1FC0A

Human liver glycogen phosphorylase complexed with n-acetyl-beta-d-glucopyranosylamine
Total Genus 326
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
326
sequence length
809
structure length
792
Chain Sequence
b'NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOGEN PHOSPHORYLASE, LIVER FORM
publication title Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 326
structure length 792
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2000-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1fc0A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1fc0A01
2ASVA 3CUWA 3O3CA 1NOKA 2YJNA 4RBNA 3T3GA 4MHOA 4GPBA 4RIFA 2IEIA 4M60A 1HLFA 1WW3A 3HBMA 3Q3HA 1FU7A 2JJMA 1L7XA 3E3OA 2IV3A 2BGTA 3OTHA 1A8IA 4WACA 2SKEA 2P6PA 3MT8A 4MHSA 4MICA 2QRGA 2QN2A 2QN1A 3T3HA 3G2KA 1XOIA 3HBJA 1FA9A 4RIEA 1FTWA 2FFRA 1NVKA 2IV7A 4XIFA 1EM6A 4F97A 1L5SA 2C4MA 3E3LA 3MSCA 2AW3A 2BFWA 3MT9A 3ZCSA 4EKEA 4N39A 4NESA 3HBNA 1Z6QA 2GPBA 1IXYA 3VUFA 2C1XA 1O6CA 3SYMA 2FETA 1SXQA 1GPAA 3T7DA 3CUVA 1K08A 2VSYA 3IA7A 2QNBA 4AY6A 5ENZA 4N3BA 1FU8A 4YI3A 3NCHA 3DD1A 3TSAA 5IKPA 3OY2A 2ATIA 2R4UA 2AMVA 2XA1A 2QRQA 1WUYA 2VG8A 2XCUA 4HLNA 3GUHA 1L5WA 8GPBA 3MTBA 3OT5A 3BD8A 2ACVA 1V4VA 4Z5XA 1RZUA 3T5TA 6GPBA 3OTGA 3CEJA 2PYDA 3NPAA 3CUYA 1LWNA 4F96A 2BGUA 3QKWA 3WAGA 2JLBA 3S27A 2XMPA 3Q3EA 4L22A 4GYYA 3MRVA 4MRAA 5JTUA 3MTDA 3CEHA 4KQ1A 4F9FA 3Q3IA 3PE4A 2QRHA 1KTIA 3BCUA 2G9QA 4X6LA 3RHZA 5C1DA 1GPYA 3OTIA 3D0QA 2IYFA 1ABBA 3C4VA 3S29A 5DXFA 2OFFA 1K06A 5I45A 4EJ2A 1JEJA 1Z6PA 3WC4A 2QN7A 4N3CA 2GEKA 2QLNA 2QRMA 3G2JA 1C8KA 1UZUA 3NAZA 3MT7A 3MS2A 1Z62A 4FKZA 4CTMA 5LQDA 2QN3A 1GZ5A 2X6QA 4RENA 2G9RA 3G2LA 3RSZA 2R66A 1NLMA 1YA6A 3MS4A 5GPBA 5IKOA 2BISA 4X7PA 5HXAA 2IYAA 5TMBA 1Y8ZA 2PRJA 2SKDA 4RIHA 4AY5A 1BX3A 3C4QA 3HBFA 4WADA 1F0KA 5D01A 4AMBA 4CTNA 1SXPA 3OKAA 3CUUA 2IUYA 2F9FA 3FROA 1GFZA 2QLMA 3L7CA 1FU4A 2HY7A 3AMVA 3NP7A 1NZFA 4LEIA 3D1JA 2F3UA 3E3NA 2WTXA 3VDMA 2GEJA 2Q6VA 3RT1A 3ZCRA 1JIVA 4GZ5A 3G2IA 1PN3A 1JG7A 3WADA 1QKJA 5D00A 3ZCQA 2IEGA 2PQ6A 3OY7A 2G9UA 2H1HA 2X0EA 3L7BA 1FC0A 4PQGA 2R4TA 1GPBA 2IW1A 1QM5A 1J39A 2C9ZA 3T3EA 3UYKA 3MBOA 1H5UA 3TOVA 1UQTA 3ZCPA 4N9WA 2QN9A 4MI6A 1E4OA 1AXRA 1P2BA 3L7DA 4X7MA 5JTTA 1RRVA 3BCSA 4FZRA 2GPNA 2KS6A 4REMA 1YGPA 1P4HA 3H4TA 1C50A 1L5VA 4AMGA 4EKYA 5TMDA 4BQIA 2XGSA 1JG6A 4YI5A 1XC7A 2R60A 1WV1A 4WHMA 3OKPA 3IAAA 3L01A 3EBPA 1Y6GA 1LWOA 1IIRA 3PE3A 3T3DA 1VGVA 4EL0A 2SKCA 4YUAA 5DU2A 3MRTA 1JIXA 4X7RA 2X0DA 4BFCA 3S0JA 1L5RA 4GYWA 3VDNB 2QZSA 3NC4A 1PYGA 3ZCTA 1M5RA 1AHPA 4NC9A 1XV5A 2AV6A 4EL5A 3L79A 2GJ4A 1P29A 2XCIA 4M83A 4KQ2A 3G2HA 3CV3A 3S28A 3G2NA 4MI9A 4RIIA 2ECPA 2QLLA 3S2UA 4QLBA 2XA9A 1GG8A 3NB0A 3D0RA 4NEQA 1JIUA 3CUTA 4N3AA 4RELA 4GZ6A 1WW2A 3MRXA 3CX4A 2GT1A 4CTOA 1NZDA 1P2GA 3C48A 2VCEA 4HWGA 4AN4A 3OKCA 2X0FA 2ACWA 4CDRA 9GPBA 2F3QA 3MTAA 1B4DA 4BQFA 1L6IA 1E1YA 2G9VA 3COPA 3ZCVA 2XGOA 1UQUA 1Y6FA 4W6QA 3CEMA 4LDPA 1WV0A 2QRPA 3L7AA 3EBOA 3RSCA 3UYLA 2X6RA 5BNWA 5DLDA 1FTYA 4GZ3A 1P2DA 3VUEA 1XKXA 1PNVA 3MS7A 1EXVA 3BCRA 4XI9A 2GM9A 1XL1A 3BD7A 3ZCUA 1P4GA 2H1FA 4KQMA 1P4JA 2PRIA 2O6LA 1Z8DA 1NOJA 2XA2A 4G2TA 3DDSA 3H4IA 3DDWA 3GPBA 2VSNA 4RIGA 2JZCA 1FTQA 3QHPA 3BEOA 2F3PA 7GPBA 3MQFA 2VCHA 3BD6A 2F3SA 2R68A 3T3IA 3TAXA 4BQEA 3BDAA 1L5QA 1C8LA 5TVGA 2AZDA 2ZB2A 2XGMA 2QN8A 2C1ZA 1XL0A 3SYRA 1C3JA 1RZVA 1PSWA 3DZCA 5TMEA 1FS4A 1WUTA 2PYIA 4M7PA 1GGNA 2FF5A 4MI3A 3NP9A 1NOIA 2GPAA 1F6DA
chains in the Genus database with same CATH superfamily
5BMOA 2ZIWB 4Q6BA 4F4UA 1FW8A 4W1PA 5EIXA 1EBBA 1IN5A 3NWOA 4Z99A 3WQRA 1J8YF 4W9NC 2ACKA 4WFKA 4LBZA 3R75A 1MQAA 3ER9A 2UYYA 3HR4A 5ALHA 4H31A 1COWD 4IXTA 3GMSA 3LQYA 2GKGA 2YHUA 3HB4X 1M1UA 3G5TA 4QTTB 4MW2A 3BERA 5D5QA 2I2AA 3PFFA 1LNSA 2GK4A 2P0EA 5CTAA 5E2AA 1CE8A 3VU9A 5B6IA 3A37A 5G4KA 2NMVA 2VQSA 4JVLA 4G3XA 5HKAA 4WACA 1MP0A 4H15A 5ALLA 4L27A 4RHXA 2REBA 1K3UB 1MO6A 3FVWA 1NUTA 4F45A 2ODEA 5AJHA 3KB8A 1L4YA 2MYNA 4HSGA 1KWKA 5E6SB 5GIOE 5G1NA 1J5PA 3IERA 5D6NA 5DJ5A 3TEMA 1ZM3A 3H2IA 4B3GA 4CDNA 5AW1A 2VTDA 4L8LA 4ZC8A 2C0QA 4UXIA 2WC1A 5FULA 3LBIA 1Z15A 2B1GA 4BX8A 5AD1A 1OASA 1TKCA 4RJIA 5CCBA 5CLJA 2ENWA 1CD5A 2WUFA 3JVIA 3HL4A 3LDGA 3AUYA 4DM3A 1LW6E 4J29A 1CX9B 3HUFA 4LCEA 5B1SA 4HYEA 3T1NA 1NW8A 4XWWA 4P7BA 5CTJA 4LE1A 2PGAA 4GE3A 4JUIA 3E5NA 3PEYA 5GONA 3OT1B 1S2LA 2Z2JA 2V58A 1T5HX 3SQNA 2LRHA 1ZY2A 4ZOAA 3I01A 1N78A 3HH8A 3ZG6A 3KJGA 3U4GA 3W77A 3LVFO 1OC2A 1EK6A 1JQJC 1YR3A 2Q8PA 2QRUA 3MD0A 1CRZA 2OCDA 5TV2A 2VJDA 3SXUB 2QX4A 4CFSA 1OLXA 1Q22A 1U9IA 2IXDA 4OP1A 4LCBA 4RF2A 3ZDDA 3MJ4A 3QLTA 3V1UA 1USGA 2H11A 3NBUA 1N2ZA 1R50A 4KPUA 4UD6A 4XQEA 4D0RA 2P2ZA 4RZ3A 4OOEA 2EF0A 5ER6A 4KSBA 4BKOA 4MR7A 2F00A 4Z9FA 1DINA 1MAAA 4DZRA 1VL5A 1HDIA 2Y4NA 1J5EB 2R8YA 1ZGCA 1GSAA 2QTAA 3GY0A 2YHAA 3INNA 1WPXA 4LK3A 3H3JA 3NCHA 5AK3A 3DD1A 4ZEMA 5BR8B 4C0SA 2KI5A 1LVGA 1ZITA 4IJVA 1N2CA 3WL8A 5KYUA 1XA4A 2ATIA 2KJQA 5HFJA 2CV0A 2HHHB 4PZPA 1UWCA 1M8PA 1KFJB 1RJFA 3HJTA 1W1IA 3MWJA 4C4TA 3MGCA 3I6BA 4REOA 2VYNA 2FLWA 4PZEA 5CLLA 1TB4A 