1FC1A

Crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic refinement and atomic models of a human Fc fragment and its complex with fragment B of protein A from Staphylococcus aureus at 2.9- and 2.8-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords FC FRAGMENT
total genus 36
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1981-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fc1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fc1A01
1QR1B 1NAMA 5DVOA 1MHEA 4HFWA 4X6CE 5HHME 1FHGA 2VDNL 2YXMA 4JFPA 1WVZA 1T1ZA 4JKKA 4U1KA 2DB8A 3BRGC 1ACYL 4YFDB 1GYAA 3RU8H 4F57L 2NW2B 2R8SH 4QXWA 3SPVB 4LOUC 5LGHL 2Y25A 3QIWA 2RCSL 4Y1AA 4PJ7A 2VABB 3IS0X 4OLVH 4LLYB 4WW2F 3HZYB 1QLRA 4YZFE 5F7FA 5KS9E 5BV7B 5J1AA 3HI6L 4BYHA 1NFKA 5T5NG 5FM4A 5IFAL 3AC0A 4I8DA 3BO8A 4U7MA 2B5IC 1FNLA 1T2JA 4TQEH 1LO2H 3DXAB 3H9SD 3V6OC 1KCSL 4KUCF 2D7TH 4L8BA 4MQSB 5KVGH 4PR5B 1U8LA 1SEQH 5IB3B 3BWAA 4N90E 4XP1L 2R4SL 4RQQB 3GMPA 1KEGL 4ACPA 1S9WA 5LKNA 4Y19A 1JPSL 1BECA 4LQ1A 1JPFA 5CEZD 5DHVB 1YY8A 3T8XB 4I0PD 5F97E 3CFDB 4HZLA 1O7SA 4Z7UF 4JRWA 1BAFL 3FB7B 1KC5L 1D9KB 4LAQL 4XVSH 1BM3H 3HNSH 4RZCA 4Q0XL 4G8EA 2BSRB 4ODSL 4OFDA 2AI0L 4PRPD 3OTTA 4CJ1A 4QOKE 1QSVA 1G6RL 1JWSA 2GITA 4HBQA 4XAWL 4HG4K 1AP2B 1B6UA 3IDNA 4HIEB 2OSLB 2HMID 2A0LD 1TZGH 2FYYB 4L9LC 4YC2C 4NN5B 4QXUL 5T5FL 4Z6AT 1V3LA 1YPZF 1HILB 4N8VG 4UNVA 1L7TL 1ZGLM 5CP3H 2A6IA 2FEEL 1K2DB 5M7QA 2B8OT 3IXTB 4JCLA 1OAXH 1AD9A 3IKKA 2Z8VC 4Y0GA 4K94C 3VGHA 2V6HA 2QHRH 1QR4A 3UZEA 4P2RA 1UACL 1MLBA 2HKFL 4PJIB 4QRSA 5BZWB 2VJXA 1BBJA 1OWWA 4EI5D 4P5MA 1UWEL 3O2WH 2NY1B 2A6KB 4OI9A 3V52H 2EE6A 3C5ZC 2R23B 4MNGB 3L3JB 3U0PA 2QADC 3L3JA 2VRAA 5CILH 4WWKD 1K6QH 5FV2A 1YN7A 4BZYA 5EBLA 4LL9A 5C09B 4G8GA 5K9OB 2EDWA 3EJJX 3EJYC 1LNUB 4PJ9D 3QCVH 2Z93B 4IOFD 4OD1H 4M61A 4PRNA 4S1SL 1AKJB 4ZD3L 4J8RA 4NZRL 5TE6H 3A6OA 3MGTA 4PRPB 3ARZA 4IJ3C 4N5EC 4F7TA 4HHAA 4MMXC 3S5LB 3M45A 5CZKA 1CR9H 1N59B 4NSKB 3ZTNL 5I1DA 2EIZA 5IKCB 1S9KC 4N0UB 1F8TL 1X5KA 3KPTA 