AA 1I6XA 2VE9A 1SD7A 3FMQA 1QPMA 2CYYA 1V3FA 3TGNA 5JR3A 1G3YA 3TDUC 5D8KB 1ZARA 3RJPA 3HSRA 2HYFA 3HIFA 2RKHA 2YU3A 2W85A 3BJ6A 5FLXK 3WG9A 3SQNA 1R23A 1AWCA 2HS5A 1I27A 5DEQA 1IRGA 3LA7A 1LNWA 4OU0A 2A6HF 4UVCA 1W7PD 2IW5A 4DQ2A 3TOBA 4ZYEA 2Y48A 4HA8A 1PUEE 2K27A 5F1RA 2V9VA 3O6BB 1ON1A 4M9ZA 2KIFA 2HTJA 1LDDA 3ZP5A 2DW4A 4BHCA 4A6DA 2GWRA 3HOTA 2EB7A 3P7NA 1TQIA 2XAHA 3TO9A 4HF2A 4ENNA 5DUKA 1XGSA 3CJNA 2DPDA 3BWGA 1IW7F 2VONA 1FOKA 3IC7A 1JE8A 4EVIA 5HS8A 4MEXF 1YIOA 1KU7A 4M72A 5BOXA 4KIGA 1HXDA 1U3EM 2YSRA 2HWVA 2GIVA 1CF7B 2MBFA 4WK8F 3M1EA 3ZMSA 4CO8A 5F64A 5BS6A 1Z9CA 4MTDA 4MNUA 1OKRA 3VB2A 2O8XA 1IUYA 4O3MA 2QQ9A 1TQPA 1ZG3A 2A68F 4PGGA 1HSJA 5JI6A 3WE3A 1P4WA 1G3SA 2BE5F 4NHJA 1W7PB 5LBQA
chains in the Genus database with same CATH superfamily
1LEBA 2ZKZA 3DU6A 3GF2A 1VQKI 4NDLA 3ZN1A 2BVMA 3U1KA 1J5YA 2WB1A 2OAZA 3I58A 5GP9A 4YG2F 2IS4A 3IUOA 4IRGA 1XB4A 2CW7A 1ETYA 2DDAA 2STTA 2CQQA 3LL7A 3CJTB 3BLYA 2IS6A 4GCVA 5CVUA 2CV1A 3ABKH 4XONA 3A4CA 3HKZN 3QOPA 2P81A 4ENKA 5CPRB 4R8HA 2FMYA 2VE8A 2HOTA 3UR3C 2QQ8A 4JQFA 1DGWY 4BDZA 3J80Z 1DQUA 2VKDA 2JRMA 2P8TA 2AHQA 1YX3A 4NC8A 4N4OB 3TW6A 5FLMJ 1U8RA 3CDHA 2G7UA 3FM5A 3K4CA 1UHMA 1XGMA 4OIRF 1IXSB 1NH3A 2OD5A 5KVRA 1YOVB 4I76A 3L2VA 5DCFA 1PUFB 2ZBKA 4BEHB 2HQAA 3IAS2 4ENJA 2X4HA 3R0JA 2DBBA 1H9TA 4UUSA 1Z0XA 3CLOA 2QSGX 1MSEC 4B47A 1J0RA 1ZLJA 1W0UA 1IO2A 6PAXA 3HYIA 3MQ0A 2OCEA 4U88A 2A6TA 3ZQLA 1X3ZB 3RYPA 2XVCA 2WV0A 3KEOA 4L18B 1JJ8C 2CUFA 4UV8A 1UAAA 5H2FC 3C7JA 3EUHC 1BW5A 4P1WA 3IRRA 2XKPA 2HKXA 5FKKA 1WJFA 3V8LA 1S8NA 1P7IA 4KN7X 4V2GA 5LHGA 1DUXC 2QA4I 2W48A 3QAHA 3MVPA 2XF7A 5EG0A 2YPRA 2KLOA 1FEXA 2JUCA 4M74A 4M3FA 3K6GA 4IVNA 1KU9A 3OS2A 2O8KA 5HLIA 4A69C 3GVAA 2EFNA 4FE7A 1KQ8A 1GVJA 1BR1A 1IUFA 3DEWA 3SJMA 1A35A 2HKOA 3JRDA 4MQVA 5E1XA 4I09A 1T38A 4O6JA 3VFZA 4XKWA 3ZQIA 4MEYF 2E36A 2L5QA 2R7OA 5E18F 2CMPA 2GLOA 3BY6A 4CZCA 3HTUA 3CF5F 3ERED 5AONA 2OTJI 1LUJB 2OBPA 1D1AA 3CCYA 4G8XA 3OYEA 2CH0A 1X4OA 1DU0A 2PJRA 4BJTA 2FBHA 3CQZJ 2E1CA 1XDSA 3IHUA 1Q1HA 4BE2A 1J09A 4C2MJ 1QBJA 2M34A 2VC0A 1XC5A 1VQ4I 3DBLB 1R5HA 2O3FA 3S14J 1JTYA 2B0LA 2WY8Q 2M0CA 1XMAA 2EV0A 1ZELA 2FQ3A 2W57A 1TT5B 3F9KA 3TW7A 3C2HA 5LHIA 3S3OA 1USTA 1FT9A 3M3YJ 2L02A 3BJAA 1BW6A 4HLXA 1V4RA 3RQ4A 4EM1A 2VODA 1EH8A 1LVAA 1R1TA 4A0YA 1E2XA 2DFEA 3WTYC 1KYZA 1E0EA 1ETOA 4L9JA 3TOAA 2B9SA 2ZXIA 3OIQA 1Z21A 4C3IJ 1MMAA 2W25A 2BY3A 4H0EA 2HXOA 4WCGA 2DMTA 5J8CA 3HOYJ 4HOBA 2BY1A 1NK3P 3FXRA 4DZJA 1QZEA 5LEKA 3N97A 2FSWA 3JRAA 4E7IA 3SDGA 2O0YA 1O7FA 4BXFA 5FLVA 3PFYA 2MH9A 2XIGA 5FRMA 1ETWA 1S7OA 1Y1VJ 2M30A 1CQTA 2ZJ2A 3WTUC 2PMZA 4XLEA 1X2NA 3LSMA 3A03A 3LSPA 1SFKA 2M2EA 3NRVA 3PO2J 2MW8A 4EJOA 2Y69H 1KZHA 1QHHD 5HNHA 5HLGA 3B6AA 5EEAA 3WU0A 1R71A 4M3EA 3EUKL 5K5OA 4IHYA 1OPCA 2LY2A 1P4AA 1VQ5I 4HX4A 1B72B 2F6CA 3ABUA 1FYKA 1IC8A 4FASD 2P6SA 1K7AA 3QPSA 3FXJA 1WSUA 1P4XA 2H6CA 1XPXA 3GTJJ 3DLLF 2CW8A 1A04A 4KIFA 4JYKA 3ERMA 5IP7J 2ECCA 4D7MA 5KCMA 4MTEA 2MG4A 4IJAA 3JAMZ 5FLXZ 2O6GE 1GT0C 1U5TA 2VL8A 3J7AO 1YHQI 3V4GA 3DLAA 2JT1A 3GFIA 4A3CJ 2RDPA 1S9HA 5J1UA 1FBUA 1K6YA 1UMQA 5KNLA 1FWZA 1WJAA 2F4OB 2P5LC 2LFBA 4HRIA 2PMHA 3HGGA 5GADJ 1B1BA 2HQRA 1ZR2A 3WTWC 3UNGC 2F5VA 4LLNA 2RVCA 3GZNB 4XNFA 5HLHA 4G7OF 4FX0A 3AL0B 2EZHA 2K3PA 3ZMTA 4KUMA 3EYIA 1N75A 3WTTC 3K4MA 5DM7F 2F5FA 1RETA 1GV2A 3VYTB 1YS6A 1ZTRA 2ZMEC 1UG2A 2BW3B 2WY7Q 3A1YA 3ZQQA 1FIAA 2FJ1A 1TWAJ 2KMUA 1ZRFA 4CDGA 2L7KA 5EZHA 1VQ6I 4HLYA 2E5ZA 2V1NA 1A5JA 1MNDA 1R6RA 1OLTA 1BM9A 1B4AA 4LG3A 3T1BA 3KYCB 1MZBA 2E2JJ 3P9KA 3CMYA 3S15J 2MC4A 4ZDOA 4N9IA 1FNNA 5F0HA 1SAUA 3J7AY 1F1ZA 2L9RA 2QQBA 4IKFA 3DQVC 2EZKA 3GBGA 5DYMA 4D7NA 2JA5J 2ELKA 3I4NJ 3CCMI 1F9NA 3DPUA 3FHNA 1FYLA 5FKNA 2O61A 1POGA 2I10A 2BXYA 2TRTA 2KIMA 2K7LA 3HOXJ 4A3KJ 5H20A 1HBXG 1ERDA 5C3EJ 2ZCWA 2KDOA 3F8MA 3SZPA 5EEGA 4CUGA 5ICCA 3NARA 1LE8B 2ZFWA 3IWFA 2DLLA 3ZPLA 1T56A 1ITYA 3ZMVA 3HHGA 2D5VA 1FZPB 2ZSIB 2UZKA 1ZYRF 2QEXI 1I5ZA 2OTLI 2DFFA 1FC3A 3OYDA 2ISYA 3JSOA 2IP2A 2E1NA 4I99C 1T2KA 5HODA 1Z6RA 1HW5A 3DEUA 2IGKA 3JTHA 3RYRA 5C44J 3PQJA 3PSIA 3UKGA 3E6DA 2QZ8A 1UELB 2EZLA 1VQ8I 3A2KA 1KONA 2JVHA 1IXRC 2KZGA 2VQCA 2CQXA 3DKXA 4II2A 4PDKA 3ZQGA 2VC1A 2KJBA 3NQOA 4ESJA 3Q0UA 4ON0A 3C18A 4EM0B 3K70C 3HXLA 5E3OA 4XLAA 2K4JA 3OR2C 2XF6A 4XKVA 5D5XB 1TL8A 3HGYA 2IGMA 3RPUD 1G59A 5IY5H 3OSGA 3FISA 1MW7A 1YITI 5JFRA 2WAFA 5IT9K 2PBIA 2H6BA 1YG2A 4AIDA 3T0YA 3BR2A 1XCBA 4IX7A 4UNOA 2X1EA 2MABA 3BPXA 1O57A 3KX2A 4Y15A 4QSHA 4YEJA 2HPMA 1LB2A 2LLKA 3KP7A 4BQNA 4BJ6C 4UB8C 2E35A 3QU3A 2NVXJ 2XPUA 1MKMA 2A6EF 2G0EA 3P5JA 4E4HA 3TO7A 3S2DJ 4XLPF 5H6RA 2LBFA 1KGSA 3FXLA 3J81K 4L9TA 1K83J 3ML6A 1JUPA 2XF5A 3K4JA 2DDBA 3ABLH 3I4PA 1FTZA 1HW1A 1MMGA 5CVVA 4A12A 1IRFA 1FOXA 3DKWA 3JSPA 4UXNA 3L1PA 4G6TB 2MYSA 1ZAOA 2KRFA 1BI0A 2ESNA 3S1RJ 1S7AA 2HDWA 2YU9J 2PJPA 1IAWA 1R7JA 3HOWJ 1XCVA 1HOMA 2PN6A 5FKMA 2R0QC 2OV7A 2IXSA 1JGGA 4L9VA 5DCMA 1VQLI 2P6TA 2Y31A 2M5WA 3QRFF 2VOOA 4OINF 4U0WA 3VPRA 4B09A 5D8LB 5D5WB 2WBMA 3GFMA 2NOJB 3V7CA 1RNLA 2PLYA 4XLFA 3QPTA 3VWBA 4NUBA 3BR6A 2V4JC 3BDDA 1OR7C 4CYCB 4IQJA 2LF7A 3CUOA 2Z99A 3CF2A 2JZYA 2VBYA 3QPHA 2WA0A 3QYBA 2GA1A 2ISZA 3CDIA 3JRGA 2E19A 2VT3A 4C2TA 3H3VK 2X6WA 3M1CA 1ZREA 4NC7A 3OR1C 1RI7A 1MMNA 1STZA 3CO7C 2IRFG 3CC2I 2OC6A 3AKZA 1FYMA 5L3EA 2EINH 3BCBA 5A2QK 1W7PA 4BU2A 4ASNA 9ANTA 2LY9A 1FPQA 5KAIC 3U9GA 3CMEI 3NAUA 2V9PA 3ECHA 4PJ0C 3I59A 3ZMUA 3EPZA 1U6GA 3H5AA 3E3VA 2B63J 3JRHA 3S8PA 4ZTJA 2HR3A 3RKWA 2LOOA 2FF4A 4XQFA 2LREA 5E1WA 2XGEA 3TDZC 2X1DA 1ZGWA 2RNJA 2CUEA 2R5ZB 2WAQN 2ZB9A 3OS1A 3R6SA 1Z77A 2NVUB 3GTGJ 1TNSA 3FF5A 3LFKA 2VJ5A 2L0KA 1MDMB 4R1HA 1YE9A 4U7BA 4B4CA 2MC3A 3BR1A 4XLCA 2STWA 5FGMA 3C1DA 3GO5A 2DXIA 3GFLA 4FHTA 2JUGA 1WI3A 2ZJRF 2NNYA 2KHMA 1EKEA 2ZSHB 2ETHA 3S2WA 3B02A 4HF0A 4M9XA 1ZN2A 1DPUA 1MMSA 1PUFA 2X6YA 5J3LA 1IGNA 4RB0A 1XS9A 4U0VA 4BEHA 4E70A 3GMEA 4QPQA 1LKXA 3ZXSA 1T0FC 4PGHA 3K2ZA 4F91B 1VQPI 3M7GA 4QWQA 5M5WJ 4AVPA 2WC2A 1YQAA 1S3JA 4BH9A 1D1BA 1YI2I 4D0PA 3CCSI 1T6SA 1Z7UA 3M8FA 3GWZA 4XSXF 1OISA 2HZDA 4HV5A 4XIDA 3S1QJ 2K9QA 4BY1J 1BN5A 5IOYA 4NNJA 2P7VB 4UUTA 5K5RA 5FKOA 2HI3A 3BG5A 3OYBA 1XSXA 2DYSH 3S2HJ 3W2AA 2JJ7A 1J2XA 1B59A 3BG9A 2DAOA 2F4MB 2X9DA 5BMZA 1XSDA 3FX3A 4RM2A 1YLFA 2XRLA 1JUSA 2KZVA 3F3XA 1JKPC 4LGWA 2QLZA 3F6VA 1I6HJ 4F3QA 3KP2A 2O7OA 4LG0A 4HSRA 4IQ4A 1T8IA 4EM2A 4G7ZF 4E7SA 2HYGD 4EJUA 2ELHA 4G7HF 2DPUA 2NRAC 3K0LA 1R4NB 2EK5A 3VEPA 3CJRB 2D1VA 2F4IA 3HG9A 4BKXA 4WXDA 4BDYA 4H4KC 3CCEI 3AG2H 3JRFA 3BJOA 4HZFA 3OYAA 1X1DA 4CICA 2ZJPF 1Z1DA 1PP8F 4ETSA 1D8KA 1BIAA 1GHCA 2CW0F 4Q48A 3BZKA 5ILUA 2DQLA 1G4DA 1HLVA 1VQNI 2QM3A 4HF1A 1G2HA 4CHUA 1CGPA 1MBJA 1W1WE 3G71I 3IV5A 2E7WA 4P5OA 2BV6A 2DMPA 1VFCA 1W36C 2NAZA 2WTEA 3CUQA 1XN7A 1MNEA 5IP9J 1RC9A 3IP4B 2XB5A 4I98B 2LP0A 3HB9A 4IF4A 5DTDA 1APLC 2DU9A 2EV6A 5KK1A 2MH2A 1TNTA 3GEZA 4HDVA 4RLFA 2NVYJ 3HZJA 3M4OJ 1BJAA 2V1XA 3AG1H 3MN2A 3CO6C 3IL2A 1VF9A 1X3UA 1VQ9I 4A93J 4N9HA 3F72A 3PUBA 5H6QA 3W3CA 4YELA 1BJZA 2KJCA 2ELJA 1IN5A 1WI9A 5K5QA 4ZC3A 4LB6B 3W2VA 3W6JB 3ABMH 3WTZA 2L7FP 3T8RA 3VSKA 1NK2P 3FXMA 1S29A 5K7ZA 2HPIA 3K4KA 4HSTA 4F93B 1JKRC 4FX4A 4XK4A 3LQQA 4ZDLA 3VOEA 4MLOA 4ZH4F 1J59A 2XAFA 2JVGA 4ESBA 1SVLA 5EJCA 3HOSA 1SANA 2CJJA 3D1NI 2M1BA 1ZGAA 3G1OA 3OIPA 5ICFA 4EQQA 1LFUP 4GXOA 3WHBA 1EF4A 3E6CC 4XLNF 2DOEA 3M8JA 3LSRA 3FM3A 5LEJA 4ENMA 2QBYB 1B72A 2DI3A 3VODA 2ID3A 4E7KA 5LGTA 4MFEA 3DTKA 4B1RA 2K5CA 3ISPA 4XKBA 2VT2A 2CQKA 2LRDA 5CVJA 2DK5A 2Y9ZA 2V6EA 1TP4A 3N05A 2IVMA 1W4MA 4XICA 1ZRCA 5TJJA 5E8GA 2DYRH 4RB3C 4QPOA 1FTTA 3BZ6A 1RPWA 2EFOA 2EIJH 3HJEA 4PFOA 4IEJA 2DO7A 4IO9F 4OOIA 4C9YA 5KAFC 2VPRA 2JPCA 4WF2A 4LITA 2G9WA 4IHWA 3ZN0A 3QWLA 2CV0A 5DM6F 3F22A 1ZRDA 3HUGB 1R58A 3GYHX 2OF7A 4ANJA 3K4NA 2LKSA 2XPVA 3FIWA 4LLGF 1YTYA 1DDNA 2HNHA 4XKCA 1TZLA 3I71A 2IPQX 4AYBN 4WX9A 2VJIA 1WJ5A 3FDYA 3WU2C 1OQYA 5GTIC 1R5ID 2CUJA 4BHPA 4I2OA 1IDYA 1YJ9I 2IA0A 5BNGA 3JR9A 4F92B 1RR8C 1D0XA 4RB1A 5EEHA 1VQ7I 1IV6A 3HSEA 3E97A 5IT9Z 1JXSA 4AWXB 2K3FA 4HPQA 4RS8A 1P7JA 3M07A 1FOWA 2L9SA 4XOTA 3KE2A 1BOBA 1ULYA 2DCEA 2NOGA 2VI6A 3D5RC 2LSOA 4KMUX 3Q0WA 1HQCA 3T8TA 1JGSA 1D5VA 5CVRA 4E6KG 4EMSA 5M3MJ 3FMRA 3FBNB 2K02A 5FD5A 2OZ6A 3NWSA 4CSWA 3LAJA 5BPDA 4YFXF 3U21A 2ID6A 2KIQA 2XPWA 2OU2A 2M7AA 4OAZA 4X1EA 3WU1B 2M8EA 5J1RA 1W5SA 2BHYA 3LSKA 4IOCF 1E3HA 5D5VB 2EIMH 1R00A 1LJ9A 1BOAA 3MFKA 2LK2A 3RKQA 2YR2A 3BG3A 1OCRH 4AIJA 3RKYA 3H0GJ 3ZQFA 4BBRJ 1EV7A 3GW2A 3X2QH 2UWMA 3J7ZI 1RZ4A 4BNCA 1Z67A 2XAJA 2GXGA 3R4KA 4YIIA 2BVLA 2DN0A 1LE8A 3FHZA 1IN4A 2ICWG 1SEUA 4AU7A 2RAEA 4TV7A 2W82A 3I0TA 3MZHA 2R92J 1QHGA 1U0JA 3CC7I 4JK1X 3GTOJ 1LFPA 1DP3A 2ZMEB 2JTVA 2Q2EA 1ZG1A 3A0BC 1SD5A 2RGVA 2D2WA 2HVQA 3W6KB 1GVDA 1MBKA 2VBZA 2V26A 4ABZA 4HQEA 1YFHA 5DD8A 1MMDA 1PDNC 2K40A 5CLSA 4A3MJ 5E3LA 5E1ZB 1P2FA 3OYJA 1U78A 3DV8A 4EJWA 5A2QZ 4IHSA 2OPTA 1G6NA 3DFGA 5GTHC 1WHUA 2BY0A 1N25A 1ETKA 3RZDJ 4BE0A 5JVGF 5M5XJ 4BJ5C 1WFXA 1YX5A 5IYCJ 3ASOH 1D1CA 3OV8A 4PJLA 4U7DA 1MD0A 4UUSB 4IRIA 2JRTA 4M73A 3P9CA 3P9IA 3L00A 4RGXA 3PQKA 1IV8A 1MBEA 2EILH 3EQLF 1JKQC 3F8BA 3MEXA 3N4MA 3H36A 5D4SA 5HS7A 5L3GA 5IYDJ 2R7XA 3V7RA 3MWMA 2M4KA 3BQYA 3KCCA 4S0HB 1Q1VA 5L3FA 4DIQA 2O5RA 4LFUA 3TP3A 1H0MA 3WTSC 2QYOA 5M3FJ 4CCKA 1A36A 2E5NA 3OIOA 2XRNA 4S05A 1SD4A 4M3BA 5EG0B 1PP7U 1HCRA 5GAEJ 1BC8C 2A5WA 2DK8A 4KDPA 3IAM2 3BZCA 2GXBA 1SFOJ 2L54A 4RAFA 2XSDC 2W84A 3WE2A 2K9NA 3K1PA 2VOPA 4XRSG 1ZKGA 2KFDA 1W0TA 3DP7A 4LD5A 3H9QA 2W24A 2EV5A 3OWTA 3M8EA 4ZZDA 4QTRA 1SMYF 1YYVA 4G9YA 3SDBA 4MO7A 5B1AH 1IRZA 5HOOA 1ZR4A 4MFDA 2ZC2A 1VTNC 2GQQA 2IBDA 3QP5A 5JLXA 2V1UA 1ONVA 3KP5A 3MAJA 2DT6A 4C30A 1R4MB 1YO5C 2KL4A 4V19K 1VI0A 1QQIA 4OMYA 1GLNA 2BYVE 3S32A 4XR6A 2N8GA 5AIQA 4CYCA 3H0DA 3E6BA 1A6QA 2XKOA 4MHGA 3K2AA 2FNPA 2HZTA 1LPQA 1QA6A 3AG3H 2ESHA 4YFNF 4F7ZA 4B8XA 3A02A 3H35A 4KITB 1Z7LA 2Y30A 5EYRA 1R22A 1TQMA 3R0AA 4ZYGA 1PVEA 3U1DA 3RQIA 3WGHA 4FTHA 4LLLA 1AKHA 5J4VA 3A01A 5LRRA 3KZZA 4M9SA 5LFAA 3OL3A 1I3AA 3S1MJ 4HQMA 4AM3A 1XGOA 2LTPA 4II3A 4Q5SF 2UV1A 4ZYAA 2X85A 3RPUA 2K86A 3EDPA 2BXZA 1B8IB 4BAYA 3OYIA 4J19A 3FK7A 1GXPA 2CU7A 1XG1A 3IH4A 4MQ9F 5F04A 3BTJA 2LF8A 2ZNZA 4B48A 5C4XJ 4WWCA 1ZK8A 2Y0SA 1WH5A 2ZXHA 2A3SA 2R5ZA 1OCZH 2DJIA 2NS0A 3BPVA 3REOA 4BXUA 2WAQA 5TRDA 4A3LJ 4PSWA 1VZ0A 1NG6A 5FFXA 4KMFA 2H09A 2R7RA 3MZYA 4R79A 3COAC 4JX6A 2ZXWH 1FP1D 2DA4A 2GAUA 1R9TJ 1MDMA 3RIRA 4M6YA 5DD4A 2WAEA 1KYWA 2LYCA 2TCTA 1H9GA 1LEAA 2QWWA 3Q9VA 3Q9SA 3HRSA 4DNCA 5LLQA 1TT0A 1REPC 3F8NA 3B73A 