1FC0A

Human liver glycogen phosphorylase complexed with n-acetyl-beta-d-glucopyranosylamine
Total Genus 326
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
326
sequence length
809
structure length
792
Chain Sequence
NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOGEN PHOSPHORYLASE, LIVER FORM
publication title Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 326
structure length 792
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2000-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1fc0A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1fc0A01
5HXAA 3IA7A 3OT5A 4G2TA 4F96A 4NC9A 1FTWA 4MI9A 2QLNA 2IV7A 3RSCA 1RRVA 2AZDA 2G9QA 5IKPA 1UQUA 4YUAA 1IIRA 3OKAA 5ENZA 2SKCA 4RIIA 1SXQA 3L01A 3BCRA 1EM6A 4RENA 3D1JA 1IXYA 4AMBA 3HBJA 1NOJA 3BDAA 1RZUA 1M5RA 2F3PA 2X6QA 3ZCQA 3MRXA 4M60A 4GYWA 1XL1A 2R60A 3S2UA 4GZ3A 1Y6GA 4EKYA 4EL0A 5D01A 1H5UA 3SYRA 1NLMA 1C8KA 4EJ2A 3ZCTA 3DDWA 2VSYA 3VUEA 1JIVA 1EXVA 4AY6A 1XOIA 4MICA 3T3IA 3T3EA 1BX3A 1C3JA 2F3SA 2H1FA 4XIFA 3L7DA 4KQ2A 3GUHA 2XA9A 2JLBA 2R4UA 1NZFA 4RBNA 3NC4A 2IYFA 2O6LA 2PYDA 2IUYA 3S0JA 3HBFA 3G2NA 2Q6VA 1AHPA 2QNBA 3AMVA 3CUTA 1P2GA 1JIXA 3MBOA 1WUTA 1P4GA 2GT1A 4REMA 4Z5XA 1JEJA 3E3NA 4RIFA 2P6PA 3VDNB 4YI5A 2XCUA 3Q3IA 1GFZA 1VGVA 3MRVA 2X0EA 1L7XA 3MT8A 1P4HA 4HWGA 4LEIA 3OTGA 2FF5A 1FU8A 2QN1A 3BCUA 3T3GA 5LQDA 5BNWA 1NVKA 1WW3A 2PRIA 4YI3A 1J39A 4M83A 4PQGA 2X0FA 2PQ6A 2AW3A 1PSWA 2ASVA 2IEIA 3DZCA 2QN2A 1FC0A 3TOVA 8GPBA 2ACVA 3MRTA 3PE4A 4N3AA 3ZCSA 2GPBA 1JG6A 3MQFA 7GPBA 1KTIA 5GPBA 1SXPA 3CEJA 1QKJA 2VCHA 1Z8DA 1P2BA 4CTMA 3G2HA 3WC4A 3NCHA 2IYAA 4FKZA 3QKWA 1FS4A 4X7RA 1GPYA 2QZSA 2XCIA 3CV3A 3MT7A 1Z62A 3CUVA 1XKXA 3C4VA 5C1DA 1A8IA 5DU2A 4WHMA 3VUFA 4X6LA 2QN7A 1FU4A 2G9RA 3PE3A 4XI9A 3C4QA 2H1HA 2QRPA 3S28A 3MTDA 4AY5A 1JG7A 3MTBA 4WADA 3NB0A 3NP9A 3E3LA 2PYIA 1PYGA 2VCEA 4HLNA 3O3CA 1NOIA 3BCSA 3H4TA 2ACWA 3ZCPA 2QN9A 2C1XA 3ZCRA 4F9FA 2C9ZA 2QN3A 1E1YA 4N3CA 2YJNA 2R68A 1Y8ZA 2F3UA 1K06A 2SKEA 3NPAA 1WV1A 1GG8A 2GEKA 5TMBA 3L79A 2GEJA 2X6RA 4RIEA 2G9UA 2QRMA 1QM5A 3FROA 1WW2A 4MHSA 3UYKA 2FFRA 3DDSA 3L7CA 3MT9A 3HBNA 3S27A 4BQFA 2VG8A 4CTNA 3D0RA 2JJMA 2HY7A 4GPBA 1XC7A 3MTAA 2R4TA 4RIGA 2XMPA 1F6DA 1Z6QA 3T7DA 4QLBA 1FA9A 2SKDA 2JZCA 2ATIA 3BD7A 3VDMA 1E4OA 1WUYA 1YGPA 1P4JA 4RELA 4L22A 1P29A 1PN3A 4GZ6A 3OTIA 3MS7A 4NEQA 2WTXA 2R66A 3G2IA 5TVGA 1L5RA 4GZ5A 3RHZA 1XV5A 4NESA 4AN4A 1K08A 1GPBA 1L5QA 3CUWA 3GPBA 2XGOA 2C1ZA 4RIHA 3EBPA 4N3BA 3MS2A 1LWOA 2F3QA 2XA1A 4MHOA 3T3DA 2ZB2A 1AXRA 2GPNA 4MI6A 4X7PA 1FTQA 2VSNA 3OKCA 4M7PA 1ABBA 4BFCA 4X7MA 4WACA 1GZ5A 1Z6PA 1FU7A 4BQEA 3G2LA 5DXFA 1HLFA 2QLLA 2XGSA 2GM9A 3Q3HA 3SYMA 4MRAA 2C4MA 1YA6A 2G9VA 2IEGA 3DD1A 3MSCA 4N39A 3WADA 3IAAA 3D0QA 3G2KA 3HBMA 1F0KA 4MI3A 3RSZA 1V4VA 3CUYA 3CEHA 4EL5A 2QN8A 1B4DA 2BISA 3C48A 9GPBA 2BGTA 3NAZA 5JTUA 3BD8A 1LWNA 3CX4A 2FETA 2GJ4A 5D00A 3Q3EA 3BEOA 2BGUA 4EKEA 1L5SA 5TMEA 1JIUA 2GPAA 1GGNA 3OTHA 1C8LA 3RT1A 2IV3A 4KQMA 3L7BA 1Y6FA 5TMDA 1RZVA 6GPBA 4LDPA 3TSAA 3TAXA 3OKPA 1UZUA 4FZRA 1L6IA 3CEMA 1NZDA 2OFFA 1UQTA 5DLDA 3MS4A 2QLMA 1C50A 1FTYA 2AV6A 4AMGA 3OY7A 3ZCVA 2QRHA 5IKOA 3OY2A 2PRJA 1P2DA 3G2JA 1XL0A 4CTOA 4GYYA 3H4IA 5I45A 2ECPA 3COPA 1O6CA 3S29A 3ZCUA 1GPAA 3E3OA 3NP7A 4N9WA 2IW1A 1PNVA 1L5WA 2XGMA 3BD6A 2X0DA 1WV0A 2BFWA 3EBOA 1L5VA 2AMVA 3T3HA 2KS6A 2XA2A 5JTTA 2QRQA 4KQ1A 4F97A 3WAGA 2F9FA 3UYLA 3CUUA 4BQIA 4W6QA 1NOKA 2QRGA 3L7AA 3QHPA 3T5TA 4CDRA
chains in the Genus database with same CATH superfamily
4KOAA 5FQOA 3UICA 5J58A 1KMHB 5L6MB 1XVIA 1NDQA 3OF2A 2WHEA 3W7AA 5CA0A 1IY0A 2JEYA 4AQ7A 4C4SA 3LC2O 3CJRA 4Q9DA 2A5LA 4MVYA 4CMEC 1RRVA 3ZDFA 2P5TB 2G9QA 1Q77A 4BEBA 4CFYA 1BWQA 3I64A 4RH0A 5F4ZA 5KYVA 3FAZA 4K9OA 3EVCA 2QX9A 3ORYA 3Q1KA 4OMDA 4GX2A 1VFNA 3GW8A 3AHFA 1EM6A 2I55A 2ZIUB 1SQSA 3PC8C 3GAAA 2FPGA 3G79A 3LOUA 3OZIA 3AW9A 3PPYA 4X8MA 1IUNA 5BW5A 5GINE 3ISTA 1TUBB 1N2IA 3BDAA 2W6JA 2FPKA 4A4DA 5JDIC 1M5RA 1NLZA 3EQ2A 3EFOB 2JDIA 3D6UA 3FCYA 5BURA 4TQAA 3A1DA 2CNLA 4LVCA 1FMCA 2YV1A 3UCEA 1XTSA 3UFBA 1UEIA 4BBPA 3W8RA 1ZZEA 1NW8A 2PJUA 2GPYA 2QYTA 3MLAA 3IJRA 3EZ9A 3MPUA 1XJCA 2PLFA 4HVCA 5TS3A 5TQ0B 4CCYB 3VR5A 5LWQA 2O6HA 3G0CA 2OO5A 1W46A 1RXYA 2VOJA 3NTLA 2JJ2D 4MV4A 4AXBA 3J81k 2PJZA 3AIOA 3KDPA 3Q88A 4YT5A 2JARA 1S4QA 1W4AA 3N05A 1CRQA 3FLMA 1K66A 3SMVA 5M2QA 3WBJA 4U2KA 5G1NA 5KKNB 4ABTA 2B1RA 5K7SA 4Q66C 5CH8A 3TLCA 1VE7A 3QJYA 4KXUA 4PBRA 3BX1A 3VSAA 1XOIA 5JU6A 1QGDA 3PDIA 1R88A 3IEVA 1LNSA 3E1GA 1ADCA 2HPAA 5LDDC 1YZGA 3VR4H 2DQKA 1SMKA 2DR0A 4K81B 3WWCA 2B92A 5ARBA 4L5CA 1J22A 4D46A 4EJMA 4FC7A 2ZCJA 3JZFA 4MS4B 4CM1A 2WQ6A 4PCAA 2DWOA 4GMHA 1ENOA 1PJ8A 1LLCA 1UOEA 4G1BA 1E9CA 2YYAA 3E5RA 4HDNA 5MGNA 3CJTA 2Q0QA 3MWKA 3F3KA 2ZT8A 1KBZA 2PXCA 2BMEA 5KINB 4EB6A 1TQDA 4X41A 5EESA 2ZUWA 3DAFA 3S55A 3U7HB 2XITA 3D6AA 2NQ2C 3A6DA 3PJGA 4XWTA 1WB4A 1Q20A 1P5ZB 4D4LA 1S3GA 3FYTA 3NC1C 1ZM7A 4YDHB 3WGJA 4V0RA 3ZVNA 4UNPA 1JDJA 1GA6A 4FGUA 5L3ZA 3E3NA 2AWNA 4FMPA 4R9NA 4CLEA 2JCGA 2N1MA 1Z82A 4L4UA 2H9AA 4HBGA 4UDNA 1E5QA 1HDEA 