3PHOA 4JREB 3Q0HA 5EB9A 3FB5A 5EA0H 5BS0B 5BS0A 3VGDA 3MRHA 4U49A 5ESQA 1GPOH 3MODH 4XRCA 3MFFB 3TCXA 1OT2A 4ZDHA 2AXGB 1EVTC 1ZT1A 3WHE1 1IM9B 2DWDA 4PIRF 1T6WA 3ZDXE 4G43A 2XZQH 3FB7A 4UQ3A 5DI8B 4N0CD 1HQRB 1DQQA 3R1GL 5FCUL 4P4KD 2W91A 2UVFA 4JFZL 1G9MC 2GIYA 4BKLA 2OZ4L 2RFXB 4OLXH 3P77B 2CKBH 3VXMB 1X44A 2DTML 2EDTA 4PB9L 4F15C 1JZ6A 3WEXB 3WDHA 3PP3K 5E2TL 5KSVB 5F3HB 2DM2A 1H3GA 1LO5B 2WM0A 5GRJH 1FAIH 3C8HA 5HHXL 4CU7A 4ORGB 2KL6A 1ONQA 4PBVC 2PW1A 3JTTA 1B0RA 5F70A 1MQ8A 1G7MB 2J4WH 4URTB 5CIPB 2CRIA 1UVQB 2BHUA 5HJ3B 4KJYB 5E6ZA 1NAKL 1Q9KB 2GK0B 2ICWI 4C56D 4ZPTA 2VXVH 4UAOB 1JN6A 3BDBA 4JG1H 4MAYC 4Y4KC 5D7LB 4NZTH 3SQOH 3BZEA 4FQPA 3VDAA 1AO7D 3U6RB 4JDVA 4IMKA 4MA1B 3W5MA 1NAKH 1EZVY 5DMGD 1EFXA 3T4AB 4IEFB 3VGGA 1ZGLB 1OD7A 3EJZC 1JI2A 2ZP0T 2HTLC 2FO1A 5INDB 2BOCB 3ZKMC 3I50L 1J1XH 4YDLC 2OMNA 5LGKA 2EXWC 4PJ8C 3OKMA 3AMLA 3DX7A 1J18A 3T65A 3DX7B 4Z0XB 5CMAB 4LPYA 4CL7A 5LXGH 1CL7I 4U1NA 2PW2B 1MJ8H 1YMHA 1PJ9A 3JV6B 3MRIB 4F33A 4UOW1 3L6FA 2X1XR 5I30L 3BZ4B 1MUJB 1MUJA 2YD1A 4KKCD 4OLYL 1T80A 4KK5C 4FQXA 1A14H 1KELL 3KYNA 2P49B 4OCMC 2FECL 2H1PH 4P59H 2ICWB 2DL9A 4YUEH 3RVXD 4K7PH 3C09B 1MCEA 1J12A 2W65A 1CLOH 1A4JA 1DVFC 2VLRD 3NTCL 1T5XB 1A4JB 1C7TA 6CGTA 2A6DB 4Y5YA 43CAA 1DSFH 2YRZA 1IM3A 1RULH 4JFQB 1JIBA 5KSVA 3LRGA 4LGRB 4J3VA 3P11L 1GAFH 1MCWW 1MCPH 4DGVH 2F54D 1CFQA 2NX5B 5C9JB 2ZSVA 3HHRB 1NCBL 1MAJA 1P9MC 5IV2A 5EG6C 4ZD3H 4M5ZL 1FO0H 2W9EL 3ARFC 5CHNA 3WDJA 1T1XA 1UXWA 3WJJC 4UT7L 4G7YH 4JPWH 4RGNE 4HLZH 5GGVY 4ETQB 4JHAH 1Z9SA 2I9TA 3P9LA 1A7NL 1IKFH 5DK0A 1M7IA 4P23B 4NM8H 2DQFA 5TDPB 1FZOB 3OKEB 4U6YB 3UBXI 5TE6L 1VFOA 1XF5B 1H3PH 4DUVA 3QWRA 1HQRA 1A6AA 3BD5A 3LB6D 2XY1A 1KIPB 1Y18B 1AQKL 7FABL 2ESVB 2F8OA 1AC6A 1MRDL 2W60B 3B6SA 3QEUA 3QUZA 2NW3B 5E6IA 4KQ4H 4X5XB 3DGGA 4LVNB 4UQ2B 1JTPA 5F1IA 4EIZC 1M7XA 5GS1B 3GBNL 4K7FA 5H94B 1FFNA 5AG8A 5HY9A 4PGCB 4ZG1A 1FVEA 4UUJA 5DJAA 2XWJA 3PWVA 3U7YH 4KMTL 2UZYB 4FQJL 3KPSB 1IT9H 2A6KA 1NUFA 5EN2A 1AGDA 4LCUB 3TIEA 1A6ZA 