3D5LA 3CESA 4XL9A 4E7JA 3IH3A 3OOUA 1Z3YA 1EH7A 1OCPA 1QPIA 1SFUA 4XN0A 2LKPA 3SZTA 4UHTA 2CQ7A 2R7QA 5B1BH 4L5JA 5B66C 5FFZA 3W6VA 3ESWB 2LR8A 2O9LA 3JW4A 1LVKA 3F6OA 4RGRA 3OSFA 3OYHA 4XN3A 1WJEA 4XOPA 1MNMC 4BGDA 2FQ4A 3DKYA 4Q47A 1SFEA 2XGXA 1G8XA 2PG4A 2DMUA 5EF6A 4KN4X 5HDNA 2PQ8A 3CCVI 3H3ZA 2X6XA 1G3TA 2G7HA 3BTCA 5CYVA 4F55A 4E7HA 1WJDA 2M4GA 5E17F 2V9KA 1BI3A 3EYYA 4FISA 2A61A 1MJAA 1RKTA 2PMUA 2IS1A 1QVTA 3PL8A 4A2UA 3FXKA 4YRVA 3K69A 5EGOB 2J5PA 1BI1A 3F8FA 2QKLB 4A5MA 3OYFA 1O3QA 2Y75A 2JPBA 1ZLKA 4PJJA 1JHFA 3H9GA 4YIRX 5K7HA 3DU5A 5DDGA 1W36D 4IHXA 1EH6A 4P9UA 3ZMZA 2CSOA 3CDLA 4KNYA 3TO6A 4NC6A 3E5QA 2UXNA 1N78A 3HEFA 1CF7A 1B9NA 3WTVC 5FKLA 2HQ5A 1SVOA 3I54A 3NWTA 1JT6A 1F5TA 2E34A 2OUMA 5DV5A 4PUSA 4PJMA 2L4MA 4A3IJ 4RAGA 1W5TA 3TBIA 3CCJI 2COBA 1ZQ3P 3HPHA 1J75A 4AIHA 1O7LA 5JHUA 1MBHA 3M9AA 5IPAA 3CCLI 2W00A 1KA8A 4NQWA 1S6LA 4AVZA 2JMWA 1JI8A 3QODA 3JRBA 3EUHA 5GAGJ 3LNQA 2MGQA 4KA4A 3BTLA 1IZ1A 5BQTA 1K78A 1TWFJ 2HVRA 3H3UA 3K7AJ 1V55H 3L09A 3LMMA 1LQ1A 3I5UA 1MIJA 5GAHJ 2P0WA 1BR4A 1HKSA 4B44A 5LHHA 1WQ2A 5FJ8J 1F36A 2GIZA 5LGNA 2CG4A 2HEOA 3S1NJ 3K4BA 3GX4X 1X1CA 5JVTA 2Y9YA 2Q8KA 3LSHA 1U5TC 5JLWA 1S7EA 3ZGKA 3HKZA 2D45A 4KISA 1ETQA 3G73A 2R7TA 2EFWA 4M71A 1YJWI 1RESA 3GTMJ 4DBQA 1BI2A 2DQRA 1DU6A 2XGDA 3WHCA 3L9FA 1JKOC 2DFHA 1YRNB 1FSHA 1JJ6C 2MD5A 2VPLA 2FA5A 2LMDA 3PSFA 3R60A 4RBOA 3RSNA 4Z6YA 1OYYA 1UCRA 3CP8A 3JAMK 1D8JA 1ON2A 3U2RA 4PK4A 1Y56A 2NYXA 3MMYB 2JA7J 2HVSA 2EJRA 5GPCA 3S3NA 3DEEA 1WJCA 3QU6A 4FT8A 5IT3A 3KPHA 2VBWA 2QSFX 1AOYA 1DGRM 1FLIA 3GTKJ 3Q0VA 2Z9OA 4IHTA 2XHKA 5GPAA 2QBYA 1JT0A 4OIQF 5LGUA 2H94A 1L0OC 2RREA 4LK0F 1FIPA 1TBXA 2PFBA 4Y13A 2L9NA 3FXUA 3RPQA 2M45A 5AIPA 4I02A 1BA5A 4G94A 3GTQJ 2F5CA 4L0ZB 1USSA 4LJZF 4E7ZA 3ZCOA 1A31A 3DPTA 3GXOA 1UFMA 2AO9A 4XM3A 4EJVA 4AIKA 2R7WA 3JRIA 3L2CA 3LWFA 1BBYA 2E1MC 4ZYHA 2XROA 2QQAA 5CJ9A 3OYLA 3J7YJ 1ENHA 2X48A 2DJNA 4UV9A 2LBFB 4Y17A 4XBFA 5FB2A 3PNYA 1P92A 2HGCA 2RQPA 3HUGA 1OCOH 3V8KA 1O4XA 2P4WA 2Z2SB 3I9V2 3KP6A 5EZGA 2VUMJ 4BBSJ 3FXOA 4I0BA 1J7KA 2ZNYA 3BTIA 5E79C 2K9MA 3LQRA 1I39A 3S3MA 1X4PA 1OCCH 2HOAA 2IEKA 3SYTA 1Y8RB 2DODA 1R49A 3BR0A 2W4SA 1XD7A 3F23A 1YS7A 5DCMB 4HG2A 3KLOA 2XASA 1WKMA 3K1NA 2R7VA 3CZ6A 2R4GA 1MBFA 3AG4H 4ESFA 1X1PA 4BXXJ 3O8HA 3L7WA 1BR2A 1TWCJ 4GGGA 5HVQC 2QUFA 4U0YA 4XSZF 3PIPF 1Z05A 2DA6A 2DFIA 2GOXB 1EJ9A 2D1HA 3BG7A 2MA3A 2H27A 4JBAA 2F5DA 3GZ5A 2VQGA 4LMYA 3HRMA 3FXQA 5FO5A 4GDFA 1QO0D 2Y2ZA 1VQOI 2BOLA 1Y0UA 3GUDA 2CQNA 4HAMA 3WGIA 3S16J 2YUSA 1FMVA 4CCJA 2P5VA 4KFCA 2EFPA 2XAGA 4KICA 4BQAA 4KT5C 2C6YA 3I3LA 2HTSA 5D4RA 4ZYDA 1BIBA 1SMTA 3BCAA 1QGPA 3CMAI 4XLHA 3DF8A 1P6RA 2MLKA 2FBIA 1ACIA 4Y52J 3K9TA 2NS7A 3CLQA 3HPGA 4OAYA 2M8GX 3I59B 1DPRA 2R5YB 2R3SA 1ZH5A 4XORA 2NNNA 3GLXA 2O03A 2JWTA 4Y3OA 2ECBA 4GYGA 1KQ9A 1U2WA 1UHWA 1X1BA 4KIBA 1MH4A 3TKYA 3JTGA 2IT0A 4RB2C 2KQRA 3MCZA 4GO1A 4UY8I 4L9NA 1JTXA 2IA1A 5JHFA 2K4BA 3G3ZA 3QYEA 4RDUA 2P5KA 2ZMEA 4JOMA 5F1JA 5IP6A 2MLGA 3ZR8X 5KHDA 3DTEA 3AAFA 1UHSA 1WZ2A 3ELKA 2E71A 2FUG2 3I56I 1OMIA 1FSEA 4HX7A 2KRHA 2V1DA 3ABTA 2EFQA 3IWZA 4UVAA 5EDNA 4EGZA 4DJAA 2CV2A 2FX0A 1G3WA 4PCQA 3I53A 4XMYA 1WPKA 1I1GA 1ODDA 3KLNA 1HC8A 3LAPA 2DT7B 2WWYA 2IAIA 2JSPA 2GOMA 3PO3J 1TWHJ 3RKXA 4CYDA 2EH3A 2Q0OA 5J8FA 2OJED 4KJZA 1SAXA 3HOUJ 2JA6J 3ZQHA 2P7CB 1OCTC 1D5YA 1O3SA 2LNBA 1Y6IA 1E3OC 4MGRA 2EA2A 4JX4A 1IJWC 4A3GJ 1VQMI 1OYIA 2ZJQF 4LIVA 2H8WA 2CFXA 4B3XA 4WXCA 2KIUA 4RGUA 3AFHA 2BGCA 1XGNA 3DPLC 1FJLA 5J6XA 2IS2A 2V79A 1ZG5A 1P9QC 1T95A 1Z3XA 2QENA 1K78B 1L3LA 3GTLJ 2LH9A 4L5IA 1TWGJ 1XTAA 3GZ6A 1H88C 3CP2A 1XSVA 1K79A 3KEQA 5E3MA 1D3YA 3SFIA 1BC7C 5D6FA 2KT0A 1GDTA 4N4NB 1V5GA 1KU2A 4LG0B 2XUBA 4HV6A 4N0BA 3O2PE 2IA2A 4RMNA 2YS9A 4X0GA 2BW3A 5F08A 3VYUB 1JHHA 4YFKF 2VBXA 1HKQA 4A6EA 1V5EA 1IXCA 2LY1A 3OYCA 3I4MJ 3QP6A 1U9OA 2OCCH 1WRJA 2I8DA 1SFXA 4I0AA 2M7BA 1ETVA 5F0CA 5HDGA 3RTRA 5HS9A 3MD2A 3J81Z 2BBYA 4LK1F 3F21A 3C3WA 2WV1A 3K4LA 3E5UA 4BYYA 2EA4A 4ZDPA 4ZJZA 5E3NA 1NHAA 2FOKA 4P9FA 1R1VA 2L01A 5D5UB 1H89C 1YJNI 1AHDP 2UXXA 4G6QA 2GA2A 1PYVA 4W1UA 2Z33A 1RR7A 3LFUA 5E20A 2OQRA 4QIWN 1HKTA 4CZZA 3MKZA 3TEDA 4OIOF 2XGCA 4GYIA 3CUQB 2X0LA 2L7MP 2FEZA 2VB6A 4BL0B 2L7ZA 4Q4ZF 1SD6A 2WB1N 1ORKA 2R7DA 2FRHA 2XAQA 1I3QJ 3FK6A 2BY2A 3CTAA 4EATA 5DS9A 1FP2A 5K1YA 1YW8A 1M1EB 3K70D 2DA3A 3KZIC 2HQNA 4V2FA 4UVBA 3VYRB 3HSFA 1B8IA 2F48A 2EQRA 2HOEA 2KRCA 3JREA 1IN6A 2B7EA 4PZJA 2QF7A 4D5FA 1B9MA 2DT5A 2R7FA 2Z3YA 4K2EA 3H92A 5CQGA 3E5XA 5ICGA 3GTPJ 4Y4RA 2GM4A 1R36A 2DA1A 4GFBA 2FBKA 4PJNA 1TW2A 1MJ9A 5L3BA 3DTIA 3KFWX 4Z2YA 2RV8A 3JCUC 1FMWA 2BZTA 2OA4A 2V7FA 1BL0A 1DP7P 1QU3A 4RAZA 1XDUA 2CS3A 5TISC 4RAYA 2I5UA 3MKYB 3HL2A 4CCOA 2JQ7A 3SXYA 3LA3A 5DUIA 1OR7A 2EWNA 2VJ4A 3FMSA 1K61A 2FMLA 3PNVA 4P55A 1X3WB 3CMMA 2ADUA 1WWXA 1JUMA 5D6EA 1TW3A 1Z6TA 4IXAA 4M3DA 4RA2A 4RGSA 2UUZA 1T08B 2CFOA 3ONQA 5HNFA 2BHZA 2ZO4A 3FKJA 3WG7H 1ZGJA 3PM1A 4B43A 4LOCA 5L3CA 1LDKB 1HSTA 5FD6A 4IPAA 4UUVA 3FZVA 4HYEA 4A3FJ 4DOZA 1O3TA 2JA8J 3D0SA 3ULQB 2XAUA 2QVOA 4Y7NJ 2DMNA 1OYWA 2KDZA 3OS0A 2FE3A 2HXIA 3HTSB 3CUQC 2BEOA 2JK3A 4LB5A 5B3SH 4J00A 3G2BA 4BY7J 4A0XA 1F43A 3SHFA 2RN7A 1YW9A 3BC8A 2FU4A 3BOQA 1Z91A 4ZZLA 3OYGA 3DBHB 1T39A 4C3JJ 1RIOH 3HC7A 1LDJA 3HOZJ 3KETA 2VASA 4XRFA 3RI4A 4JX5A 3E7LA 4ITVA 5EGOA 5ERIA 3F8CA 3TQNA 4I01A 5CQEA 4DYRA 1A6IA 3ZQ7A 1IN7A 4EV0A 1TLHB 3MKWB 2GZWA 1HDPA 2MFZA 1Y8QB 5M5YJ 4MIMA 2KISA 1O3RA 1H8AC 1PJRA 2CO5A 1OFCX 4NB5A 1WVRA 1RUOA 1GXQA 2KP6A 3LA2A 2PEXA 2FOWA 3HRTA 4P96A 4S04A 3ZRGA 1QNTA 1UJ8A 3R61A 2DA7A 3Q3SA 3OMYA 3PJRA 3EETA 3V7SA 3CCQI 3C2GA 4EEFG 1VNDA 2M0MA 1RKWA 2PJRB 4UB6C 3HDDA 4FE4A 2H1LA 3HHHA 4Y33A 1QRYA 1KU3A 1FX7A 4D9JA 3ECOA 1T0FA 3L2RA 3QQAA 3J80K 1ZHFA 3S93A 4CH7A 3WTXC 2Y0MA 2X51A 4HBLA 2FXAA 3GFJA 2XC7A 3RDIA 4A5NA 4M6XA 5CKTA 4A0ZA 3ROUA 3FWEA 4CGZA 4A3DJ 1Y0NA 1GV5A 2YX4A 3H1CA 4B3AA 3HBLA 1I1SA 1TTYA 1F4KA 4IL6C 2XV4S 2NXNB 2EPFA 1T98A 1FBQA 2AS5F 2NVQJ 3F0CA 1IG7A 3CCRI 2DOAA 4AC0A 4BQQA 2XB0X 2DMQA 2L4AA 5LD2C 1R1UA 2K9SA 2AXLA 5L3DA 2W1OA 4M6VA 3V42A 1I50J 1S5LC 4HW0A 1MGTA 2LKXA 2QGUA 4OMZA 4KYWA 5E8IA 1IN8A 2HFHA 3RCOA 2HDCA 3K1MA 3HOVJ 4QLCU 2LVSA 3HM5A 3BROA 4OWRB 5K7FA 3DCFA 4DYQA 1OJLA 5J1YA 2PMZN 3KYDB 2XSJC 5CVIA 3KZYA 4CA0A 4E7LA 2R93J 1YRNA 5F6FA 3CD6I 4M3GA 3IRQA 2Q2EB 4J01A 2F5EA 1IF1A 2L2OA 5LRSA 2A5YB 1HW2A 1N77A 3KEYA 4XRSA 3DBRB 1WCMJ 2LDUA 2VN2A 1E3PA 3I55I 4L0YB 4A3BJ 1HA8A 3BG6A 3E1SA 3WGGA 3RZOJ 2KPMA 2CGPA 3VDXA 3AL0C 2VJJA 3V8JA 3A0HC 2PX9A 4FETA 3LSGA 1QZYA 4BS9A 4DZPA 4AUXA 2OQGA 4ZTFA 2M87A 4IZZA 2GXAA 2ME6A 2A07F 3B6CA 3KP3A 3FKIJ 2VQHA 5TGTA 3NEUA 2HDDA 1RUNA 2HOSA 1X58A 2VKHA 1E17A 2CRGA 2PI0A 3I64A 2R7SA 2QCOA 4RM3A 2A69F 5J40A 2RQQA 4HNVA 3W2WA 4HDUA 2Z16A 1QZZA 2HU9A 2L3DA 2M3AA 4BHBA 5ICEA 3JRCA 5FROA 2JSCA 5J47A 4YIFA 1GUUA 2H8RA 3LSTA 3QOEA 4DGWB 5FRNA 1U5TB 3ZOBA 1R5GA 4RLQA 4WXHA 2A05A 4EJTA 4U87A 5J4YA 2NS8A 1K6OA 4I7HA 3BT9A 4C3HJ 2NVTJ 1S72I 2ZXJA 3T5XA 1XMKA 2W7NA 3BR3A 3DXJF 4IRHA 4DBRA 3PFIA 3Q5FA 4FCYA 3G1LA 2VQLA 4NBQA 2DTRA 3IKTA 1FBSA 2FNAA 1YW7A 4A3EJ 3VSLA 2VXZA 4D1QA 3KP4A 3BR5A 2KKOA 3BP8A 3OOPA 4O5VA 2VXDA 5ILVA 2VIXA 3KIOA 2JA2A 3DWLE 3SEQA 4HX8A 4HEA2 1MH3A 2F2EA 2V6CA 3ZMDA 4DW6A 5HLTA 3E6MA 2OZUA 3D5SC 3OYNA 1KQ0A 2COMA 1UG0A 2TDXA 3O3KA 4OIPF 4CXFA 3L2WA 1MJBA 1UB9A 1SC7A 1WH7A 2RNGA 2E7XA 1FY7A 3OL4A 2DA5A 1AU7A 3ZQCA 2RC4A 3G1MA 2YX7A 3GCMA 1C0WA 4KT6A 5ILSA 3K10A 2EIKH 5BPIA 5ED4A 4G6DA 3OYMA 2CWEA 2Z5UA 4F52A 2DA2A 2E1OA 3IKVA 3HRUA 3OY9A 1X1AA 2QSHX 1J9IA 3O8GA 4AD9A 5HDKA 3G4SI 2ACJA 2Z1DA 3EUAA 3SFZA 2E1MB 2AQFA 2J5OA 3G6EI 4EGYA 5F0FA 2MD0A 2JN6A 1ETXA 1NG7A 3WODF 2IJLA 1IRXA 1B6AA 1QVUA 1I6XA 1XMXA 5C4JJ 2VE9A 1V5FA 1HDDC 1SD7A 3FMQA 4DYCA 1QPMA 2CYYA 1AKHB 2Q1ZB 3A01B 1V3FA 3TGNA 5JR3A 3CC4I 1Y1WJ 3GLLA 1WGXA 3SEZA 1G3YA 4CCMA 3TDUC 5D8KB 4BACA 1W5CC 1ZARA 2R5YA 3RJPA 3E0JB 1Y39A 3HSRA 3H5RA 4C2UA 2HYFA 2IGOA 3HIFA 3CCUI 2RKHA 2Y0SN 2W85A 2YU3A 2VLAA 4IHVA 4FQGA 3BJ6A 4PFPA 5FLXK 1U8BA 2K9LA 3WG9A 3SQNA 1R23A 4HNTA 1AWCA 3TL4X 1D0YA 2HS5A 4LIUA 4BQOA 1HF0A 1I27A 5DEQA 5IYBJ 2R7UA 4CCLA 1WJBA 1IRGA 2R7ZJ 2ME0A 3LA7A 1AA7A 3SZGA 1LNWA 4OU0A 2A6HF 2HYJA 4UVCA 4X6AJ 1W7PD 2LG4A 2K85A 3PUFA 4PSXA 2LC2A 2IW5A 4DQ2A 3TOBA 4ZYEA 3LSIA 1MBGA 2VKVA 3L2UA 3S17J 2Y48A 4G12A 4HA8A 1PUEE 2VKEA 2K27A 3H9JA 4D5CA 5F1RA 2V9VA 3O6BB 4XRMA 1ON1A 2ZFUA 3MZ8A 4M9ZA 4BUPA 1RRJA 2E2IJ 3LSJA 4BE1A 2KIFA 2HTJA 1LDDA 4W97A 2X6OA 3ZP5A 4L5EA 2E2HJ 3MKLA 2DW4A 4CCNA 4BHCA 2AXTC 3ASNH 2L9VA 4A6DA 2QKMB 2GWRA 3HOTA 2EB7A 3P7NA 5IOZA 1TQIA 2XAHA 3TO9A 2X1CA 4HF2A 4IOAF 2FD5A 4ENNA 5DUKA 1XGSA 3CJNA 3QPLA 5F27A 3BWGA 4JP0A 2DPDA 1SVMA 2H1KA 1IW7F 2VONA 2MSYA 1UZCA 2WADA 1YIJI 1FOKA 3IC7A 1JE8A 4EVIA 1K4SA 2DOFA 1V54H 2DTZA 4AYBA 5HS8A 1LFBA 4MEXF 1YIOA 1KU7A 4M72A 3LOCA 2M9HA 3BQZA 4GRIA 5BOXA 3TMOA 1T33A 4KIGA 1HXDA 1U3EM 2YSRA 2CUZA 2HWVA 2GIVA 1X19A 1CF7B 2MBFA 4WK8F 2IGNA 3L2QA 3M1EA 1K4TA 3ZMSA 5B5EC 4CO8A 5F64A 5BS6A 1Z9CA 2LD5A 1EA3A 3VYSB 3CJQB 4I6ZA 3PNTA 3OYKA 4MTDA 1XX5A 2EBIA 4MNUA 1OKRA 1IDZA 3VB2A 2E60A 2O8XA 1U9NA 1IUYA 4O3MA 1X2MA 3IH2A 1NTCA 2QQ9A 1D0ZA 2EZIA 1TQPA 1ZG3A 2A68F 2GBYA 4PGGA 1HSJA 3PIOF 4HNUA 3TP0A 4NQWB 5JI6A 3WE3A 1P4WA 1FOYA 2AQEA 3FBIB 1G3SA 2BE5F 3C2BA 3KYLA 2XDVA 4NHJA 1W7PB 3QYFA 3H5NA 1TC3C 1MSFC 5LBQA 4A3JJ
chains in the Genus database with same CATH topology