4ENWA 1H6DA 2EJWA 1UMDA 2H5IA 4Q3CA 1QC5A 4BP3A 4KIWA 1WP9A 3KWLA 1KJ8A 3MJCA 5TDHA 3U7RA 5KB3A 4KJZA 3IT3A 2VHXA 5L7YA 2Q4BA 3TQFA 3UZUA 4BEWA 5AVYA 4G86A 1CJCA 3DYVA 3HV0A 4EUFA 1LTKA 3RK0A 2GLUA 2L2QA 3M1YA 3R9WA 3EF0A 2ADFA 1II8B 3GEHA 3L1HA 1IRXA 1NBME 1ZIXA 3LTNC 4BZPA 3DP9A 2QTMA 3OTGA 2XMSA 5HP4A 1K63A 2I99A 3ANSA 3QYAA 3LY7A 1PVOA 3HFGA 4E7PA 1TT5A 2V6BA 1QG6A 4M9XA 1EVQA 1KFKB 2I7CA 3X1WA 2P79A 1D6JA 4IS2A 3M9LA 4P81A 1WEKA 4HNHA 2RAVA 2XUQA 5HJEA 2J3DA 2M1XA 2MOKA 5CXUA 3PV0A 2HCRA 1WMEA 3O4HA 1NNI1 2MTBA 3KDSE 1KWGA 1GEGA 1E7WA 1T24A 2XGGA 3PNQA 4R1UA 1MHPA 2JBAB 1F3OA 4CM9A 2IOFA 1JILA 4JKYA 5CVCA 1FVHA 1MAHA 2NZJA 2A86A 1LK7A 4O2AB 3DC2A 3OCXA 1B76A 1QO0D 1ZICA 2FGJA 3EDRA 3KEGA 3RTCA 4AWAA 3T7EA 3WSWA 2HL6A 5KNDA 1PR2A 5KVCA 1DO2A 2VP0A 4AP6A 4UPEA 2GM4A 1RM3A 1Z17A 3ZCSA 3L1KA 2GPBA 1U0OC 4FFBB 3ASYA 3SC2B 1RBZA 2X8WA 1GZHB 2VNJA 3ESZA 4EG0A 3GLHB 1SXGA 1F1BA 4G9BA 1Y3DE 4RNCA 1D5WA 7GPBA 2ZBQA 2Z57A 2NQTA 3PKIA 4KQJA 5TB5A 5F2NA 1BVUA 4GNKA 3D4BA 4OHMA 5AHWA 4P7GA 1PFKA 4DKXA 4UUOA 5AJHA 5CB6A 2YMQA 1TGYA 2HF2A 3AM4A 4CGYA 4BTLA 1T9HA 2BEUA 4TMZA 4PHTA 1REQA 4FKZA 4HWPA 2X3UA 1H4SA 1V96A 2FPMA 2EATA 2O14A 3GRCA 4ZZ0A 5KSWB 1RTTA 3F5MA 4NKRA 4OAPA 3R9KA 1S96A 3RG8A 4LJ9A 4RZQA 1UL1X 2WTNA 2VYNA 4XJXA 4Q05A 4DQXA 4DRYA 2FLWA 1KEVA 2R6GA 2XT6A 3SSMA 2H1OA 3CV3A 1NULA 3K70B 1H3EA 3FSRA 2CL7X 1BVRA 3GH3A 1Y98A 1GQFA 1ZA1A 2IUFA 2EYQA 4WECA 1CZLA 1ADYA 4N8EA 2O2JA 4AJ9A 4ASUD 5DNCA 1KMCA 2AC4A 2DUNA 2DQSA 2BUBA 2FRDA 3EWSA 4TVBA 3C4QA 4YJFA 4CQMA 3LXRA 4I6JA 4WUTA 1DBSA 1RPNA 3VH1A 2Q0SA 4XVCA 5KWJA 4MV5A 1AQ6A 1JTEA 4FYXA 3IEKA 3ZNPA 3HYSA 1A9QA 4U8GA 3H11A 2QZJA 5J4KA 1BXGB 1TJ5A 3WJAA 5REQB 4DLYA 2ZTMA 2F55A 4WERA 3EARA 4EOGA 3SZGA 2ZDGA 5AIBA 2WHYA 3DE3X 1OZ0A 3PXGA 5K4AA 1WEHA 1JHDA 2OO5C 3R4CA 4MWCA 3T7TA 3D4LA 2OPHA 3VBCA 1UXKA 2ZIXB 5FOSA 3WIVA 2I2FA 9ATCA 1XQWA 5F9FA 4G1EB 4P1ZA 1IUOA 5K0ZA 1KVQA 5A4FS 2QE7A 1DEHA 3FMIA 5EZSA 4BWVA 5EKTA 2EKQA 5JIBA 3D8BA 3P9PA 3IAS6 4KPEC 3DF9A 1P5HA 4IVRA 4PLTA 1GUZA 3FF1A 2V7EA 1LC3A 1IY1A 3PL5A 4ZVNA 4B3GA 3FCSB 4NHOA 3K96A 5F77A 4AS3A 3VJLA 1Z4PX 2O2GA 1U2DA 1PIWA 5CLQA 2GN6A 4D9EA 1P5RA 1U0JA 2H1IA 2YMPA 4HYQA 2H8GA 2G1UA 4O4LF 1O95A 2CMFA 3QW4B 1PS0A 3OKFA 4AZWA 2B4TO 2NG1A 5JNWA 1Y80A 3UQZA 5DIZA 4B71A 1JFFA 1SN7A 1BEEA 2O50A 3GIDA 2W22A 4R68A 1DKMA 4CIVA 2ZM6B 3FWYA 4WLNA 1EVZA 1GFSA 3K0FA 1XQ6A 4TUYF 4H7HA 4RWEA 5JLAA 3CZPA 3VOSA 1WABA 5TF4A 2PPVA 1KQGA 1B00A 2B5VA 4PAMA 1IIBA 4NYMR 1RI4A 4DXHA 3T7RA 4UTNA 4GQIA 5ADVA 3OZTA 4HGZA 5EJFA 5HA5A 3R7SA 1STOA 1P1FA 2UZ1B 2H9YA 1KDRA 2CE2X 1P29A 1PN3A 1T5HX 1TJYA 3PF8A 4AUEA 1FVXA 3JQFA 4YASA 3P2IA 2X0RA 2O06A 3AJ9A 4PXSA 3A3YA 4R5MA 3K9CA 3MJ4A 4PQEA 1TU3A 5LUAA 4TXNA 2FQ1A 4YHHB 4W9RA 1RYEA 1U2EA 5INTA 1I7SB 1ZUNB 3G68A 4K1LA 4LZJA 1SQFA 3NHAA 1URPA 3CX8A 4HRAA 3HBAA 4RKEA 4X1YA 5E3JA 3THOA 1GJRA 5GTDA 4QPZA 2C2ZA 2FEWB 4F2DA 3H5NA 4K88A 3E0XA 2DR3A 3H4VA 3STXA 4NFYA 5I5EA 1J7JA 4HEA6 1E32A 2H1VA 2X8JA 1JLRA 2XQVA 5KOIA 1GQRA 3L7NA 2QI9C 5HG0A 2V96A 1ZIPA 3GY0A 4UTVA 3JQQA 2XA1A 2POCA 2XTAA 4GI3A 3PQ6A 1LSJA 3IURA 1B6TA 5KSPA 2QTVB 2YHSA 3EIFA 2GPNA 1S7GA 1JHZA 4HOYA 3F6SA 2ZBDA 5K3SA 1QHEA 3FPHA 5IN5A 4Z4GA 1V95A 4LY0A 3WV5A 3VPSA 4GRIA 4HK4A 1PJ3A 1LXCA 2OD2A 5LN1A 3L4KA 4DCCA 2LWIA 2XNDA 3IP8A 1M2GA 2QLJA 1T5IA 3ER6A 5I5GA 3U17A 5A6SA 2DRIA 4FI3F 4WACA 4OREX 1HTBA 3QG1A 1E3QA 4KQHA 3R6GA 4ALJA 4EAQA 4F85A 3E22B 4PHCA 2XVZA 4XGQA 4OP2A 4DRXB 1OXTA 2O1EA 5AKGA 1NBAA 1XDWA 3B5IA 3G8AA 3KPJA 1HLFA 1DV1A 4QQKA 3UV3A 2YWDA 1GUFA 3WTCA 5CK4A 5AD1A 4BFWA 1SCIA 3H5WA 5LQNA 1MVOA 1OT3A 1I1HA 1NQWA 2WG0A 3GFBA 3Q6MA 4NWIA 1MMFB 3LFUA 1KSGA 4BKQA 1G8GA 1X92A 1YU9A 3BZWA 1F2DA 5B1DA 5BV7A 2NPIA 1DAOA 3PTAA 3DO6A 1E1QA 1DQPA 3UV7A 3ZWCA 4G24A 2OHVA 2PGLA 4W5HA 3MF4A 4ZPXA 1E2UA 5DYYA 4YDRA 4WKGA 2F8SA 1RI2A 4RZXA 2VF2A 4CU5A 2PO7A 2E4VA 4YUYA 4Y2QA 1F12A 2J5RA 3OOEA 3RBXA 5CFLA 3HG7A 1AMNA 1E1MA 2YOGA 4KR6A 4MI3A 5AVQA 2V5UA 3K09A 3F96A 3K8QA 3LX8A 3NYQA 1IJBA 2ODEA 5A3RA 3KQTA 3OWXA 4YIKA 1BSVA 3PHLA 4O5OA 2DR2A 1G4UR 2HK9A 1O5OA 4QXAA 4UUPA 2ZRAA 2NWQA 3M2TA 3THXB 1GSHA 4Y0VA 4HDSA 3P0RA 4ND8A 3U61B 3F74A 5JYBA 2IEZA 2FRDC 3E9YA 3KSZO 1HC7A 3IPAA 3NAZA 4OXKA 1O94D 1BMQA 1Q57A 4HQRA 4C2UA 1FSPA 3KQMA 1MF7A 2PGJA 3KLNA 821PA 2FHSA 1QS0A 5JNRA 4LVNA 2OR3A 5C8XA 1HDGO 2E9SA 3HXPA 1FX0B 3CX4A 4IDQA 2H4FA 3UB4A 2YDYA 3DT9A 1ZJ4A 3EQ8A 4YWHA 5C46F 4KMOA 4S0XA 3OIGA 1BRTA 4EKEA 3MBIA 1IOZA 2VKQA 3KZOA 3LIIA 2O5VA 1BOFA 1JIUA 1YS2X 1TA9A 1KVUA 1G4HA 2P41A 2Y9MB 4LE2A 1X74A 1EHIA 4RADA 5CYPA 3RYFA 5LPNA 3M6MD 4BLUA 4UNRA 2JG3A 3Q85A 2UU9B 1Z5GA 1VI6A 3I9JA 4OMCA 1U4SA 1K6MA 2PZLA 4ZWNA 5T7BA 4BFVA 5BOSB 4U63A 2G6TA 3H0KA 4J07A 1RC8A 1ZOLA 4G9GA 2IK8A 1M7HA 1W44A 3MJEA 1GPMA 3M1LA 3TSAA 4F3CA 2EL9A 3I01A 3Q9NA 1R8SA 2QZZA 1NW5A 3SOZA 3G0GA 3RC7A 5C80A 3L8GA 2H52A 2KBEA 3A14A 4MDFA 1Z4MA 4NBVA 1YE8A 3RO7A 1QG4A 3F97A 1E6UA 3G7UA 4ZQBA 4G4SO 4GO1A 5CB4B 5IKPA 5ES4B 5BV0A 1Y9JA 2I1VB 4PQFA 3SHVA 2XB8A 3ETEA 1U2DC 1Z4IA 1UJBA 2IF2A 1RM0A 2M32A 3O8BA 4IR7A 