4EF4A 4FZVA 3LQ2A 4J1TA 3DE0X 3IHTA 4MVYA 5EJAA 4BLQA 4ZDKA 3DB2A 3GLKA 5JALA 2COEA 1BJRE 2WU3A 3M6UA 3P2KA 3BD8A 1ODTC 2QQ5A 4B43A 3ECSA 1FJXA 3WICA 2BDEA 1GCUA 3HZHA 2GH1A 2YQZA 4MZXA 3OUUA 4QDKA 4PZ9A 3SFZA 3VYUB 5JSFA 3FTQA 1UZAA 3WRYA 1BE1A 2ZI4A 4H6WA 3ABRB 1R0SA 4HUQA 4BEJA 1W9MA 6GPBA 3DMGA 4LF5B 3GP8A 5KYKA 1FTGA 1ZMBA 2INGX 3AKZA 5EJ5A 3MCVA 5DW0A 2QIPA 3VYWA 2QTTA 5BWOA 1CZKA 5I7VA 4G97A 2V7QD 1O3YA 3UMCA 2AK3A 2PIAA 3AXSA 3DGFC 4RTSA 1FQWA 2WM9B 3I09A 3LJKA 3HLYA 1EWYA 3CZ4A 3QFCA 4WXEA 4YJDA 1Q0UA 3BMOB 4OKIA 3KKLA 4RVGA 5TB5A 1MTOA 4FFBB 5CH3A 2ZUVA 2D00A 1AQIA 2XUKA 2ZYWX 5LDDC 1LX6A 1YT5A 2QR3A 3U44B 5KB3A 5GOZA 1U94A 5C37A 2E89A 2FW7A 3RAEC 2JATA 1PG0A 1V8PA 2NZXA 4RPCA 4HDRA 2W2PA 3OU7A 1S7GA 4U0JA 1E0KA 3GLUA 1HY3A 2C84A 4FZJA 2OXCA 4FR5A 3BZUA 5CGQB 1QK3A 2O7NA 1VI2A 2P9QA 3R3VA 1FP1D 2D1FA 3ISJA 1A7AA 3SSNA 4JX9A 2A1UB 2IW3A 3M0EA 1E69A 1RAGA 2Q7OE 3KETA 4WLEA 1TO1E 2Z5GA 1UC5B 4BNKA 3ZNPA 5KHOC 4M2LA 2R6CA 2ZIFA 5MFZA 1KK2A 2ZS7A 3DMPA 3PVZA 5CAEB 2XMZA 1OZGA 3GNTA 4IIXA 4NAHA 3U3KA 3E8MA 1NURA 5IJWA 1H1LB 2JD0A 2HRDA 3BK2A 1C9DB 4TM7A 2PMEA 1RXUA 3TMYA 4DWOA 3OBIA 5ESXA 3QX9A 5AKEA 5TY0A 1S2DA 2IYEA 2MSDB 1TM3E 3R0QA 2PCLA 3WK4A 1S4MA 5HXAA 1H8HD 4X6XA 3TNFA 2FPWA 2WD9A 3OOEA 3P2MA 3WGTA 5A6SB 4KBYA 4M49A 4ANFA 2DFPA 2WVGA 4DDTA 1EIWA 1JDBC 1EVQA 3R6WA 4WESA 1P7YA 2ZYGA 3R7DA 1L5NA 1PV2A 4JYMA 5TS2A 5I4KA 2B94A 3V4ZA 2IZ7A 1BFUA 1LDNA 3LF2A 3QPAA 2PWZA 2VHQA 3FZNA 5CYGA 1VSUA 5IF9A 1SXPA 4D4MA 2VTKA 3ZY4A 2G07A 1Q50A 2GWHA 4TLMB 1GGHA 3E18A 1JVBA 4P5PA 3WFIA 1U63A 1BKDR 4D8UA 2ZZMA 2NTVA 4V0LA 3I6IA 3PQ7A 4JNKA 5JDCC 4UDNA 3RS7A 3TSZA 1U5CA 5ES4B 4MUHA 4XJSA 3EUWA 1NY6A 3DUWA 4URWR 2ZU6A 4DOMA 1TQ4A 4EITA 3RYCA 4HHEA 4CU5A 5EKXA 3CPHA 3T7SA 4B4DA 1LBQA 3A2NA 4ITVA 3SVTA 4LXTA 2P3LA 4GEKA 4MPDA 3QVSA 3UJ9A 4AMUA 5EKSA 3NATA 3UNXA 1JEYA 4E03A 3JVUA 2ZPTX 1MA0A 3VDMA 4L3VA 4ZYVA 1NUQA 3MWLA 1JAXA 4QDOA 1L8AA 4L15A 2F1RA 3DQQA 4HAZA 4NENA 5IVDA 2VZ9A 1GPUA 4ZJUA 5BQXA 5CGZA 1LLUA 1FNSA 1OC4A 4BC1A 4N76A 3C1AA 2YZNA 4CQLB 4MDFA 3S44A 3RK4A 1H42A 2ZI5A 1QJ4A 1BZYA 2XWJI 4MIOA 4P82A 5HG0A 1F9AA 1AU9A 2QE7A 4R2IA 4G4SP 2OXIA 4AF6A 4JBLA 4D6YA 3BJMA 3LL7A 5ESRA 3S5JA 4BO1A 4UUMA 1ZVVA 2D5IA 2IHNA 4OI4A 1MNAA 2HUPA 4LZLA 4MQEA 1OWLA 1C9NA 1LVUA 1XVVA 2OY0A 3VHLB 3IQGX 3R41A 3T15A 4C22A 1J39A 2Q4OA 4OQXA 1I4DD 3K8OE 3KFLA 4JHLA 1LI4A 2FK8A 2QGZA 3BM5A 4MXDA 4ND5A 4NR0A 4RYDA 4W5WA 2XY4A 4UBMA 1UQTA 1WBJB 1KEWA 1FP6A 3OQPA 2Q9CA 4ZZ2A 2JIRA 4YTEA 2AKEA 4YC7A 4WL0A 2HSEA 2ZM6B 5DGDA 2Q9UA 4RMIA 3FCXA 5D5HA 2FSSA 3RASA 2XVAA 3ZZMA 3NKLA 5AW9A 1EBUA 3BGIA 3A6EA 2I0FA 4FHGA 4NBRA 5BSVA 3KJXA 3NXSA 2EP8A 5EQFA 1U2SA 2JGJA 4GRDA 3RGGA 3EQ6A 4CMJA 1ZBDA 1H1DA 2A9OA 3I9MA 3JATA 4QC2A 5EN4A 5DHAA 3S70A 1GTMA 1G8FA 3GLHE 4PSKA 5LOVA 3UJ7A 4AG3A 3HYRA 4EMTA 5DTJA 3VZRA 4JP2A 3GJTA 1KRWA 4DDWA 2QSJA 1JG6A 2F8MA 5K03A 3H4MA 2XDAA 1N2EA 2W6QA 3KYIB 4FWIB 1A5BB 1KQOA 1B0PA 4QZVA 4IEIA 3HE3A 5FPKA 1UJNA 1WOYA 3LRPA 4O2BB 4HDMA 4JGIA 3DWFA 2VQFB 1EVYA 4FK8A 1QFJA 3BS4A 1IIRA 4X5OA 1Y5NA 3DC2A 3QW4B 4HLUA 4NJMB 3ZK8A 4C4RA 3P1JA 3H2SA 3DFZA 1KOFA 3HN7A 3KXDA 3PSHA 1Q0PA 1G5PA 4LPKA 1IAVA 3VSDA 1Y98A 3C7KA 3AOEA 5HF8A 4DEXA 4CM6A 1TQ2A 4YUAA 3IBTA 2ZUDA 3UFXB 2YNMD 4D8WA 4Q7MB 4P86A 1Q1BA 4DTCA 2ORED 1Y82A 3BWCA 3E58A 3PNYA 4IMIB 4NBWA 2O0HA 3SSOA 2EZ8A 3N2LA 2DKNA 4R9SA 4ZTUB 2ZB8A 4KXQA 3RQSA 4R2MA 2D0IA 5TT1A 2YJ5A 5ULLA 1NJGA 1KPHA 5IBPA 2DBZA 2XEDA 2Y4OA 4OVKA 2VUUA 3DFUA 3UAZA 2W9XA 2GYVA 4NZOA 3S4YA 3UC9A 4UTVA 5JNTA 2PLRA 4X41A 4D9EA 3ORSA 1X8LA 2DYKA 2D0PB 1RABA 2XUOA 1KI1A 1YA4A 5JHHB 5L3SB 4UUQA 5IK2A 5D3QA 3TQFA 1PNQA 3F90A 2VT2A 4YRBA 4IQ8A 4KWIA 4QAQA 2OUKA 5GVSA 1WXQA 4WK6A 2H7YA 3S3TA 2ADOA 1UJ5A 1YCDA 1E5LA 3QLVC 5CRIA 3W05A 1VMDA 3CV3A 3ZBPA 5AM1A 4ZPXA 3MJFA 5CH5A 3LTNC 4JGGA 5J63A 2AOXA 4RJLA 3RUAA 1TTQB 4CKWB 3WWDA 2XUHA 3MCWA 4UMDA 1AUVA 1CERA 1J5XA 1J00A 2P6OA 3LW8A 4PYOA 2V3WA 3TW6A 1HM5A 3TZHA 1GG8A 4IH4A 1JX6A 1KMQA 5FEMA 3IYLW 1GD1O 2AJCA 2YNMC 4G5OA 1R5JA 2AX4A 2O7QA 2PUJA 2QW8A 4NEQA 2RGAA 2V6FA 5CCXA 2PLWA 4C4ZA 4N3AA 3T0IA 1X7XB 3UOWA 2G25A 4RELA 2DP4E 3ZKAA 3PNKA 2E4XA 4G0YA 4ZVQA 2GZSA 3K94A 5TEVA 3C48A 1JEAA 2YY6A 4M1OA 1NW7A 4BX3A 4D8VA 1MR3F 2QP4A 5JECA 4PLPA 2IHKA 4K05A 3U7FB 1R88A 2DH5A 2RHJA 4MR8A 2ACEA 4PNHA 5JCXA 3I9KA 3NHZA 1R8YA 3QVGB 2I1WA 4WWHA 1D2RA 3AM4A 3ANMA 1ULSA 1OVMA 2C58A 3HA3A 4FSHA 2RKWA 4L3WA 5CX1A 5AKLA 5JO9A 4WBNF 1VG9B 5ICCA 3I4LA 4DGQA 5IVKA 1GVNB 1T9CA 4OEHA 1RBMA 1T36B 5BV2P 2F4VB 1NI4A 2XGOA 4RNDB 5EWLA 1A1VA 2OMEA 1Y6FA 1M0TA 4LV5B 4YYZA 5D86A 2VUSA 3EF0A 3NT5A 3OCZA 2C5BA 5JYBA 4LJRA 4ND1A 1QP0A 2P35A 2Y0EA 1CEYA 1NI3A 1Q11A 2PUEA 1JKIA 2RHDA 3PVSA 4YY3B 4RQTA 3X43A 4JNCA 4EKDA 4RULA 4GZ3A 3BAFA 1DU4A 2J6HA 1S7CA 1Z8NA 4MTLA 3GRAA 1F0NA 4FDAA 2H5LA 3WK5A 4CIWA 3QTBA 2CZGA 1D6MA 2XBUA 4ZHQB 5J23A 2MINB 2VWGA 5AVVA 3LPDA 4LNUA 4V03A 3BCRA 3AZQA 4WZBE 5CYFA 2HBRA 5FKJA 3SFVA 4DBLC 1BQEA 2IKSA 3O2NA 4L7QA 3F5QA 4LDJA 1HYBA 2ID8A 2V03A 4QXOA 2WKRA 1TCAA 4P4NA 4NQZA 4EPYA 3W5AA 1H3EA 