1LEBA 2ZKZA 3GF2A 3ZN1A 1J5YA 2OAZA 3I58A 4YG2F 4IRGA 1XB4A 2STTA 4GCVA 5CVUA 3QOPA 4ENKA 4R8HA 2FMYA 2VE8A 4JQFA 3J80Z 2P8TA 1U8RA 3CDHA 2G7UA 3FM5A 1UHMA 1XGMA 4OIRF 1IXSB 2OD5A 5KVRA 5DCFA 2ZBKA 4ENJA 2X4HA 3R0JA 2DBBA 1H9TA 3CLOA 1J0RA 1ZLJA 6PAXA 3HYIA 3MQ0A 4U88A 3RYPA 2XVCA 2WV0A 3KEOA 4L18B 4UV8A 3C7JA 3IRRA 2XKPA 2HKXA 3V8LA 1S8NA 4KN7X 5LHGA 1DUXC 3QAHA 2YPRA 4M74A 4IVNA 1KU9A 5HLIA 3GVAA 2EFNA 1KQ8A 1GVJA 2HKOA 4MQVA 5E1XA 4I09A 1T38A 4O6JA 3VFZA 4MEYF 5E18F 3BY6A 3HTUA 3ERED 5AONA 2OBPA 4G8XA 2FBHA 2E1CA 1XDSA 3IHUA 1Q1HA 1QBJA 2VC0A 1R5HA 2O3FA 2B0LA 1XMAA 2EV0A 2FQ3A 2W57A 5LHIA 1USTA 1FT9A 2L02A 3BJAA 4HLXA 1V4RA 4EM1A 2VODA 1EH8A 1LVAA 1R1TA 4A0YA 1E2XA 3WTYC 1KYZA 4L9JA 3TOAA 2W25A 4H0EA 4WCGA 5J8CA 4HOBA 3FXRA 5LEKA 3N97A 2FSWA 2O0YA 1O7FA 2MH9A 2XIGA 1S7OA 2M30A 2ZJ2A 3WTUC 3NRVA 4EJOA 5HLGA 3WU0A 5K5OA 1OPCA 1P4AA 4HX4A 3ABUA 1FYKA 2P6SA 1K7AA 1WSUA 1P4XA 2H6CA 1A04A 4KIFA 4MTEA 4IJAA 3JAMZ 5FLXZ 2O6GE 1U5TA 3J7AO 3V4GA 2JT1A 3GFIA 2RDPA 1FBUA 1FWZA 2P5LC 2PMHA 1B1BA 2HQRA 3WTWC 4LLNA 2RVCA 5HLHA 4G7OF 4FX0A 3ZMTA 4KUMA 3EYIA 3WTTC 2F5FA 1YS6A 1ZRFA 4CDGA 4HLYA 1BM9A 1B4AA 3T1BA 1MZBA 3P9KA 4N9IA 1FNNA 1F1ZA 2QQBA 3DQVC 5DYMA 1F9NA 1FYLA 2O61A 2KIMA 2K7LA 5H20A 1HBXG 2ZCWA 3F8MA 3SZPA 5EEGA 5ICCA 2ZFWA 3IWFA 2DLLA 3ZPLA 3ZMVA 3HHGA 1FZPB 2UZKA 1ZYRF 1I5ZA 1FC3A 2ISYA 3JSOA 2IP2A 2E1NA 1T2KA 1Z6RA 1HW5A 3DEUA 3JTHA 3RYRA 3PQJA 3E6DA 2QZ8A 1IXRC 4PDKA 2VC1A 2KJBA 3NQOA 4ESJA 4ON0A 3C18A 4EM0B 2K4JA 5D5XB 5JFRA 5IT9K 2PBIA 2H6BA 1YG2A 3T0YA 1XCBA 4UNOA 4Y15A 3BPXA 1O57A 1LB2A 3KP7A 3QU3A 1MKMA 2A6EF 3TO7A 4XLPF 5H6RA 1KGSA 3J81K 4L9TA 3ML6A 3I4PA 1HW1A 5CVVA 4A12A 1IRFA 3DKWA 3JSPA 4UXNA 1ZAOA 2KRFA 1BI0A 2ESNA 1S7AA 2PJPA 1IAWA 1R7JA 1XCVA 2PN6A 4L9VA 5DCMA 2P6TA 2M5WA 3QRFF 2VOOA 4OINF 4U0WA 4B09A 5D8LB 5D5WB 3GFMA 3V7CA 1RNLA 2PLYA 3QPTA 3BDDA 2LF7A 3CUOA 2Z99A 2JZYA 2VBYA 3QPHA 2GA1A 2ISZA 2VT3A 1ZREA 1RI7A 1STZA 3CO7C 2IRFG 1FYMA 5L3EA 5A2QK 1W7PA 4ASNA 1FPQA 3U9GA 3ECHA 3I59A 3ZMUA 1U6GA 3E3VA 2HR3A 3RKWA 2FF4A 5E1WA 3TDZC 2RNJA 3R6SA 1TNSA 3FF5A 3LFKA 1MDMB 4R1HA 4U7BA 2MC3A 2STWA 5FGMA 3C1DA 3GO5A 3GFLA 4FHTA 2NNYA 2ETHA 3S2WA 3B02A 4HF0A 4M9XA 1ZN2A 1DPUA 4RB0A 4U0VA 4E70A 4PGHA 3K2ZA 3M7GA 4QWQA 4AVPA 2WC2A 1YQAA 1S3JA 4BH9A 4D0PA 1T6SA 1Z7UA 3M8FA 3GWZA 4XSXF 4HV5A 1BN5A 2P7VB 5K5RA 1XSXA 1J2XA 1B59A 2DAOA 5BMZA 1XSDA 3FX3A 1YLFA 3F3XA 4LGWA 2QLZA 3F6VA 3KP2A 4LG0A 4EM2A 4G7ZF 2HYGD 4EJUA 2ELHA 4G7HF 2DPUA 2NRAC 3K0LA 2EK5A 3VEPA 2D1VA 4WXDA 3BJOA 4HZFA 4CICA 1Z1DA 1PP8F 4ETSA 1D8KA 1BIAA 1GHCA 2CW0F 4Q48A 5ILUA 2DQLA 1G4DA 2QM3A 4HF1A 4CHUA 1CGPA 2E7WA 4P5OA 2BV6A 2NAZA 2WTEA 3CUQA 1XN7A 4I98B 4IF4A 2DU9A 2EV6A 5KK1A 2MH2A 1TNTA 3GEZA 4HDVA 1BJAA 2V1XA 3CO6C 3IL2A 1X3UA 4N9HA 3F72A 5H6QA 2KJCA 1IN5A 1WI9A 5K5QA 4LB6B 3W6JB 3WTZA 3T8RA 1S29A 4FX4A 3LQQA 3VOEA 1J59A 4ZH4F 2XAFA 4ESBA 3HOSA 2M1BA 1ZGAA 5ICFA 4EQQA 4GXOA 3E6CC 4XLNF 3FM3A 5LEJA 4ENMA 2QBYB 2DI3A 3VODA 5LGTA 3ISPA 2VT2A 2CQKA 5CVJA 2DK5A 2IVMA 1W4MA 1ZRCA 5TJJA 5E8GA 4RB3C 3BZ6A 2EFOA 2DO7A 4OOIA 2JPCA 4WF2A 2G9WA 3ZN0A 3F22A 1ZRDA 3GYHX 1R58A 4LLGF 1YTYA 1DDNA 3I71A 2IPQX 4WX9A 4BHPA 4I2OA 2IA0A 4RB1A 5EEHA 3HSEA 3E97A 5IT9Z 1JXSA 4AWXB 4RS8A 3KE2A 1ULYA 2LSOA 4KMUX 1HQCA 3T8TA 1JGSA 1D5VA 5CVRA 4EMSA 3FMRA 2K02A 5FD5A 2OZ6A 3LAJA 5BPDA 4YFXF 2OU2A 3WU1B 2M8EA 1W5SA 5D5VB 1R00A 1LJ9A 1BOAA 3MFKA 2YR2A 4AIJA 3RKYA 1EV7A 3GW2A 2UWMA 1RZ4A 4BNCA 2XAJA 2GXGA 3R4KA 4YIIA 3FHZA 1IN4A 4TV7A 3I0TA 3MZHA 4JK1X 2ZMEB 2JTVA 2Q2EA 1ZG1A 1SD5A 2RGVA 2D2WA 3W6KB 2VBZA 4HQEA 1YFHA 5DD8A 1PDNC 5CLSA 5E1ZB 1P2FA 1U78A 3DV8A 4EJWA 5A2QZ 4IHSA 1G6NA 3DFGA 3OV8A 4U7DA 1MD0A 4IRIA 2JRTA 4M73A 3P9CA 3P9IA 3L00A 4RGXA 3PQKA 3EQLF 3F8BA 3MEXA 3N4MA 5D4SA 5HS7A 5L3GA 3V7RA 3MWMA 3KCCA 5L3FA 4LFUA 1H0MA 3WTSC 2QYOA 4S05A 2XRNA 1PP7U 1SD4A 1BC8C 2DK8A 4KDPA 2GXBA 2L54A 2W84A 3WE2A 3K1PA 2VOPA 3DP7A 4LD5A 2W24A 2EV5A 3M8EA 4ZZDA 1SMYF 1YYVA 4G9YA 5HOOA 1VTNC 2GQQA 3QP5A 2V1UA 1ONVA 3KP5A 3MAJA 1YO5C 1QQIA 4OMYA 2BYVE 5AIQA 3E6BA 2XKOA 4MHGA 2FNPA 2HZTA 2ESHA 4YFNF 4F7ZA 4B8XA 1R22A 1TQMA 3R0AA 4ZYGA 3U1DA 3WGHA 4LLLA 5LRRA 3KZZA 4M9SA 4HQMA 1XGOA 4Q5SF 3RPUA 2K86A 3EDPA 4BAYA 1GXPA 4MQ9F 2LF8A 2ZNZA 4WWCA 2A3SA 2NS0A 3BPVA 3REOA 4BXUA 5TRDA 5FFXA 4KMFA 2H09A 3MZYA 4R79A 3COAC 1FP1D 2GAUA 1MDMA 3RIRA 4M6YA 5DD4A 1KYWA 1H9GA 1LEAA 2QWWA 3Q9VA 3Q9SA 3HRSA 4DNCA 5LLQA 1REPC 3F8NA 3B73A 3D5LA 1EH7A 1SFUA 2LKPA 3SZTA 4UHTA 4L5JA 5FFZA 3JW4A 3F6OA 4RGRA 4Q47A 1SFEA 2XGXA 2PG4A 5HDNA 4KN4X 2PQ8A 3H3ZA 1G3TA 2G7HA 5CYVA 5E17F 1BI3A 3EYYA 2A61A 1MJAA 2PMUA 4A2UA 3K69A 2J5PA 1BI1A 3F8FA 4A5MA 1O3QA 2Y75A 2JPBA 1ZLKA 1JHFA 5DDGA 1EH6A 4P9UA 3ZMZA 2CSOA 4KNYA 3TO6A 3E5QA 2UXNA 1CF7A 1B9NA 3WTVC 3I54A 1F5TA 5DV5A 2L4MA 1W5TA 1J75A 4AIHA 1O7LA 5JHUA 3M9AA 1KA8A 4NQWA 1S6LA 3EUHA 4KA4A 1IZ1A 5BQTA 1K78A 3H3UA 3L09A 1LQ1A 3I5UA 5LHHA 1HKSA 1WQ2A 5LGNA 2CG4A 2HEOA 3GX4X 5JVTA 2Q8KA 1U5TC 2D45A 3G73A 2EFWA 4M71A 1BI2A 2DQRA 3L9FA 1FSHA 2MD5A 2FA5A 3R60A 1OYYA 1UCRA 3JAMK 1D8JA 1ON2A 3U2RA 2NYXA 2EJRA 3QU6A 4FT8A 5IT3A 1FLIA 2VBWA 1AOYA 2Z9OA 4IHTA 2XHKA 2QBYA 4OIQF 5LGUA 2H94A 1L0OC 4Y13A 4LK0F 1TBXA 2PFBA 3FXUA 3RPQA 2M45A 5AIPA 4I02A 4G94A 2F5CA 4L0ZB 1USSA 4LJZF 3DPTA 3GXOA 1UFMA 4AIKA 4EJVA 3L2CA 3LWFA 1BBYA 4ZYHA 2XROA 2QQAA 5CJ9A 4UV9A 4Y17A 4XBFA 5FB2A 1P92A 2HGCA 2RQPA 3HUGA 3V8KA 2P4WA 3KP6A 4I0BA 1J7KA 2ZNYA 3LQRA 1XD7A 3F23A 1YS7A 5DCMB 3KLOA 2XASA 1WKMA 3K1NA 4ESFA 3L7WA 4GGGA 5HVQC 2QUFA 4U0YA 4XSZF 1Z05A 2DFIA 2D1HA 2MA3A 2H27A 4JBAA 2F5DA 3GZ5A 4LMYA 3HRMA 3FXQA 5FO5A 1QO0D 3GUDA 1Y0UA 4HAMA 3WGIA 2P5VA 4KFCA 2EFPA 2XAGA 4KICA 4BQAA 4KT5C 2C6YA 2HTSA 5D4RA 4ZYDA 1BIBA 1SMTA 1QGPA 3DF8A 1P6RA 2MLKA 2FBIA 3K9TA 3I59B 1DPRA 2R3SA 1ZH5A 2NNNA 3GLXA 2O03A 4GYGA 1KQ9A 1U2WA 1UHWA 4KIBA 3TKYA 3JTGA 2IT0A 4RB2C 3MCZA 4GO1A 4L9NA 2IA1A 2K4BA 3G3ZA 2P5KA 2ZMEA 2MLGA 3AAFA 3ELKA 1OMIA 1FSEA 4HX7A 2V1DA 3ABTA 2EFQA 3IWZA 4UVAA 4EGZA 1G3WA 4PCQA 3I53A 1I1GA 1ODDA 3KLNA 3LAPA 2WWYA 3RKXA 4CYDA 2Q0OA 5J8FA 1SAXA 2P7CB 1O3SA 2LNBA 4MGRA 2EA2A 1OYIA 2CFXA 4WXCA 2KIUA 4RGUA 2BGCA 1XGNA 3DPLC 5J6XA 2V79A 1ZG5A 2QENA 1K78B 1L3LA 4L5IA 3GZ6A 1XSVA 1K79A 3KEQA 1D3YA 1BC7C 5D6FA 1KU2A 4LG0B 2XUBA 4HV6A 4N0BA 3O2PE 2IA2A 4YFKF 1JHHA 2VBXA 1HKQA 4A6EA 1IXCA 3QP6A 1WRJA 1SFXA 4I0AA 5HDGA 3RTRA 5HS9A 3J81Z 2BBYA 4LK1F 3F21A 3C3WA 3E5UA 4BYYA 2EA4A 1NHAA 2FOKA 4P9FA 1R1VA 2L01A 5D5UB 2UXXA 4G6QA 2GA2A 2Z33A 5E20A 2OQRA 1HKTA 4CZZA 4OIOF 4GYIA 3CUQB 2X0LA 2FEZA 4Q4ZF 1SD6A 2R7DA 2FRHA 2XAQA 3CTAA 1FP2A 5K1YA 1YW8A 2HQNA 4UVBA 3HSFA 2HOEA 1IN6A 4PZJA 1B9MA 2DT5A 2R7FA 2Z3YA 4K2EA 3H92A 3E5XA 5ICGA 1R36A 2FBKA 1TW2A 1MJ9A 5L3BA 3KFWX 4Z2YA 2RV8A 2OA4A 1DP7P 4RAZA 1XDUA 4RAYA 3SXYA 3LA3A 5DUIA 1OR7A 2EWNA 3FMSA 2FMLA 4P55A 2ADUA 1WWXA 5D6EA 1TW3A 1Z6TA 4IXAA 4RGSA 2ZO4A 1ZGJA 5L3CA 1LDKB 1HSTA 5FD6A 4IPAA 4UUVA 3FZVA 4HYEA 1O3TA 3D0SA 3ULQB 2QVOA 1OYWA 2FE3A 3HTSB 3CUQC 2BEOA 4LB5A 4A0XA 3SHFA 2RN7A 1YW9A 2FU4A 3BOQA 1Z91A 4ZZLA 1T39A 1RIOH 1LDJA 3KETA 3RI4A 4XRFA 5ERIA 3F8CA 3TQNA 4I01A 3ZQ7A 1IN7A 4EV0A 1TLHB 2GZWA 1O3RA 2CO5A 4NB5A 1RUOA 1GXQA 3LA2A 2PEXA 3HRTA 4P96A 4S04A 1QNTA 3R61A 3EETA 3V7SA 3HHHA 1KU3A 1FX7A 3ECOA 1T0FA 3J80K 1ZHFA 3WTXC 2Y0MA 4HBLA 2FXAA 3GFJA 3RDIA 4A5NA 4M6XA 4A0ZA 3ROUA 3FWEA 4CGZA 2YX4A 1I1SA 1TTYA 1F4KA 2XV4S 1T98A 1FBQA 2AS5F 2L4AA 1R1UA 2AXLA 5L3DA 4HW0A 1MGTA 4OMZA 4KYWA 5E8IA 1IN8A 2HFHA 2HDCA 3K1MA 4QLCU 3BROA 5CVIA 3KZYA 5F6FA 3IRQA 2F5EA 1IF1A 5LRSA 2A5YB 1HW2A 2LDUA 2VN2A 4L0YB 3WGGA 2CGPA 3V8JA 1QZYA 2OQGA 2M87A 2A07F 3KP3A 3NEUA 1RUNA 1E17A 2PI0A 3I64A 2A69F 4HDUA 1QZZA 2L3DA 4BHBA 5ICEA 2JSCA 4YIFA 3LSTA 1U5TB 1R5GA 4WXHA 4EJTA 1K6OA 4I7HA 2ZXJA 3T5XA 1XMKA 3DXJF 4IRHA 3PFIA 3Q5FA 3IKTA 2DTRA 1FBSA 2FNAA 1YW7A 2VXZA 3KP4A 2KKOA 3BP8A 3OOPA 4O5VA 5ILVA 4HX8A 2F2EA 2V6CA 3ZMDA 3E6MA 2OZUA 1KQ0A 2COMA 2TDXA 3O3KA 4OIPF 4CXFA 1MJBA 1UB9A 2E7XA 1FY7A 2RC4A 2YX7A 1C0WA 5ILSA 5BPIA 5ED4A 4G6DA 2CWEA 2Z5UA 3IKVA 3HRUA 1J9IA 4AD9A 5HDKA 2ACJA 3SFZA 2J5OA 4EGYA 3WODF 2IJLA 1B6AA 1I6XA 2VE9A 1SD7A 3FMQA 1QPMA 2CYYA 1V3FA 3TGNA 5JR3A 1G3YA 3TDUC 5D8KB 1ZARA 3RJPA 3HSRA 2HYFA 3HIFA 2RKHA 2YU3A 2W85A 3BJ6A 5FLXK 3WG9A 3SQNA 1R23A 1AWCA 2HS5A 1I27A 5DEQA 1IRGA 3LA7A 1LNWA 4OU0A 2A6HF 4UVCA 1W7PD 2IW5A 4DQ2A 3TOBA 4ZYEA 2Y48A 4HA8A 1PUEE 2K27A 5F1RA 2V9VA 3O6BB 1ON1A 4M9ZA 2KIFA 2HTJA 1LDDA 3ZP5A 2DW4A 4BHCA 4A6DA 2GWRA 3HOTA 2EB7A 3P7NA 1TQIA 2XAHA 3TO9A 4HF2A 4ENNA 5DUKA 1XGSA 3CJNA 2DPDA 3BWGA 1IW7F 2VONA 1FOKA 3IC7A 1JE8A 4EVIA 5HS8A 4MEXF 1YIOA 1KU7A 4M72A 5BOXA 4KIGA 1HXDA 1U3EM 2YSRA 2HWVA 2GIVA 1CF7B 2MBFA 4WK8F 3M1EA 3ZMSA 4CO8A 5F64A 5BS6A 1Z9CA 4MTDA 4MNUA 1OKRA 3VB2A 2O8XA 1IUYA 4O3MA 2QQ9A 1TQPA 1ZG3A 2A68F 4PGGA 1HSJA 5JI6A 3WE3A 1P4WA 1G3SA 2BE5F 4NHJA 1W7PB 5LBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LEB A;  2ZKZ A;  3GF2 A;  3ZN1 A;  1J5Y A;  2OAZ A;  3I58 A;  4YG2 F;  4IRG A;  1XB4 A;  2STT A;  4GCV A;  5CVU A;  3QOP A;  4ENK A;  4R8H A;  2FMY A;  2VE8 A;  4JQF A;  3J80 Z;  2P8T A;  1U8R A;  3CDH A;  2G7U A;  3FM5 A;  1UHM A;  1XGM A;  4OIR F;  1IXS B;  2OD5 A;  5KVR A;  5DCF A;  2ZBK A;  4ENJ A;  2X4H A;  3R0J A;  2DBB A;  1H9T A;  3CLO A;  1J0R A;  1ZLJ A;  6PAX A;  3HYI A;  3MQ0 A;  4U88 A;  3RYP A;  2XVC A;  2WV0 A;  3KEO A;  4L18 B;  4UV8 A;  3C7J A;  3IRR A;  2XKP A;  2HKX A;  3V8L A;  1S8N A;  4KN7 X;  5LHG A;  1DUX C;  3QAH A;  2YPR A;  4M74 A;  4IVN A;  1KU9 A;  5HLI A;  3GVA A;  2EFN A;  1KQ8 A;  1GVJ A;  2HKO A;  4MQV A;  5E1X A;  4I09 A;  1T38 A;  4O6J A;  3VFZ A;  4MEY F;  5E18 F;  3BY6 A;  3HTU A;  3ERE D;  5AON A;  2OBP A;  4G8X A;  2FBH A;  2E1C A;  1XDS A;  3IHU A;  1Q1H A;  1QBJ A;  2VC0 A;  1R5H A;  2O3F A;  2B0L A;  1XMA A;  2EV0 A;  2FQ3 A;  2W57 A;  5LHI A;  1UST A;  1FT9 A;  2L02 A;  3BJA A;  4HLX A;  1V4R A;  4EM1 A;  2VOD A;  1EH8 A;  1LVA A;  1R1T A;  4A0Y A;  1E2X A;  3WTY C;  1KYZ A;  4L9J A;  3TOA A;  2W25 A;  4H0E A;  4WCG A;  5J8C A;  4HOB A;  3FXR A;  5LEK A;  3N97 A;  2FSW A;  2O0Y A;  1O7F A;  2MH9 A;  2XIG A;  1S7O A;  2M30 A;  2ZJ2 A;  3WTU C;  3NRV A;  4EJO A;  5HLG A;  3WU0 A;  5K5O A;  1OPC A;  1P4A A;  4HX4 A;  3ABU A;  1FYK A;  2P6S A;  1K7A A;  1WSU A;  1P4X A;  2H6C A;  1A04 A;  4KIF A;  4MTE A;  4IJA A;  3JAM Z;  5FLX Z;  2O6G E;  1U5T A;  3J7A O;  3V4G A;  2JT1 A;  3GFI A;  2RDP A;  1FBU A;  1FWZ A;  2P5L C;  2PMH A;  1B1B A;  2HQR A;  3WTW C;  4LLN A;  2RVC A;  5HLH A;  4G7O F;  4FX0 A;  3ZMT A;  4KUM A;  3EYI A;  3WTT C;  2F5F A;  1YS6 A;  1ZRF A;  4CDG A;  4HLY A;  1BM9 A;  1B4A A;  3T1B A;  1MZB A;  3P9K A;  4N9I A;  1FNN A;  1F1Z A;  2QQB A;  3DQV C;  5DYM A;  1F9N A;  1FYL A;  2O61 A;  2KIM A;  2K7L A;  5H20 A;  1HBX G;  2ZCW A;  3F8M A;  3SZP A;  5EEG A;  5ICC A;  2ZFW A;  3IWF A;  2DLL A;  3ZPL A;  3ZMV A;  3HHG A;  1FZP B;  2UZK A;  1ZYR F;  1I5Z A;  1FC3 A;  2ISY A;  3JSO A;  2IP2 A;  2E1N A;  1T2K A;  1Z6R A;  1HW5 A;  3DEU A;  3JTH A;  3RYR A;  3PQJ A;  3E6D A;  2QZ8 A;  1IXR C;  4PDK A;  2VC1 A;  2KJB A;  3NQO A;  4ESJ A;  4ON0 A;  3C18 A;  4EM0 B;  2K4J A;  5D5X B;  5JFR A;  5IT9 K;  2PBI A;  2H6B A;  1YG2 A;  3T0Y A;  1XCB A;  4UNO A;  4Y15 A;  3BPX A;  1O57 A;  1LB2 A;  3KP7 A;  3QU3 A;  1MKM A;  2A6E F;  3TO7 A;  4XLP F;  5H6R A;  1KGS A;  3J81 K;  4L9T A;  3ML6 A;  3I4P A;  1HW1 A;  5CVV A;  4A12 A;  1IRF A;  3DKW A;  3JSP A;  4UXN A;  1ZAO A;  2KRF A;  1BI0 A;  2ESN A;  1S7A A;  2PJP A;  1IAW A;  1R7J A;  1XCV A;  2PN6 A;  4L9V A;  5DCM A;  2P6T A;  2M5W A;  3QRF F;  