4UZEA 3KJNA 5EYPA 3MS4A 3W5CA 1T13A 5B6PA 1HFJA 1GPKA 2P9YA 2Y68A 3KYCA 4XOUA 2QS9A 1XQXA 3ZV3A 1O95C 2FWAA 3DS8A 2IEDA 2WYVA 3C3CA 3HPRA 5FHQA 4KOEC 2QU8A 3VPGA 3VYTB 1C9DB 1PGJA 3SXUB 4EUKA 1A9ZA 5KHLB 3TRHA 4DTIA 4WQMA 3BGWA 1YQ9A 3VVLA 4TYPA 1MAWA 1ITZA 1MV8A 2PT5A 4ID3A 5AOCA 4PN3A 3WGVA 4BLSA 4CIWA 2H17A 2B8TA 3OZWA 4U5QA 1MGOA 2IRWA 3IP5A 1EFHA 4RHXA 5A05A 2JFFA 3HWWA 3PTLA 4I1RA 5DCUA 1TU0A 4OJMX 2KJQA 4G1FA 4Q4LA 4CL2A 2CLFB 3R8FA 1QGOA 3NM6B 4DMRA 2MU1A 1HDIA 1R15A 2O3UA 3DKKA 4Q9IA 3W4IA 4NMHA 1KJQA 3EZNA 3HFRA 3FPKA 2CFRA 3QP9A 4BE7B 1WA5A 2GOYA 3NP7A 4FK8A 1V3VA 3U39A 3JQFC 3K32A 1OZHA 2H0RA 1UZMA 2OLEA 2Q3HA 5TJHA 4H1WA 1TPYA 1FSZA 1IUKA 1BVHA 1WV0A 4E3ZA 1C7FA 2IYPA 2V54A 3NOVA 4QPPA 3B1XA 3V6LA 3ZWAA 2UUAB 5JATA 4GI1A 4NTZA 1D9XA 1A4RA 2FZEA 2GK7A 4TTTS 1H9AA 2QG9A 1L7DA 5BWBA 1XZNA 3IIEA 4F97A 4D9HA 2NSYA 2AOXA 3PPXA 2F00A 3NEJA 4UVEA 4YQEA 4DA9A 1T29A 3L7OA 1FVFA 5JMPA 3SHQA 2VL7A 2UYHA 1MC5A 3AUAA 2X3YA 1NAHA 1KE2A 3T5TA 1WDTA 3ITEA 1JU3A 1KJ9A 3U31A 4ENQA 4TYNA 3DHEA 3SNKA 4G5QA 1VMKA 1NPYA 1PL8A 3A6HA 2WWGA 3JU3A 3AJEA 1KDOA 4IJ6A 3WQSB 3UWMA 1Z2DA 3IO3A 3K4QA 2AZDA 3V55A 4C4TA 4GEKA 2C2OA 1KI1A 4R3UC 3X2EA 5ITZA 1Q1EA 2C92A 2FE1A 1NUPA 2AZXA 1OH6A 5TPZD 1SXQA 1EA7A 3NNSA 1J2EA 4MVCA 1X13A 2QYSA 3R75A 4JQSA 5ALNA 4PR3A 4O4IF 4WZBB 4HQ0A 3DWGA 3EXG2 5HDQA 4FYWA 4TKZA 2X9VA 3KLPX 1WCIB 4DN6A 2DLCX 1NRJB 2ARKA 5PGMA 3ZGZA 4UHEA 1W0JD 4YAGA 4Y1GA 4WW0A 3B2QA 1A9SA 4RHCA 4YR7A 1XO1A 2RI0A 3E7DA 4J1SA 4OQXA 2HMVA 4P5DA 3L8ZA 4L3OA 3FPFA 4DMGA 5ED0A 2YVKA 2AMJA 4BMXA 4DM4A 1JW9B 1RJ9B 3HJCA 1C1XB 2YFYA 4UNSA 1K9VF 4B4OA 3L05A 4P7KA 4WA8A 3R7WB 3ZHQA 3FFTA 3SN6A 4IIHA 4QOHA 1E79A 3TM4A 2NUPB 4HQFA 1NVAA 5AXBA 1YUMA 2HDOA 2Z8YA 4MW2A 2LP4Y 4LHYA 3E70C 3KXPA 3K09C 3WV4A 5FIUA 1JIVA 4MQ5A 1N0UA 2FN3A 1Z2PX 2O2HA 4Z8XA 2XRMA 1ETUA 1YB5A 2ZT7A 1BS1A 2NZ8A 2XWSA 1G4AE 1U3GA 2D06A 2WNSA 5DYIA 5JZOA 2J0UA 3LLMA 4WZAE 3QBTA 5AVZA 3DVAA 1YV9A 5KQRA 3PHIA 3GGSA 4RY0A 3P45A 1X1RA 2G67A 3FUXA 5K9ZA 3NM4A 1A72A 4B4DA 3KOOA 3AKYA 3IQWA 1TB4A 1AXEA 4Q7JB 1Y4ZA 2QRVA 5LIRA 4YJDA 5TXGA 3TMYA 1NPTO 3HBFA 4JJ6A 2ZBRA 4OQPA 3FUCA 1FP4B 3ILYA 2ETXA 3IQDB 4BAGA 4E5UA 5I48A 3AMVA 1GZ6A 4MLDA 2KSQA 5TQVA 2UXBB 1E2PA 3F3MA 1X1CA 4DUGA 1FEZA 1BE1A 2I8LA 4MWDA 2H63A 4MVXA 3DDNA 3QNMA 4UXIA 2IZ0A 3NWOA 2PUDA 5FWNA 2HTFA 4NF2A 2W0SA 3DZDA 3JS5A 4IH9A 1PR4A 1DTEA 4MUGA 2P5YA 2UYQA 3KRTA 2J9XB 4NK5A 5EN4A 2PNJA 2WT9A 3TL2A 1AHHA 4UE3S 2EP7A 2NAFA 4AY3A 1GPWB 1RYYA 1Y3IA 1YD7A 4DJEC 1KMHA 2IUEA 2ZXUA 5HBRA 2WM8A 4PO9A 1GPDG 3ZY5A 3U60B 2P2YA 4QJ4A 3DL4A 1FNSA 2Q0XA 1UK9A 2ZBGA 4KRGA 2HM7A 4C3ZA 4H17A 4I1UA 2GWRA 2XTJA 4QDUA 3GPDG 5DLYA 2O8DA 1KP3A 4X1KB 3NCTA 2VDQB 1K0FA 3YASA 5AW7A 4M49A 3HP7A 3BCUA 5G3YA 4CHGA 2DHRA 3UEOA 4X92A 4ZP1A 5EEHA 4X60A 1LF5A 1USGA 2E3JA 5FBQB 1N2CA 2EFJA 2P0EA 3S3TA 4UAGA 5C8YF 2XADA 3O8OB 1NVKA 1WW3A 2CXNA 1V41E 2QB5A 1XCOA 2PN1A 4X94A 2FVYA 3N1UA 3LTEA 1D7AA 4DLLA 1FRNA 4PQGA 3A37A 2BHNA 3RWMB 3NMUF 3FLBA 2R8OA 4HLDA 2GNAA 4RS3A 3RJ9A 4MPTA 3RVQA 1BNCA 4Y2UA 2OG1A 3ZHCA 1KVRA 1V45E 3IHWA 2QUAA 1BDIA 4QGAA 1YNSA 3NVKI 3OZSA 1LDYA 4GX0A 2OCIA 4MTLA 4EYQA 1LF0A 4HXEB 5FRDA 4ARBA 1AO0A 3UV6A 2IITA 1H3FA 4NICA 3LPLA 2C3UA 4ZAFA 1GL9B 2ANCA 3TPZA 1ETHA 1H2XA 3QV1A 2ODNA 4QARA 1JJIA 1QX3A 1EM8A 3A9UA 4RA9B 2H57A 1W52X 3FZYA 2GVDC 4UJ3A 2J3LA 4RW0A 5E7MA 5FUQA 2O19A 4V0MA 1IL0A 2A0UA 1LNQA 2G5GX 4J49A 3R09A 3PQ2A 1KMMA 3AP3A 5EWLA 4F6CA 4XVUA 3K15A 4IUYA 1XNQB 2DG2A 5CTAA 4MIYA 3IKJA 3CZ4A 2R86A 2ZYSA 5I47A 3BK7A 4OB8A 2ZZKA 3MELA 4NL4H 4EKDA 4QVIA 4QA9A 4OFBA 3WIBA 5FWYB 5IAOA 1Y1SA 3WC4A 1QHGA 3ETDA 4OV6B 1UWCA 5E4JA 2V3VA 1QX4A 2WG2A 1SIOA 4S12A 1RWMA 4DUYB 3P0HA 1UXGA 3EQ7A 1IOLA 3N7UA 4KQKA 4Q48A 1L4NA 2B61A 1OLOA 2ZTHA 3AHCA 3CUVA 3IR7A 3QEJA 5JSQA 5AIAA 3QA9A 3BS4A 5A4AA 2ILTA 3AHIA 4LNUB 1QDUA 3LCCA 1QB8A 2YYSA 4WHMA 3GUVA 4RPJA 2HDWA 5AWFC 5I8ZA 3OM1A 5AW9A 3QH4A 4CKCB 4WT7A 1Q17A 2VK1A 1DJMA 2B7BA 1K2WA 3HB1A 3K30A 2OXIA 4NV1A 4RQAA 4B3RB 2F4VB 4KJXA 3QPCA 1KAMA 1F38A 3KQQA 3ZOZA 1P3Y1 2Q6IA 3MTDA 3O4RA 3V34A 2XMQA 3HNPA 2O8VA 2QTLA 3BIOA 2QX8A 3F8TA 3OCVA 3TJMA 4BFUA 4QU9A 3V7NA 4DWJA 4V3BA 2MMGA 5B2FA 1PAUA 2O0KA 1ID8A 5CVTA 3O3CA 2QTNA 4HXGA 5F35A 1IVSA 1D9ZA 2UZIR 1ECCA 1WUKS 4FQ7A 2CYCA 2WICA 4FW9A 4BN4A 4TYYA 3DZIA 3T1VA 1QR2A 4DV6B 1U6KA 5IMBA 2D2VA 4GH5A 3X44A 3GVCA 3KOMA 3GVHA 3DFUA 4IH4A 4YJ2F 3V4VB 4HVTA 5AT1A 3BE6A 4ZVKA 3DEKA 2A8YA 4W63A 1E1YA 1JLLB 4LBVA 3E4DA 3H3FA 1WP4A 3WMGA 1AH2A 1XCMA 1BWSA 2M98A 1Y8ZA 4X3OA 2DBZA 4INPA 4EFDA 4PZLA 1ORIA 2EFDB 4EI2A 2ADMA 1A4UA 4K6OA 4NFLA 5DNYB 3ICQB 3OSZA 1V43A 1WV1A 4PE5B 3HNOA 1M33A 3ZVLA 1O03A 3WZMA 1D2CA 5GGYA 2PE5A 1D4FA 1IEQA 1DZ3A 4EY5A 2ZRIA 2HWXA 3EUFA 1GNLA 1CF9A 2I3ZA 3NAQA 4K9NA 4X63A 2JBAA 4RU1A 2JB9A 2Y76A 1OLXA 1NC3A 3D9QX 3IT0A 4X8HA 2QDKA 5EJGA 3RUHA 1MHTA 5KYTA 1U1FA 5AKIA 3IQZA 3S27A 3S7ZA 4JR1A 2PUGA 1KRWA 5T3UA 3D0RA 4AX4A 4G4GA 3TIIA 3U81A 5DBIA 4EENA 2OZPA 1JZTA 1U8FO 5DWQA 1A69A 4Z1OA 4LYYA 3L0YA 1A2QA 3G5UA 5EAIA 3JYNA 4G25A 3GLHA 1L8LA 3GFQA 