1TADA 1V39A 3KHUA 1XN4A 4X84A 4UTPA 2Y0DA 2ZWVA 3QYFA 1VKRA 2PBRA 3QX7A 1JQKA 1W2WB 2VRCD 2O14A 3ORHA 5EHQA 3HO1A 4I7EA 1OFIA 4CEHA 1MEJA 1WMFA 2ZR0A 1U9ZA 1M1XB 5I7SA 1Z2DA 4GM1A 1FCJA 1Z6TA 4C0LA 4A36A 2OHHA 5BSUA 5IAOA 1Z5UA 2WQZA 1KJYA 1T8RA 1Q5PA 2RGGA 3L8MA 4G5HA 4HDSB 3WISA 2EKBA 3ETJA 5D8DA 2WJGA 2P8JA 3UKOA 4G6ZA 4QFBA 4ZT5A 3UUEA 5EMKA 4M0PA 3UXHA 3L7JA 4BGUA 1OIWA 2GZ3A 3IKMB 4IJ5A 1L5QA 1Z2OX 3GHHA 1ODLA 4UBIA 5HK9A 1OKKD 3M33A 4I5FA 5IAJA 4EJSA 3BILA 3EZLA 2I80A 3O84A 4F4FA 5F9MA 1VG0B 4QOEA 5CD1A 1PT6A 2OC4A 5I7HA 5DEIA 3MWGA 3OZ7A 1KJZA 5H9WA 3V55A 4G2NA 4I1YA 1GRVA 1XAHA 1RZVA 2VAWA 3ZHRA 1CF9A 3N6VA 1VHLA 3PR1A 4J4BA 4LE0A 4MZDA 4MW7A 5BN1A 3ILYA 1GAQA 3W2GA 3ZD7A 5FADA 2GD2A 4JT4A 1OFTA 1T0JB 2HYDA 4ODIA 4TV8A 3HDTA 4ZIRB 1QGZA 2AGVA 3NDIA 3L6EA 2GPAA 4DR5B 2XF8A 3QG5A 1F6DA 2WJHA 4B46A 1H6DA 2WFLB 4UNIA 2ECFA 2C7PA 3O3CA 2VHYA 4V0RA 3B5EA 4YJ3B 5ALMA 2IDZA 5BUCA 1Q0TA 1K1EA 1MJGA 5KQLA 3RIHA 2ZJAA 3KYCA 1FX0B 4JT8A 4M60A 3U3DA 1K27A 2WYIA 4QXAA 1WMEA 1KHHA 4L76A 1AXGA 1M5UA 4Z49A 2Y1EA 2WD8A 5HZHA 1QPZA 4RMNA 5DTIA 1GOTA 1HMYA 3FSGD 2C2KA 2Q99A 1OFUA 1C30A 4EB6A 1STOA 4HGPA 4IJUA 4BB5A 4DDKA 1HH4A 4PBSA 4DILA 3QY9A 1KXZA 2Q3MA 3DDNA 3KTAB 4LYGA 3T4XA 3J80A 2WJVA 3CMMA 3EIEA 2C2GA 3JZMA 2A6PA 1GTZA 3HRHA 2VYCA 4LF4B 3UT6A 4ETIA 4ENUA 4RD6A 1XWWA 1KJWA 1U5BB 5DLYA 3G79A 1Z3CA 1Q7RA 1K89A 3B53X 4N5MA 3M5WA 1JMKC 2VP2A 1JE1A 2P8SA 4PAMA 5LZ5A 1KMHB 2P9EA 1SOUA 4PYLA 4H7DA 5D7BA 1KIFA 3GELA 5F52A 2P69A 1ORWA 2FLKA 3ICOA 4CXMA 1IK4A 2G06A 4MVWA 1P7PA 4UVIA 1JJVA 3VTZA 3VZQA 4YHHB 4I8XA 2GZMA 3GCXA 4FDVA 3ZCSA 4C6RA 3ZGZA 3HBNA 3FG9A 2D1RA 1J20A 1PL0A 3AR8A 2V65A 3JSAA 4FIDA 2COUA 2Y1CA 1XZDA 3K8YA 4P3KA 3I5YA 1L8OA 1QSGA 2MSWA 3LXMA 1F7UA 1LLCA 3W1WA 1G3MA 1DWUA 1HBJA 1KYVA 2IEBA 4QNMA 4TKZA 1V5EA 5AXBA 3MA0A 3FPSA 4RC9A 3PLNA 2O48X 2R00C 2IT1A 5D6OA 2XDYA 1RWMA 1FQKA 4RJTA 1A2OA 2XBLA 2YRXA 4CL8A 2FR8A 4F2GA 4RE6A 5K20A 3CUVA 4Y2GA 2OGSA 1MENA 2J9GA 5IJ9A 2XVYA 4E15A 3IBFA 1X39A 1HDYA 1SHKA 3AUTA 1K66A 3GFSA 4II3A 2IX3A 1M1NB 5ENZA 2R5WA 1A96A 2Y2UA 4R40A 3K0AA 1GDHA 2FR1A 1K7FB 1IWOA 1JG1A 1HO3A 3QEOA 2JRLA 2AF3C 3Q9SA 5I9BA 2TS1A 1O95C 5CP8A 4HTFA 2V5AA 2WJWA 3KUKA 3CBQA 3RSQA 1J70A 3NTQA 2H18A 2XWSA 2G4VA 3BL8A 3N8IA 4DCCA 4D5GA 1BWSA 1RQGA 2JA1A 3A10A 3FYSA 3EMBA 4YMIA 4F8EA 1NYRA 1Y48E 1D1SA 2YHIA 1XK7A 2H17A 1VJ1A 1PHPA 1TCUA 4G25A 3AX6A 5JWHA 4GU5A 3UT0A 3A4IA 1EX6A 1JGTA 3C14C 3OHMA 4XCVA 1WTAA 1QFYA 3E3MA 2CE7A 3MB5A 3UUGA 4DLLA 1RPJA 4M9XA 3I45A 1UOEA 4X7BA 2VF4X 2X9GA 1USUA 2IOQA 2OWEA 1GQ2A 2FRDA 2HYIC 4IKEA 5GZ3A 5J4KA 3RC1A 2EKPA 3N8HA 2H1SA 3PJFA 4RK7A 2B78A 4GBJA 4TUYA 1M76A 5BMVB 3TEJA 5JZMA 2AJLI 4K6KA 4E13A 3PP8A 4FB5A 1CS4C 4MDEA 3R44A 2NO4A 2J6IA 4C04A 1I3MA 1M6EX 1LWNA 3CUYA 4C1NA 2M9MA 2D2VA 1SUBA 2FW1A 4NTZA 2JLBA 121PA 3KXKA 4EF6A 5I9LA 3OIFA 4X00A 1DXYA 5FYQA 3LUBA 4GX2A 4R1PA 1YJAA 2VYND 3GOQA 4OG2A 3TQIA 2IH2A 2WAYA 3EXAA 5JH7A 1SM4A 4M46A 3ORYA 1W36B 4U7JA 4EHFA 4IPTA 4CEIA 3RHZA 3IQIX 1LLFA 2WYOA 1WCWA 5C1DA 2P4SA 3SOZA 1QIEA 3PLAE 5KNDA 2DX7A 3AF3A 3P9CA 3ZDXB 1U0TA 3RUCA 1XRSB 1SBNE 4JLUA 1BJKA 1C8VB 4G1CA 4OI1A 1FIUA 1ZAYA 1JLLA 3C4VA 3QEJA 4JBWA 3WGMA 3R8FA 4W6ZA 5I3ZA 4WE3A 1WE2A 3BQMB 1W44A 3DB1A 2HSDA 3D4PA 4NZYA 4CDMA 4EPRA 3FPBA 3R7LA 1TNDA 1ZZGA 3W6OA 5MHTA 3FCAA 1TJ5A 2HQBA 2XOXA 1WZCA 2VDOB 2ZJ1A 4RMJA 4NCBA 3N0WA 2R79A 3QJYA 4A0HA 4B31A 1RRCA 3B1KA 2HSWA 4BGEA 1DKPA 4A6DA 2JZOA 1UBLS 2ZRCA 1KY4A 3OCXA 3BE5A 3C5VA 1GPJA 2JHGA 2Q5QA 3IV7A 4S12A 4B3FX 1SC4A 2WT4A 4A16A 4XSGA 3D8UA 4QTXA 2FFBA 1PQ4A 1POXA 1S0UA 5LLSA 1J56A 2XTZA 3JQFC 3T7JA 1S8AA 4P4SB 4DMCA 3NUGA 1FYDA 1J2UA 3D3KA 5IUKC 1R9NA 1XI2A 1FB5A 4NMXB 1PFGA 4R3NA 4CKCB 4QM6A 5A7FA 3QFRA 2AA3A 4Y6LA 2CB0A 2JHAA 2CXUA 1K6IA 1L4MA 2HF7A 3CVOA 3FOFC 5EJMA 4Z4FA 5DGIA 3TLEA 3RSSA 1ISPA 3TTUA 1ISIA 4CWAA 1RZRA 1DQPA 2SKDA 3ONDA 5FP0A 5AESA 1UADA 3AY6A 4ZT4A 1MORA 1BX3A 4B71A 1HETA 1AQLA 4UDXX 1GV0A 2XNDA 4RA9A 3BFJA 4HK4A 1XG5A 2I2CA 2FVYA 2GNPA 4ZOQI 1I7QB 1LRJA 3EH2A 2QP9X 1JDJA 3WA7A 4RVDA 5AM2A 4ARIA 4R2JA 2FOLA 4M8LA 3K35A 1H94A 4FB4A 3F73A 3F3MA 1OTYA 5IHPA 3DMYA 3EGOA 2GD0A 5DKFA 2VATA 4DMUB 1Y7HA 5HE8A 4RXUA 1QIFA 1XDUA 1SHJA 1UR5A 2VDRB 3CUUA 1CTQA 1UMDB 4QOGA 5TEWA 2PX2A 1PR5A 2ENUA 3KU4A 4Y9DA 1KDZA 1E58A 1B0ZA 4CKEA 1NZFA 5IKEA 3B2QA 5TNXA 1UKAA 4R1OA 2BFCA 1NF2A 1XU7A 3HP4A 4DDMA 2ZYTX 3E3NA 3DFKA 4P5EA 3V7NA 3F2VA 3KLMX 4MW5A 3Q7QA 3LOPA 3ADKA 4L0QA 3RT1A 4B45A 2V6BA 3A1WA 1IQ0A 1QK5A 4WK4B 2LGJA 4GZ5A 2XTJA 3DWIA 3D59A 1UWKA 1ZUD1 1IOVA 1DOAA 1E2EA 2BMEA 2H2FA 2Q62A 2H4FA 2H4YA 1K9SA 3NDBB 1Q1GA 3QZUA 3UW3A 5K8UA 2Q46A 5EIBC 3GP5A 1Q95A 1D0VA 3UHPA 3QE9Y 4E46A 4R0MA 1MB2A 2NXNA 3WGLA 3L4BC 5GIPE 5HDQA 3F4LA 3NHFA 3ID6C 4Q3CA 1OYWA 2B5WA 2Y8EA 1NRJB 4AYXA 2FX3A 5D1HA 3WDSA 3DM9B 1HKUA 1O5IA 3DC7A 4C7VA 3OFJA 2VR1A 3QYPA 4YROA 2HIHA 3P2JA 4UQPA 3BTOA 3U31A 3COWA 3NM6B 4WUTA 5FR2A 2NZ2A 2LKDA 1JPUA 2W2XA 4KMRA 3QUBA 4AI6A 1XXHA 3AF2A 3FAKA 4DAEA 3D6AA 1UCFA 2Z5FA 4R8RA 5BYAA 4N41A 5A5DA 2BUAA 1AXRA 4KW7A 3LMKA 5JRZA 4NRDA 