2VOO A;  4OIN F;  4U0W A;  4B09 A;  5D8L B;  5D5W B;  3GFM A;  3V7C A;  1RNL A;  2PLY A;  3QPT A;  3BDD A;  2LF7 A;  3CUO A;  2Z99 A;  2JZY A;  2VBY A;  3QPH A;  2GA1 A;  2ISZ A;  2VT3 A;  1ZRE A;  1RI7 A;  1STZ A;  3CO7 C;  2IRF G;  1FYM A;  5L3E A;  5A2Q K;  1W7P A;  4ASN A;  1FPQ A;  3U9G A;  3ECH A;  3I59 A;  3ZMU A;  1U6G A;  3E3V A;  2HR3 A;  3RKW A;  2FF4 A;  5E1W A;  3TDZ C;  2RNJ A;  3R6S A;  1TNS A;  3FF5 A;  3LFK A;  1MDM B;  4R1H A;  4U7B A;  2MC3 A;  2STW A;  5FGM A;  3C1D A;  3GO5 A;  3GFL A;  4FHT A;  2NNY A;  2ETH A;  3S2W A;  3B02 A;  4HF0 A;  4M9X A;  1ZN2 A;  1DPU A;  4RB0 A;  4U0V A;  4E70 A;  4PGH A;  3K2Z A;  3M7G A;  4QWQ A;  4AVP A;  2WC2 A;  1YQA A;  1S3J A;  4BH9 A;  4D0P A;  1T6S A;  1Z7U A;  3M8F A;  3GWZ A;  4XSX F;  4HV5 A;  1BN5 A;  2P7V B;  5K5R A;  1XSX A;  1J2X A;  1B59 A;  2DAO A;  5BMZ A;  1XSD A;  3FX3 A;  1YLF A;  3F3X A;  4LGW A;  2QLZ A;  3F6V A;  3KP2 A;  4LG0 A;  4EM2 A;  4G7Z F;  2HYG D;  4EJU A;  2ELH A;  4G7H F;  2DPU A;  2NRA C;  3K0L A;  2EK5 A;  3VEP A;  2D1V A;  4WXD A;  3BJO A;  4HZF A;  4CIC A;  1Z1D A;  1PP8 F;  4ETS A;  1D8K A;  1BIA A;  1GHC A;  2CW0 F;  4Q48 A;  5ILU A;  2DQL A;  1G4D A;  2QM3 A;  4HF1 A;  4CHU A;  1CGP A;  2E7W A;  4P5O A;  2BV6 A;  2NAZ A;  2WTE A;  3CUQ A;  1XN7 A;  4I98 B;  4IF4 A;  2DU9 A;  2EV6 A;  5KK1 A;  2MH2 A;  1TNT A;  3GEZ A;  4HDV A;  1BJA A;  2V1X A;  3CO6 C;  3IL2 A;  1X3U A;  4N9H A;  3F72 A;  5H6Q A;  2KJC A;  1IN5 A;  1WI9 A;  5K5Q A;  4LB6 B;  3W6J B;  3WTZ A;  3T8R A;  1S29 A;  4FX4 A;  3LQQ A;  3VOE A;  1J59 A;  4ZH4 F;  2XAF A;  4ESB A;  3HOS A;  2M1B A;  1ZGA A;  5ICF A;  4EQQ A;  4GXO A;  3E6C C;  4XLN F;  3FM3 A;  5LEJ A;  4ENM A;  2QBY B;  2DI3 A;  3VOD A;  5LGT A;  3ISP A;  2VT2 A;  2CQK A;  5CVJ A;  2DK5 A;  2IVM A;  1W4M A;  1ZRC A;  5TJJ A;  5E8G A;  4RB3 C;  3BZ6 A;  2EFO A;  2DO7 A;  4OOI A;  2JPC A;  4WF2 A;  2G9W A;  3ZN0 A;  3F22 A;  1ZRD A;  3GYH X;  1R58 A;  4LLG F;  1YTY A;  1DDN A;  3I71 A;  2IPQ X;  4WX9 A;  4BHP A;  4I2O A;  2IA0 A;  4RB1 A;  5EEH A;  3HSE A;  3E97 A;  5IT9 Z;  1JXS A;  4AWX B;  4RS8 A;  3KE2 A;  1ULY A;  2LSO A;  4KMU X;  1HQC A;  3T8T A;  1JGS A;  1D5V A;  5CVR A;  4EMS A;  3FMR A;  2K02 A;  5FD5 A;  2OZ6 A;  3LAJ A;  5BPD A;  4YFX F;  2OU2 A;  3WU1 B;  2M8E A;  1W5S A;  5D5V B;  1R00 A;  1LJ9 A;  1BOA A;  3MFK A;  2YR2 A;  4AIJ A;  3RKY A;  1EV7 A;  3GW2 A;  2UWM A;  1RZ4 A;  4BNC A;  2XAJ A;  2GXG A;  3R4K A;  4YII A;  3FHZ A;  1IN4 A;  4TV7 A;  3I0T A;  3MZH A;  4JK1 X;  2ZME B;  2JTV A;  2Q2E A;  1ZG1 A;  1SD5 A;  2RGV A;  2D2W A;  3W6K B;  2VBZ A;  4HQE A;  1YFH A;  5DD8 A;  1PDN C;  5CLS A;  5E1Z B;  1P2F A;  1U78 A;  3DV8 A;  4EJW A;  5A2Q Z;  4IHS A;  1G6N A;  3DFG A;  3OV8 A;  4U7D A;  1MD0 A;  4IRI A;  2JRT A;  4M73 A;  3P9C A;  3P9I A;  3L00 A;  4RGX A;  3PQK A;  3EQL F;  3F8B A;  3MEX A;  3N4M A;  5D4S A;  5HS7 A;  5L3G A;  3V7R A;  3MWM A;  3KCC A;  5L3F A;  4LFU A;  1H0M A;  3WTS C;  2QYO A;  4S05 A;  2XRN A;  1PP7 U;  1SD4 A;  1BC8 C;  2DK8 A;  4KDP A;  2GXB A;  2L54 A;  2W84 A;  3WE2 A;  3K1P A;  2VOP A;  3DP7 A;  4LD5 A;  2W24 A;  2EV5 A;  3M8E A;  4ZZD A;  1SMY F;  1YYV A;  4G9Y A;  5HOO A;  1VTN C;  2GQQ A;  3QP5 A;  2V1U A;  1ONV A;  3KP5 A;  3MAJ A;  1YO5 C;  1QQI A;  4OMY A;  2BYV E;  5AIQ A;  3E6B A;  2XKO A;  4MHG A;  2FNP A;  2HZT A;  2ESH A;  4YFN F;  4F7Z A;  4B8X A;  1R22 A;  1TQM A;  3R0A A;  4ZYG A;  3U1D A;  3WGH A;  4LLL A;  5LRR A;  3KZZ A;  4M9S A;  4HQM A;  1XGO A;  4Q5S F;  3RPU A;  2K86 A;  3EDP A;  4BAY A;  1GXP A;  4MQ9 F;  2LF8 A;  2ZNZ A;  4WWC A;  2A3S A;  2NS0 A;  3BPV A;  3REO A;  4BXU A;  5TRD A;  5FFX A;  4KMF A;  2H09 A;  3MZY A;  4R79 A;  3COA C;  1FP1 D;  2GAU A;  1MDM A;  3RIR A;  4M6Y A;  5DD4 A;  1KYW A;  1H9G A;  1LEA A;  2QWW A;  3Q9V A;  3Q9S A;  3HRS A;  4DNC A;  5LLQ A;  1REP C;  3F8N A;  3B73 A;  3D5L A;  1EH7 A;  1SFU A;  2LKP A;  3SZT A;  4UHT A;  4L5J A;  5FFZ A;  3JW4 A;  3F6O A;  4RGR A;  4Q47 A;  1SFE A;  2XGX A;  2PG4 A;  5HDN A;  4KN4 X;  2PQ8 A;  3H3Z A;  1G3T A;  2G7H A;  5CYV A;  5E17 F;  1BI3 A;  3EYY A;  2A61 A;  1MJA A;  2PMU A;  4A2U A;  3K69 A;  2J5P A;  1BI1 A;  3F8F A;  4A5M A;  1O3Q A;  2Y75 A;  2JPB A;  1ZLK A;  1JHF A;  5DDG A;  1EH6 A;  4P9U A;  3ZMZ A;  2CSO A;  4KNY A;  3TO6 A;  3E5Q A;  2UXN A;  1CF7 A;  1B9N A;  3WTV C;  3I54 A;  1F5T A;  5DV5 A;  2L4M A;  1W5T A;  1J75 A;  4AIH A;  1O7L A;  5JHU A;  3M9A A;  1KA8 A;  4NQW A;  1S6L A;  3EUH A;  4KA4 A;  1IZ1 A;  5BQT A;  1K78 A;  3H3U A;  3L09 A;  1LQ1 A;  3I5U A;  5LHH A;  1HKS A;  1WQ2 A;  5LGN A;  2CG4 A;  2HEO A;  3GX4 X;  5JVT A;  2Q8K A;  1U5T C;  2D45 A;  3G73 A;  2EFW A;  4M71 A;  1BI2 A;  2DQR A;  3L9F A;  1FSH A;  2MD5 A;  2FA5 A;  3R60 A;  1OYY A;  1UCR A;  3JAM K;  1D8J A;  1ON2 A;  3U2R A;  2NYX A;  2EJR A;  3QU6 A;  4FT8 A;  5IT3 A;  1FLI A;  2VBW A;  1AOY A;  2Z9O A;  4IHT A;  2XHK A;  2QBY A;  4OIQ F;  5LGU A;  2H94 A;  1L0O C;  4Y13 A;  4LK0 F;  1TBX A;  2PFB A;  3FXU A;  3RPQ A;  2M45 A;  5AIP A;  4I02 A;  4G94 A;  2F5C A;  4L0Z B;  1USS A;  4LJZ F;  3DPT A;  3GXO A;  1UFM A;  4AIK A;  4EJV A;  3L2C A;  3LWF A;  1BBY A;  4ZYH A;  2XRO A;  2QQA A;  5CJ9 A;  4UV9 A;  4Y17 A;  4XBF A;  5FB2 A;  1P92 A;  2HGC A;  2RQP A;  3HUG A;  3V8K A;  2P4W A;  3KP6 A;  4I0B A;  1J7K A;  2ZNY A;  3LQR A;  1XD7 A;  3F23 A;  1YS7 A;  5DCM B;  3KLO A;  2XAS A;  1WKM A;  3K1N A;  4ESF A;  3L7W A;  4GGG A;  5HVQ C;  2QUF A;  4U0Y A;  4XSZ F;  1Z05 A;  2DFI A;  2D1H A;  2MA3 A;  2H27 A;  4JBA A;  2F5D A;  3GZ5 A;  4LMY A;  3HRM A;  3FXQ A;  5FO5 A;  1QO0 D;  3GUD A;  1Y0U A;  4HAM A;  3WGI A;  2P5V A;  4KFC A;  2EFP A;  2XAG A;  4KIC A;  4BQA A;  4KT5 C;  2C6Y A;  2HTS A;  5D4R A;  4ZYD A;  1BIB A;  1SMT A;  1QGP A;  3DF8 A;  1P6R A;  2MLK A;  2FBI A;  3K9T A;  3I59 B;  1DPR A;  2R3S A;  1ZH5 A;  2NNN A;  3GLX A;  2O03 A;  4GYG A;  1KQ9 A;  1U2W A;  1UHW A;  4KIB A;  3TKY A;  3JTG A;  2IT0 A;  4RB2 C;  3MCZ A;  4GO1 A;  4L9N A;  2IA1 A;  2K4B A;  3G3Z A;  2P5K A;  2ZME A;  2MLG A;  3AAF A;  3ELK A;  1OMI A;  1FSE A;  4HX7 A;  2V1D A;  3ABT A;  2EFQ A;  3IWZ A;  4UVA A;  4EGZ A;  1G3W A;  4PCQ A;  3I53 A;  1I1G A;  1ODD A;  3KLN A;  3LAP A;  2WWY A;  3RKX A;  4CYD A;  2Q0O A;  5J8F A;  1SAX A;  2P7C B;  1O3S A;  2LNB A;  4MGR A;  2EA2 A;  1OYI A;  2CFX A;  4WXC A;  2KIU A;  4RGU A;  2BGC A;  1XGN A;  3DPL C;  5J6X A;  2V79 A;  1ZG5 A;  2QEN A;  1K78 B;  1L3L A;  4L5I A;  3GZ6 A;  1XSV A;  1K79 A;  3KEQ A;  1D3Y A;  1BC7 C;  5D6F A;  1KU2 A;  4LG0 B;  2XUB A;  4HV6 A;  4N0B A;  3O2P E;  2IA2 A;  4YFK F;  1JHH A;  2VBX A;  1HKQ A;  4A6E A;  1IXC A;  3QP6 A;  1WRJ A;  1SFX A;  4I0A A;  5HDG A;  3RTR A;  5HS9 A;  3J81 Z;  2BBY A;  4LK1 F;  3F21 A;  3C3W A;  3E5U A;  4BYY A;  2EA4 A;  1NHA A;  2FOK A;  4P9F A;  1R1V A;  2L01 A;  5D5U B;  2UXX A;  4G6Q A;  2GA2 A;  2Z33 A;  5E20 A;  2OQR A;  1HKT A;  4CZZ A;  4OIO F;  4GYI A;  3CUQ B;  2X0L A;  2FEZ A;  4Q4Z F;  1SD6 A;  2R7D A;  2FRH A;  2XAQ A;  3CTA A;  1FP2 A;  5K1Y A;  1YW8 A;  2HQN A;  4UVB A;  3HSF A;  2HOE A;  1IN6 A;  4PZJ A;  1B9M A;  2DT5 A;  2R7F A;  2Z3Y A;  4K2E A;  3H92 A;  3E5X A;  5ICG A;  1R36 A;  2FBK A;  1TW2 A;  1MJ9 A;  5L3B A;  3KFW X;  4Z2Y A;  2RV8 A;  2OA4 A;  1DP7 P;  4RAZ A;  1XDU A;  4RAY A;  3SXY A;  3LA3 A;  5DUI A;  1OR7 A;  2EWN A;  3FMS A;  2FML A;  4P55 A;  2ADU A;  1WWX A;  5D6E A;  1TW3 A;  1Z6T A;  4IXA A;  4RGS A;  2ZO4 A;  1ZGJ A;  5L3C A;  1LDK B;  1HST A;  5FD6 A;  4IPA A;  4UUV A;  3FZV A;  4HYE A;  1O3T A;  3D0S A;  3ULQ B;  2QVO A;  1OYW A;  2FE3 A;  3HTS B;  3CUQ C;  2BEO A;  4LB5 A;  4A0X A;  3SHF A;  2RN7 A;  1YW9 A;  2FU4 A;  3BOQ A;  1Z91 A;  4ZZL A;  1T39 A;  1RIO H;  1LDJ A;  3KET A;  3RI4 A;  4XRF A;  5ERI A;  3F8C A;  3TQN A;  4I01 A;  3ZQ7 A;  1IN7 A;  4EV0 A;  1TLH B;  2GZW A;  1O3R A;  2CO5 A;  4NB5 A;  1RUO A;  1GXQ A;  3LA2 A;  2PEX A;  3HRT A;  4P96 A;  4S04 A;  1QNT A;  3R61 A;  3EET A;  3V7S A;  3HHH A;  1KU3 A;  1FX7 A;  3ECO A;  1T0F A;  3J80 K;  1ZHF A;  3WTX C;  2Y0M A;  4HBL A;  2FXA A;  3GFJ A;  3RDI A;  4A5N A;  4M6X A;  4A0Z A;  3ROU A;  3FWE A;  4CGZ A;  2YX4 A;  1I1S A;  1TTY A;  1F4K A;  2XV4 S;  1T98 A;  1FBQ A;  2AS5 F;  2L4A A;  1R1U A;  2AXL A;  5L3D A;  4HW0 A;  1MGT A;  4OMZ A;  4KYW A;  5E8I A;  1IN8 A;  2HFH A;  2HDC A;  3K1M A;  4QLC U;  3BRO A;  5CVI A;  3KZY A;  5F6F A;  3IRQ A;  2F5E A;  1IF1 A;  5LRS A;  2A5Y B;  1HW2 A;  2LDU A;  2VN2 A;  4L0Y B;  3WGG A;  2CGP A;  3V8J A;  1QZY A;  2OQG A;  2M87 A;  2A07 F;  3KP3 A;  3NEU A;  1RUN A;  1E17 A;  2PI0 A;  3I64 A;  2A69 F;  4HDU A;  1QZZ A;  2L3D A;  4BHB A;  5ICE A;  2JSC A;  4YIF A;  3LST A;  1U5T B;  1R5G A;  4WXH A;  4EJT A;  1K6O A;  4I7H A;  2ZXJ A;  3T5X A;  1XMK A;  3DXJ F;  4IRH A;  3PFI A;  3Q5F A;  3IKT A;  2DTR A;  1FBS A;  2FNA A;  1YW7 A;  2VXZ A;  3KP4 A;  2KKO A;  3BP8 A;  3OOP A;  4O5V A;  5ILV A;  4HX8 A;  2F2E A;  2V6C A;  3ZMD A;  3E6M A;  2OZU A;  1KQ0 A;  2COM A;  2TDX A;  3O3K A;  4OIP F;  4CXF A;  1MJB A;  1UB9 A;  2E7X A;  1FY7 A;  2RC4 A;  2YX7 A;  1C0W A;  5ILS A;  5BPI A;  5ED4 A;  4G6D A;  2CWE A;  2Z5U A;  3IKV A;  3HRU A;  1J9I A;  4AD9 A;  5HDK A;  2ACJ A;  3SFZ A;  2J5O A;  4EGY A;  3WOD F;  2IJL A;  1B6A A;  1I6X A;  2VE9 A;  1SD7 A;  3FMQ A;  1QPM A;  2CYY A;  1V3F A;  3TGN A;  5JR3 A;  1G3Y A;  3TDU C;  5D8K B;  1ZAR A;  3RJP A;  3HSR A;  2HYF A;  3HIF A;  2RKH A;  2YU3 A;  2W85 A;  3BJ6 A;  5FLX K;  3WG9 A;  3SQN A;  1R23 A;  1AWC A;  2HS5 A;  1I27 A;  5DEQ A;  1IRG A;  3LA7 A;  1LNW A;  4OU0 A;  2A6H F;  4UVC A;  1W7P D;  2IW5 A;  4DQ2 A;  3TOB A;  4ZYE A;  2Y48 A;  4HA8 A;  1PUE E;  2K27 A;  5F1R A;  2V9V A;  3O6B B;  1ON1 A;  4M9Z A;  2KIF A;  2HTJ A;  1LDD A;  3ZP5 A;  2DW4 A;  4BHC A;  4A6D A;  2GWR A;  3HOT A;  2EB7 A;  3P7N A;  1TQI A;  2XAH A;  3TO9 A;  4HF2 A;  4ENN A;  5DUK A;  1XGS A;  3CJN A;  2DPD A;  3BWG A;  1IW7 F;  2VON A;  1FOK A;  3IC7 A;  1JE8 A;  4EVI A;  5HS8 A;  4MEX F;  1YIO A;  1KU7 A;  4M72 A;  5BOX A;  4KIG A;  1HXD A;  1U3E M;  2YSR A;  2HWV A;  2GIV A;  1CF7 B;  2MBF A;  4WK8 F;  3M1E A;  3ZMS A;  4CO8 A;  5F64 A;  5BS6 A;  1Z9C A;  4MTD A;  4MNU A;  1OKR A;  3VB2 A;  2O8X A;  1IUY A;  4O3M A;  2QQ9 A;  1TQP A;  1ZG3 A;  2A68 F;  4PGG A;  1HSJ A;  5JI6 A;  3WE3 A;  1P4W A;  1G3S A;  2BE5 F;  4NHJ A;  1W7P B;  5LBQ A; 