5SZIA 4RZUA 3GEEA 4Q7EA 2PLRA 4AZ3B 2F90A 3VYWA 3ZD8A 2JJYA 3LX6A 1U3FA 5I9MA 5DGTA 3W6PA 4RELA 1RJDA 3E9RA 4CMKA 5B4VA 1T0HB 3OAAD 2Q1WA 5JYCA 4XR9A 3E61A 1DEXA 2WWYA 2JLYA 3P9YA 4H7DA 4Y2GA 2F9MA 5CEJA 3OBBA 2JHGA 3U7JA 2Q3BA 1J0XO 2J8ZA 4KR0A 2PV0A 4DDMA 5AW3A 1XTBA 1V7PC 2XVXA 1G7SA 4GZMA 3I4LA 1R0RE 5GIOE 1X7HA 1KJWA 3KOYA 5JCJA 4UC0A 2WYIA 3WNDA 2G08A 3ACBA 3LX5A 1A2KC 3G02A 3M70A 1E2JA 1ZC3A 3I4CA 1KU6A 3P0FA 1M72A 4LJYA 4XX1A 3CXRA 2XMRA 3ESYA 4E94A 2P9HA 3TOSA 3UJ7A 2WU3A 3PNYA 1YBVA 1LS1A 3M89A 2QL7A 1QFXA 5TQ2B 2R7AA 2OEPA 1AKMA 1C4XA 2ZRMA 3CYFA 1UWLA 4CV3A 5EINA 3VVBA 2WHPA 5REQA 5A7HA 1HTTA 1BMFA 1ZP6A 1WMFA 2RGAA 2GB4A 3K70D 3FWKA 3GHHA 2R5NA 4B3FX 4W99A 1EKXA 1M6EX 5FTJA 5EPUA 3IMEA 1HG0A 4IFBA 3G7NA 3C4JA 3RM3A 3WIDA 3CMCO 5ICMA 1E61A 3OKCA 1ABBA 4F1WA 1T5BA 1P1HA 2QW1A 4PFJA 1R3DA 4ZV7A 5JADA 3OD5A 3SE7A 4EVRA 2I91A 3KQYA 2PAFA 1ZVVA 5IDXA 4TSKA 2PZAA 2TS1A 3LSYA 1M2EA 1QB7A 3ZJ4A 5EVJA 4KB5A 3OIVA 4KFRA 4KO8A 5D86A 1KZ1A 4BMDA 2Q49A 2RAUA 4MA4A 4FSHA 4IX9A 1D1PA 1U2RA 2GTHA 2QLLA 1V11B 2D2IA 4JP3A 3H86A 1MG5A 1SHTX 4ROTA 1MORA 2WD7A 3BIFA 5ARCA 1G55A 2HADA 2YX1A 4W5TA 4I4TB 3JQAB 1IY8A 1ZY2A 3I0NA 3KJIA 3L0OA 5HKKA 3GP8A 1GTG1 5CT6A 3S6JA 3FNIA 1ZVJA 2IQ5A 1VI2A 4MMXB 4RABA 4CI0B 2Q3EA 4JEUA 4LZOA 3I9KA 3IAAA 4HDOB 5EJEA 4QM7A 4WX2B 1E4EB 3HBMA 4HWTA 4J4HA 5U4XA 1ODCA 5CNKA 1SC4A 1ZJWA 2J6CA 1N6PA 3A1WA 4NNJA 2B6NA 2DC1A 2P35A 4B6EA 1OPXA 1IHPA 3A9TA 1UBFA 1XDGA 1Y1TA 2FPOA 2P6UA 4AAYA 1YVPA 5E3HA 1ORVA 1M8JA 4NZYA 3A6PC 4YAKA 3TSOA 4BVGA 3K0CA 4GU5A 4D4MA 1UDWA 4ITRC 2VPZA 4WBNB 2DPGA 5THKA 4WLFA 1QYDA 3UKJA 2DAPA 3L4EA 1J7KA 4KZKA 1M7BA 1M34B 2ALJA 4TLDA 1LRJA 2J3MA 4ENTA 2WB4A 3B3FA 1ZD3A 3C1UA 4LY3A 3UMRA 2CFTA 4BGIA 1QFJA 2DQYA 4BVAA 1QCZA 4D0LB 3TNFA 3DKRA 3LX4A 4UQLA 2PUFA 1HYEA 3OTHA 4LGVA 2HDNB 1B26A 4DCUA 4IHAA 3DLTA 3P2MA 5D1NA 3ZV5A 5J2UA 1P7VA 1VE9A 5C53B 2J4DA 3L7MA 1C4OA 2D5CA 4WEQA 3U09A 2EF1A 2CJWA 2NAPA 3AONB 2PA0A 3E27A 3E9MA 3HZHA 3ZQJA 3K6SA 1QPGA 3TCNA 5ITSA 3L1JA 4KFTA 4KDFA 1T5SA 4NIMA 2J33A 2R85A 1YOVA 3N6RA 1R16A 1NG1A 4A1OA 1P31A 3QUTA 2HV8A 1NBOA 4J1NA 3WK4A 5HIIA 2PRSA 4OKNA 1WTCA 3WRWA 4QVKA 1VMDA 2X8BA 3QXGA 1CF2O 2C29D 5ADUS 1NZDA 3KKLA 5FTWA 3HDYA 3TQHA 2HZ7A 2VC2B 3U4HA 4DUPA 3O4FA 3Q7TA 1WCXA 4GNRA 3ROGA 5JQGF 3X3HA 4K3UA 5DW3A 1A3CA 2P3SA 3JAKB 4Z54A 1T1JA 1IBKB 2Q2QA 4HPXB 4PZYA 4QPDA 4BKRA 1AZTA 1EB8A 4HNAA 3OY2A 4DRXA 3UPTA 4B80A 4WWHA 1I3NA 2EP5A 2H3HA 3KE9A 1GR0A 2W11A 2JGJA 4MS1A 5EUQB 1CYEA 2HT1A 1SCKA 3ZU6A 3TKLA 2W2VA 4L0CA 1NW9B 3KPWA 3BH0A 4NJOA 3UKOA 4MW7A 3V7UA 4IUCS 3O3OB 3QLVA 1OPRA 4NAHA 4U3JB 4W8GA 2VUIB 2Q3LA 1XLTA 3DE4X 4FFDA 4X64B 4MDHA 2C54A 4E88A 3SHTA 3SM9A 4NYMQ 2VH2A 2WSIA 4WIAA 2EC5A 1VHTA 4FMDB 1AU9A 4P98A 1OX6A 2NYVA 4Y2XA 3WK8A 4ETIA 3DEIA 2H4XA 1C4KA 1PBNA 5U1PA 1L5WA 2D5LA 3CO5A 3GP5A 3GUZA 3B1YA 4PX3A 3CNHA 4UM7A 3QFFA 2HK8A 5F78A 3PS9A 3CZQA 4C4XA 1ZHOA 4U0JA 1ZK4A 2PZMA 4I5GA 4QYIA 3UUFA 4DHEA 4LXIA 1F20A 4QBIA 5IKXA 1JDUA 5EZYB 3K0KA 4UAJA 3I83A 3A28A 4BTEA 4BMVA 4DM7A 1OE0A 3JYLA 1ZS9A 3BZUA 3D4OA 3GDOA 3WJ2A 1QUFA 2X0KA 2D1SA 3C7TA 3U48A 1AQJA 1VIMA 2D2FA 4FE3A 2LDXA 4W4TA 1Z5NA 1RS0A 3TZ6A 2WAOA 2AOWA 2GK3A 2YCLA 1CJUC 4FCCA 5JJLA 3HC7A 2AOUB 1FX0A 1Q0LA 4GD3Q 4Q37A 1JVSA 4OQ4A 4C89A 3OCJA 4Z0PA 4OXYA 3OTOB 4BDTA 4D6PA 3CLVA 1GNSA 3EZLA 3L77A 3U5ZB 4PYMA 1I7NA 3GLHE 4LSMA 1FTWA 5EJAA 5B3AA 3U0VA 3VGPA 1JR3A 3NKFA 2NTEA 4F6LA 1ST2A 3T4PA 3FMPB 5TT0A 3C7AA 3QPAA 4LXGA 4E08A 3CLSC 2DWCA 4R2LA 1DKNA 1R8JA 4EHFA 3GCXA 4EG7A 4ZGWA 5AW0A 2AOTB 4K05A 2IS6A 3PR2B 4UM9D 4ZEWA 2GF0A 3WFIA 3TTWA 5TGDA 1ZJ5A 4QOSA 5TRTA 1MV5A 1XEWX 3QUQA 1WOYA 3H5AA 3ZS9A 4N76A 4EUNA 4ZHQF 4EUSA 2AXQA 3ZQ4A 4RTPA 5LLSA 3ZWPA 2P69A 2B4RO 3SYTA 1P1CA 3EEYA 2GWHA 4J91A 4ZMSA 3IKTA 4OSOA 2XF8A 2G72A 5EJ6A 3HJFA 1QZ3A 3ZCQA 3N59A 2ATVA 2XB6A 3PWSA 3FA2A 4YP6A 3PPWA 2O8EA 2ZJ1A 4L2IA 1JUDA 1N2OA 5EIAA 3K5IA 4AXXA 5CH3A 5KJ1A 3SE0A 4LBWA 4EA6A 1M1NB 3IKMB 4FXOA 3P2OA 3T8YA 3PRYA 3F49S 3MWJA 4FOLA 4MQEB 3AB7A 5ECDA 2ZB7A 1TAHA 4OHXA 2BE7A 3VNBA 4DDWA 1QBKC 4H31A 3AETB 3QTBA 4PZUA 3EISA 2GCNA 3ZIAD 3KJZA 3WLFA 3IYLW 4KLRA 4RAOA 3BE8A 3SX4A 3WLTA 3U44B 4BFXA 3CZAA 4V0QA 5D3QA 4KQ2A 1PQWA 1PYDA 1ZUWA 2C4UA 1B3RA 3IOCA 2WIBA 3TLGB 3WQBA 3DJFA 1AKEA 3C39A 3K0CC 1FDVA 1G8FA 3E8XA 4QRIA 3LF2A 3SF0A 1ESZA 2X42A 1TM1E 2R2GA 5CVDA 5FUWA 3ANYB 3UB2A 3DCJA 4GRAA 1DCMA 1YT5A 2D7JA 3GROA 2NX2A 1FDWA 4PTLA 5HJ7A 3PJRA 1QLWA 1Q11A 4WKCA 1GCIA 4RXUA 4HQ6A 4YP9A 1AHPA 3EVDA 4NOMA 1BTOA 3AHDA 3H42B 4FB4A 1RU3A 1W85B 4DG8A 1JA0A 4TKUA 2B37A 1HH4A 4P4LA 3S2FA 4EDFA 4D45A 3RHSA 4WOBA 1W2WB 5JFTA 3R2JA 2VSFA 3LXXA 1NRXA 2AW5A 3I42A 3X1DA 1E0JA 1U7DA 2VNAA 1U8ZA 3A6KA 3M4YA 1NUHA 4WDRA 1ZM4A 4D6YA 1TUIA 3CWCA 2AI3A 3S99A 3ZHBA 1KYIA 2JHFA 2H1WA 1MNAA 2ZJFA 2PSEA 3BRCA 3HUTA 1ENPA 4TXLA 4UD6A 1AV6A 2B4YA 3TIXB 1CLEA 5CGZA 1B93A 4FS8A 4OQLA 4PC1A 2CLLB 1PGPA 3CXUA 4P58A 3THWA 2C7PA 1U2GA 1LLFA 1YONA 3NLLA 2OLJA 3KKEA 2I1WA 3WISA 4ZYXA 1JJ7A 1ICEA 5CLHA 3U7QA 5CK5A 1ODJA 1OXSC 1S2NA 4JU9A 5JQWA 3V2HA 3ADBA 