4JYPA 2JFQA 1DAMA 1RJWA 2QE7D 3LF1A 5LBTA 4BMNA 3DVQX 4KOEC 5U1PA 3GR6A 4IHKA 2XECA 3EK2A 1PFKA 4Y2QA 3ROZA 1W46A 1YKSA 1QX3A 1YQEA 2ZTVA 2UZ0A 3H18A 4EGFA 2Z9BA 3RFTA 2WKPA 3O0TA 3N39C 2BH2A 1AY0A 3FWPA 3V7YA 5KJFA 1XIVA 4OQPA 4PO1A 1W36C 2GCIA 4A8PA 4C0KA 1KEEB 4II2A 1NU8A 4FD3A 3PNSA 3EXHC 4C0HA 3O9MA 5KTNA 1TJ3A 2I3ZA 2C20A 4JLPA 3FHCB 4JK3A 4O33A 1QCYA 4J9UE 4YI5A 2GPTA 3ZD8A 3ML1A 5CLHA 1QIKA 4JB8A 3RLFA 1TM5E 3MOSA 1PTKA 2FGJA 2ZJ7A 3COVA 1OE0A 1JSRA 1Q3TA 1UWVA 1W9HA 2YIVX 1XA0A 2VP4A 2X8BA 1JTVA 1KFBB 1KY5A 1YQQA 1EGVB 1NDHA 5ERGB 3VO1A 1JJBA 4X6YA 2FSVC 4G1BA 5I8ZA 4C5CA 3NYRA 1VP9A 2G1AA 3LUGA 1RM4A 2OLJA 4CLDA 4DQ0A 1XMOB 1KZYC 3ESAA 1Y9JA 1GRQA 1PNOA 3A1UA 3RK0A 4C7BA 4EQ6B 2EWMA 3BGOS 1XO1A 4HVLA 3OOJA 2ZSUA 8ABPA 2GRJA 1XP5A 3PJRA 4ND4A 2IHUA 3JWIA 4DVJA 1PX2A 2BJVA 4OFBA 4KKXB 3S2ZA 3MOIA 5TMPA 1Y3AA 1CSEE 3CEPB 2O8DB 3W5UA 3C6MA 5LMCA 4U2FA 1GNTA 3VDNB 1VDZA 1CULC 2ZJFA 1XRNA 5AIAA 2ZIZA 1RI4A 4HADA 4BAZA 3RSHA 4JJZA 3OAAA 5AFSA 1D04A 1AGPA 4IDPA 3USZA 3IP3A 2PSJA 4DDHA 3E23A 4CM4B 4IJKA 1NPDA 1T1JA 1BW9A 3AFIA 5AHKA 3I01M 621PA 1MBZA 4RGBA 1A50B 1RLTA 4ER7A 3OE7A 4OMUA 1OR8A 1QZXA 2ZIXB 4O5AA 4JOBA 2HMAA 3RJTA 4B79A 4EZBA 1WUIS 5CT5A 3OSZA 2TMKA 4HEA6 4OHPA 1HLDA 3C70A 1HX7A 1VQ1A 3LSTA 2VSOA 2QRNA 4I9HA 4D3FA 1CUAA 2QPAA 1KAGA 4Q47A 4L6IA 5H82A 4FC7A 3BFKA 5DE3A 2B8TA 1INLA 1KI8A 1ORDA 4BQOA 4DSZA 3V8RA 2CVHA 1TF5A 3ON5A 5K0TA 2MSEB 3DEKA 4N49A 3SKXA 1E2LA 2OAEA 1PVDA 4MCJA 1GDDA 2RJOA 2VZ0A 1YK1A 3EDCA 4RLQA 4TKMA 3RYHB 4TKUB 3T5BA 3RIMA 4NYJQ 4A15A 3VR6H 5EXEA 5BN5A 1X3SA 4O2RA 1Q91A 5LJLA 2R44A 4HMOA 3SVLA 5IK2D 1C1XA 3KQSA 3JVDA 4HAXA 4POOA 1CZNA 1ENPA 3V34A 4DJFC 4XDGA 3JQGB 3FMOB 3P0FA 1FLVA 3SF8B 4UU8A 1P3DA 4WGFA 4B6JA 1AOXA 3KZVA 4NS4A 5K0FA 4KITB 1DIOB 1AK1A 4ICIA 1J1UA 2GFHA 1Q1ZA 4LE2A 3HPRA 4JY7A 4HWRA 5B55A 3OZIA 4HLUC 4JEHA 3GVPA 1G7CA 5FI5A 1UBFA 5I3CA 1LBSA 1MOPA 4O25A 1KDOA 3WX0A 3DT6A 3QUAA 5F78A 4ASUA 3P2OA 1UF9A 5AQ1A 3GEDA 4X8MA 5B7GA 1IOZA 1X1BA 2ZSBA 4HBZA 5J4VA 3WIOA 2DZDA 4K86A 1U7OA 4URFA 5AVSA 4MS3B 1FLNA 2BZGA 4JQYA 3U3OA 3H04A 2QM8A 1FUEA 4J7AA 4AO7A 1XEXB 3EBOA 1NN3A 2NN3C 2BDTA 1CY1A 1TLLA 2BCJQ 1M2KA 1T6NA 1XJ5A 5E6SA 5JAQA 4EK9A 5AVZA 5ESWA 4LX0A 5HZMA 2IBSA 1AV7A 2D3TA 3WRVA 4XARA 1Z07A 3QLUC 2RHLA 1XELA 3WLKX 2Q7XA 4BTVA 5CDSA 2IHYA 3L0SA 3L6CA 4Q3LA 3K5HA 2ZJ6A 1NMEA 4J16A 2Z8XA 2GDZA 1QQTA 1ZUIA 1UJ6A 2C98A 3CX6A 4PAWA 4MUKA 4J1SA 3WWEA 4CGYA 1SD5A 1EXVA 3ZGOA 2Q5CA 3GJXC 4I9UA 4M7OA 1RADA 3DWGA 3QVJA 1TGVA 2AWOA 2O05A 2YXDA 3RJZA 4N8DA 4BS9A 5HSGA 1E9FA 3OT1A 1DQYA 2OQRA 1XEAA 1ML3A 5FOUA 1PJBA 2O6LA 2DVMA 1QLWA 3IURA 4E5DA 1R0XA 3AUKA 3QF7A 1TT5A 1C5KA 3D81A 3KCNA 4GSLA 4JITA 4KFTA 3SE7A 4J07A 4EDFA 3CNLA 4NAVA 2GASA 2BHNA 2A9JA 3DDSA 3EZYA 3UMJA 2G6BA 2H92A 1NR7A 4Z0HO 1PJ4A 4IICA 3ENZA 5B12A 4DUZB 1TQDA 3TQSA 3DAHA 3IS3A 3W7VA 4KL8S 1Z0UA 3KAPA 5FD8A 4UVHA 1N9GB 4A8JB 3SIXA 2VUIB 4US1R 3DVLA 4INJA 2RGBA 4NU5A 3UMSA 2OB2A 4CV0A 1IZ0A 1VBFA 3TKYA 1Q1NA 5IMBA 3UMFA 4B87A 5L4NA 3AVWA 3BJIC 2R6AA 3JD3A 2QUBA 3IQHX 4AIIA 5IPFA 4QARA 5ECWA 1WP4A 1HSOA 1LPPA 3CZRA 4ZQCB 2DBVO 5EINA 1BIFA 2JIBA 2EJWA 2X0KA 4IZIA 5E9AA 4C05A 2Z57A 4ESOA 1CS0A 1CQIA 4M9CA 4O63O 3ELWA 4CPDA 1DBSA 3G0HA 1LPSA 2Z30A 3CA8A 2UVDA 4WOPA 3RRFA 2M6LA 2ZRAA 5LMUB 4O4JA 2Z6QA 1YXMA 2NYVA 3JYQA 4JB3A 1QANA 3CPEA 4A3SA 1C4KA 1J1IA 2ASVA 1MCZA 4MV8A 3PQEA 4B47A 2JAPA 1DADA 4DUPA 3T3GA 4EX7A 2PLFA 1Z7BA 2D0DA 1NSYA 3ST7A 3UV6A 3TIIA 3HADA 3NDRA 3PEEA 5HNKA 2O0MA 2VDUE 4EA6A 2HTFA 4M87A 4OLBA 3RSGA 3T4EA 2JAQA 3PC3A 1L7XA 4N6NA 1JMYA 1JBKA 1UIMA 1JNYA 3BMOA 1SVKA 2HHCA 4NSNA 4CM1A 1JPNA 5AK6A 3SJ7A 1KYQA 1ZEMA 4NG5A 4ERXA 4HX2A 1VJ0A 3U44A 3REFA 2HPVA 3KEMA 3L7NA 4EM6A 3PEUA 4EBFA 2X0NA 1YS9A 2BF4A 1VBKA 1XOIA 4FEYA 3BSWA 4XQ0A 1U4NA 4ZQHA 4PCUA 4AM8A 4D4LA 3W5DA 4N54A 4G89A 2ZRKA 2MSCB 1O94A 3DXXA 1KE1A 1U3DA 1MAWA 1NMQA 1PTJA 2WPNA 1XLVA 2JGDB 3DWEX 3N2EA 4EAAA 4B5KA 2XLBA 3E3LA 2A1UA 3MSCA 3U4HA 2RGUA 2X5JO 1X7ZB 3NHKA 2BE7A 2AW3A 2RGXA 4N3NA 1CLUA 5IF3A 3IDOA 2HPAA 1OROA 4Z4EA 1PL7A 2FSPA 4Z1MA 5LDGA 5JBNA 4GDMA 1ZK4A 3E7DA 1RLUA 5L3QA 3EWSA 1D7AA 3ANXA 1T3ZA 1ZJZA 3DO6A 4ROTA 4DF3A 1XVUA 4EW3A 4F06A 1HE8B 1EUCB 2ZB4A 5JI2E 3EMVA 3NVMB 3HVRA 3C24A 1JSZA 1U3WA 3C98A 4WQMA 3D31A 4LXUA 3OJCA 4RVUA 4E3WA 2NW6A 5DLQC 2ZJZA 4LY3A 4G41A 3AFHA 3ZI7A 5C1OA 4Q21A 4AN1A 3ETDA 4YT4A 2B35A 3EJWA 1DKNA 1O87A 1XBTA 4WZAA 4ZMSA 2VSYA 3BRCA 1NC1A 1V3QE 4MYUA 4A6XA 3T5PA 3JTEA 4WT7A 2O8BB 5A6SA 1DJMA 4ALJA 3WNVA 1D2MA 2GETA 1NBHA 1M3SA 1TLFA 2OCYC 1NULA 2IWHA 1E89A 3IUQA 1FU8A 4GOXA 4QGBA 4ZAXA 2P3OA 4G9EA 2P6MA 4G63A 4QU8A 3LUHA 4JYBA 1Y4UA 4ZMRA 2VHVA 4NS1A 2W6MA 4AAYA 3WGHA 2FNAA 1RC8A 1JDZA 1SOWA 3L06A 3RSLA 5EHNA 1GZ7A 4ARVA 4WJLA 5LLDA 2G1JA 1X70A 3L6RA 4NJEB 1RW4A 5KNDH 1S8OA 1VKJA 1DARA 1TYDE 4NDAA 3RV3A 1H9CA 3X2SA 4W5TA 3GLIE 4UEOA 3ROKA 3WL6A 1EHYA 2BEVB 4GXQA 5C3UA 2HK9A 3ESDA 1A9ZA 3FPKA 2VLBA 5FUBA 1A2QA 2NYRA 1VLZA 1T8TA 4KLCA 3K70B 4XWTA 2O2DA 4UEQA 3AQIA 1PFWA 5HKBA 1KXJA 2WD7A 3J7AC 1G6HA 3IPXA 4NOJA 5DFAA 4F72A 