#chains in the Genus database with same CATH topology
 1LEB A;  2ZKZ A;  3DU6 A;  3GF2 A;  1VQK I;  4NDL A;  3ZN1 A;  2BVM A;  3U1K A;  1J5Y A;  2WB1 A;  2OAZ A;  3I58 A;  5GP9 A;  4YG2 F;  2IS4 A;  3IUO A;  4IRG A;  1XB4 A;  2CW7 A;  1ETY A;  2DDA A;  2STT A;  2CQQ A;  3LL7 A;  3CJT B;  3BLY A;  2IS6 A;  4GCV A;  5CVU A;  2CV1 A;  3ABK H;  4XON A;  3A4C A;  3HKZ N;  3QOP A;  2P81 A;  4ENK A;  5CPR B;  4R8H A;  2FMY A;  2VE8 A;  2HOT A;  3UR3 C;  2QQ8 A;  4JQF A;  1DGW Y;  4BDZ A;  3J80 Z;  1DQU A;  2VKD A;  2JRM A;  2P8T A;  2AHQ A;  1YX3 A;  4NC8 A;  4N4O B;  3TW6 A;  5FLM J;  1U8R A;  3CDH A;  2G7U A;  3FM5 A;  3K4C A;  1UHM A;  1XGM A;  4OIR F;  1IXS B;  1NH3 A;  2OD5 A;  5KVR A;  1YOV B;  4I76 A;  3L2V A;  5DCF A;  1PUF B;  2ZBK A;  4BEH B;  2HQA A;  3IAS 2;  4ENJ A;  2X4H A;  3R0J A;  2DBB A;  1H9T A;  4UUS A;  1Z0X A;  3CLO A;  2QSG X;  1MSE C;  4B47 A;  1J0R A;  1ZLJ A;  1W0U A;  1IO2 A;  6PAX A;  3HYI A;  3MQ0 A;  2OCE A;  4U88 A;  2A6T A;  3ZQL A;  1X3Z B;  3RYP A;  2XVC A;  2WV0 A;  3KEO A;  4L18 B;  1JJ8 C;  2CUF A;  4UV8 A;  1UAA A;  5H2F C;  3C7J A;  3EUH C;  1BW5 A;  4P1W A;  3IRR A;  2XKP A;  2HKX A;  5FKK A;  1WJF A;  3V8L A;  1S8N A;  1P7I A;  4KN7 X;  4V2G A;  5LHG A;  1DUX C;  2QA4 I;  2W48 A;  3QAH A;  3MVP A;  2XF7 A;  5EG0 A;  2YPR A;  2KLO A;  1FEX A;  2JUC A;  4M74 A;  4M3F A;  3K6G A;  4IVN A;  1KU9 A;  3OS2 A;  2O8K A;  5HLI A;  4A69 C;  3GVA A;  2EFN A;  4FE7 A;  1KQ8 A;  1GVJ A;  1BR1 A;  1IUF A;  3DEW A;  3SJM A;  1A35 A;  2HKO A;  3JRD A;  4MQV A;  5E1X A;  4I09 A;  1T38 A;  4O6J A;  3VFZ A;  4XKW A;  3ZQI A;  4MEY F;  2E36 A;  2L5Q A;  2R7O A;  5E18 F;  2CMP A;  2GLO A;  3BY6 A;  4CZC A;  3HTU A;  3CF5 F;  3ERE D;  5AON A;  2OTJ I;  1LUJ B;  2OBP A;  1D1A A;  3CCY A;  4G8X A;  3OYE A;  2CH0 A;  1X4O A;  1DU0 A;  2PJR A;  4BJT A;  2FBH A;  3CQZ J;  2E1C A;  1XDS A;  3IHU A;  1Q1H A;  4BE2 A;  1J09 A;  4C2M J;  1QBJ A;  2M34 A;  2VC0 A;  1XC5 A;  1VQ4 I;  3DBL B;  1R5H A;  2O3F A;  3S14 J;  1JTY A;  2B0L A;  2WY8 Q;  2M0C A;  1XMA A;  2EV0 A;  1ZEL A;  2FQ3 A;  2W57 A;  1TT5 B;  3F9K A;  3TW7 A;  3C2H A;  5LHI A;  3S3O A;  1UST A;  1FT9 A;  3M3Y J;  2L02 A;  3BJA A;  1BW6 A;  4HLX A;  1V4R A;  3RQ4 A;  4EM1 A;  2VOD A;  1EH8 A;  1LVA A;  1R1T A;  4A0Y A;  1E2X A;  2DFE A;  3WTY C;  1KYZ A;  1E0E A;  1ETO A;  4L9J A;  3TOA A;  2B9S A;  2ZXI A;  3OIQ A;  1Z21 A;  4C3I J;  1MMA A;  2W25 A;  2BY3 A;  4H0E A;  2HXO A;  4WCG A;  2DMT A;  5J8C A;  3HOY J;  4HOB A;  2BY1 A;  1NK3 P;  3FXR A;  4DZJ A;  1QZE A;  5LEK A;  3N97 A;  2FSW A;  3JRA A;  4E7I A;  3SDG A;  2O0Y A;  1O7F A;  4BXF A;  5FLV A;  3PFY A;  2MH9 A;  2XIG A;  5FRM A;  1ETW A;  1S7O A;  1Y1V J;  2M30 A;  1CQT A;  2ZJ2 A;  3WTU C;  2PMZ A;  4XLE A;  1X2N A;  3LSM A;  3A03 A;  3LSP A;  1SFK A;  2M2E A;  3NRV A;  3PO2 J;  2MW8 A;  4EJO A;  2Y69 H;  1KZH A;  1QHH D;  5HNH A;  5HLG A;  3B6A A;  5EEA A;  3WU0 A;  1R71 A;  4M3E A;  3EUK L;  5K5O A;  4IHY A;  1OPC A;  2LY2 A;  1P4A A;  1VQ5 I;  4HX4 A;  1B72 B;  2F6C A;  3ABU A;  1FYK A;  1IC8 A;  4FAS D;  2P6S A;  1K7A A;  3QPS A;  3FXJ A;  1WSU A;  1P4X A;  2H6C A;  1XPX A;  3GTJ J;  3DLL F;  2CW8 A;  1A04 A;  4KIF A;  4JYK A;  3ERM A;  5IP7 J;  2ECC A;  4D7M A;  5KCM A;  4MTE A;  2MG4 A;  4IJA A;  3JAM Z;  5FLX Z;  2O6G E;  1GT0 C;  1U5T A;  2VL8 A;  3J7A O;  1YHQ I;  3V4G A;  3DLA A;  2JT1 A;  3GFI A;  4A3C J;  2RDP A;  1S9H A;  5J1U A;  1FBU A;  1K6Y A;  1UMQ A;  5KNL A;  1FWZ A;  1WJA A;  2F4O B;  2P5L C;  2LFB A;  4HRI A;  2PMH A;  3HGG A;  5GAD J;  1B1B A;  2HQR A;  1ZR2 A;  3WTW C;  3UNG C;  2F5V A;  4LLN A;  2RVC A;  3GZN B;  4XNF A;  5HLH A;  4G7O F;  4FX0 A;  3AL0 B;  2EZH A;  2K3P A;  3ZMT A;  4KUM A;  3EYI A;  1N75 A;  3WTT C;  3K4M A;  5DM7 F;  2F5F A;  1RET A;  1GV2 A;  3VYT B;  1YS6 A;  1ZTR A;  2ZME C;  1UG2 A;  2BW3 B;  2WY7 Q;  3A1Y A;  3ZQQ A;  1FIA A;  2FJ1 A;  1TWA J;  2KMU A;  1ZRF A;  4CDG A;  2L7K A;  5EZH A;  1VQ6 I;  4HLY A;  2E5Z A;  2V1N A;  1A5J A;  1MND A;  1R6R A;  1OLT A;  1BM9 A;  1B4A A;  4LG3 A;  3T1B A;  3KYC B;  1MZB A;  2E2J J;  3P9K A;  3CMY A;  3S15 J;  2MC4 A;  4ZDO A;  4N9I A;  1FNN A;  5F0H A;  1SAU A;  3J7A Y;  1F1Z A;  2L9R A;  2QQB A;  4IKF A;  3DQV C;  2EZK A;  3GBG A;  5DYM A;  4D7N A;  2JA5 J;  2ELK A;  3I4N J;  3CCM I;  1F9N A;  3DPU A;  3FHN A;  1FYL A;  5FKN A;  2O61 A;  1POG A;  2I10 A;  2BXY A;  2TRT A;  2KIM A;  2K7L A;  3HOX J;  4A3K J;  5H20 A;  1HBX G;  1ERD A;  5C3E J;  2ZCW A;  2KDO A;  3F8M A;  3SZP A;  5EEG A;  4CUG A;  5ICC A;  3NAR A;  1LE8 B;  2ZFW A;  3IWF A;  2DLL A;  3ZPL A;  1T56 A;  1ITY A;  3ZMV A;  3HHG A;  2D5V A;  1FZP B;  2ZSI B;  2UZK A;  1ZYR F;  2QEX I;  1I5Z A;  2OTL I;  2DFF A;  1FC3 A;  3OYD A;  2ISY A;  3JSO A;  2IP2 A;  2E1N A;  4I99 C;  1T2K A;  5HOD A;  1Z6R A;  1HW5 A;  3DEU A;  2IGK A;  3JTH A;  3RYR A;  5C44 J;  3PQJ A;  3PSI A;  3UKG A;  3E6D A;  2QZ8 A;  1UEL B;  2EZL A;  1VQ8 I;  3A2K A;  1KON A;  2JVH A;  1IXR C;  2KZG A;  2VQC A;  2CQX A;  3DKX A;  4II2 A;  4PDK A;  3ZQG A;  2VC1 A;  2KJB A;  3NQO A;  4ESJ A;  3Q0U A;  4ON0 A;  3C18 A;  4EM0 B;  3K70 C;  3HXL A;  5E3O A;  4XLA A;  2K4J A;  3OR2 C;  2XF6 A;  4XKV A;  5D5X B;  1TL8 A;  3HGY A;  2IGM A;  3RPU D;  1G59 A;  5IY5 H;  3OSG A;  3FIS A;  1MW7 A;  1YIT I;  5JFR A;  2WAF A;  5IT9 K;  2PBI A;  2H6B A;  1YG2 A;  4AID A;  3T0Y A;  3BR2 A;  1XCB A;  4IX7 A;  4UNO A;  2X1E A;  2MAB A;  3BPX A;  1O57 A;  3KX2 A;  4Y15 A;  4QSH A;  4YEJ A;  2HPM A;  1LB2 A;  2LLK A;  3KP7 A;  4BQN A;  4BJ6 C;  4UB8 C;  2E35 A;  3QU3 A;  2NVX J;  2XPU A;  1MKM A;  2A6E F;  2G0E A;  3P5J A;  4E4H A;  3TO7 A;  3S2D J;  4XLP F;  5H6R A;  2LBF A;  1KGS A;  3FXL A;  3J81 K;  4L9T A;  1K83 J;  3ML6 A;  1JUP A;  2XF5 A;  3K4J A;  2DDB A;  3ABL H;  3I4P A;  1FTZ A;  1HW1 A;  1MMG A;  5CVV A;  4A12 A;  1IRF A;  1FOX A;  3DKW A;  3JSP A;  4UXN A;  3L1P A;  4G6T B;  2MYS A;  1ZAO A;  2KRF A;  1BI0 A;  2ESN A;  3S1R J;  1S7A A;  2HDW A;  2YU9 J;  2PJP A;  1IAW A;  1R7J A;  3HOW J;  1XCV A;  1HOM A;  2PN6 A;  5FKM A;  2R0Q C;  2OV7 A;  2IXS A;  1JGG A;  4L9V A;  5DCM A;  1VQL I;  2P6T A;  2Y31 A;  2M5W A;  3QRF F;  2VOO A;  4OIN F;  4U0W A;  3VPR A;  4B09 A;  5D8L B;  5D5W B;  2WBM A;  3GFM A;  2NOJ B;  3V7C A;  1RNL A;  2PLY A;  4XLF A;  3QPT A;  3VWB A;  4NUB A;  3BR6 A;  2V4J C;  3BDD A;  1OR7 C;  4CYC B;  4IQJ A;  2LF7 A;  3CUO A;  2Z99 A;  3CF2 A;  2JZY A;  2VBY A;  3QPH A;  2WA0 A;  3QYB A;  2GA1 A;  2ISZ A;  3CDI A;  3JRG A;  2E19 A;  2VT3 A;  4C2T A;  3H3V K;  2X6W A;  3M1C A;  1ZRE A;  4NC7 A;  3OR1 C;  1RI7 A;  1MMN A;  1STZ A;  3CO7 C;  2IRF G;  3CC2 I;  2OC6 A;  3AKZ A;  1FYM A;  5L3E A;  2EIN H;  3BCB A;  5A2Q K;  1W7P A;  4BU2 A;  4ASN A;  9ANT A;  2LY9 A;  1FPQ A;  5KAI C;  3U9G A;  3CME I;  3NAU A;  2V9P A;  3ECH A;  4PJ0 C;  3I59 A;  3ZMU A;  3EPZ A;  1U6G A;  3H5A A;  3E3V A;  2B63 J;  3JRH A;  3S8P A;  4ZTJ A;  2HR3 A;  3RKW A;  2LOO A;  2FF4 A;  4XQF A;  2LRE A;  5E1W A;  2XGE A;  3TDZ C;  2X1D A;  1ZGW A;  2RNJ A;  2CUE A;  2R5Z B;  2WAQ N;  2ZB9 A;  3OS1 A;  3R6S A;  1Z77 A;  2NVU B;  3GTG J;  1TNS A;  3FF5 A;  3LFK A;  2VJ5 A;  2L0K A;  1MDM B;  4R1H A;  1YE9 A;  4U7B A;  4B4C A;  2MC3 A;  3BR1 A;  4XLC A;  2STW A;  5FGM A;  3C1D A;  3GO5 A;  2DXI A;  3GFL A;  4FHT A;  2JUG A;  1WI3 A;  2ZJR F;  2NNY A;  2KHM A;  1EKE A;  2ZSH B;  2ETH A;  3S2W A;  3B02 A;  4HF0 A;  4M9X A;  1ZN2 A;  1DPU A;  1MMS A;  1PUF A;  2X6Y A;  5J3L A;  1IGN A;  4RB0 A;  1XS9 A;  4U0V A;  4BEH A;  4E70 A;  3GME A;  4QPQ A;  1LKX A;  3ZXS A;  1T0F C;  4PGH A;  3K2Z A;  4F91 B;  1VQP I;  3M7G A;  4QWQ A;  5M5W J;  4AVP A;  2WC2 A;  1YQA A;  1S3J A;  4BH9 A;  1D1B A;  1YI2 I;  4D0P A;  3CCS I;  1T6S A;  1Z7U A;  3M8F A;  3GWZ A;  4XSX F;  1OIS A;  2HZD A;  4HV5 A;  4XID A;  3S1Q J;  2K9Q A;  4BY1 J;  1BN5 A;  5IOY A;  4NNJ A;  2P7V B;  4UUT A;  5K5R A;  5FKO A;  2HI3 A;  3BG5 A;  3OYB A;  1XSX A;  2DYS H;  3S2H J;  3W2A A;  2JJ7 A;  1J2X A;  1B59 A;  3BG9 A;  2DAO A;  2F4M B;  2X9D A;  5BMZ A;  1XSD A;  3FX3 A;  4RM2 A;  1YLF A;  2XRL A;  1JUS A;  2KZV A;  3F3X A;  1JKP C;  4LGW A;  2QLZ A;  3F6V A;  1I6H J;  4F3Q A;  3KP2 A;  2O7O A;  4LG0 A;  4HSR A;  4IQ4 A;  1T8I A;  4EM2 A;  4G7Z F;  4E7S A;  2HYG D;  4EJU A;  2ELH A;  4G7H F;  2DPU A;  2NRA C;  3K0L A;  1R4N B;  2EK5 A;  3VEP A;  3CJR B;  2D1V A;  2F4I A;  3HG9 A;  4BKX A;  4WXD A;  4BDY A;  4H4K C;  3CCE I;  3AG2 H;  3JRF A;  3BJO A;  4HZF A;  3OYA A;  1X1D A;  4CIC A;  2ZJP F;  1Z1D A;  1PP8 F;  4ETS A;  1D8K A;  1BIA A;  1GHC A;  2CW0 F;  4Q48 A;  3BZK A;  5ILU A;  2DQL A;  1G4D A;  1HLV A;  1VQN I;  2QM3 A;  4HF1 A;  1G2H A;  4CHU A;  1CGP A;  1MBJ A;  1W1W E;  3G71 I;  3IV5 A;  2E7W A;  4P5O A;  2BV6 A;  2DMP A;  1VFC A;  1W36 C;  2NAZ A;  2WTE A;  3CUQ A;  1XN7 A;  1MNE A;  5IP9 J;  1RC9 A;  3IP4 B;  2XB5 A;  4I98 B;  2LP0 A;  3HB9 A;  4IF4 A;  5DTD A;  1APL C;  2DU9 A;  2EV6 A;  5KK1 A;  2MH2 A;  1TNT A;  3GEZ A;  4HDV A;  4RLF A;  2NVY J;  3HZJ A;  3M4O J;  1BJA A;  2V1X A;  3AG1 H;  3MN2 A;  3CO6 C;  3IL2 A;  1VF9 A;  1X3U A;  1VQ9 I;  4A93 J;  4N9H A;  3F72 A;  3PUB A;  5H6Q A;  3W3C A;  4YEL A;  1BJZ A;  2KJC A;  2ELJ A;  1IN5 A;  1WI9 A;  5K5Q A;  4ZC3 A;  4LB6 B;  3W2V A;  3W6J B;  3ABM H;  3WTZ A;  2L7F P;  3T8R A;  3VSK A;  1NK2 P;  3FXM A;  1S29 A;  5K7Z A;  2HPI A;  3K4K A;  4HST A;  4F93 B;  1JKR C;  4FX4 A;  4XK4 A;  3LQQ A;  4ZDL A;  3VOE A;  4MLO A;  4ZH4 F;  1J59 A;  2XAF A;  2JVG A;  4ESB A;  1SVL A;  5EJC A;  3HOS A;  1SAN A;  2CJJ A;  3D1N I;  2M1B A;  1ZGA A;  3G1O A;  3OIP A;  5ICF A;  4EQQ A;  1LFU P;  4GXO A;  3WHB A;  1EF4 A;  3E6C C;  4XLN F;  2DOE A;  3M8J A;  3LSR A;  3FM3 A;  5LEJ A;  4ENM A;  2QBY B;  1B72 A;  2DI3 A;  3VOD A;  2ID3 A;  4E7K A;  5LGT A;  4MFE A;  3DTK A;  4B1R A;  2K5C A;  3ISP A;  4XKB A;  2VT2 A;  2CQK A;  2LRD A;  5CVJ A;  2DK5 A;  2Y9Z A;  2V6E A;  1TP4 A;  3N05 A;  2IVM A;  1W4M A;  4XIC A;  1ZRC A;  5TJJ A;  5E8G A;  2DYR H;  4RB3 C;  4QPO A;  1FTT A;  3BZ6 A;  1RPW A;  2EFO A;  2EIJ H;  3HJE A;  4PFO A;  4IEJ A;  2DO7 A;  4IO9 F;  4OOI A;  4C9Y A;  5KAF C;  2VPR A;  2JPC A;  4WF2 A;  4LIT A;  2G9W A;  4IHW A;  3ZN0 A;  3QWL A;  2CV0 A;  5DM6 F;  3F22 A;  1ZRD A;  3HUG B;  1R58 A;  3GYH X;  