4EY3A 3EAQA 3BPSA 1AVTA 4HD8A 3GBVA 2VDPB 3I37X 4J94A 5AVRA 4H7PA 4AZ3A 7MDHA 1SK9A 2V1UA 4XRGA 2PZBA 2R0QC 1XZDA 4UU7A 4NG4A 1DMRA 2ZUFA 3P9XA 4YJ3B 4H7FA 5DXAA 1R5BA 2DOKA 5B58C 4M3NA 4WZBA 5BNWA 4LAFA 3KKPA 2JS7A 1QHYA 4L7QA 1SAYA 1T4BA 2IPNA 1WCIA 3DVLA 4OIFA 5IBRA 3GMIA 4BB0A 4DIMA 1TKBA 3L0DA 1O3YA 4M6WA 3RU3A 2YQ5A 3W34A 3F6EX 2FPRA 2CCKA 3QLVC 4BVLA 3I58A 5FLXA 4N41A 4KN6A 1XLTC 1ND6A 1E0AA 4DZZA 5ARDA 1RI3A 1EQ2A 3LIPA 2HQOA 1UBNA 3ROKA 4EG8A 1MKYA 1DOHA 3TJZA 1TVKB 2IEAA 5KYUB 5FA8A 3ISVA 1RMQA 5CA0F 1C1XA 2D4AA 1XUOA 1TM2A 3R7WA 4CLOA 3HGTA 3OQOA 3PE4A 1TADA 1YOBA 1YR7A 2PVCA 1D2NA 2W4QA 3DZJA 1GQSA 3JWIA 5B3JA 1JG6A 2BMWA 1NQOA 4L8YA 4OU4A 1R0CA 2RKBA 1Y5LA 2WMYA 3KVOA 4WK6A 5AUQA 4CIAA 1XVVA 4FYJA 4LKOA 1AKVA 4GXNA 4BMYA 3PEWA 1HFEL 4P4UA 4C1BA 4J8PA 2AD5A 4Q4CA 1UAAA 5IARA 1QKJA 2VCHA 1U8CB 2Q27A 1PJLA 3EZGA 1G1MA 1ZH8A 4YQZA 5TC4A 3RD5A 1JXOA 5K99A 4MUJA 4U02A 3G2HA 2ZG6A 4XOIA 5FADA 4CF7A 3RFTA 1GRNA 3HSYA 3QKWA 5A3QA 2VJAA 4G97A 4KH0A 4QJBA 1DPFA 1JKMA 2NU6B 3TEJA 2E4YA 1CVLA 1U11A 1S1CA 1SOWA 2WJWA 2XB9A 2WA2A 3KIPA 3MWGA 3ZG6A 4QOJA 2AG5A 2I6QA 1MT0A 3GR6A 2XCIA 3PGJA 2ZRNA 2BKAA 3FDZB 2P40A 3B6JA 5PNTA 4AW9A 1H2AS 2MIIA 1I0IA 4Q21A 4S1TA 1LDMA 1A8IA 5CHEA 4BPBA 1BKSB 3PD1A 1PFUA 2AFRA 4HN4B 2OXEA 1R4MB 2GZ3A 2I4MA 1Y7PA 5FBHA 1C9YA 3QKTA 3D7RA 4FZVA 3B6IA 2FF7A 3AHEA 3FWHA 4Q6BA 2XYRA 3LW7A 3LOQA 2QRPA 3PCXA 3HKEB 1R0ZA 2KQUA 1N5OX 2HJRA 1W94A 4WN9B 1XQ9A 4R31A 1CUAA 4EQZA 3PXCX 5AKJA 3C85A 3EXAA 3LDFA 2H00A 3NB0A 3TRJA 2GPSA 2IJGX 3LHFA 4ND6A 1U6IA 4FNGA 3FCEA 5L40A 2YOFA 4PCUA 5CFPA 3ZHOA 1B8PA 5ALWA 3WX0A 4IDBA 3AFNA 4C7XA 2NZUG 3OEED 4GR5A 4ARZB 1X80A 2GLTA 2W7TA 2PYZA 4ZGGA 5TPWB 1T4CB 1G21A 1J4AA 1T3GA 1UBCA 1JJAA 2CL6X 1TC1A 2Q8NA 1XXLA 1J1ZA 1N9KA 4X71A 1PL6A 4FMCF 2BTOA 3WNQA 4JCOA 2DFDA 2YJNA 1RE1A 3HKBA 2F3UA 3K1ZA 4KZPA 3QU4A 1PO7A 3QOYA 4MRVA 1AGNA 2XOKD 3L40A 5EP2A 5JC1A 4JJGA 3LKBA 4J7XA 4G67A 3NHWA 4QBFA 4M0UA 2HA6A 1JR3E 2FMUA 3HR8A 3S2SA 3OFSA 3O8LA 1WY7A 4F72A 4Z7OB 4CNBA 2P8JA 3DW1X 4L8GA 2WM9B 1RKXA 4D79A 4O02B 3VH2A 1H2BA 4URXR 1I7DA 3EVFA 3J7TA 2IOQA 1OX5A 4UUMA 3TW6A 2IHYA 3GLVA 2J67A 1SBQA 4I5EA 2FR8A 5T6MA 3NHPA 1PQYA 3V00A 1Z0AA 5BT8A 2HY7A 4HJXA 1I36A 2JI7A 1XMPA 1R6VA 1Z6QA 1RLIA 2DFTA 1N3LA 3FX2A 4RA9A 4DJTA 1NN3A 2BFDA 1FNCA 2VPXA 4OIMA 4YRQA 5HK8A 1I33A 2BJVA 4OPMA 2Z5FA 1H0KA 1LH0A 2BEWB 1R9GA 3NTXA 4Y2TA 4NR0A 4IUDS 2QI9F 2OAP1 1NJ6A 4G4JA 4PPFA 3I6QA 1UXJA 5IUJC 1X1TA 1BXZA 2F1HA 5K0FA 4RSGA 2A78A 5FOXA 4Q7QA 1Z2NX 5IEBA 1VL0A 4ILKA 2P1ZA 4C0WA 3KCQA 3I73A 3U7GA 3H97A 5FF9A 4YBRA 3G5MA 5IT0A 1VG8A 2XNHA 1T5DX 5DV9A 4ZCIA 2FR0A 1U2GC 2RC5A 4MQMA 2PEYA 4OOEA 1QVRA 4XWYA 3PHHA 3IRUA 2XUOA 3CGWA 3IEPA 3IXLA 2ANBA 1SA0A 2ZRKA 4AJKA 2K7FA 4HDCA 4EH1A 1PZGA 5B1HA 3VTAA 1I3KA 1K08A 1S8FA 4ARCA 4I6GA 4ZOBA 5AVTA 2W6PA 1Q74A 4RTSA 2XGOA 5JE8A 4CKCA 2L82A 3DOJA 3TIFA 1ILWA 2REBA 1J06A 1PVDA 3B1ZA 2X9NA 3LV8A 4DAEA 4GKKB 1DKRA 1CY1A 2AG0A 2C2HA 4I50A 3TQSA 2CVZA 3IBGA 4IIEA 5KI6A 1AN9A 3B53X 1A9RA 3D4IA 2HI0A 3FGOA 2IYRA 2IYNA 4O3FA 3EZYA 3SJCA 5LMZA 2XHZA 1Q84A 3S1SA 3QI2A 1HORA 4PWYA 4Y30A 2EZUA 1KVTA 3MIZA 5JJ5A 1JEYA 2B2XA 1FS6A 3GJXC 1QIKA 4UNIA 3SAJA 4EFKA 5EPOA 4H3VA 4ER3A 2YN0A 4FTWA 4BKOA 5LMNB 3VR1A 2BFAA 3QWBA 1KWKA 2CNWD 1LBIA 2VTVA 2Z6AA 5AVJA 3FLAA 4FYYA 5A02A 5D84A 1CUHA 1D0VA 1JLLA 1P2TA 5KX5B 4NMXB 4Y2HA 3I9V6 1VTKA 2ZAMA 4KMRA 4BEJA 1OB2A 5B3JC 3KQLA 4EEZA 1M8GA 5JZBA 1O8BA 1YFZA 3FSGD 2QZ4A 4TZ6A 5F1KA 3ZS8A 1IRIA 1K5PA 3QWIA 3VSCA 2IEBA 2P8SA 2BJWA 2RSLA 3HCOA 2HMAA 3IJ5A 3ONFA 3QVJA 1XVLA 2C57A 4IIJB 4KIJA 4WL0A 1VECA 4DMKA 2CDNA 4ZMRA 2A4MA 3V8RA 3UWDA 1VYUA 2QRLA 1V16B 3WLRA 3S7TA 1IPHA 3BJZA 3GEGA 4OGWA 1YA6A 4XWAA 4NDNE 1EINA 1RRPA 3KT3A 4HEHA 4WZBE 5HZKA 2WUWE 1A9XB 1TEXA 1E2HA 4GM0A 4JLPA 1J9ZA 4MVJG 2IU4A 1FLDA 2R97A 2LE0A 2OMEA 3O83A 5DYNA 3K9BA 4PWZA 3ANXA 3HHEA 3QIAA 4HDMA 5SZKB 1VBNA 2V7WA 4D8YA 4QT4A 2XNJA 1B4DA 5JFOA 5D5HA 1RXCA 2O8BB 3GJZA 1GV0A 3C48A 9GPBA 4MEJA 4AMYA 4C7MA 3WKCA 5KDOA 2C00A 3QVVA 4Q4HB 4YYZA 3ZV4A 1X7YB 4NU6A 1XEAA 4O4HB 4QODA 1Y81A 5AI6A 5IRCD 4WD3A 4NBWA 5FL3A 4LQCA 3SBDA 3LKVA 1NMZA 4QIHA 2ZATA 3KV1A 4IHJB 4QM6A 4YO8A 5ANRB 1PR0A 1QYVA 3L8DA 2C8JA 5BR4A 1YB1A 2W90A 2B5OA 5F5NA 2ZYTX 2RH4A 4UEWA 3RYIA 4DNOA 1KAEA 1SVNA 1IFXA 3AEUA 3AUXA 1MIOB 2E85A 3GDWA 4DPMA 3IEIA 4RCVA 1N2SA 3TZCA 3EJ6A 3BD9A 3KWJA 4KQMA 3T9BA 2IXFA 5K3CA 2IPAB 3QQ5A 2CVQA 3SYKA 1JWAB 4JB3A 1XJQA 1OKKD 4RSHA 3ACCA 4GVLA 2W43A 3VMMA 2F7SA 2DB3A 4RVNA 5TQ2A 4H0NA 1SUSA 4D96A 3IKLA 2O3JA 5AYVA 1R7RA 3PUWA 3NHJA 1ZJYA 2YH2A 3NHBA 3E5MA 3I12A 4I1VA 4MKXA 2Q99A 3IC5A 1GITA 4MA0A 4OKSA 3BWBA 4OUKX 4WPGA 1IQRA 2OZLB 2GCIA 2JAQA 3PSAA 4NV3A 4TMFA 4CN9A 1KO8A 2SCUB 4MVWA 4WLEA 3DAGA 1BCRB 2OUKA 1C50A 4EQ6B 2XIQA 3CSDA 5F5LA 4EG6A 1I7QB 5K20A 2QQFA 3CY6A 1M2WA 4LYGA 1ZLXA 2FR8C 5ALGA 5K3FA 1W36B 3DBVO 5AVOA 3COWA 3QIVA 1G98A 3WB9A 1GUYA 3TNDA 2W42A 3LHKA 2GBIA 2ZBFA 4EVIA 3O2NA 2GNPA 4QGBA 2WLTA 1WMDA 4CLRB 3CUKA 4CEHB 1I94B 2OOSA 1GQQA 3WYFA 3TTUA 4ARVA 1V11A 2NNLD 3MYYA 4XX0A 3RC9A 