4HGZA 3Q9NA 1U7WA 3WB2A 3I39X 3H1AA 3FTEA 1FZTA 4ZICA 4FWTA 4S3MA 3FX2A 2WUGA 1KI7A 2EGUA 4WCFB 5LQRA 1Z36A 2CGEA 3SXPA 3PF9A 4EYEA 3FCYA 1OSNA 3AWIA 3E9QA 5CDFA 2P90A 3MCTA 3ANNA 2C4HA 4JWTA 3SLGA 4JVSB 3SQOA 4X3PA 1A9RA 2Q29A 4U7HA 3RYFA 4FKMA 4PHHA 3U4QB 3LDFA 2PS0A 1E8NA 4QUKA 2J3EA 2A3NA 4S35A 1U0BB 3LH5A 5ISMA 2J33A 3N0RA 1FUUA 2A9QA 2JCGA 3F3KA 1SCBA 1NJ6A 2IELA 4U9HS 3NKFA 4LMBA 1O9BA 3Q6MA 3V00A 3KHTA 4TLBA 2BR4A 3UANA 3O26A 1Y3HA 3U9SA 1H0HA 2A33A 2YIDA 3PD1A 4G0QA 4O2LA 3SEFA 5C7YA 4AKIA 1VJCA 1RIFA 1TJYA 5LA6B 3G0GA 4P4LA 2FZLA 2LD4A 3WTCA 4M8SA 1JDNA 2OG1A 1YDWA 3IIJA 3M6MD 3QVWA 5A0TA 4H0CA 1A7KA 3L49A 4O4HB 4UM9D 4OHVA 2QRLA 3LZDA 1WNFA 1RRGA 1UKEA 3L0ZA 5K5EA 2QT0A 3MMXA 2PQ0A 5L8VA 1PBTA 3OQJA 1ZS9A 2JGIA 2ONZA 2XW6A 4PWZA 3DOEA 1MX1A 1HDGO 4FFWA 1BN7A 4NDZA 4UBJA 3O8QA 4LY6A 4R7TA 3TZBA 3TJRA 5EZYF 4B75A 5AM5A 5A5VA 3QMVA 3RSZA 5CB4B 1AGRA 2BI8A 3WLHA 2UVPA 3VYTB 3GAMA 3ZNOA 2JPDA 3ZXXA 3QX3A 5DGXA 3LL4A 4IOMA 1E20A 1OF1A 4RK6A 1N2IA 4X91A 1PL6A 3LWDA 1RPZA 4CM9D 4AUNA 1NJ2A 2K87A 1LBHA 4NP6A 4U6NA 2YXNA 1S4QA 1SC1A 5C81A 4D25A 3FUWA 2AG8A 3REQA 1FF9A 3FNQA 1PP4A 5ITZB 4NJMA 3V9PA 2XE7A 3B1FA 3JALA 1NKSA 2GYWA 4B7ZA 4PC3A 4Q93A 3MLBA 3QXSA 4HDOB 1FFYA 3VH4A 1X3LA 3UFXA 2DPXA 4IZHA 2JJQA 2NQ8A 3DOJA 3OOYA 3TN7A 3I1FA 2R7MA 1LS1A 1PRYA 3KEFA 2XWBF 4G8JA 4A82A 1PUJA 2JAOA 3DBVO 5EZSA 2KM1A 4HAYA 5IHXA 4H17A 5HJ2A 1TGYA 2E5LB 3VPGA 1N75A 2EG9A 1MJ5A 4PSVA 3KR1A 5LZ2A 1CUWA 1T9AA 4R8KA 1LQ2A 4GC5A 3QM1A 5DYYA 2Q9BA 3UTDA 3K0EA 1RZRD 3KXIA 1GPMA 2ZJ5A 4JU8A 4YAIA 2JAXA 2F3UA 4RJJA 3D3WB 3L8FA 2XNDD 3LBAA 3MTIA 1T2EA 1DAFA 4F2PA 2O07A 3ZU6A 5CBKA 3RVLA 2HRCA 4FYWA 2FPKA 3ZJ5A 1EH5A 3ORQA 4FI3F 5K1ZA 5L3SA 3GMTA 1GRCA 4CG1A 3RU3A 1EUYA 4FYPA 1WX1A 4NICA 4HEA1 3EPKA 3DS8A 3CJQA 1YKGA 1J9ZA 3OY7A 2AXQA 4IIFA 2ZRIA 3TR5A 3GLQA 1GVHA 5KAPA 3H5NA 3HFGA 1WG8A 4YDHB 4COOA 3TCNA 4RTOA 3OUZA 3OU6A 1IEWA 1EZ4A 1YQGA 2FCAA 1F4PA 2P9FA 3DUFB 4RD4A 5KC9A 2IITA 5KNBA 4D4JA 4JLMA 1TMGE 5H4GA 4ISCA 4B0PA 2EZ4A 4G67A 5A06A 3PC2A 4L8FA 2I54A 4H1HA 1AJEA 1JKJA 1YZ3A 1MMFB 1XRLA 1Z0AA 2A35A 2ZI9A 1WQ3A 4HN2A 3HWSA 2JGRA 4EA9A 2QPTA 1DJPA 4EPVA 5KKCA 4I9GA 1EFHA 1RAHA 4OA8A 5J5AA 5KWJA 3W5CA 1OOEA 3WNBA 2A5LA 4EO9A 1HFJA 1RMYA 1JILA 1JR3A 1X9HA 4D4HA 3V9AA 2O8FA 5DEOA 3RGWS 3OF5A 4QSMA 3CKKA 3OM9A 1E4OA 3TE7A 3N0VA 3OQVA 1T0IA 5IDXA 4KIJA 3VX3A 1FFXB 1OBHA 1OZFA 3K4QA 4WBNB 5JTTA 1I2AA 2WOOA 4KLAA 4IX9A 1X7HA 2J3IA 1ULHA 2PKQO 3QVGA 2OCXA 4JC8A 3P96A 1W1UA 3GARA 1ONPA 1R18A 4GE0A 3RS3A 3ND6A 1DO2A 2X8JB 1YJ5A 2HSGA 1DUVG 2OD7A 1EQUA 3JQQA 3JX9A 3KX2A 1EUDB 1NBWB 1VJ5A 3M6IA 1C50A 1GNVA 4YP5A 5I9NA 4PQRA 1T36A 3LPCA 4GXTA 1ABEA 3PNMA 4G26A 1VKZA 1MJGM 2HL6A 3ULKA 1MC4A 4I1IA 3G88A 4ZO4A 4PSCA 5ALRA 4L6AA 1Z18A 3L0CA 2OUIA 3QH4A 4A92A 4ARAA 4BC0A 4F9GA 2V6GA 1GPLA 4Q15A 3LLMA 4QELA 2OV1A 3C7TA 4WA8A 1WETA 3ZN2A 3D7LA 2Z2XA 3NDJA 3IR5A 1LGYA 4XR4A 4LZAA 1F8FA 1GZ4A 2XJ4A 2ZIUB 4WHMA 5E2BA 3S1AA 3S2EA 4C4SA 2VJNA 4ZEVA 3BCHA 4R4JA 1AURA 3RKUA 2ZPUA 3STWA 1UDXA 5KUTA 1IN8A 2DUJA 2ZATA 3B6JA 1NF9A 3AGQA 3IHKA 1UBCA 3FGOA 1ADFA 3SGLA 1GNLA 1OMOA 2WHRA 5HIIA 5TQJA 1PZNA 2W4MA 4D8XA 4BV9A 4OBXA 2BZSA 1RAFA 2MINA 3FNFA 4ENVA 3G9UA 2D06A 3QKUA 2DMRA 5BORA 3FKJA 3TQHA 2DH6A 4ESHA 2XKBA 4IM7A 1U0NA 1I4WA 4RVFA 1J23A 1JEOA 1GQRA 5BUQA 1T8SA 3B3AA 5F3WB 1KKUA 5AP9A 4CG2A 4PFSA 4TPKA 1NW9B 2N47A 2IRWA 3MJTA 5GV7A 4HJXA 5FPQA 1P9WA 5SZJA 2WSIA 1E3DA 1F2TB 2OHXA 2F1OA 4X64B 2R8BA 2W00A 2RBGA 3H9QA 1G5RA 4R1LA 4GL4A 1F2VA 2P2LA 2CDNA 4BY9E 1YU6A 2XVMA 1JVSA 4K46A 3V1TC 2RI0A 3KKZA 3P0IA 3QE4A 2J3DA 3W4IA 1RWKA 4FC6A 4HDSA 4WNIA 2GJ4A 3GGGA 3ESXA 1XQYA 4HV4A 3N53A 1AQYA 2RGNC 3EC1A 1URPA 2I8AA 1H5QA 3COZA 5GOTA 4KREA 2KBFA 2OG2A 4JC4A 3HXTA 4MVXA 1XK6A 4PC2A 2PVCA 2R86A 4UVEA 4IRMA 1WHSA 1DV1A 3HHEA 4B80A 4M53A 4KO2S 5JSUA 1N5OX 3DTYA 4GI5A 4F4IA 4TKVA 2ZYDA 1QF7A 2XDQB 3OAAD 4RGQA 4TT8A 2FSIA 3B20A 3OQBA 3EBLA 5THQA 5HILA 3E27A 3PGMA 3CH6A 1I5OA 3MM4A 2ZYIA 4XUEA 4MVCA 3CUTA 3LDUA 3OE7D 4QRDA 1J6UA 1QG2A 1QAOA 2NZVG 2W71A 3PS9A 5L4LA 2I7TA 3NEYA 2H07A 4UAUA 3DT8A 1NZDA 1DKRA 1LK0A 3B3FA 2MU1A 3JU3A 1M6HA 3FSEA 3UHAA 5B6PA 5K01A 1BVHA 1J25A 3UQYS 2LWIA 2QMYA 4JFAA 1RLMA 4CIYA 4WLFA 1FX0A 1QRUA 2QUJA 3MAJA 5GJWC 1X9GA 2O8VA 3EXIB 5ERXA 4L57A 5EMHA 4A8TA 5I4IA 1WXXA 2AMFA 4GUAA 5AM4A 4IGEA 4C6TB 4RZUA 1N3LA 3EG5A 1YONA 3DW1X 1R1DA 4EY7A 5JZSA 1J09A 1ZRSA 3ZUPA 4J4TA 4F60A 5JBQA 3B9QA 3D5EA 3RFUA 4YPOA 2EAUA 2HJGA 4X1YB 1NXTA 3FXAA 5B1HA 2ZSFA 2PXAA 2XLCA 5A3VA 4PO9A 4AWXA 4I08A 2KSQA 1NQAO 4GWLA 2X6RA 3F6YA 2L69A 4J03A 1JWBB 4B09A 1VL2A 5BN4B 1U5BA 3I64A 1XF1A 4EFDA 2DECA 3N2KA 2WINI 4V1CA 4WCDA 2OXFA 3H9UA 2CCJA 4ZXPA 5KNDD 1B8NA 3IUMA 5EIOA 3KUCA 2Q5IA 3C3MA 3FVVA 3KWJA 4RWZA 4ASUD 2WWWA 1FMCA 3PHGA 2Q45A 3MTQA 2ODNA 3C8HA 3S7TA 4YMHA 2XTMA 1DX6A 2NNWB 4B2PA 3EMKA 2W2NA 1O8BA 3F5SA 5BQPA 3A26A 3FPLA 1B42A 1P39A 4G86A 3W2TA 2AMJA 4QGFA 3UC5A 3H9CA 4DV0B 1QZTA 2GXUA 2FMTA 1I3OA 2WM8A 2CNKA 3PDWA 4Q1EA 5J43A 1NUAA 1Z8DA 2J41A 2F59A 4E07A 5JWOA 4JZKA 1OPRA 4UOZA 1XMSA 2FSUA 