2OF7 A;  4ANJ A;  3K4N A;  2LKS A;  2XPV A;  3FIW A;  4LLG F;  1YTY A;  1DDN A;  2HNH A;  4XKC A;  1TZL A;  3I71 A;  2IPQ X;  4AYB N;  4WX9 A;  2VJI A;  1WJ5 A;  3FDY A;  3WU2 C;  1OQY A;  5GTI C;  1R5I D;  2CUJ A;  4BHP A;  4I2O A;  1IDY A;  1YJ9 I;  2IA0 A;  5BNG A;  3JR9 A;  4F92 B;  1RR8 C;  1D0X A;  4RB1 A;  5EEH A;  1VQ7 I;  1IV6 A;  3HSE A;  3E97 A;  5IT9 Z;  1JXS A;  4AWX B;  2K3F A;  4HPQ A;  4RS8 A;  1P7J A;  3M07 A;  1FOW A;  2L9S A;  4XOT A;  3KE2 A;  1BOB A;  1ULY A;  2DCE A;  2NOG A;  2VI6 A;  3D5R C;  2LSO A;  4KMU X;  3Q0W A;  1HQC A;  3T8T A;  1JGS A;  1D5V A;  5CVR A;  4E6K G;  4EMS A;  5M3M J;  3FMR A;  3FBN B;  2K02 A;  5FD5 A;  2OZ6 A;  3NWS A;  4CSW A;  3LAJ A;  5BPD A;  4YFX F;  3U21 A;  2ID6 A;  2KIQ A;  2XPW A;  2OU2 A;  2M7A A;  4OAZ A;  4X1E A;  3WU1 B;  2M8E A;  5J1R A;  1W5S A;  2BHY A;  3LSK A;  4IOC F;  1E3H A;  5D5V B;  2EIM H;  1R00 A;  1LJ9 A;  1BOA A;  3MFK A;  2LK2 A;  3RKQ A;  2YR2 A;  3BG3 A;  1OCR H;  4AIJ A;  3RKY A;  3H0G J;  3ZQF A;  4BBR J;  1EV7 A;  3GW2 A;  3X2Q H;  2UWM A;  3J7Z I;  1RZ4 A;  4BNC A;  1Z67 A;  2XAJ A;  2GXG A;  3R4K A;  4YII A;  2BVL A;  2DN0 A;  1LE8 A;  3FHZ A;  1IN4 A;  2ICW G;  1SEU A;  4AU7 A;  2RAE A;  4TV7 A;  2W82 A;  3I0T A;  3MZH A;  2R92 J;  1QHG A;  1U0J A;  3CC7 I;  4JK1 X;  3GTO J;  1LFP A;  1DP3 A;  2ZME B;  2JTV A;  2Q2E A;  1ZG1 A;  3A0B C;  1SD5 A;  2RGV A;  2D2W A;  2HVQ A;  3W6K B;  1GVD A;  1MBK A;  2VBZ A;  2V26 A;  4ABZ A;  4HQE A;  1YFH A;  5DD8 A;  1MMD A;  1PDN C;  2K40 A;  5CLS A;  4A3M J;  5E3L A;  5E1Z B;  1P2F A;  3OYJ A;  1U78 A;  3DV8 A;  4EJW A;  5A2Q Z;  4IHS A;  2OPT A;  1G6N A;  3DFG A;  5GTH C;  1WHU A;  2BY0 A;  1N25 A;  1ETK A;  3RZD J;  4BE0 A;  5JVG F;  5M5X J;  4BJ5 C;  1WFX A;  1YX5 A;  5IYC J;  3ASO H;  1D1C A;  3OV8 A;  4PJL A;  4U7D A;  1MD0 A;  4UUS B;  4IRI A;  2JRT A;  4M73 A;  3P9C A;  3P9I A;  3L00 A;  4RGX A;  3PQK A;  1IV8 A;  1MBE A;  2EIL H;  3EQL F;  1JKQ C;  3F8B A;  3MEX A;  3N4M A;  3H36 A;  5D4S A;  5HS7 A;  5L3G A;  5IYD J;  2R7X A;  3V7R A;  3MWM A;  2M4K A;  3BQY A;  3KCC A;  4S0H B;  1Q1V A;  5L3F A;  4DIQ A;  2O5R A;  4LFU A;  3TP3 A;  1H0M A;  3WTS C;  2QYO A;  5M3F J;  4CCK A;  1A36 A;  2E5N A;  3OIO A;  2XRN A;  4S05 A;  1SD4 A;  4M3B A;  5EG0 B;  1PP7 U;  1HCR A;  5GAE J;  1BC8 C;  2A5W A;  2DK8 A;  4KDP A;  3IAM 2;  3BZC A;  2GXB A;  1SFO J;  2L54 A;  4RAF A;  2XSD C;  2W84 A;  3WE2 A;  2K9N A;  3K1P A;  2VOP A;  4XRS G;  1ZKG A;  2KFD A;  1W0T A;  3DP7 A;  4LD5 A;  3H9Q A;  2W24 A;  2EV5 A;  3OWT A;  3M8E A;  4ZZD A;  4QTR A;  1SMY F;  1YYV A;  4G9Y A;  3SDB A;  4MO7 A;  5B1A H;  1IRZ A;  5HOO A;  1ZR4 A;  4MFD A;  2ZC2 A;  1VTN C;  2GQQ A;  2IBD A;  3QP5 A;  5JLX A;  2V1U A;  1ONV A;  3KP5 A;  3MAJ A;  2DT6 A;  4C30 A;  1R4M B;  1YO5 C;  2KL4 A;  4V19 K;  1VI0 A;  1QQI A;  4OMY A;  1GLN A;  2BYV E;  3S32 A;  4XR6 A;  2N8G A;  5AIQ A;  4CYC A;  3H0D A;  3E6B A;  1A6Q A;  2XKO A;  4MHG A;  3K2A A;  2FNP A;  2HZT A;  1LPQ A;  1QA6 A;  3AG3 H;  2ESH A;  4YFN F;  4F7Z A;  4B8X A;  3A02 A;  3H35 A;  4KIT B;  1Z7L A;  2Y30 A;  5EYR A;  1R22 A;  1TQM A;  3R0A A;  4ZYG A;  1PVE A;  3U1D A;  3RQI A;  3WGH A;  4FTH A;  4LLL A;  1AKH A;  5J4V A;  3A01 A;  5LRR A;  3KZZ A;  4M9S A;  5LFA A;  3OL3 A;  1I3A A;  3S1M J;  4HQM A;  4AM3 A;  1XGO A;  2LTP A;  4II3 A;  4Q5S F;  2UV1 A;  4ZYA A;  2X85 A;  3RPU A;  2K86 A;  3EDP A;  2BXZ A;  1B8I B;  4BAY A;  3OYI A;  4J19 A;  3FK7 A;  1GXP A;  2CU7 A;  1XG1 A;  3IH4 A;  4MQ9 F;  5F04 A;  3BTJ A;  2LF8 A;  2ZNZ A;  4B48 A;  5C4X J;  4WWC A;  1ZK8 A;  2Y0S A;  1WH5 A;  2ZXH A;  2A3S A;  2R5Z A;  1OCZ H;  2DJI A;  2NS0 A;  3BPV A;  3REO A;  4BXU A;  2WAQ A;  5TRD A;  4A3L J;  4PSW A;  1VZ0 A;  1NG6 A;  5FFX A;  4KMF A;  2H09 A;  2R7R A;  3MZY A;  4R79 A;  3COA C;  4JX6 A;  2ZXW H;  1FP1 D;  2DA4 A;  2GAU A;  1R9T J;  1MDM A;  3RIR A;  4M6Y A;  5DD4 A;  2WAE A;  1KYW A;  2LYC A;  2TCT A;  1H9G A;  1LEA A;  2QWW A;  3Q9V A;  3Q9S A;  3HRS A;  4DNC A;  5LLQ A;  1TT0 A;  1REP C;  3F8N A;  3B73 A;  3D5L A;  3CES A;  4XL9 A;  4E7J A;  3IH3 A;  3OOU A;  1Z3Y A;  1EH7 A;  1OCP A;  1QPI A;  1SFU A;  4XN0 A;  2LKP A;  3SZT A;  4UHT A;  2CQ7 A;  2R7Q A;  5B1B H;  4L5J A;  5B66 C;  5FFZ A;  3W6V A;  3ESW B;  2LR8 A;  2O9L A;  3JW4 A;  1LVK A;  3F6O A;  4RGR A;  3OSF A;  3OYH A;  4XN3 A;  1WJE A;  4XOP A;  1MNM C;  4BGD A;  2FQ4 A;  3DKY A;  4Q47 A;  1SFE A;  2XGX A;  1G8X A;  2PG4 A;  2DMU A;  5EF6 A;  4KN4 X;  5HDN A;  2PQ8 A;  3CCV I;  3H3Z A;  2X6X A;  1G3T A;  2G7H A;  3BTC A;  5CYV A;  4F55 A;  4E7H A;  1WJD A;  2M4G A;  5E17 F;  2V9K A;  1BI3 A;  3EYY A;  4FIS A;  2A61 A;  1MJA A;  1RKT A;  2PMU A;  2IS1 A;  1QVT A;  3PL8 A;  4A2U A;  3FXK A;  4YRV A;  3K69 A;  5EGO B;  2J5P A;  1BI1 A;  3F8F A;  2QKL B;  4A5M A;  3OYF A;  1O3Q A;  2Y75 A;  2JPB A;  1ZLK A;  4PJJ A;  1JHF A;  3H9G A;  4YIR X;  5K7H A;  3DU5 A;  5DDG A;  1W36 D;  4IHX A;  1EH6 A;  4P9U A;  3ZMZ A;  2CSO A;  3CDL A;  4KNY A;  3TO6 A;  4NC6 A;  3E5Q A;  2UXN A;  1N78 A;  3HEF A;  1CF7 A;  1B9N A;  3WTV C;  5FKL A;  2HQ5 A;  1SVO A;  3I54 A;  3NWT A;  1JT6 A;  1F5T A;  2E34 A;  2OUM A;  5DV5 A;  4PUS A;  4PJM A;  2L4M A;  4A3I J;  4RAG A;  1W5T A;  3TBI A;  3CCJ I;  2COB A;  1ZQ3 P;  3HPH A;  1J75 A;  4AIH A;  1O7L A;  5JHU A;  1MBH A;  3M9A A;  5IPA A;  3CCL I;  2W00 A;  1KA8 A;  4NQW A;  1S6L A;  4AVZ A;  2JMW A;  1JI8 A;  3QOD A;  3JRB A;  3EUH A;  5GAG J;  3LNQ A;  2MGQ A;  4KA4 A;  3BTL A;  1IZ1 A;  5BQT A;  1K78 A;  1TWF J;  2HVR A;  3H3U A;  3K7A J;  1V55 H;  3L09 A;  3LMM A;  1LQ1 A;  3I5U A;  1MIJ A;  5GAH J;  2P0W A;  1BR4 A;  1HKS A;  4B44 A;  5LHH A;  1WQ2 A;  5FJ8 J;  1F36 A;  2GIZ A;  5LGN A;  2CG4 A;  2HEO A;  3S1N J;  3K4B A;  3GX4 X;  1X1C A;  5JVT A;  2Y9Y A;  2Q8K A;  3LSH A;  1U5T C;  5JLW A;  1S7E A;  3ZGK A;  3HKZ A;  2D45 A;  4KIS A;  1ETQ A;  3G73 A;  2R7T A;  2EFW A;  4M71 A;  1YJW I;  1RES A;  3GTM J;  4DBQ A;  1BI2 A;  2DQR A;  1DU6 A;  2XGD A;  3WHC A;  3L9F A;  1JKO C;  2DFH A;  1YRN B;  1FSH A;  1JJ6 C;  2MD5 A;  2VPL A;  2FA5 A;  2LMD A;  3PSF A;  3R60 A;  4RBO A;  3RSN A;  4Z6Y A;  1OYY A;  1UCR A;  3CP8 A;  3JAM K;  1D8J A;  1ON2 A;  3U2R A;  4PK4 A;  1Y56 A;  2NYX A;  3MMY B;  2JA7 J;  2HVS A;  2EJR A;  5GPC A;  3S3N A;  3DEE A;  1WJC A;  3QU6 A;  4FT8 A;  5IT3 A;  3KPH A;  2VBW A;  2QSF X;  1AOY A;  1DGR M;  1FLI A;  3GTK J;  3Q0V A;  2Z9O A;  4IHT A;  2XHK A;  5GPA A;  2QBY A;  1JT0 A;  4OIQ F;  5LGU A;  2H94 A;  1L0O C;  2RRE A;  4LK0 F;  1FIP A;  1TBX A;  2PFB A;  4Y13 A;  2L9N A;  3FXU A;  3RPQ A;  2M45 A;  5AIP A;  4I02 A;  1BA5 A;  4G94 A;  3GTQ J;  2F5C A;  4L0Z B;  1USS A;  4LJZ F;  4E7Z A;  3ZCO A;  1A31 A;  3DPT A;  3GXO A;  1UFM A;  2AO9 A;  4XM3 A;  4EJV A;  4AIK A;  2R7W A;  3JRI A;  3L2C A;  3LWF A;  1BBY A;  2E1M C;  4ZYH A;  2XRO A;  2QQA A;  5CJ9 A;  3OYL A;  3J7Y J;  1ENH A;  2X48 A;  2DJN A;  4UV9 A;  2LBF B;  4Y17 A;  4XBF A;  5FB2 A;  3PNY A;  1P92 A;  2HGC A;  2RQP A;  3HUG A;  1OCO H;  3V8K A;  1O4X A;  2P4W A;  2Z2S B;  3I9V 2;  3KP6 A;  5EZG A;  2VUM J;  4BBS J;  3FXO A;  4I0B A;  1J7K A;  2ZNY A;  3BTI A;  5E79 C;  2K9M A;  3LQR A;  1I39 A;  3S3M A;  1X4P A;  1OCC H;  2HOA A;  2IEK A;  3SYT A;  1Y8R B;  2DOD A;  1R49 A;  3BR0 A;  2W4S A;  1XD7 A;  3F23 A;  1YS7 A;  5DCM B;  4HG2 A;  3KLO A;  2XAS A;  1WKM A;  3K1N A;  2R7V A;  3CZ6 A;  2R4G A;  1MBF A;  3AG4 H;  4ESF A;  1X1P A;  4BXX J;  3O8H A;  3L7W A;  1BR2 A;  1TWC J;  4GGG A;  5HVQ C;  2QUF A;  4U0Y A;  4XSZ F;  3PIP F;  1Z05 A;  2DA6 A;  2DFI A;  2GOX B;  1EJ9 A;  2D1H A;  3BG7 A;  2MA3 A;  2H27 A;  4JBA A;  2F5D A;  3GZ5 A;  2VQG A;  4LMY A;  3HRM A;  3FXQ A;  5FO5 A;  4GDF A;  1QO0 D;  2Y2Z A;  1VQO I;  2BOL A;  1Y0U A;  3GUD A;  2CQN A;  4HAM A;  3WGI A;  3S16 J;  2YUS A;  1FMV A;  4CCJ A;  2P5V A;  4KFC A;  2EFP A;  2XAG A;  4KIC A;  4BQA A;  4KT5 C;  2C6Y A;  3I3L A;  2HTS A;  5D4R A;  4ZYD A;  1BIB A;  1SMT A;  3BCA A;  1QGP A;  3CMA I;  4XLH A;  3DF8 A;  1P6R A;  2MLK A;  2FBI A;  1ACI A;  4Y52 J;  3K9T A;  2NS7 A;  3CLQ A;  3HPG A;  4OAY A;  2M8G X;  3I59 B;  1DPR A;  2R5Y B;  2R3S A;  1ZH5 A;  4XOR A;  2NNN A;  3GLX A;  2O03 A;  2JWT A;  4Y3O A;  2ECB A;  4GYG A;  1KQ9 A;  1U2W A;  1UHW A;  1X1B A;  4KIB A;  1MH4 A;  3TKY A;  3JTG A;  2IT0 A;  4RB2 C;  2KQR A;  3MCZ A;  4GO1 A;  4UY8 I;  4L9N A;  1JTX A;  2IA1 A;  5JHF A;  2K4B A;  3G3Z A;  3QYE A;  4RDU A;  2P5K A;  2ZME A;  4JOM A;  5F1J A;  5IP6 A;  2MLG A;  3ZR8 X;  5KHD A;  3DTE A;  3AAF A;  1UHS A;  1WZ2 A;  3ELK A;  2E71 A;  2FUG 2;  3I56 I;  1OMI A;  1FSE A;  4HX7 A;  2KRH A;  2V1D A;  3ABT A;  2EFQ A;  3IWZ A;  4UVA A;  5EDN A;  4EGZ A;  4DJA A;  2CV2 A;  2FX0 A;  1G3W A;  4PCQ A;  3I53 A;  4XMY A;  1WPK A;  1I1G A;  1ODD A;  3KLN A;  1HC8 A;  3LAP A;  2DT7 B;  2WWY A;  2IAI A;  2JSP A;  2GOM A;  3PO3 J;  1TWH J;  3RKX A;  4CYD A;  2EH3 A;  2Q0O A;  5J8F A;  2OJE D;  4KJZ A;  1SAX A;  3HOU J;  2JA6 J;  3ZQH A;  2P7C B;  1OCT C;  1D5Y A;  1O3S A;  2LNB A;  1Y6I A;  1E3O C;  4MGR A;  2EA2 A;  4JX4 A;  1IJW C;  4A3G J;  1VQM I;  1OYI A;  2ZJQ F;  4LIV A;  2H8W A;  2CFX A;  4B3X A;  4WXC A;  2KIU A;  4RGU A;  3AFH A;  2BGC A;  1XGN A;  3DPL C;  1FJL A;  5J6X A;  2IS2 A;  2V79 A;  1ZG5 A;  1P9Q C;  1T95 A;  1Z3X A;  2QEN A;  1K78 B;  1L3L A;  3GTL J;  2LH9 A;  4L5I A;  1TWG J;  1XTA A;  3GZ6 A;  1H88 C;  3CP2 A;  1XSV A;  1K79 A;  3KEQ A;  5E3M A;  1D3Y A;  3SFI A;  1BC7 C;  5D6F A;  2KT0 A;  1GDT A;  4N4N B;  1V5G A;  1KU2 A;  4LG0 B;  2XUB A;  4HV6 A;  4N0B A;  3O2P E;  2IA2 A;  4RMN A;  2YS9 A;  4X0G A;  2BW3 A;  5F08 A;  3VYU B;  1JHH A;  4YFK F;  2VBX A;  1HKQ A;  4A6E A;  1V5E A;  1IXC A;  2LY1 A;  3OYC A;  3I4M J;  3QP6 A;  1U9O A;  2OCC H;  1WRJ A;  2I8D A;  1SFX A;  4I0A A;  2M7B A;  1ETV A;  5F0C A;  5HDG A;  3RTR A;  5HS9 A;  3MD2 A;  3J81 Z;  2BBY A;  4LK1 F;  3F21 A;  3C3W A;  2WV1 A;  3K4L A;  3E5U A;  4BYY A;  2EA4 A;  4ZDP A;  4ZJZ A;  5E3N A;  1NHA A;  2FOK A;  4P9F A;  1R1V A;  2L01 A;  5D5U B;  1H89 C;  1YJN I;  1AHD P;  2UXX A;  4G6Q A;  2GA2 A;  1PYV A;  4W1U A;  2Z33 A;  1RR7 A;  3LFU A;  5E20 A;  2OQR A;  4QIW N;  1HKT A;  4CZZ A;  3MKZ A;  3TED A;  4OIO F;  2XGC A;  4GYI A;  3CUQ B;  2X0L A;  2L7M P;  2FEZ A;  2VB6 A;  4BL0 B;  2L7Z A;  4Q4Z F;  1SD6 A;  2WB1 