2FX2A 4AYTA 4C0XA 3GLIA 5AI4A 5B6JA 3G9UA 1M9NA 3JQ7A 3ONVA 5CM2Z 3TZKA 2DWPA 3KPYA 3KC2A 2MYTA 4DXAA 4CKWB 1E3MA 6AT1A 5EI5A 4OBEA 5T6BA 3BORA 3EZXA 4FJ2A 4AUKA 1WXEA 2HA2A 5L3RA 5E0KB 1E4EA 4RFSA 1VLVA 4KQ9A 1BEZA 1F0YA 1C9JA 2AFIA 4A6DA 1KEWA 2B98A 2C03A 2XD9A 4KQ1A 2XVYA 2R1UA 5A0VA 3IMCA 1E2LA 3GPCA 4Z9BA 3WHKA 3WAGA 2F9FA 2G5TA 2C4KA 4Y0NA 4MCIA 4DREA 3JQAD 1ZNZA 3F2IA 2AKYA 1RAGA 2AZMA 1O96B 1PEYA 2CLHB 3DQQA 3HXTA 4QLAA 2X58A 4BCDA 2HO5A 5DTEA 4AP9A 2QTZA 4P84A 1OROA 2FJ0A 1QAOA 4JV5B 1L5ZA 1O6ZA 2DUWA 2AEJA 1NL3A 2EVWX 3PHBE 5F33A 4NEGA 3PGXA 3RBAA 3ZEIA 4OBXA 4NC9A 1UC5B 3HZRA 5TGTA 5IPFA 3Q5EA 4GC9A 4ZGBA 2LRHA 2Z0MA 1UMKA 2WIGA 2B21A 2X3FA 2A58A 3ZIDA 4OI0A 5IAAA 5KYGA 2B36A 2UAGA 4HGYA 1K8RA 2AN9A 2WU1A 3PQCA 3LUBA 4L3VA 4EM6A 4U2BA 1TXGA 3CGGA 3D6MA 4XJTA 5EXDA 5L3SA 5KMGA 4CVNA 1PFYA 2WFLB 2UVPA 1BRMA 2V0CA 1KI6B 3NHSA 1PFVA 4JVMA 3AUJB 1HMYA 1HYBA 3F6CA 3K2EA 2Z9CA 3HBJA 2P62A 3W7BA 4YB8A 5LWHA 3SVTA 3RTGA 4N6GA 5K0NA 5EIHA 1G66A 4C7BA 3GMTA 3ZDRA 1EVIA 2LTAA 2AMFA 1V1RB 5K51A 5JZVA 2GAOA 4K0KB 1M2OB 1T9GR 1W1IA 1XZ8A 4UFOA 4WINA 2Y6VA 3TYXA 4CQMD 4LRWA 1ULAA 2Q07A 2C42A 1OIXA 4KBFA 4ND3A 4PAGA 3HE3A 3D43A 2V65A 4HNUA 1A27A 1S2OA 1WPXA 4Q1BA 5HQ3B 3JAKA 1KOGA 4CKBB 4B6RA 2FZVA 3UAGA 5SY4A 3HCNA 2VDWB 4Q01A 4Y8VA 3C5WP 1KQFA 3GLGB 2AOVA 4P0TA 3C7DB 2C5HA 4HWRA 1RRFA 4ZAXA 4OYLA 1PZNA 3NBKA 3OFVA 4RC9A 1EDZA 2ENUA 2Q29A 4OQYA 3RS4A 4EPVA 3RSGA 5BRAA 4UBJA 2RB4A 3H2BA 1AUOA 3QPUA 1XYYA 4PM4A 2IBSA 1KJIA 5KTRA 3U2QA 1G6HA 3N6VA 4OGLA 4GGOA 4Z0HO 3MRSA 3I61A 2ZYRA 1ZDMA 1VLJA 2DBVO 3PITA 1QORA 3AERB 1EJ6A 3H65A 1IB0A 2PXAA 1YULA 1XTKA 2GD6A 3BIJA 3IPLA 3N86A 1WY5A 3RYCB 4IDPA 1V71A 1D1SA 1P8JA 2Y77A 3NRCA 1AOXA 2PYDA 2OYSA 1Z0JA 4O33A 4XD7A 2VHUA 3BICA 3KVRA 3HP4A 4IJKA 4XXHA 5B53A 4AJLA 3O9VA 3GJ8A 3K16A 3H9JA 3A10A 2JGKA 1ARZA 1Y9EA 2FUCA 1XEWY 3COYA 3KT6A 1Y9AA 5JS6A 1CRZA 2HK7A 1SBNE 1JDTA 1E9FA 1UKVY 1N7IA 4ONEA 3KM0A 5GV8A 1M1YB 1EQUA 1XZAA 1Z2EA 4J4TA 1A97A 1TKRA 3OTQA 5K3EA 1YWGO 2Q1SA 3OD1A 3N7TA 2ZJ0A 5FI1B 1Z15A 1BYUA 2YXBA 1EFPB 4DNPA 3CEAA 2YHAA 2QJOA 3WY9A 1GCAA 4UMFA 6Q21A 3WL5A 3HZOA 1AG9A 2ZVJA 1BD4A 3MILA 2HIMA 3BC1A 1CEQA 3IP9A 1DQNA 2QUIA 1R74A 4BIIA 4KK4A 5AI8A 4O3MA 1OLUA 4Q9NA 2IEYA 1MAAA 4X93A 2NVWA 1R0KA 3HA2A 5AKEA 1DDIA 4LEIA 4Q9HA 3SEAA 4LC0A 3A4LA 4WUVA 4CMBA 2AOTA 2PKQO 1TVEA 4FW8A 3SFTA 1H1LB 1HDXA 2GKOA 1V6SA 2RKOA 4RTLA 3PXBA 4DCGA 3IUJA 4CM4A 1UDCA 1Z2AA 2I6XA 3TLMA 2QTCA 2RCYA 3A9SA 3WFJA 3O84A 4KUHA 1JQAA 3SQLA 3TZHA 4DC1A 3F5DA 5A9RA 1GO2A 3RVLA 4CL0A 5CDGA 2BR3A 2LZ0A 3PR1A 5DM0A 1ISSA 4NCBA 1V8ZA 1QMPA 1X86B 2V58A 5EQTA 4AO8A 4E15A 4Z53A 1KDVA 1ZH2A 3UK2A 2FAXA 2AUMA 2HRDA 2W6QA 3HA5A 3QLJA 3TLAA 4EAAA 4AMUA 1TLLA 2Q4RA 2V6FA 4MXDA 5JPIA 1BCSA 3WYCA 2IEIA 1XFAA 1VJCA 3DZCA 3EN0A 3NV9A 3IAM6 1IAVA 4RHFA 4Z4CA 4ZEOA 5FT9A 1PD0A 1BHJA 4TRMA 4M9UA 2C9MA 4ZOCA 1QIIA 4RDHA 3TRKA 2EFCB 2EP8A 1LK0A 1N8SA 1W4LA 3OX2A 1Y5IA 1CB7A 2VH1A 3C6ZA 3EVGA 4LVUA 1EFDN 2DT5A 4ZYWA 2FPIA 4IGAA 1T6ZA 4ZICA 4DADA 2HHJA 1FE8A 4YCMA 1QOPB 1YFKA 3LGAA 1LZLA 4YP7A 2V0GA 3DL2A 4HQOA 4DW8A 3AHHA 4BNDB 1GTRA 4WJZA 4JC8A 1A5BB 1K2VN 4OM8A 4R3WA 1V9LA 4BUCA 3AO0B 1LNZA 1KGDA 3RAPR 1PK7A 4YXWA 3U1BA 1VPTA 2CXTA 5DOVA 3RIHA 4E30A 1U0FA 2IVFA 5I7WA 1O58A 1MX5A 1GZ7A 3FKSA 2R8ZA 3MT7A 5AJYA 2HTEA 1FXUA 3V1NA 1RABA 4HDAA 4CTJA 3C4VA 1UOOA 1HWYA 1W85A 2AHRA 1ECFA 3R3SA 4LW8A 1Z28A 1Z4JA 3DDHA 1E8NA 2QN7A 3D6VA 3R3WA 3FVWA 4DQDA 1TL7C 4Q34A 1OH5A 1YE5A 2HXSA 3OPYI 2PUTA 5BYBA 3EY9A 4IINA 3UMSA 1VZ3A 5EXTA 1IU9A 3NKVA 3DM9B 4JJ7A 4QU8A 4E22A 4MR7B 3FYUB 3L46A 2QYHA 4YRPA 1SCBA 3FYDA 1MGPA 3PQDA 1ZGZA 4M87A 3VC3A 4BVKA 2C97A 3KB8A 2VRCD 2GZHA 2QSYA 2OBMA 2UYOA 3QFTA 4OMUA 3AR3A 4E2FA 4TS1A 1K6JA 2A33A 3W3AD 3BJIC 2J6IA 2M1ZA 2PX6A 3QTLA 3SLGA 4G8BA 5F3RA 4BLVA 3VU0A 2IXGA 2QJTA 3ORQA 3AYXB 1GAEO 3JWHA 3OH8A 3RRZA 3IPCA 4NBSA 4I81A 4XIGS 5A2GA 5HTOA 3KOZA 5ADHA 3I04M 1YBMA 4OK5A 2CW5A 4EY6A 5L4NA 3GEPA 1OC2A 3BF7A 1NJSA 1Q6YA 3DVRX 3WI7A 3FB1A 1NSYA 1P61B 3N8NA 3RS7A 1EIZA 2Q5LA 4YJ3A 1P7ZA 4K9KA 1G5IA 3CNEA 3NRJA 4DB4A 4ND1A 4JDUA 2AN1A 5G3ZA 1ZH0A 2GAAA 2JI6A 2BHLA 2YNMD 2YV4A 3OMXA 4M8KA 1M34E 1GNTA 1DXYA 3TG8A 5KHAA 4Y9SA 2IHNA 1RYMA 3L79A 5K6TA 5C1BA 1RXWA 2X6RA 5K09A 4XPZA 5B7QA 4XW2A 5G0WA 2GN9A 4BJ5A 2ZRFA 1C7QA 4UVDA 2QGFA 4GI5A 4LNHA 5A9TA 3FGPA 3H3JA 3QOWA 1NF8A 3WDLA 3DHNA 3UK7A 2ZAOA 2I6SA 3WDSA 5JMWA 1MT3A 1VG9B 2FUKA 1F2UA 2BFNA 1A04A 2O23A 3INTA 3NEYA 3AY0A 3KVYA 3Q3GE 1GGFA 3QF4B 5E0OA 1K6IA 1TVKA 1U0LA 3VR5D 1BIFA 3C70A 2H2IA 3L82B 1XZJA 1TIKA 3MN1A 2EGGA 2JJMA 1K9SA 3C5CA 3I2YX 3E1SA 3I2FA 3IALA 4MWZA 1AO3A 5U4QA 2AJLI 4JI1B 4JL5A 3T7DA 2AF3C 1IC6A 2F64A 3H2HA 4DZTA 4HAIA 2CV2A 1KORA 4MKHA 1E0KA 2PRKA 3FNEA 3WWPA 5BORA 1A82A 1ZM3A 2OECA 5AW1A 4EFMA 4YCBA 4BFYA 5IZCC 1NXTA 2CDRA 1C30B 1DAFA 3OHSX 1VDMA 3VDMA 3DEYX 1V5FA 3ONNA 3PKJA 4DSAA 1MZPA 4IUBS 1HX7A 4ZDKA 2UUBB 1FRVA 1GRCA 1N92A 1OXMA 3OC0A 1EYZA 2QVLA 3KUDA 2A88A 3T35A 4A3SA 3AY6A 4JYCA 2FRXA 3ZW8A 4NS4A 3TD2A 1JEQB 3VR6H 2MSCB 1G5TA 1M2VB 4UQOA 2NU6A 