4F71A 4DV7B 2GZRA 3U17A 3TOSA 3MAAC 2PG3A 4XJTA 1CUJA 4F46A 1KSHA 3GPBA 4URXR 1Z4PX 2XYQA 1JA1A 1VIYA 4U9IS 5ALNA 5T5QA 3PGJA 8LDHA 4L7VA 3ETEA 1ZYUA 3HKDA 2BGMA 3BD9A 1KEUA 2A8YA 2BMVA 1FNCA 3M83A 1XRPA 4EUNA 5HP4A 2JIDA 1SUDA 4P7KA 2JJ2D 4I4LA 3NRBA 4TTVA 3NC0C 5TVGA 4HQKA 2QX8A 2HDHA 5C8DA 1AZSC 2JLXA 2OB1A 3LU1A 2O1SA 1V8DA 2PJZA 3Q5GA 2O2YA 4QXPA 5IBQA 2CCKA 3A1NA 1SR8A 4TMYA 5CG2A 1CYEA 1TJNA 4DLVA 4F1WA 4AY2A 3FUUA 4Q7QA 5EJEA 3A9SA 1I4EB 1T2NA 4YHBA 1OYOA 4BJHB 4BRZA 5LJIA 4E5NA 4Z4IA 1BS9A 4MVJI 3KUXA 1BX0A 2JZNA 1T8WA 1Z4QA 2GXAA 1U7DA 2AG1A 1I6MA 3MJSA 4E5YA 3SQWA 2PXCA 2X58A 2NPIA 1AHHA 2B92A 3OETA 4LK2A 3HB1A 4O0MA 3ZY5A 4KPYA 4AJ4A 1D03A 1E2FA 1THMA 1FFBA 1C9JA 1G9SA 3JARB 1JQBA 2MHCA 2WFAA 3AEQB 3ECCA 3CRMA 1XZPA 2HZ7A 2ZRPA 2CK3A 3QE0A 1A5AB 5F3RA 3T52A 4ATNA 4BDSA 2XZOA 1T9GS 1KK1A 3L1IA 3TXAA 5MN5A 3TLJA 4U3JA 3DHWC 2JJMA 3LWBA 3BXGA 1L4GA 3TQQA 2WF8A 2QTVA 4JLWA 2O19A 3SHWA 2IFTA 4BECA 1JW9B 1Y1SA 1LS6A 3DZKA 5H83A 4PW0A 2R8ZA 3MF4A 2LCFA 1J0DA 1E6UA 2XUPA 4E31A 1YKFA 4LXQA 1KFKB 3NHRA 3IB3A 2FPPB 4AWBA 1ACLA 1GL6A 4CJXA 2PL5A 2PX8A 4M0DA 4CN8A 1ZVMA 3V4LA 4BQPA 4LRWA 3VNQA 1IY8A 1IMOA 1SQGA 3M9XA 1CUGA 2J0EA 3PV0A 1C7QA 2CLMB 4HDKA 4RFVA 5KHAA 3ZBUA 4MJ7A 2Y05A 1MABB 2UU9B 4RCZA 3FR7A 4K9KA 5CK4A 2VJLA 3FBTA 3JVEA 1FPMA 1NVKA 1R5NA 1XZKA 4LAFA 4QECA 4ZCPA 4YMGA 4AKHA 1VYHA 4LOKA 4EYOA 4U9UA 1R4MB 2X8LA 5B7PA 5EUQB 2WA1A 1DMRA 5LNK1 2FRVA 1KK3A 3TRIA 3U4MA 2UZ1B 3UHOA 4U00A 4X45A 1HDRA 3EG9A 3ZJYA 3GLRA 3QUCA 3LS2A 1QLJA 2EV9A 1Z6QA 1I2DA 4QPJC 1TUBB 4C4OA 5CDUA 4MV6A 4N5DA 4M0MA 3UN1A 4YMTA 3GA7A 5LFAA 3DKPA 1YK0A 3CC8A 4FNMA 3P5SA 3VUFA 5JY1A 4MRMB 1CWUA 1QO7A 1V9LA 4P4SA 5CVDA 3RVDA 3VBCA 2PX6A 1WY5A 4AROA 2QTRA 4BKQA 4Y1GA 4CKCA 2CL5A 1B15A 1FYEA 1O94D 4YO7A 1G7TA 3FCCA 5HIMA 3TTTA 4C9BA 1K08A 3WJAA 1GCGA 3KLBA 4RPKA 2FW8A 3TIVA 3VVBA 4D3XA 3ETCA 4W1SA 3AI7A 2JLQA 1V8BA 2F3TA 5LXTF 4I5GA 2IUEA 3T1TA 2P2NA 1NG1A 4B4VA 4TYWA 4MAMA 3KQHA 4FW8A 1A95A 1UBOS 4KXFB 4RPHA 3ONVA 4Z1MD 4HD8A 3X1ZA 4HNTA 4XWAA 3JRNA 1XZLA 1X1EA 1WIWA 2BSAA 2YOFA 3QU9A 3ZXIA 4BMVA 5KC8A 1I14A 1FFAA 2O7VA 1MC1A 3TLBA 2G7MC 2R9VA 2OC9A 4IV8A 2QRQA 2C8JA 3LHFA 1JJIA 5T8KC 1OGIA 1ZIPA 1O97D 2C7VA 2JVKA 2XCUA 3LBFA 3QY0A 5AKZA 3K6RA 2WB2A 3ZYCA 3CKLA 4G37A 2IUUA 3MTGA 4RLSA 3T0FA 5JUWA 3KQWA 2NU6B 3OQNA 2OO7A 4DNPA 3EIHA 4OREX 3IUEA 2FPOA 4QJIA 4DXAA 2DWUA 2HOQA 3F74A 1IOLA 4BXOA 5I6DA 3E1SA 1HF3A 3OT5A 3TUZC 4X1KB 4RCYA 5HCIA 3NV7A 4O4IF 5F23A 2VTEA 3B1VA 2JFNA 1VJDA 1T24A 1M2OB 4RM2A 5CPBA 3ZKWB 3Q5DA 4DJDC 4AULA 2JGEA 4P92A 3QI7A 1UJ2A 3NBQA 4CBVA 3MUNA 4PO3X 2O4UX 4DUYB 3K0SA 3DHEA 4WCVA 1UT8A 3L4EA 4UOQA 1JA0A 3CBGA 3HDVA 4KH0A 1EK2A 4HJRA 3SK0A 4WNCA 5JASA 4YASA 3GJYA 4AJ2A 5JTUA 2F62A 4MIYA 1K7SN 1LI7A 3O82A 1NJ5A 3CNHA 2RCYA 1Z4IA 3ASYA 4PAGA 2FDCA 4KK4A 3TW4A 5ITVA 2A0UA 3SX4A 5K05A 5JMOA 1U6KA 1QAMA 2FV8A 2PKQP 1KOLA 2I5PO 1FJGB 1A5ZA 4IV5A 4ZDWA 3MMNA 2O2CA 2ZTSA 1LK7A 3LCMA 1BH2A 2EQ5A 2Y0BA 3UW1A 5HA5A 2C1EA 1ZK0A 2QG6A 3T3PB 2PT9A 2G8LA 5FX2A 2V0CA 1YR6A 4LNHA 2X7XA 5EGSA 3G2MA 3LW7A 3REOA 3RVSA 4A0FA 5CDHA 1QRSA 1KR5A 1O6ZA 4V0SA 4AW9A 4EVIA 4RTNA 2V0NA 2DJ5A 3L0YA 3W3ZB 3I5AA 3WWYA 1POWA 3KQTA 4K5QA 2EATA 4FMPA 5IM4F 1CCWA 1ZESA 1TTTA 1PUIA 2VK2A 3QVVA 4I1VA 1A27A 3SCZA 4MV3A 4EQZA 3GN2A 5AW2A 1A4XA 1V16A 1JQ5A 3U48A 2EX0A 1RBZA 1Z62A 3DFFA 1ZR4A 3VJRA 3FD8A 4A9AA 3A3YA 4QBKA 1W88B 3GT4A 3AM5A 1DIHA 3H9GA 3SX0A 4IDAA 2X86A 3PZRA 3TRJA 5EE9A 3S8MA 3AVVA 2M6KA 3R40A 4LTDA 1JHVA 5GWXA 4JI7B 4AG5A 5BWMA 1T2FA 2O2GA 4NZ9A 1QWSA 2EBHX 2YJ6A 3AETB 4QDTA 4X7PA 1RXVA 4WN3A 2NZYA 4CU2A 4JHXA 4BAGA 4X6UA 2ZROA 4CLOB 4M76B 2OBBA 4E08A 4LJ6A 3SJAA 3G2PA 1NQUA 1Y1PA 2REOA 3C4QA 1ULUA 3K92A 5TJ9A 3X2FA 5JD6A 4LPSA 1H4SA 4E5SA 3T41A 1YVRA 2EL7A 2W7TA 2AEMA 2G08A 3N8NA 4N1AA 1GZVA 4EQ6A 5AUNB 2ANCA 3IAS6 3E5HA 4X20B 2WTBA 1UDBA 5HRAA 2AIRA 4FFMA 3VJMA 4C4YA 3SQXA 3I8XA 3ZH9B 2QV7A 3DYVA 1P62B 3NWPA 4C2TA 4JJ8A 4LQLA 4RE5A 4CNBA 5G3ZA 1KO5A 2XUIA 3WGQA 3O2SB 4I50B 4RWEA 4TTTS 2N1BA 1L5HA 3ZE0B 4R83A 1U11A 1J7KA 1J07A 2ATEA 2EJBA 2ZI6A 3KOMA 4BNTA 1CP3A 5L51A 4PNEA 1PSDA 2Q3JA 4KR2A 3D1JA 1XAIA 2WAXA 4KUGA 5HZGA 1D2AA 4EHBA 3CW2A 5G41A 1HGXA 3KOXA 4OX9B 1IJFA 1JJ7A 3R3XA 3SY8A 4CM4A 1RWWA 4FE3A 4GWKA 5EHIA 3GFFA 4D80A 1SXJB 2PRSA 3RHTA 2ZIXA 1IHDA 4AIRA 2X1VA 1S2MA 3UJ6A 2DR2A 1QKJA 4YJKA 4DVGA 3ZCQA 2JCVA 2PT7A 4AJOA 2LV8A 4XDZA 4RFSB 2GCPA 1CHDA 3IQZA 4WXYB 3IOBA 3VNBA 2X0EA 1ZD2P 2C94A 3ZDEA 3FRIA 1Y1QA 2CD7A 1MRNA 2W0SA 4IFTA 4ABYA 1DIGA 1PJCA 2QW1A 3BBPA 3LCRA 1K88A 3RVOA 1T6YA 4MUNA 3GLGA 1QM5A 2XODA 5KVSA 4TKUA 4DEVA 2DERA 3AG6A 3CZ5A 4J0FA 2JIPA 3T3EA 5B36A 3JAWB 4BVFA 4DV3B 5K0NA 4UCXA 5HUJA 2H8GA 3DE3X 1CJVC 1T9HA 1ZMRA 1Y3BE 2AEFA 4JLNA 3LCVB 4OJKA 1CEEA 4YN3A 3CZMA 4BIMA 2BKXA 1DJOA 3IAFA 2D5LA 4GXNA 1NSFA 2V7PA 4KO8A 4MW9A 5JAHA 1ZI8A 5A05A 3WLAA 3WYGA 2AXPA 2FF7A 3U0VA 4AS3A 5MDHA 1A9PA 3G8CA 5JD3A 4F56A 1HC7A 5ADWA 4FX2A 1WUKS 2Q5JA 4PZDA 1NX9A 3HU3A 4L0DA 1F4VA 4JC0A 1CFJA 1NMSA 3LYUA 2BELA 4TSRA 5E1DA 1C4XA 2NO9A 1W4LA 4RKWA 1IQRA 