N;  1ORK A;  2R7D A;  2FRH A;  2XAQ A;  1I3Q J;  3FK6 A;  2BY2 A;  3CTA A;  4EAT A;  5DS9 A;  1FP2 A;  5K1Y A;  1YW8 A;  1M1E B;  3K70 D;  2DA3 A;  3KZI C;  2HQN A;  4V2F A;  4UVB A;  3VYR B;  3HSF A;  1B8I A;  2F48 A;  2EQR A;  2HOE A;  2KRC A;  3JRE A;  1IN6 A;  2B7E A;  4PZJ A;  2QF7 A;  4D5F A;  1B9M A;  2DT5 A;  2R7F A;  2Z3Y A;  4K2E A;  3H92 A;  5CQG A;  3E5X A;  5ICG A;  3GTP J;  4Y4R A;  2GM4 A;  1R36 A;  2DA1 A;  4GFB A;  2FBK A;  4PJN A;  1TW2 A;  1MJ9 A;  5L3B A;  3DTI A;  3KFW X;  4Z2Y A;  2RV8 A;  3JCU C;  1FMW A;  2BZT A;  2OA4 A;  2V7F A;  1BL0 A;  1DP7 P;  1QU3 A;  4RAZ A;  1XDU A;  2CS3 A;  5TIS C;  4RAY A;  2I5U A;  3MKY B;  3HL2 A;  4CCO A;  2JQ7 A;  3SXY A;  3LA3 A;  5DUI A;  1OR7 A;  2EWN A;  2VJ4 A;  3FMS A;  1K61 A;  2FML A;  3PNV A;  4P55 A;  1X3W B;  3CMM A;  2ADU A;  1WWX A;  1JUM A;  5D6E A;  1TW3 A;  1Z6T A;  4IXA A;  4M3D A;  4RA2 A;  4RGS A;  2UUZ A;  1T08 B;  2CFO A;  3ONQ A;  5HNF A;  2BHZ A;  2ZO4 A;  3FKJ A;  3WG7 H;  1ZGJ A;  3PM1 A;  4B43 A;  4LOC A;  5L3C A;  1LDK B;  1HST A;  5FD6 A;  4IPA A;  4UUV A;  3FZV A;  4HYE A;  4A3F J;  4DOZ A;  1O3T A;  2JA8 J;  3D0S A;  3ULQ B;  2XAU A;  2QVO A;  4Y7N J;  2DMN A;  1OYW A;  2KDZ A;  3OS0 A;  2FE3 A;  2HXI A;  3HTS B;  3CUQ C;  2BEO A;  2JK3 A;  4LB5 A;  5B3S H;  4J00 A;  3G2B A;  4BY7 J;  4A0X A;  1F43 A;  3SHF A;  2RN7 A;  1YW9 A;  3BC8 A;  2FU4 A;  3BOQ A;  1Z91 A;  4ZZL A;  3OYG A;  3DBH B;  1T39 A;  4C3J J;  1RIO H;  3HC7 A;  1LDJ A;  3HOZ J;  3KET A;  2VAS A;  4XRF A;  3RI4 A;  4JX5 A;  3E7L A;  4ITV A;  5EGO A;  5ERI A;  3F8C A;  3TQN A;  4I01 A;  5CQE A;  4DYR A;  1A6I A;  3ZQ7 A;  1IN7 A;  4EV0 A;  1TLH B;  3MKW B;  2GZW A;  1HDP A;  2MFZ A;  1Y8Q B;  5M5Y J;  4MIM A;  2KIS A;  1O3R A;  1H8A C;  1PJR A;  2CO5 A;  1OFC X;  4NB5 A;  1WVR A;  1RUO A;  1GXQ A;  2KP6 A;  3LA2 A;  2PEX A;  2FOW A;  3HRT A;  4P96 A;  4S04 A;  3ZRG A;  1QNT A;  1UJ8 A;  3R61 A;  2DA7 A;  3Q3S A;  3OMY A;  3PJR A;  3EET A;  3V7S A;  3CCQ I;  3C2G A;  4EEF G;  1VND A;  2M0M A;  1RKW A;  2PJR B;  4UB6 C;  3HDD A;  4FE4 A;  2H1L A;  3HHH A;  4Y33 A;  1QRY A;  1KU3 A;  1FX7 A;  4D9J A;  3ECO A;  1T0F A;  3L2R A;  3QQA A;  3J80 K;  1ZHF A;  3S93 A;  4CH7 A;  3WTX C;  2Y0M A;  2X51 A;  4HBL A;  2FXA A;  3GFJ A;  2XC7 A;  3RDI A;  4A5N A;  4M6X A;  5CKT A;  4A0Z A;  3ROU A;  3FWE A;  4CGZ A;  4A3D J;  1Y0N A;  1GV5 A;  2YX4 A;  3H1C A;  4B3A A;  3HBL A;  1I1S A;  1TTY A;  1F4K A;  4IL6 C;  2XV4 S;  2NXN B;  2EPF A;  1T98 A;  1FBQ A;  2AS5 F;  2NVQ J;  3F0C A;  1IG7 A;  3CCR I;  2DOA A;  4AC0 A;  4BQQ A;  2XB0 X;  2DMQ A;  2L4A A;  5LD2 C;  1R1U A;  2K9S A;  2AXL A;  5L3D A;  2W1O A;  4M6V A;  3V42 A;  1I50 J;  1S5L C;  4HW0 A;  1MGT A;  2LKX A;  2QGU A;  4OMZ A;  4KYW A;  5E8I A;  1IN8 A;  2HFH A;  3RCO A;  2HDC A;  3K1M A;  3HOV J;  4QLC U;  2LVS A;  3HM5 A;  3BRO A;  4OWR B;  5K7F A;  3DCF A;  4DYQ A;  1OJL A;  5J1Y A;  2PMZ N;  3KYD B;  2XSJ C;  5CVI A;  3KZY A;  4CA0 A;  4E7L A;  2R93 J;  1YRN A;  5F6F A;  3CD6 I;  4M3G A;  3IRQ A;  2Q2E B;  4J01 A;  2F5E A;  1IF1 A;  2L2O A;  5LRS A;  2A5Y B;  1HW2 A;  1N77 A;  3KEY A;  4XRS A;  3DBR B;  1WCM J;  2LDU A;  2VN2 A;  1E3P A;  3I55 I;  4L0Y B;  4A3B J;  1HA8 A;  3BG6 A;  3E1S A;  3WGG A;  3RZO J;  2KPM A;  2CGP A;  3VDX A;  3AL0 C;  2VJJ A;  3V8J A;  3A0H C;  2PX9 A;  4FET A;  3LSG A;  1QZY A;  4BS9 A;  4DZP A;  4AUX A;  2OQG A;  4ZTF A;  2M87 A;  4IZZ A;  2GXA A;  2ME6 A;  2A07 F;  3B6C A;  3KP3 A;  3FKI J;  2VQH A;  5TGT A;  3NEU A;  2HDD A;  1RUN A;  2HOS A;  1X58 A;  2VKH A;  1E17 A;  2CRG A;  2PI0 A;  3I64 A;  2R7S A;  2QCO A;  4RM3 A;  2A69 F;  5J40 A;  2RQQ A;  4HNV A;  3W2W A;  4HDU A;  2Z16 A;  1QZZ A;  2HU9 A;  2L3D A;  2M3A A;  4BHB A;  5ICE A;  3JRC A;  5FRO A;  2JSC A;  5J47 A;  4YIF A;  1GUU A;  2H8R A;  3LST A;  3QOE A;  4DGW B;  5FRN A;  1U5T B;  3ZOB A;  1R5G A;  4RLQ A;  4WXH A;  2A05 A;  4EJT A;  4U87 A;  5J4Y A;  2NS8 A;  1K6O A;  4I7H A;  3BT9 A;  4C3H J;  2NVT J;  1S72 I;  2ZXJ A;  3T5X A;  1XMK A;  2W7N A;  3BR3 A;  3DXJ F;  4IRH A;  4DBR A;  3PFI A;  3Q5F A;  4FCY A;  3G1L A;  2VQL A;  4NBQ A;  2DTR A;  3IKT A;  1FBS A;  2FNA A;  1YW7 A;  4A3E J;  3VSL A;  2VXZ A;  4D1Q A;  3KP4 A;  3BR5 A;  2KKO A;  3BP8 A;  3OOP A;  4O5V A;  2VXD A;  5ILV A;  2VIX A;  3KIO A;  2JA2 A;  3DWL E;  3SEQ A;  4HX8 A;  4HEA 2;  1MH3 A;  2F2E A;  2V6C A;  3ZMD A;  4DW6 A;  5HLT A;  3E6M A;  2OZU A;  3D5S C;  3OYN A;  1KQ0 A;  2COM A;  1UG0 A;  2TDX A;  3O3K A;  4OIP F;  4CXF A;  3L2W A;  1MJB A;  1UB9 A;  1SC7 A;  1WH7 A;  2RNG A;  2E7X A;  1FY7 A;  3OL4 A;  2DA5 A;  1AU7 A;  3ZQC A;  2RC4 A;  3G1M A;  2YX7 A;  3GCM A;  1C0W A;  4KT6 A;  5ILS A;  3K10 A;  2EIK H;  5BPI A;  5ED4 A;  4G6D A;  3OYM A;  2CWE A;  2Z5U A;  4F52 A;  2DA2 A;  2E1O A;  3IKV A;  3HRU A;  3OY9 A;  1X1A A;  2QSH X;  1J9I A;  3O8G A;  4AD9 A;  5HDK A;  3G4S I;  2ACJ A;  2Z1D A;  3EUA A;  3SFZ A;  2E1M B;  2AQF A;  2J5O A;  3G6E I;  4EGY A;  5F0F A;  2MD0 A;  2JN6 A;  1ETX A;  1NG7 A;  3WOD F;  2IJL A;  1IRX A;  1B6A A;  1QVU A;  1I6X A;  1XMX A;  5C4J J;  2VE9 A;  1V5F A;  1HDD C;  1SD7 A;  3FMQ A;  4DYC A;  1QPM A;  2CYY A;  1AKH B;  2Q1Z B;  3A01 B;  1V3F A;  3TGN A;  5JR3 A;  3CC4 I;  1Y1W J;  3GLL A;  1WGX A;  3SEZ A;  1G3Y A;  4CCM A;  3TDU C;  5D8K B;  4BAC A;  1W5C C;  1ZAR A;  2R5Y A;  3RJP A;  3E0J B;  1Y39 A;  3HSR A;  3H5R A;  4C2U A;  2HYF A;  2IGO A;  3HIF A;  3CCU I;  2RKH A;  2Y0S N;  2W85 A;  2YU3 A;  2VLA A;  4IHV A;  4FQG A;  3BJ6 A;  4PFP A;  5FLX K;  1U8B A;  2K9L A;  3WG9 A;  3SQN A;  1R23 A;  4HNT A;  1AWC A;  3TL4 X;  1D0Y A;  2HS5 A;  4LIU A;  4BQO A;  1HF0 A;  1I27 A;  5DEQ A;  5IYB J;  2R7U A;  4CCL A;  1WJB A;  1IRG A;  2R7Z J;  2ME0 A;  3LA7 A;  1AA7 A;  3SZG A;  1LNW A;  4OU0 A;  2A6H F;  2HYJ A;  4UVC A;  4X6A J;  1W7P D;  2LG4 A;  2K85 A;  3PUF A;  4PSX A;  2LC2 A;  2IW5 A;  4DQ2 A;  3TOB A;  4ZYE A;  3LSI A;  1MBG A;  2VKV A;  3L2U A;  3S17 J;  2Y48 A;  4G12 A;  4HA8 A;  1PUE E;  2VKE A;  2K27 A;  3H9J A;  4D5C A;  5F1R A;  2V9V A;  3O6B B;  4XRM A;  1ON1 A;  2ZFU A;  3MZ8 A;  4M9Z A;  4BUP A;  1RRJ A;  2E2I J;  3LSJ A;  4BE1 A;  2KIF A;  2HTJ A;  1LDD A;  4W97 A;  2X6O A;  3ZP5 A;  4L5E A;  2E2H J;  3MKL A;  2DW4 A;  4CCN A;  4BHC A;  2AXT C;  3ASN H;  2L9V A;  4A6D A;  2QKM B;  2GWR A;  3HOT A;  2EB7 A;  3P7N A;  5IOZ A;  1TQI A;  2XAH A;  3TO9 A;  2X1C A;  4HF2 A;  4IOA F;  2FD5 A;  4ENN A;  5DUK A;  1XGS A;  3CJN A;  3QPL A;  5F27 A;  3BWG A;  4JP0 A;  2DPD A;  1SVM A;  2H1K A;  1IW7 F;  2VON A;  2MSY A;  1UZC A;  2WAD A;  1YIJ I;  1FOK A;  3IC7 A;  1JE8 A;  4EVI A;  1K4S A;  2DOF A;  1V54 H;  2DTZ A;  4AYB A;  5HS8 A;  1LFB A;  4MEX F;  1YIO A;  1KU7 A;  4M72 A;  3LOC A;  2M9H A;  3BQZ A;  4GRI A;  5BOX A;  3TMO A;  1T33 A;  4KIG A;  1HXD A;  1U3E M;  2YSR A;  2CUZ A;  2HWV A;  2GIV A;  1X19 A;  1CF7 B;  2MBF A;  4WK8 F;  2IGN A;  3L2Q A;  3M1E A;  1K4T A;  3ZMS A;  5B5E C;  4CO8 A;  5F64 A;  5BS6 A;  1Z9C A;  2LD5 A;  1EA3 A;  3VYS B;  3CJQ B;  4I6Z A;  3PNT A;  3OYK A;  4MTD A;  1XX5 A;  2EBI A;  4MNU A;  1OKR A;  1IDZ A;  3VB2 A;  2E60 A;  2O8X A;  1U9N A;  1IUY A;  4O3M A;  1X2M A;  3IH2 A;  1NTC A;  2QQ9 A;  1D0Z A;  2EZI A;  1TQP A;  1ZG3 A;  2A68 F;  2GBY A;  4PGG A;  1HSJ A;  3PIO F;  4HNU A;  3TP0 A;  4NQW B;  5JI6 A;  3WE3 A;  1P4W A;  1FOY A;  2AQE A;  3FBI B;  1G3S A;  2BE5 F;  3C2B A;  3KYL A;  2XDV A;  4NHJ A;  1W7P B;  3QYF A;  3H5N A;  1TC3 C;  1MSF C;  5LBQ A;  4A3J J; 
#chains in the Genus database with same CATH homology
 1LEB A;  2ZKZ A;  3GF2 A;  3ZN1 A;  1J5Y A;  2OAZ A;  3I58 A;  4YG2 F;  4IRG A;  1XB4 A;  2STT A;  4GCV A;  5CVU A;  3QOP A;  4ENK A;  4R8H A;  2FMY A;  2VE8 A;  4JQF A;  3J80 Z;  2P8T A;  1U8R A;  3CDH A;  2G7U A;  3FM5 A;  1UHM A;  1XGM A;  4OIR F;  1IXS B;  2OD5 A;  5KVR A;  5DCF A;  2ZBK A;  4ENJ A;  2X4H A;  3R0J A;  2DBB A;  1H9T A;  3CLO A;  1J0R A;  1ZLJ A;  6PAX A;  3HYI A;  3MQ0 A;  4U88 A;  3RYP A;  2XVC A;  2WV0 A;  3KEO A;  4L18 B;  4UV8 A;  3C7J A;  3IRR A;  2XKP A;  2HKX A;  3V8L A;  1S8N A;  4KN7 X;  5LHG A;  1DUX C;  3QAH A;  2YPR A;  4M74 A;  4IVN A;  1KU9 A;  5HLI A;  3GVA A;  2EFN A;  1KQ8 A;  1GVJ A;  2HKO A;  4MQV A;  5E1X A;  4I09 A;  1T38 A;  4O6J A;  3VFZ A;  4MEY F;  5E18 F;  3BY6 A;  3HTU A;  3ERE D;  5AON A;  2OBP A;  4G8X A;  2FBH A;  2E1C A;  1XDS A;  3IHU A;  1Q1H A;  1QBJ A;  2VC0 A;  1R5H A;  2O3F A;  2B0L A;  1XMA A;  2EV0 A;  2FQ3 A;  2W57 A;  5LHI A;  1UST A;  1FT9 A;  2L02 A;  3BJA A;  4HLX A;  1V4R A;  4EM1 A;  2VOD A;  1EH8 A;  1LVA A;  1R1T A;  4A0Y A;  1E2X A;  3WTY C;  1KYZ A;  4L9J A;  3TOA A;  2W25 A;  4H0E A;  4WCG A;  5J8C A;  4HOB A;  3FXR A;  5LEK A;  3N97 A;  2FSW A;  2O0Y A;  1O7F A;  2MH9 A;  2XIG A;  1S7O A;  2M30 A;  2ZJ2 A;  3WTU C;  3NRV A;  4EJO A;  5HLG A;  3WU0 A;  5K5O A;  1OPC A;  1P4A A;  4HX4 A;  3ABU A;  1FYK A;  2P6S A;  1K7A A;  1WSU A;  1P4X A;  2H6C A;  1A04 A;  4KIF A;  4MTE A;  4IJA A;  3JAM Z;  5FLX Z;  2O6G E;  1U5T A;  3J7A O;  3V4G A;  2JT1 A;  3GFI A;  2RDP A;  1FBU A;  1FWZ A;  2P5L C;  2PMH A;  1B1B A;  2HQR A;  3WTW C;  4LLN A;  2RVC A;  5HLH A;  4G7O F;  4FX0 A;  3ZMT A;  4KUM A;  3EYI A;  3WTT C;  2F5F A;  1YS6 A;  1ZRF A;  4CDG A;  4HLY A;  1BM9 A;  1B4A A;  3T1B A;  1MZB A;  3P9K A;  4N9I A;  1FNN A;  1F1Z A;  2QQB A;  3DQV C;  5DYM A;  1F9N A;  1FYL A;  2O61 A;  2KIM A;  2K7L A;  5H20 A;  1HBX G;  2ZCW A;  3F8M A;  3SZP A;  5EEG A;  5ICC A;  2ZFW A;  3IWF A;  2DLL A;  3ZPL A;  3ZMV A;  3HHG A;  1FZP B;  2UZK A;  1ZYR F;  1I5Z A;  1FC3 A;  2ISY A;  3JSO A;  2IP2 A;  2E1N A;  1T2K A;  1Z6R A;  1HW5 A;  3DEU A;  3JTH A;  3RYR A;  3PQJ A;  3E6D A;  2QZ8 A;  1IXR C;  4PDK A;  2VC1 A;  2KJB A;  3NQO A;  4ESJ A;  4ON0 A;  3C18 A;  4EM0 B;  2K4J A;  5D5X B;  5JFR A;  5IT9 K;  2PBI A;  2H6B A;  1YG2 A;  3T0Y A;  1XCB A;  4UNO A;  4Y15 A;  3BPX A;  1O57 A;  1LB2 A;  3KP7 A;  3QU3 A;  1MKM A;  2A6E F;  3TO7 A;  4XLP F;  5H6R A;  1KGS A;  3J81 K;  4L9T A;  3ML6 A;  3I4P A;  1HW1 A;  5CVV A;  4A12 A;  1IRF A;  3DKW A;  3JSP A;  4UXN A;  1ZAO A;  2KRF A;  1BI0 A;  2ESN A;  1S7A A;  2PJP A;  1IAW A;  1R7J A;  1XCV A;  2PN6 A;  4L9V A;  5DCM A;  2P6T A;  2M5W A;  3QRF F;  2VOO A;  4OIN F;  4U0W A;  4B09 A;  5D8L B;  5D5W B;  3GFM A;  3V7C A;  1RNL A;  2PLY A;  