2PD3A 1QPZA 3M82A 2W37A 3ON5A 4J0KA 3FDZA 3GLSA 4ARIA 5IK2D 5HKOA 5AW4A 1P0PA 4JYZA 1CDZA 1JHYA 1TZMA 1GPBA 4B2LA 1EDOA 3I6BA 5C34B 1R4MA 1M1ZA 3UM9A 5HHTA 4UAVA 4TKVB 1ZN9A 3FAKA 4P80A 3BAZA 2JLCA 2CNKA 2C4HA 3OT1B 3U9SA 4ABYA 1ODIA 2A14A 3A32A 4TVOA 3VR3A 3UJBA 3VKVA 1TM7E 1U9ZA 1GV1A 4XVHA 1UKAA 5B64A 2IXEA 3Q9LA 3G1WA 2WQ7A 5JSZB 1S1MA 2QMYA 2CL0X 1SKMA 1GL6A 4B74A 5EKDA 3DBOB 1XVTA 1DVRA 5G40A 4B4VA 2AG8A 3VI3B 3RRJA 2GF9A 1AHNA 1JQ5A 1RLJA 2VSNA 3C87A 3JRWA 3UATA 1FP6A 3BMNB 3WBBA 1NA5A 5AKXA 5CFMA 3KUCA 1G291 2DX7A 3M6UA 2NACA 4NX2A 3ZU4A 4IDEA 4FZ3A 2WTAA 3LQFA 3AKZA 4Z1MA 2WNHA 4FYHA 2IX3A 1AUPA 4ZJZA 3ZHSA 3NETA 3EZ6A 5CFRA 3SR4A 4UW9A 3KHUA 2W6NA 3VR6A 5JSKA 1JA9A 1YZYA 2VDNB 3A0RB 1U04A 1MR3F 5HZHA 3F5FA 3GRZA 5DULA 1YDWA 2IY8A 3HI4A 2R6ZA 4P22A 3BMOA 3FMFA 3K0EA 1Y3FE 3PVSA 2NSLA 3QVLA 4MCAA 5ALHA 3WBFA 4ZQFA 3RRXA 4YT8A 4CEIB 1JALA 1E66A 4B34A 2WABA 1NP6A 2SNIE 1MIHA 3MWDB 2DSNA 1ZZGA 3DOFA 3NXKA 1RQ2A 2VHYA 2JK0A 3C24A 1V3UA 1XRLA 3DLCA 4J7CA 4NULA 3TQIA 4BKPA 4JXKA 5L4LA 5J4YA 2O3QA 5JXJA 4IIUA 2X76A 2CB9A 1QOZA 3G2KA 4TZ0A 2GD1O 3QEMA 1NQXA 1TLFA 3WWZA 2C7QA 3CEHA 4IDGA 1RNLA 4WKPA 3MWEA 4TXJA 4COKA 2QXYA 3E7WA 2FP4A 4R2WA 4R6XA 1RKBA 2IIQA 4RHUA 1Q0TA 5CNIA 1WM1A 1EUCA 2DM6A 3ANNA 4G0ZA 3SQNA 2VK4A 5JCZA 5J2TB 1POXA 2PRYA 2V98A 3OOJA 1E5DA 3BD8A 3QLUA 1RWBA 5JNVA 5LB2A 1TVCA 2FXVA 1TW2A 4DBVO 2G77B 2QL5A 5EIBD 4ZVUA 2J3QA 3AR8A 3IA2A 4C0BA 4D41A 1NBIA 3BEOA 2EEPA 4IGEA 4B6FA 1TFUA 2BGUA 3Q6IA 1NR5A 1M6HA 5C8ZA 1JE1A 5IZ4A 2PL1A 2OGSA 2WW8A 4GLJA 4XFKA 2OWEA 1HDOA 3BGIA 2BF7A 3H16A 4G85A 1D7OA 5CLGA 4Q9JA 1XN1A 1VKRA 2Z4TA 4TV8A 4JD5A 1F4VA 1ZUHA 4GIBA 3T5PA 5LQJA 2IWHA 1KO5A 2DFPA 4EYKA 3AHJA 4FWTA 3HCEA 3H9GA 3ESRA 2CJXA 1E7YA 1EVKA 1LFAA 1FNBA 3H1AA 4MOWA 4E12A 2BM9A 1QIDA 3WDKA 2BM1A 3FBWA 4IAOA 4Z86A 4OG2A 3JWJA 2C59A 4INAA 3WGKA 1O9GA 4G5FA 5LZ8A 3RWOA 4BNVA 4LF7B 1UPAA 3LI2A 1WMBA 4PZDA 1GU7A 2RIPA 2AWOA 3TL3A 4KR2A 3RT7A 1QRDA 4OHYA 1AQLA 5DJ5A 1EGHA 3C7CB 4DJDC 3PRKE 4R8VA 3C16C 1CJTC 3PC6A 3UMFA 5F51A 3AVXA 5JQGA 3RBVA 3BFVA 4FN5A 3FZNA 3GCDA 3QEOA 1CP2A 5IKOA 3G5LA 4YGYA 4JLVA 5L6LB 2W2LA 3T6KA 1PUIA 3SJUA 1UBHS 4QG3A 3GJ4A 3G5TA 2XEDA 1W8IA 5KKAA 5MFPA 4IVPA 2E49A 3PRJA 1D5CA 3UMMA 1PHPA 5FPPA 4CCWA 1CS0B 3G9ZA 1T6NA 2TYSB 4GPD1 4RHEA 2ECKA 4HEJA 3N74A 4X6UA 5FNVB 3UXEA 1KXJA 1J49A 4WA7A 2PV7A 4ACAA 3U80A 3T54A 1FUUA 1T5OA 3PQ8A 1MOZA 3BBLA 4XWGA 1V16A 2J9RA 1EUYA 1CJMA 2FW7A 5G0TA 5J40A 2I2XB 3SEFA 2E48A 3FTQA 2IW1A 1H93A 3OEYA 1T6BY 2FWNA 3N6XA 5GWXA 4UE6A 4M0KA 4EA7A 3GJSA 3OIDA 1U1CA 4IF6A 3IP3A 3VPBA 1YK1A 1U5CA 2PPLA 4J76A 1QTNA 3LYAA 1A9XA 1GVNB 1JR6A 5LIPA 1UBLS 3L6EA 3EZFA 1P5JA 2EFYA 4UNQA 4NU0A 4FGZA 4ND4A 4YFYA 2I2CA 5EVCA 4HT3B 1M0SA 3JARA 2D1TA 2I2AA 2VUHB 2Q41A 3AI2A 3WMFA 4BNIA 5CIWA 1D6SA 2C95A 1J2UA 1YDHA 3CLRC 4LPKA 5B30A 4O4HA 2RK4A 1ZFNA 3LQ4A 3QVUA 3FCOA 3QXXA 1FVOA 1RAEA 2HQSA 3MUFA 1AA6A 3JVVA 3ZHXA 3UJ3X 1KH2A 2CJPA 3EGIA 4M46A 1YB6A 4QJ5A 4R8KA 4G2TA 1YRYE 2N0SA 3LP5A 3OIWA 4IHJA 3DVQX 5SYMA 1L1FA 5G0SA 3WGUA 4C2TA 2AE2A 5T41A 2P4HX 1OZFA 2BFOA 3CZ5A 1QQ6A 1RP7A 3AFHA 1IVYA 4FOTA 3WXBA 1XDBA 4PSCA 5JJKA 3FTDA 4E13A 1NN0A 1XZHA 3S40A 1XNHA 2O4UX 2XUPA 1ZMTA 4LZAA 4PS0A 1L4GA 1VLLA 5FKJA 3UCFA 2WJJA 1IOVA 5AH0A 4MULA 5FLYA 1RAFA 2ZLBA 4FLFA 4TTPA 5ALJA 3RSQA 3JQ8B 3BSWA 3AKCA 4BB5A 5L7WA 1BOOA 4V0NA 1C9KA 2E6KA 3EXFB 4MYUA 2WFZA 1PDOA 3NJRA 3MFYA 5TR9A 1PQ4A 3AJAA 2YJ3A 2V8BA 2VEOA 1X0XA 3HGMA 3RYHB 4YYEA 2G17A 4GYWA 3R3XA 4NBNA 3T61A 1KY3A 4X20B 1I3LA 3WSTA 2NVUA 2IU0A 1XVUA 1EHCA 2Q9UA 3OOWA 4UVHA 3OCZA 4AKHA 3AZOA 4CIYA 4R5HA 2KLHA 3SZ3A 1T26A 5EQJB 4TV9B 1YKFA 4PHHA 4YJGA 5DVZA 2JIQA 3TTVA 2PZFA 2QMOA 4X84A 3H8VA 2C7RA 3AV3A 4GMGA 3OURA 4OX9Y 3QFRA 5ER6A 1CVRA 1ZCJA 1G7TA 3NEAA 5J2UF 4ZEVA 3T3IA 3DLAA 4KNVA 3QELB 5LYYA 3T3EA 5AKKA 1Y7HA 3PNBA 4FBLA 1O0BA 4CEHA 2H1FA 4IGFA 4XIYA 4NENB 1Y34E 4MRSA 5FOWA 2YCBA 2ERYA 2O3RA 1QPBA 3VO1A 4NJEB 4C88A 2ZRQA 4WE3A 2H0QA 1TLTA 3QLUC 1FYWA 2ISQA 5FYQA 3GD5A 1X14A 1SK8A 3NC4A 4RKWA 4EJSB 1I2DA 3N2KA 4ZU3A 1W36D 4FCWA 2CVFA 4FYVA 4I1YA 1ECGA 1N7HA 3CG4A 4N82A 3QX7A 1WSAA 3G2NA 1K97A 3VFDA 2Q6VA 5T67A 4EZBA 2RARA 1LV8A 2ZR7A 1CC1S 2Q1YA 5CB0A 3JQGB 1MJGA 3CW8X 1P2GA 1QQ5A 4ZD6A 5DHUA 1YZKA 3ROMA 5BSGA 1G9TA 3RH0A 1CQJB 3VHRA 4MW5A 3B70A 2GS9A 4GWKA 4R2IA 2IQIA 1BHO1 3BHNA 2A92A 4KEAA 1QP7A 1RPTA 1MD9A 1QKKA 2I65A 4YRDA 1N1DA 1MPXA 1O96A 2VO1A 1W5SA 2XCUA 3KAJA 5DP1A 3U7IA 4HPWA 4C5AA 4JZYA 4C3VA 3FPLA 1L7OA 1OQAA 1RWXA 1CFZA 1FUIA 3TTTA 3HUFA 4HNSA 4IMPA 2D6FA 3DO8A 3WNBA 1VGVA 4AD8A 1HURA 1O9HA 4DFDA 2FPLA 2W6ID 4BZWA 1H2EA 4PG4A 2IHVA 1P4HA 1N7JA 4V1CB 1TE2A 2JIRA 4JC4A 2ID7A 5K8VA 4Q6WA 4CF4A 3BB3A 2DEUA 5E2AA 4ZEMA 5LQDA 3D5QA 3LQKA 4KQGA 4D25A 1KI6A 2E4WA 5EEGA 2A0FA 1PEKE 2XQGA 3UWOA 4DZRA 3IE0A 3B3QA 2ZWMA 3GFPA 2Y2VA 4JKIA 5DGCA 4B3DA 4J1TA 4EHBA 1K5GA 2C98A 2EQBA 2FQWA 2ZDQA 4U0KA 5CVEA 1FMFA 4ZYVA 2FTKE 4DCJA 3B9PA 2BSQA 3L4JA 4CMIB 2FZWA 3A1CA 4N9QA 2VT7A 4OAQA 3ABSB 1QH8B 2HSWA 3MJVA 3IQHX 1M2OA 4MYSA 3W6UA 4FDTA 1OV4A 1SHZA 1ZISA 4B3SB 