3D3EA 4JV5B 5CLGA 4GO1A 2XMCA 4ZI2A 5LWHA 3H4TA 4RHTA 1BDHA 4BP8A 3JQRA 1WZ2A 2HUNA 2F43B 3B70A 5IW8A 3R8CA 3LLCA 4BQIA 2I7XA 4FNOA 4MS3A 1V6AA 4HQOA 5A9RA 1Q7CA 3LY7A 1QFZA 1JR3D 3Q85A 1NE2A 1TC1A 4HDAA 5BNTA 4CQNA 1SKBA 1FRZA 3MZ0A 4NNOA 2CCGA 1XEXA 4OYHA 5EJ8A 5J4YA 4JBIA 2G28A 2I78A 3M6AA 4M6WB 5ALYA 1HG1A 2ZRGA 3WLSA 1W0KA 1H5NA 3OO1A 4BN4A 2JFPA 1VRWA 3K0CC 4Z7NB 2OV8A 4ZQGA 1Y6GA 1B14A 3JWJA 4FOTA 4FFDA 3P26A 2WJ3A 2NU9B 2ZAMA 1VPTA 4CZ2A 4MW0A 2NVOA 3EEQA 5ARDA 3HCPA 3H4VA 2VK8A 5CYPA 1RT9A 3HI6A 3R3SA 2IS2A 2HCRA 2PIDA 3EAFA 2CE2X 3JQ6A 4DPKA 1I0ZA 5E3JA 4ZEXA 1N2CE 1NKTA 1K4MA 1SVIA 1WB6A 3PPWA 2Q7DA 3DJFA 2HDOA 4YA6A 1X1DA 3IUSA 4PGAA 3FWKA 1E1KA 1L5RA 3FNIA 3KQQA 4PLGA 1ATZA 3BXHA 1FNMA 1OLUB 2O2EA 1KAOA 1NHGA 3BN3A 1TA4A 4CKXA 2WW8A 1PYGA 4QJ4A 1TIKA 3COSA 3LXUX 2PMKA 3V7UA 2W6ZA 1HI9A 2E0IA 4DV2B 4KR7A 3FTFA 2J45A 4B48A 3FHOA 2X23A 4R81A 4JUAA 4KNVA 4BNJA 1SD1A 4L5BA 4MGKR 1DAOA 4Q3NA 1O54A 4IYRA 1DX9A 5M7EA 1PBNA 1UM9A 2VUTA 3A36A 1YR2A 2BJWA 3A04A 3KSZO 2BGWA 1EB9A 2HU7A 3M4XA 1N9GA 1EZ1A 4YCJA 3V1NA 1DC7A 5BYJA 3JCZA 1UC4B 3RVQA 1SAYA 4R7ZA 1SU8A 1H2BA 1OWMA 2AF4C 1MIOB 2O7RA 2NV0A 4G1UC 4KAAA 2B2CA 5C8YF 1L0BA 4K0RA 4BVJA 3IEXA 5BSGA 3QTLA 4GW3A 1JAIA 2HR1A 4TOIA 1JA9A 1WDMA 4N8SA 5FJIA 3R7WB 4D3SA 1G17A 5EWMB 3NB0A 4G0NA 1M34B 4G07A 3RT7A 4FILA 4RTRA 1YIOA 1KI9A 4GOMD 3VV3A 5E6UB 1IZ9A 3DE6X 3OG9A 1OFHA 2QMUA 3E81A 2Q28A 4G0XA 4PG4A 1DIRA 1E2MA 3WK8A 2NQTA 4GPIB 1NFFA 5ALQA 5LIPA 1RNLA 2H29A 2DWQA 3NBFA 3QFFA 4AZ0A 4XKJA 1CIJA 4F4DA 2R6R1 3IDSA 2VCEA 1ZN8A 4L4UA 4ND3A 3ZZ0A 1I0IA 2B4QA 2HLDA 3OKCA 3P20A 4J6FA 1J2YA 2FUG6 2OEPA 5E1OA 1G8HA 2EERA 3N2GB 4TTJA 3VAZA 4QTUB 1OFVA 2N9UA 5A9TA 5LYJB 2B69A 2C77A 2HKIA 3ASVA 3N2YA 4BNDB 4JQSA 2AOTB 2I4MA 2PUVA 2H4JA 4QUGA 2O2HA 3K9CA 4W6QA 5B7NA 5FI1B 4AU1A 1VLJA 4BLUA 5HR5A 5JXHA 5FV7A 3LVQE 1U0OC 1R27A 1C1YA 4MMYB 1YS4A 4RMGA 5F7ZA 3U5ZB 4ZJPA 3LCCA 2ZUUA 3PX3A 4WXHA 1U8EA 3WNDA 1P7VA 5CFLA 1SELA 1PT8A 2QI9F 3GCWA 3F49S 4RNCA 3DMRA 3KC2A 5BW5A 1A82A 1I4OA 2VJAA 1V11B 3IIIA 1P2DA 2WFMA 4H60A 4YFYA 5JAMA 1L7EA 1RRKA 2B6NA 2W2KA 4TV9F 2ESRA 1GNSA 3VO9A 4MK4A 2FPMA 4K9DA 4LJ5A 1RSZA 3CLSD 1DFHA 3P2YA 2DOKA 2ZJ8A 5FNZA 3HB5X 4RK5A 1I7SB 2J0QA 2FPRA 4OAQA 1IM2A 1ZIOA 4XFKA 3H9EO 4KTVE 2NXEA 1N0IA 4HRXA 2ZR9A 4MKRA 3KEGA 4YAUA 1VMIA 1YBHA 4CYMA 3STTA 5IT5A 2ZBRA 4QX6A 3OTWA 1AUQA 2Y6UA 3IMFA 3E2MA 3PUIA 3S7ZA 3R9XA 5I01A 3NNNA 3SMVA 3VH2A 5DGCA 2Y1LA 3P2EA 4BV3A 3PXCX 1ISSA 1X74A 1SXIA 4ZVPA 4FYIA 1L5GB 5KQGA 4ZI7A 2J7KA 1HURA 3GBVA 2P1ZA 5LZ4A 2BM0A 2ILVA 2XQGA 1FTQA 3GIWA 2ECOA 4QL3A 2H7XA 5BR7A 3TOXA 1H1TA 2QU8A 4I99A 5ANRB 5F7XA 4ZOEA 4ARZB 1ZC3A 1YFZA 4L9AA 4DPMA 4EAQA 7GPBA 1VYVA 1W4CA 2O8BA 5KCMA 2GD1O 1HNWB 4N5NA 3THYA 5FOQA 3QBDA 4OIMA 2NO0A 2REQB 1SBTA 1XFDA 3NYIA 3OEYA 2WJPA 2DC1A 3PGVA 4ZRDA 3OIYA 1CUCA 3N8KA 4OB7A 4UU7A 4IHJA 4YDSA 4HGNA 2XB6A 2GTHA 5SZKB 1CT9A 1ZW6A 3RV4A 1T5DX 2FEAA 3FPFA 3NO4A 2J0SA 3OU2A 2GA9A 1XVIA 3KTDA 1PNRA 1Z75A 3OZDA 1KAMA 1PSWA 5FXMA 4L07A 3NTLA 2IZZA 3NHUA 3KQYA 4OAPA 2PJDA 3A06A 2NU7B 3AR3A 3Q8LA 1XPRA 1M2VB 3IAUA 1XB2A 2R7AA 3N76A 1U99A 3VU1A 1A3CA 1GPKA 1Z25A 1P2SA 1ULBA 2JI6A 1NOIA 2MYPA 1JZQA 1PDWA 2ZRMA 1Q83A 3H5WA 1OXSC 4FYXA 4IDEA 2NOAA 3BULA 2YXEA 4BYMA 3L92A 4DIEA 1UBMS 1YTLA 3H1FA 1J8FA 1YZFA 2ZITA 4MGEA 3ZEAA 2YFYA 4U2BA 1WDKA 4G65A 4OQFA 3WWPA 3MBIA 2BMJA 2VTBB 2ZG6A 2X8WA 2G71A 1ZLXA 3TAHA 4S24A 5LWQA 1A0OA 1WW3A 3SZLA 4LRTB 1WB5A 3FFTA 3C8MA 2FZGA 4E4YA 1J0AA 4TYYA 1SQSA 1H85A 1W5TA 2W6IA 3EVEA 3WRXC 1FUIA 2FFQA 1YL7A 5FWYA 1J8QA 2XBMA 1MUUA 3I0ZA 2Z6VA 5KIAA 1CQXA 4J2TA 2JFWA 2A0WA 2WM2A 3OOSA 4B3XA 3SN6A 3KU1A 1KEZA 1OPXA 1VHWA 2LBPA 3UGKA 5EIHA 4EG8A 3EHDA 3WHPA 1DKQA 1CJCA 3IHWA 3NETA 1NPYA 3NHWA 4HRYA 1L4UA 5HBGA 1ISMA 2R65A 2QBYB 3T3HA 2CJFA 5B57C 2H2AA 4B76A 2H2WA 1I8TA 3HC7A 3VA7A 1JIQA 3Q8MA 2CK3D 4MB6A 1C1DB 3W6ZA 1T4BA 5C31A 4KKVA 1OBVA 2BFFB 4HBGA 5E6RB 3U3MA 1K92A 1JHXA 2GK7A 3H1PA 5KWEA 3KFVA 4F97A 2BFMA 3A1SA 4LXGA 1BC5A 1NP3A 4Z2YA 5LA6A 4LOIA 1SXHA 4AC9A 1XKLA 1XVAA 5BVGA 4NYIR 2CXHA 2IX9A 2J67A 3KLOA 3LNCA 4JR1A 4MPJA 1QHSA 4O4HA 4IXDA 1C3OA 2R8OA 4PLWA 1ANKA 1N1MA 1QIHA 1YBAA 4QTZA 4NNPA 4PG5A 1CG6A 5EJ6A 5EEGA 2QK4A 4G5RA 5JQGB 3AQ4A 5HGJA 4IHQA 3AONB 4BTLA 1E8MA 2L42A 3LUDA 3QK7A 2C1XA 2XRMA 4KDCA 3OMLA 4TMFA 3JQPA 5BQFA 4UMVA 5GTDA 4X54A 2XRYA 1UMCB 2WIGA 4WNYA 4C5AA 4OP3A 4R01A 3IA7A 3QWFA 2WHPB 1E9CA 3AY3A 3ZNQA 4CCWA 3QNMA 3P9ZA 1XLTC 4XVUA 1G63A 1QPBA 4QIHA 3OICA 2OYCA 2QZPA 1EQ2A 2VUHB 3G0DA 5G53C 3DDUA 1MZVA 1GTG1 5I47A 5ITZA 3ZHXA 4QQFA 5AKIA 1YAJA 3E0QA 3IAS1 1JKFA 4DM4A 1DKMA 3O7WA 1YOVB 2Q8QA 4UE6A 1XR3A 4JXJA 5JU6A 1AHIA 3QEMA 4UBNA 3ZE1B 1UBEA 3ABIA 5TDHA 2FZWA 5BYKA 4PGGA 4OHKA 5GQSA 1LQUA 3DMTA 4TYPA 3LA8A 2J46A 3SC6A 5KOHB 4O3MA 4JLVA 2HA6A 4HNUA 1VPLA 4ECEA 4O2AF 3DVAA 3C5CA 2B4YA 3BWVA 2W98A 2YJ3A 3AEKA 1V71A 3A9RA 4UNNA 3ZY6A 5C5EA 1B3BA 2YR0A 2HAEA 2W6PA 1ZH2A 2NUAB 4RKRA 2GKOA 5HQ3B 4C0WA 3P8ZA 2ZIVB 4DXHA 4R6XA 1VDMA 3D3WA 1EP2B 2ACVA 2C2HA 3E2PA 1LDBA 3B3QA 3HFRA 4K26A 4MJLA 4OB8A 