3QPT A;  3BDD A;  2LF7 A;  3CUO A;  2Z99 A;  2JZY A;  2VBY A;  3QPH A;  2GA1 A;  2ISZ A;  2VT3 A;  1ZRE A;  1RI7 A;  1STZ A;  3CO7 C;  2IRF G;  1FYM A;  5L3E A;  5A2Q K;  1W7P A;  4ASN A;  1FPQ A;  3U9G A;  3ECH A;  3I59 A;  3ZMU A;  1U6G A;  3E3V A;  2HR3 A;  3RKW A;  2FF4 A;  5E1W A;  3TDZ C;  2RNJ A;  3R6S A;  1TNS A;  3FF5 A;  3LFK A;  1MDM B;  4R1H A;  4U7B A;  2MC3 A;  2STW A;  5FGM A;  3C1D A;  3GO5 A;  3GFL A;  4FHT A;  2NNY A;  2ETH A;  3S2W A;  3B02 A;  4HF0 A;  4M9X A;  1ZN2 A;  1DPU A;  4RB0 A;  4U0V A;  4E70 A;  4PGH A;  3K2Z A;  3M7G A;  4QWQ A;  4AVP A;  2WC2 A;  1YQA A;  1S3J A;  4BH9 A;  4D0P A;  1T6S A;  1Z7U A;  3M8F A;  3GWZ A;  4XSX F;  4HV5 A;  1BN5 A;  2P7V B;  5K5R A;  1XSX A;  1J2X A;  1B59 A;  2DAO A;  5BMZ A;  1XSD A;  3FX3 A;  1YLF A;  3F3X A;  4LGW A;  2QLZ A;  3F6V A;  3KP2 A;  4LG0 A;  4EM2 A;  4G7Z F;  2HYG D;  4EJU A;  2ELH A;  4G7H F;  2DPU A;  2NRA C;  3K0L A;  2EK5 A;  3VEP A;  2D1V A;  4WXD A;  3BJO A;  4HZF A;  4CIC A;  1Z1D A;  1PP8 F;  4ETS A;  1D8K A;  1BIA A;  1GHC A;  2CW0 F;  4Q48 A;  5ILU A;  2DQL A;  1G4D A;  2QM3 A;  4HF1 A;  4CHU A;  1CGP A;  2E7W A;  4P5O A;  2BV6 A;  2NAZ A;  2WTE A;  3CUQ A;  1XN7 A;  4I98 B;  4IF4 A;  2DU9 A;  2EV6 A;  5KK1 A;  2MH2 A;  1TNT A;  3GEZ A;  4HDV A;  1BJA A;  2V1X A;  3CO6 C;  3IL2 A;  1X3U A;  4N9H A;  3F72 A;  5H6Q A;  2KJC A;  1IN5 A;  1WI9 A;  5K5Q A;  4LB6 B;  3W6J B;  3WTZ A;  3T8R A;  1S29 A;  4FX4 A;  3LQQ A;  3VOE A;  1J59 A;  4ZH4 F;  2XAF A;  4ESB A;  3HOS A;  2M1B A;  1ZGA A;  5ICF A;  4EQQ A;  4GXO A;  3E6C C;  4XLN F;  3FM3 A;  5LEJ A;  4ENM A;  2QBY B;  2DI3 A;  3VOD A;  5LGT A;  3ISP A;  2VT2 A;  2CQK A;  5CVJ A;  2DK5 A;  2IVM A;  1W4M A;  1ZRC A;  5TJJ A;  5E8G A;  4RB3 C;  3BZ6 A;  2EFO A;  2DO7 A;  4OOI A;  2JPC A;  4WF2 A;  2G9W A;  3ZN0 A;  3F22 A;  1ZRD A;  3GYH X;  1R58 A;  4LLG F;  1YTY A;  1DDN A;  3I71 A;  2IPQ X;  4WX9 A;  4BHP A;  4I2O A;  2IA0 A;  4RB1 A;  5EEH A;  3HSE A;  3E97 A;  5IT9 Z;  1JXS A;  4AWX B;  4RS8 A;  3KE2 A;  1ULY A;  2LSO A;  4KMU X;  1HQC A;  3T8T A;  1JGS A;  1D5V A;  5CVR A;  4EMS A;  3FMR A;  2K02 A;  5FD5 A;  2OZ6 A;  3LAJ A;  5BPD A;  4YFX F;  2OU2 A;  3WU1 B;  2M8E A;  1W5S A;  5D5V B;  1R00 A;  1LJ9 A;  1BOA A;  3MFK A;  2YR2 A;  4AIJ A;  3RKY A;  1EV7 A;  3GW2 A;  2UWM A;  1RZ4 A;  4BNC A;  2XAJ A;  2GXG A;  3R4K A;  4YII A;  3FHZ A;  1IN4 A;  4TV7 A;  3I0T A;  3MZH A;  4JK1 X;  2ZME B;  2JTV A;  2Q2E A;  1ZG1 A;  1SD5 A;  2RGV A;  2D2W A;  3W6K B;  2VBZ A;  4HQE A;  1YFH A;  5DD8 A;  1PDN C;  5CLS A;  5E1Z B;  1P2F A;  1U78 A;  3DV8 A;  4EJW A;  5A2Q Z;  4IHS A;  1G6N A;  3DFG A;  3OV8 A;  4U7D A;  1MD0 A;  4IRI A;  2JRT A;  4M73 A;  3P9C A;  3P9I A;  3L00 A;  4RGX A;  3PQK A;  3EQL F;  3F8B A;  3MEX A;  3N4M A;  5D4S A;  5HS7 A;  5L3G A;  3V7R A;  3MWM A;  3KCC A;  5L3F A;  4LFU A;  1H0M A;  3WTS C;  2QYO A;  4S05 A;  2XRN A;  1PP7 U;  1SD4 A;  1BC8 C;  2DK8 A;  4KDP A;  2GXB A;  2L54 A;  2W84 A;  3WE2 A;  3K1P A;  2VOP A;  3DP7 A;  4LD5 A;  2W24 A;  2EV5 A;  3M8E A;  4ZZD A;  1SMY F;  1YYV A;  4G9Y A;  5HOO A;  1VTN C;  2GQQ A;  3QP5 A;  2V1U A;  1ONV A;  3KP5 A;  3MAJ A;  1YO5 C;  1QQI A;  4OMY A;  2BYV E;  5AIQ A;  3E6B A;  2XKO A;  4MHG A;  2FNP A;  2HZT A;  2ESH A;  4YFN F;  4F7Z A;  4B8X A;  1R22 A;  1TQM A;  3R0A A;  4ZYG A;  3U1D A;  3WGH A;  4LLL A;  5LRR A;  3KZZ A;  4M9S A;  4HQM A;  1XGO A;  4Q5S F;  3RPU A;  2K86 A;  3EDP A;  4BAY A;  1GXP A;  4MQ9 F;  2LF8 A;  2ZNZ A;  4WWC A;  2A3S A;  2NS0 A;  3BPV A;  3REO A;  4BXU A;  5TRD A;  5FFX A;  4KMF A;  2H09 A;  3MZY A;  4R79 A;  3COA C;  1FP1 D;  2GAU A;  1MDM A;  3RIR A;  4M6Y A;  5DD4 A;  1KYW A;  1H9G A;  1LEA A;  2QWW A;  3Q9V A;  3Q9S A;  3HRS A;  4DNC A;  5LLQ A;  1REP C;  3F8N A;  3B73 A;  3D5L A;  1EH7 A;  1SFU A;  2LKP A;  3SZT A;  4UHT A;  4L5J A;  5FFZ A;  3JW4 A;  3F6O A;  4RGR A;  4Q47 A;  1SFE A;  2XGX A;  2PG4 A;  5HDN A;  4KN4 X;  2PQ8 A;  3H3Z A;  1G3T A;  2G7H A;  5CYV A;  5E17 F;  1BI3 A;  3EYY A;  2A61 A;  1MJA A;  2PMU A;  4A2U A;  3K69 A;  2J5P A;  1BI1 A;  3F8F A;  4A5M A;  1O3Q A;  2Y75 A;  2JPB A;  1ZLK A;  1JHF A;  5DDG A;  1EH6 A;  4P9U A;  3ZMZ A;  2CSO A;  4KNY A;  3TO6 A;  3E5Q A;  2UXN A;  1CF7 A;  1B9N A;  3WTV C;  3I54 A;  1F5T A;  5DV5 A;  2L4M A;  1W5T A;  1J75 A;  4AIH A;  1O7L A;  5JHU A;  3M9A A;  1KA8 A;  4NQW A;  1S6L A;  3EUH A;  4KA4 A;  1IZ1 A;  5BQT A;  1K78 A;  3H3U A;  3L09 A;  1LQ1 A;  3I5U A;  5LHH A;  1HKS A;  1WQ2 A;  5LGN A;  2CG4 A;  2HEO A;  3GX4 X;  5JVT A;  2Q8K A;  1U5T C;  2D45 A;  3G73 A;  2EFW A;  4M71 A;  1BI2 A;  2DQR A;  3L9F A;  1FSH A;  2MD5 A;  2FA5 A;  3R60 A;  1OYY A;  1UCR A;  3JAM K;  1D8J A;  1ON2 A;  3U2R A;  2NYX A;  2EJR A;  3QU6 A;  4FT8 A;  5IT3 A;  1FLI A;  2VBW A;  1AOY A;  2Z9O A;  4IHT A;  2XHK A;  2QBY A;  4OIQ F;  5LGU A;  2H94 A;  1L0O C;  4Y13 A;  4LK0 F;  1TBX A;  2PFB A;  3FXU A;  3RPQ A;  2M45 A;  5AIP A;  4I02 A;  4G94 A;  2F5C A;  4L0Z B;  1USS A;  4LJZ F;  3DPT A;  3GXO A;  1UFM A;  4AIK A;  4EJV A;  3L2C A;  3LWF A;  1BBY A;  4ZYH A;  2XRO A;  2QQA A;  5CJ9 A;  4UV9 A;  4Y17 A;  4XBF A;  5FB2 A;  1P92 A;  2HGC A;  2RQP A;  3HUG A;  3V8K A;  2P4W A;  3KP6 A;  4I0B A;  1J7K A;  2ZNY A;  3LQR A;  1XD7 A;  3F23 A;  1YS7 A;  5DCM B;  3KLO A;  2XAS A;  1WKM A;  3K1N A;  4ESF A;  3L7W A;  4GGG A;  5HVQ C;  2QUF A;  4U0Y A;  4XSZ F;  1Z05 A;  2DFI A;  2D1H A;  2MA3 A;  2H27 A;  4JBA A;  2F5D A;  3GZ5 A;  4LMY A;  3HRM A;  3FXQ A;  5FO5 A;  1QO0 D;  3GUD A;  1Y0U A;  4HAM A;  3WGI A;  2P5V A;  4KFC A;  2EFP A;  2XAG A;  4KIC A;  4BQA A;  4KT5 C;  2C6Y A;  2HTS A;  5D4R A;  4ZYD A;  1BIB A;  1SMT A;  1QGP A;  3DF8 A;  1P6R A;  2MLK A;  2FBI A;  3K9T A;  3I59 B;  1DPR A;  2R3S A;  1ZH5 A;  2NNN A;  3GLX A;  2O03 A;  4GYG A;  1KQ9 A;  1U2W A;  1UHW A;  4KIB A;  3TKY A;  3JTG A;  2IT0 A;  4RB2 C;  3MCZ A;  4GO1 A;  4L9N A;  2IA1 A;  2K4B A;  3G3Z A;  2P5K A;  2ZME A;  2MLG A;  3AAF A;  3ELK A;  1OMI A;  1FSE A;  4HX7 A;  2V1D A;  3ABT A;  2EFQ A;  3IWZ A;  4UVA A;  4EGZ A;  1G3W A;  4PCQ A;  3I53 A;  1I1G A;  1ODD A;  3KLN A;  3LAP A;  2WWY A;  3RKX A;  4CYD A;  2Q0O A;  5J8F A;  1SAX A;  2P7C B;  1O3S A;  2LNB A;  4MGR A;  2EA2 A;  1OYI A;  2CFX A;  4WXC A;  2KIU A;  4RGU A;  2BGC A;  1XGN A;  3DPL C;  5J6X A;  2V79 A;  1ZG5 A;  2QEN A;  1K78 B;  1L3L A;  4L5I A;  3GZ6 A;  1XSV A;  1K79 A;  3KEQ A;  1D3Y A;  1BC7 C;  5D6F A;  1KU2 A;  4LG0 B;  2XUB A;  4HV6 A;  4N0B A;  3O2P E;  2IA2 A;  4YFK F;  1JHH A;  2VBX A;  1HKQ A;  4A6E A;  1IXC A;  3QP6 A;  1WRJ A;  1SFX A;  4I0A A;  5HDG A;  3RTR A;  5HS9 A;  3J81 Z;  2BBY A;  4LK1 F;  3F21 A;  3C3W A;  3E5U A;  4BYY A;  2EA4 A;  1NHA A;  2FOK A;  4P9F A;  1R1V A;  2L01 A;  5D5U B;  2UXX A;  4G6Q A;  2GA2 A;  2Z33 A;  5E20 A;  2OQR A;  1HKT A;  4CZZ A;  4OIO F;  4GYI A;  3CUQ B;  2X0L A;  2FEZ A;  4Q4Z F;  1SD6 A;  2R7D A;  2FRH A;  2XAQ A;  3CTA A;  1FP2 A;  5K1Y A;  1YW8 A;  2HQN A;  4UVB A;  3HSF A;  2HOE A;  1IN6 A;  4PZJ A;  1B9M A;  2DT5 A;  2R7F A;  2Z3Y A;  4K2E A;  3H92 A;  3E5X A;  5ICG A;  1R36 A;  2FBK A;  1TW2 A;  1MJ9 A;  5L3B A;  3KFW X;  4Z2Y A;  2RV8 A;  2OA4 A;  1DP7 P;  4RAZ A;  1XDU A;  4RAY A;  3SXY A;  3LA3 A;  5DUI A;  1OR7 A;  2EWN A;  3FMS A;  2FML A;  4P55 A;  2ADU A;  1WWX A;  5D6E A;  1TW3 A;  1Z6T A;  4IXA A;  4RGS A;  2ZO4 A;  1ZGJ A;  5L3C A;  1LDK B;  1HST A;  5FD6 A;  4IPA A;  4UUV A;  3FZV A;  4HYE A;  1O3T A;  3D0S A;  3ULQ B;  2QVO A;  1OYW A;  2FE3 A;  3HTS B;  3CUQ C;  2BEO A;  4LB5 A;  4A0X A;  3SHF A;  2RN7 A;  1YW9 A;  2FU4 A;  3BOQ A;  1Z91 A;  4ZZL A;  1T39 A;  1RIO H;  1LDJ A;  3KET A;  3RI4 A;  4XRF A;  5ERI A;  3F8C A;  3TQN A;  4I01 A;  3ZQ7 A;  1IN7 A;  4EV0 A;  1TLH B;  2GZW A;  1O3R A;  2CO5 A;  4NB5 A;  1RUO A;  1GXQ A;  3LA2 A;  2PEX A;  3HRT A;  4P96 A;  4S04 A;  1QNT A;  3R61 A;  3EET A;  3V7S A;  3HHH A;  1KU3 A;  1FX7 A;  3ECO A;  1T0F A;  3J80 K;  1ZHF A;  3WTX C;  2Y0M A;  4HBL A;  2FXA A;  3GFJ A;  3RDI A;  4A5N A;  4M6X A;  4A0Z A;  3ROU A;  3FWE A;  4CGZ A;  2YX4 A;  1I1S A;  1TTY A;  1F4K A;  2XV4 S;  1T98 A;  1FBQ A;  2AS5 F;  2L4A A;  1R1U A;  2AXL A;  5L3D A;  4HW0 A;  1MGT A;  4OMZ A;  4KYW A;  5E8I A;  1IN8 A;  2HFH A;  2HDC A;  3K1M A;  4QLC U;  3BRO A;  5CVI A;  3KZY A;  5F6F A;  3IRQ A;  2F5E A;  1IF1 A;  5LRS A;  2A5Y B;  1HW2 A;  2LDU A;  2VN2 A;  4L0Y B;  3WGG A;  2CGP A;  3V8J A;  1QZY A;  2OQG A;  2M87 A;  2A07 F;  3KP3 A;  3NEU A;  1RUN A;  1E17 A;  2PI0 A;  3I64 A;  2A69 F;  4HDU A;  1QZZ A;  2L3D A;  4BHB A;  5ICE A;  2JSC A;  4YIF A;  3LST A;  1U5T B;  1R5G A;  4WXH A;  4EJT A;  1K6O A;  4I7H A;  2ZXJ A;  3T5X A;  1XMK A;  3DXJ F;  4IRH A;  3PFI A;  3Q5F A;  3IKT A;  2DTR A;  1FBS A;  2FNA A;  1YW7 A;  2VXZ A;  3KP4 A;  2KKO A;  3BP8 A;  3OOP A;  4O5V A;  5ILV A;  4HX8 A;  2F2E A;  2V6C A;  3ZMD A;  3E6M A;  2OZU A;  1KQ0 A;  2COM A;  2TDX A;  3O3K A;  4OIP F;  4CXF A;  1MJB A;  1UB9 A;  2E7X A;  1FY7 A;  2RC4 A;  2YX7 A;  1C0W A;  5ILS A;  5BPI A;  5ED4 A;  4G6D A;  2CWE A;  2Z5U A;  3IKV A;  3HRU A;  1J9I A;  4AD9 A;  5HDK A;  2ACJ A;  3SFZ A;  2J5O A;  4EGY A;  3WOD F;  2IJL A;  1B6A A;  1I6X A;  2VE9 A;  1SD7 A;  3FMQ A;  1QPM A;  2CYY A;  1V3F A;  3TGN A;  5JR3 A;  1G3Y A;  3TDU C;  5D8K B;  1ZAR A;  3RJP A;  3HSR A;  2HYF A;  3HIF A;  2RKH A;  2YU3 A;  2W85 A;  3BJ6 A;  5FLX K;  3WG9 A;  3SQN A;  1R23 A;  1AWC A;  2HS5 A;  1I27 A;  5DEQ A;  1IRG A;  3LA7 A;  1LNW A;  4OU0 A;  2A6H F;  4UVC A;  1W7P D;  2IW5 A;  4DQ2 A;  3TOB A;  4ZYE A;  2Y48 A;  4HA8 A;  1PUE E;  2K27 A;  5F1R A;  2V9V A;  3O6B B;  1ON1 A;  4M9Z A;  2KIF A;  2HTJ A;  1LDD A;  3ZP5 A;  2DW4 A;  4BHC A;  4A6D A;  2GWR A;  3HOT A;  2EB7 A;  3P7N A;  1TQI A;  2XAH A;  3TO9 A;  4HF2 A;  4ENN A;  5DUK A;  1XGS A;  3CJN A;  2DPD A;  3BWG A;  1IW7 F;  2VON A;  1FOK A;  3IC7 A;  1JE8 A;  4EVI A;  5HS8 A;  4MEX F;  1YIO A;  1KU7 A;  4M72 A;  5BOX A;  4KIG A;  1HXD A;  1U3E M;  2YSR A;  2HWV A;  2GIV A;  1CF7 B;  2MBF A;  4WK8 F;  3M1E A;  3ZMS A;  4CO8 A;  5F64 A;  5BS6 A;  1Z9C A;  4MTD A;  4MNU A;  1OKR A;  3VB2 A;  2O8X A;  1IUY A;  4O3M A;  2QQ9 A;  1TQP A;  1ZG3 A;  2A68 F;  4PGG A;  1HSJ A;  5JI6 A;  3WE3 A;  1P4W A;  1G3S A;  2BE5 F;  4NHJ A;  1W7P B;  5LBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...