3UPUA 5JXIA 2XT9A 1TYCA 3V6MA 4ITUA 3Q9UA 2W2XA 1JBQA 1N6RA 4P35A 3TOVA 2HPZA 3MRTA 3VNAA 3OU7A 4TLAA 1XLUA 4G8CA 3DBRB 4X9XA 3ZE6A 2VP4A 5C81A 3GLGA 3UIEA 1JIIA 2VBIA 5DHAA 2WSSA 4MKFA 1ZOSA 1RKVA 1RYZA 4GOXA 1FBNA 4R4JA 1OXKB 1BMFD 1KFEB 3V4ZA 2WJ3A 1RXUA 1JHUA 3P1JA 1WL8A 4I5FA 4XLTA 3RK1A 3QBVA 4ZI7B 1SXPA 1X77A 1UJ2A 3LLCA 4QULA 1PZEA 1WX1A 3GEDA 3ND6A 4PNHA 2J30A 4Q02A 4ZANA 2Y93A 1EH5A 1P7CA 1P2BA 1NU8A 4R40A 2N46A 3WK5A 2Z1DA 4WBXC 5B5SA 3T5AA 2X13A 4LY6A 1DQRA 4X90A 2CHQA 3A1NA 4FD3A 3AERA 3QMWA 1RBMA 2J1LA 1SKBA 4M36A 1MRNA 2HLDA 4B4KA 4N40A 3RYCA 3P2KA 5KBYA 1OSNA 2GHTA 4RETA 1NJ1A 4EPRA 1JSZA 5CA1B 2RGWA 1ZIYA 2R6R1 2ZP1A 5FQNA 4BX2A 1LBEA 4ID9A 2P9QA 1BHSA 4GMFA 2AYZA 4ZJPA 1N4AA 2HIGA 2QWXA 4RDIA 3PE3A 2QP9X 3AC0A 3GOQA 2BEJA 4MZDA 2NT3A 4AK9A 5IVPA 1ADFA 1H0SA 1M1YA 1TTTA 1IEWA 4FFVA 3IE1A 2Z3ZA 1BKDR 4L4SA 1EK5A 1YIDA 4RCZA 4ZCLA 3H04A 3QUBA 3RRFA 2C5SA 5TVKA 2CF6A 4QHSA 4B2PA 4ZYTA 3PUYA 4GKVA 2ACKA 3BILA 1EFPA 4IIYA 3F7TA 3UFXB 1FYEA 1RAHA 2W4IA 4WADA 1M2JA 5E7QA 5LNK1 1DTSA 1AGYA 4DPKA 2B34A 5J4VA 1XDSA 1UEXC 5BRNA 1L4YA 2FQXA 2P9JA 3IR6A 1KF0A 4Y6GB 3G2QA 3RQSA 3B9BA 1RXSA 2ZSEA 3RB8A 2YRXA 1VE1A 1Y6ZA 4TWRA 5CXSA 2CLMB 4B3XA 3BGDA 3AUUA 3COSA 4I9HA 4CR6A 4K28A 4Q3NA 4RULA 3DWIA 3T52A 2XT0A 3B7PA 1ZMXA 1J5XA 1QHSA 2GCOA 4P53A 5SY6A 4AZTA 4DT1A 2I29A 4YLYA 1UT6A 4YREA 3W1WA 2V74B 3FE2A 5B7NA 1XT6A 1W5AA 2OHJA 1II0A 4HTFB 3E5NA 4PXAA 2RC6A 3HNRA 4FM9A 2P75A 4MGEA 3TXYA 1JEYB 3GJTA 3I2JA 2FJUA 4YCLA 2JGDA 2GEKA 2NV2B 1L5HB 2C9DA 1WB5A 3W06A 2GEJA 3RSFA 2FG7C 1TEHA 3ZX5A 2G8LA 2MSLA 3EGVA 1AS3A 1Y5RA 1UAGA 1U28A 1FFHA 3CVJA 2G9UA 3EUEA 3KELA 3LDAA 5DM2A 4K7JA 1V4NA 3WMXA 1J0CA 1R4ZA 3MMZA 4KWHA 3LUDA 4G0NA 4MAAA 4XUEA 4NNOA 3FHTA 3SF8B 1LQTA 4Q4JA 3IERA 1O6GA 1J0DA 4QEZA 1JH9A 4EGSA 1WJGA 2O0JA 1NG9A 1D2RA 3R40A 1RIIA 2DBRA 2X4DA 1KI2A 2WKQA 4GPBA 4J1QA 1ZO8A 2ORWA 3KB1A 1RFGE 1CW2B 3PFBA 2XQKA 4DWVA 2PGOA 3LZDA 5ALLA 2MCFA 3GZNB 3M0EA 3ZE0B 4PLHA 2DGDA 3ENVA 3EFBA 4PNZA 1P18A 3NEPX 4OLJA 4RF3A 4XEHA 1I2MA 5DNEA 2VAPA 1C3XA 4RL4A 5JS7A 1KY2A 4L85A 1E96A 1QU2A 1G2PA 2OE2A 2Y4NA 2ORIA 3W4KA 4NPHA 3HO1A 3OOSA 1PX2A 4NEQA 2FZGA 4BX0A 5HWSA 2R66A 3LMKA 4CM8B 2P4EA 5TVGA 1DKPA 3SDBA 3N2EA 2WAXA 3ETCA 3SHFA 1SCDA 1QRAA 1XV5A 4WFQA 5HQTA 1KI9A 1LX7A 2G82A 3ABRB 4RM2A 4IO1A 3F47A 4HX5A 4GBJA 2NGRA 5JI2E 2QUBA 2X14A 2RGXA 2VTDA 4L51A 4UCFA 5J5CA 4YDQA 5E8JA 5JD4A 4MZXA 4PSKA 2OFWA 4QQFA 3GMSA 2F9LA 3EBPA 4KV9A 2VP2A 2ZT5A 2HYDA 3MS2A 3H19A 4E07A 1N25A 3HRHA 3KTAB 2AX4A 1Z6XA 2NSJA 4M1TA 5JS2A 3ORHA 4JP2A 2P3OA 1JYEA 4BP9A 3W2EA 3DNPA 2MSNA 4V1CI 1JJVA 1EFUA 4P92A 1G2QA 4LMRA 4LFCB 4J1TC 3OFND 1F3LA 1RRMA 2JRCA 2ZB2A 1VG0B 3G5AA 3JATA 3LW8A 5J2TF 1C3EA 3QEAZ 3R9XB 5EGNA 4O1IA 1WS6A 3NVDA 2GA9A 5JRDS 1XLVA 4PFKA 4B9EA 3F7MA 4PIPA 3ZNOA 4HZGA 3R7BA 2EFHB 4IW3B 1HOXA 1Y89A 3BMQA 3HYRA 4XIIA 3ZWOA 3BF8A 1Y9ZA 2W6MA 3HJAA 2Q2VA 1GG2A 4FGKA 4HFNA 1EP3B 4KNWA 5EJ9A 2ZQYA 5JH7B 4ER5A 1PGQA 2ZSBA 5JVDB 4IH1A 4V0SA 1JYFA 4G8DA 3K1YA 4RNDB 4ZJYA 1BW9B 2WDPA 2F8MA 4MR9A 4EHLA 2Q5FA 3ASVA 4M8LA 2PS9A 1YSCA 2ZJZA 3P26A 4C04A 3GUYA 2UKDA 4TRRA 1DX4A 2XGSA 4CMHA 1YS6A 2H9IA 2Q2OA 2W83A 1DWUA 3HN7A 4IQFA 5KWEA 5HOEA 3R76A 1DHTA 3HO8A 4L4YA 3GXOA 1S7CA 1SCUB 3VHQA 2C4MA 2VUUA 1JDVA 1S2LA 1IWPB 1H1TA 3F71A 3WLOA 4AC9A 1KARA 1V9CA 2EDAA 4KXQA 3HDTA 4ISCA 4PCVA 1FFCA 4RK7A 2X15A 2NXCA 4BV3A 4QBKA 2FI1A 3DUFA 1NVFA 2X40A 1DXOA 4E03A 4X1IA 1KYYA 3BJRA 1RYDA 1SM4A 3E05A 1ENYA 3G7SA 2NUAB 2BUAA 1GQYA 1H9BA 2YOHA 4GM1A 2EZTA 1HETA 1NX9A 3G59A 1R0YA 2YWFA 1GUAA 1C30A 1OWLA 1FPQA 2IXBA 2J0SA 4BO8A 1RRKA 2YWBA 5F9MA 4JEMA 4K5QA 3SI7A 3VMFA 4E33A 3WGIA 4TQGA 2ISCA 2HR1A 2QLBA 2YASA 3ZEAA 2CNDA 1YUNA 5FEMA 3FR8A 3MJFA 1JEQA 2GJ4A 2II6A 4LDRA 3V80A 4EA9A 3GLGE 2PQ2A 2YDXA 4I55F 1VMAA 5HQJA 2G83A 2G40A 1M2HA 1L8XA 4PLWA 3H9BA 5AJUA 1FUEA 4WNYA 4BNLA 5DX1A 2RGBA 2J31A 2QD1A 1G20A 1SXJA 1G63A 3ZU2A 3B2EA 3RU9A 4B40A 1LTHR 4MR8B 2CSXA 1Q7TA 1SY7A 4GS5A 4DANA 3N53A 1GFIA 1JKXA 2C7VA 1NVVR 2D0PB 1IK6A 4IXTA 1KEPA 4GFDA 3DLBA 5J5AA 1BA3A 3HKCB 2V7GA 5HZGA 2I2DA 5FCDA 3KFLA 4Y2YA 4YMTA 1P17A 2O7QA 2WKWA 4I4IA 4KYIB 5LP6A 1ILEA 3IDQA 1VSBA 3Q9SA 4FEAA 3NTUA 1LSUA 1YU6A 2BMFA 3LGXA 3TAXA 1F9EA 4DIOA 4EECA 5E6SB 3BH6A 2VDUE 4B3CA 1UP7A 3I52A 4RD2A 4AG3A 4GGMX 4I8DA 4MA5A 4PICA 1U28C 3CEMA 2J3EA 2NU8B 1I3MA 5JSZA 1Q19A 1QYRA 4Q0MA 2OFFA 1SUBA 4A2QA 3GOHA 1UQTA 1JPVA 1H5QA 1OX4A 1EMDA 3G82C 3TDKA 3Q7SA 1M1YE 4KN8A 1J33A 1P62B 3RHTA 1ACMA 3G9TA 4FHEA 4OD0A 4JY7A 1T4MA 1LLQA 1O4VA 3VX4A 4Y6PA 2PZKA 3VC7A 5CM8B 5NLLA 4Z7JA 1LSSA 1KEEA 5JOQA 1IBRA 4F45A 1QHNA 2Z09A 3HO6A 1E7RA 2QR2A 3BMCA 1PEDA 4MGIR 3HH8A 1B0PA 4HDRB 1XL0A 1R5JA 3DHVA 1WMAA 3PI6A 5GM1A 2FG6C 5AW6A 2ECPA 5CJ2A 2FSVA 3W6OA 5J1TB 4HWKA 3DMGA 3UMCA 1SVUA 3KKKA 1LPOA 2UDPA 2DCMA 2HJVA 4I50F 5IJ0B 1QCYA 3Q4GA 5MHTA 3TW8A 2FK8A 2I0FA 1OFGA 4NE9A 4DR3B 3IEXA 4JFRA 3JWGA 4CV1A 1RI1A 1UKZA 1R0LA 4DSZA 3WLMA 4NXMB 1L5VA 2OV1A 2YV5A 3JCZA 2B4AA 2GVNA 4B8ZA 3R5FA 1KDTA 1F14A 5I7VA 2X86A 1DFGA 2VPTA 2PIDA 2HUPA 3MJHA 3PK0A <