2MSKA 3THOA 1O6BA 3Q8XB 4TMZA 1QBKC 1VZ2A 3CF0A 1Q1AA 4RKYA 2AVNA 4OH7A 4DIDA 1V1RA 3HNPA 3AILA 5ETJA 3NOXA 3OTGA 3TQOA 2ZS9A 3ZWXA 2JHFA 3KFXA 3T5CA 1D2EA 3OIGA 1O2DA 4ZVUA 3D2LA 5J5VA 1UPUA 3WAGA 4A23A 4MVJG 3S27A 3EAGA 2GEFA 1KKMA 2HIMA 4ND8A 3MRVA 2C0CA 2HRQA 3DUFA 3MTDA 4X8OA 3K1JA 4YJHB 1R8SA 3DBHB 4GYJA 5ALKA 5I7AA 3SAJA 2DHDA 3FOZA 1RQPA 4Q66C 1KTIA 1G5HA 3LE8A 3ND7A 1YS7A 2HM7A 4GLOA 3L02A 2WOJA 3UHJA 3SJCA 5AR1A 3X1JA 1JQEA 4D3ZA 4RF5A 2P2DA 1ORHA 1T35A 2WUEA 5E9QA 1JTFA 3L07A 3QV1A 3S1SA 2ZUFA 5C5DA 1N36B 1ABBA 3WIBA 1XZAA 1ID1A 2JW5A 3HSKA 3CM0A 1KTVA 3AOGA 4IJ6A 5ENVA 3SJBA 2CKDA 4LWOA 4YH1A 3WJ1A 5C52B 1FFXA 2WG0A 4XDHA 4HI0E 5WRFA 2AFHE 4P6VF 1NXVA 3WC4A 3EXEB 1JXOA 1WDLA 2RE8A 2GGSA 2ANBA 3KS9A 4RTPA 1I3LA 1Z4MA 5CDTA 2A86A 3MJEA 3QLEA 2IWRA 2X8JA 3RVMA 4ALKA 3UJDA 1N0VC 4FKZA 2BZ0A 4CTMA 1RI3A 3DL4A 2IH5A 3WKBA 4EHKA 1IEVA 3DJYA 4Y9RA 3ZHZA 1R2QA 5BPFA 4LNAA 5FH9A 2G9RA 1XRJA 1FXWA 2ZB7A 4G09A 1KVQA 4L28A 2IU0A 3ZGLA 1EWQA 3IV9A 4ZO9A 5H9VA 3GG9A 3O4GA 3ORRA 1PYOA 2PKCA 2JLCA 3EMDA 2FUCA 3HWWA 4GT1A 1UJCA 2XZDA 2PRYA 4MYTA 1PGQA 2JASA 2ZWPA 5BRNA 2G1UA 3ZW9A 4HDQB 3KSUA 2WT9A 1WXHA 2CBZA 3CWQA 4ZANA 2IOYA 2MMCA 5FWXB 4KE6A 1GL3A 4CMEA 1AKNA 1IAQA 1DEKA 3WLJA 3OQOA 9MHTA 2VJYA 2IQIA 4JJ4A 5LCXA 1QR2A 1W4AA 1RMTA 3CSSA 3GROA 4M9RA 3IILA 4TM8A 2HK8A 5JAZA 2L2QA 1KGDA 4WADA 1S8FA 1GRNA 1T2AA 1KY2A 3NPMA 3N87A 3P9IA 3U62A 4LHEA 5JYDA 1QP4A 3MMPA 1LA2A 3IBYA 1E2DA 5AMXA 1Y8RB 3KR0A 1A9YA 1R10A 3TM4A 1SBHA 2ZJ4A 4TWAA 4BHTA 1RTTA 2ZU0C 2HRZA 3KT3A 4J91A 1XQWA 1DAPA 1HYQA 2ZUSA 3CF6R 4RCVA 2M6SA 2WJYA 1NFRA 2QLMA 3BEDA 3NJ8A 2R2GA 1S3SA 1E4EB 3NLLA 4NPAA 1F2TA 2CT8A 2IDMA 1IYZA 1K7YA 2DSNA 3WKDA 3LQRA 4KXLA 4DG5A 3JQ7A 3R5HA 2C99A 2BFDB 3HMKA 1TVEA 3LY9A 3EUFA 3QOWA 3ZCRA 3QIVA 3ADDA 1JIVA 3ITKA 3O4RA 4QBTA 3EDOA 1MRSA 2EW8A 4AP6A 3WADA 4J43A 2IHVA 1U0EA 4LZNA 4BEVA 1NKVA 1L3IA 1EFTA 2PQ6A 2R6GA 3WLMA 5C7LO 5BOVA 3ZX5A 1FFWA 1UOOA 2HCTA 3OX3A 4HNVA 1O89A 1ZEJA 3E03A 4R9VA 1P1CA 1RKUA 1GCAA 4JROA 4H7EA 4YRLA 1NWCA 1SHLA 2VH5R 3VXKA 3WYAA 3MINB 2I7DA 1JDVA 3UAVA 2C07A 5JS2A 5DNYB 4JKYA 3II6X 1EM8B 2O3SA 4WAUA 2VZEA 1W85A 4JVOA 1EGQA 2DKFA 2XDQA 4N5HX 1KY3A 4UFOA 5BRAA 1FX1A 1KKLA 2UVQA 4DSTA 2ZBDA 1ZIXA 3UYKA 1RHQA 2ZUCA 3ZGXA 3GYGA 2EFDB 2NU8B 1B6RA 4K0KB 3MGAA 4FI3C 3RAPR 3MWDB 3OLXA 1RWPA 3KWLA 4LKOA 4MVJA 1HOXA 3WLQA 1KBQA 2O06A 5JMWA 3DXYA 5EERA 5K2OA 4P2BA 2C2OA 3MFQA 1QRAA 1S01A 1Z7WA 3HP1A 4NZMA 4BATA 5AIBA 1L8LA 2XRZA 2FUG1 1X38A 2V4UA 2ZTLA 3HZRA 4CETA 3TH5A 2XNCA 1HEIA 2WEKA 4WDQA 5E4TA 4BX2A 3QOFA 3ONNA 3PI7A 4XUGB 4DV6B 4KIGA 4RVHA 5J2UF 4QU9A 1J8VA 2QTFA 3P32A 2W58A 4H7IA 2GTPA 3KYBA 2VEDA 4EUHA 4QQKA 4OK5A 4C6TA 3E1KA 4MPPA 4Q12A 4AQYB 5ER9A 3H3XA 4RZHA 2XCOA 4HQ0A 4NDNE 4RV5A 3A1TA 4EKYA 4KFCA 2ODQA 5E7MA 4DCUA 5HUHA 3PXBA 1P2TA 3RBAA 4X1YA 2CL7X 2YWDA 4Y9SA 2VA8A 4JJIA 3UAGA 1I1HA 1WPQA 3AIMA 4DV4B 4F5YA 1UPTA 3A32A 4JI6B 5BN4A 1SCQA 3OI7A 1WPRA 5C8YA 2HCBA 1CF2O 1R3UA 3EBPA 3NDPA 3O4VA 3SKVA 3SYLA 3HDYA 2A5GA 3KLPX 4NZNA 3SZRA 3WHLA 1AUOA 4Y0AA 3K0HA 1DG1G 3UT5B 1ONBA 3OJ0A 4KV7A 1L4LA 4FHCA 3K73O 1XA3A 4NFHA 1CJTC 2MYTA 5LQKA 1GITA 1N2HA 5LYJF 4P4UA 2Z3ZA 3UWDA 1IDOA 3B2NA 4BNUA 3NC1C 1KWGA 2A5JA 4J7UA 4QBIA 3TRKA 3WGZA 4TX1A 3FVQA 3UAYA 4F9EA 1BVRA 1ZPDA 4FHFA 4YQEA 3ZVMA 2YX1A 3B1YA 4MWEA 3SZUA 1XTBA 1P2VA 3CGWA 2QZSA 5JVDB 3ZDYB 5K3OA 5L6MB 2Q5EA 1P9NA 1L7DA 1N7JA 2RSLA 3AF1A 1P19A 4IIHA 1S2IA 1V41E 2N42A 1R4NB 3I32A 1G3QA 1KJJA 4IDBA 4I3HA 3OE1A 5JFOA 1IN7A 4BFWA 1EWVA 1OI3A 1XV5A 3K3PA 2AV6A 4NBTA 2AFIB 2QLFA 5DB4A 3TOCA 1D6SA 2FVXA 3BVPA 3MT0A 3Q0EA 5F5NA 4TSFA 2BR5A 5BW4A 2PX4A 2QTBA 2RBEA 2GF2A 3NBZC 3WLNA 3D7NA 3LTEA 3SIPA 1X9IA 1DBQA 1XJWA 3FRJA 2X4DA 3CRRA 2AOUB 3F5DA 4IP0A 4Y6RA 2EVWX 1BDIA 4CMHA 1WVIA 4Q3OA 4TVSA 2J6CA 1HV8A 3BH7A 4X3OA 2BHLA 4ES6A 4YUZA 1CP2A 3CONA 2OESA 1HE5A 1U2QA 3KZMA 4Q4AB 2XYPA 1Z5PA 4C01A 3D6UA 1WRBA 3S2FA 3TQTA 4DCGA 2ZR8A 3I3OA 5JBIA 3EEOA 4P53A 3EWNA 3KJZA 3OPXA 1PHRA 2ODAA 5SYMA 1RYYA 1VIAA 2GD6A 2ZBVA 2IOHA 2CBXA 3TDNA 3UMRA 1TJ4A 4YRSA 2ID9A 4M8NE 4Q7KA 5TF0A 3E3AA 5CR9A 3F9RA 4RM3A 3K2QA 1P2GA 1Z2AA 2GTIA 4YT8A 1NNEA 4AT1A 3R3ZA 4Q00A 2ZKIA 4CV2A 2Z2YA 3JARA 3F8TA 3AEQA 1IC6A 4LZOA 4TZ6A 5CW2A 2XGJA 4PG8A 3B9BA 3CW8X 3FYUA 5BNFA 4IQ4A 3HXMA 5AO9A 3WFZA 1SNYA 3DLIA 2AZMA 3DR3A 3O92A 2P9ZA 3PHJA 4WKNA 2R6JA 1N92A 2WHQA 1R8QA 2XUGA 3UG6A 4LGVA 4B17A 4L74A 1GR0A 3N0XA 5T6BA 1P1JA 1EFVB 5CIWA 2AD1A 4LDPA 1NONA 3UCEA 4IDHA 5ILOA 3E05A 2HMVA 2P5YA 1L1QA 2VNJA 4DJEC 1T4GA 3HL0A 2JEZA 2P7IA 3VHXA 1H4TA 4IIDA 5EJ2A 2R5FA 2FPPA 1C0KA 3GEIA 3BICA 4W7IA 1UL1X 3DEFA 2P9BA 2RAPA 2HLDD 2VP0A 3GBSA 3TSYA 3X1XA 3COYA 1EJ2A 4AUEA 2BKAA 4TYNA 5DT2A 5JJCA 1Z5OA 2HPHA 3GEGA 1L5YA 4BL5A 2E4ZA 1MABA 1MH9A 1W2GA 1XJCA 2EDCA 4L73A 5DWDA 5I9MA 3VUEA 3ZZUA 5EHGA 1B7GO 2KMLA 3B7GA 3UKJA 3EPJA 3VNAA 3WFJA 2ABWA 1PNVA 4OXIA 5INTA 1I30A 1TECE 2JS7A 3RFXA 5AYVA 2FMKA 1A76A 1P4SA 1RYZA 2LTAA 3GFOA 5TPWB 2JBAB 2B30A 3G89A 3R0VA 5AM0A 5T7BA 2UZ1A 4AP5A 3K2EA 3LKBA 2Z6UA 1ETHA 4EEXA 1Z2EA 2M32A 1YIAA 1CR0A