4MXQD 4ZTPH 5ELIA 1CU4L 5HVFB 4PGEA 1RIHL 4BUHA 1RZJH 5I76A 1LP9A 2NQCA 4YE4H 2DLFH 3MCLH 1XF2B 4HUNB 1K2DA 3WXWH 3HPLB 5E8OA 1CXKA 3PQYD 4JZJB 3V52L 3OAZK 4L5FL 4KC3B 5IB2B 1D5BA 2F58H 3V5HB 3HC3H 3TT1L 3LQAL 4MD0B 3F7VA 4WHYH 2HTKD 1UB5A 4IRZL 4XPTL 1YMMB 3I2CL 5ICXA 3AFLA 4XB8A 3C9NB 3NFSL 2C3GA 3BE1H 2YPLB 1BOGA 3SE4C 3WCYA 2R0KH 4L1HA 1YZZA 1I4FB 2YD5A 2ATPA 2DQUH 2NTFA 4WEBH 4HMDA 1U8MA 1HHHA 4GUPA 1MF2H 1G7JB 2UV3A 5BRZE 2FDBP 5CEXB 5FUCC 1FGVH 4XPHL 4TVPH 5EBGA 8FABB 4TQEL 1WFUA 4J4PC 4N9OB 2OMBA 1UZ6E 2MNUA 2BJMH 4HKZB 4PJHE 4RAVA 3TYGL 3OJ2C 4TULL 4MA7H 2FX8H 1FVDB 2V2XA 1EBPA 3BKJL 3KYKL 4ONGH 4OGZA 2EDEA 5C08B 1A7QH 4HUXA 1T04B 1YPZA 5HGHA 4CVWA 5FUOL 2O5ZH 1ZHBB 3TH3T 3QDMB 3TYGH 2ATKB 2VQ1A 2WUCH 4P2OD 1MLBB 3RZCD 4PJ9B 3E8UL 3RDTA 1X5FA 2VIRB 3KPOB 4S2SA 4ERSH 4GXUN 1GIGH 1A5FL 4PBWD 1S8DB 5BV7L 1ZVSB 2YA2A 1H8SA 2OP4H 4BH7B 1FZJB 4Y5YB 4OSUL 1G7IA 5EH1A 3QDJA 1BLNB 1MRFH 1U3HB 1PLGH 4YXKH 4LEOB 2UWEB 4IOSD 4C4KT 4HV8B 5C0AA 3BGMB 5JZ7C 2GTZB 3I6LE 3DV6B 5C0CA 4FMFA 4XNMA 4OKVA 3X3GH 4QHUB 4NKDB 1D5BB 2VWEE 5DUML 5IW6A 2F74A 3NCFB 5HD8D 3TBTA 1TDQA 1WEJL 5CGMA 1XZ0B 1UT9A 2LE9A 2DYPD 4XWGL 2OK0L 4P23C 5HGDA 3WIFB 5I1EL 3QCUH 3NIDE 3GRWL 1E4KA 3VFOB 5I9QB 5JHDE 3EYUH 3MLUH 4AEIH 2UUDH 5GS1A 3QDJE 3Q1SH 1OP3H 5A43C 3BYTA 5C09D 1BFVL 2KQMA 2Q87A 5TH2A 4RGND 3N9GH 2P24B 5FGRA 2A9ML 4KFZC 3TBSA 4M1GH 2CDGB 1B90A 1CU4H 3VWJC 3KPLA 1YNKL 1E28A 5EZLA 4CVXA 4KK8C 5DDHB 1J0YA 4JN1L 4ODTH 1Z9OA 1EHAA 3KPSA 5KSBF 1R3LB 1Z9MA 1A3QA 1KENH 1KN2H 2RGSA 4B50A 3MV8A 1WBXA 5IHZA 5JORA 4AENB 5CUSH 2B1HH 4M6NH 1RVFH 3D39E 1F11B 1FG2B 4XPHH 3GNML 3HR6A 3MMEA 5FHBH 2HN7B 2UZIH 3MROA 1VFAA 1KIRA 5T1MB 4UB0H 3RL2A 5H2BA 3HNVL 5HPMB 5F89A 4LKCB 4LHUB 4U2YA 2HT2C 1G7HB 5KVDH 3DXAD 3X3FL 3SDXF 1QFWM 1HHKB 5D7JA 2BSSB 1AQDA 2OX5A 4JRYA 5MENE 2NX5E 4DUWA 4ODBD 1KJ2A 5GRVK 3CU1A 3CIQA 35C8H 1BMGA 3QWQB 4OKDA 3TT3L 4UTAH 1MQKH 1UA6L 1OT1A 3TT1H 4KRLB 2EO1A 5SWZE 1N6QH 3O2DH 4PRAB 1PSKL 4GMSH 4YK4B 1IKFL 3MRPA 4UDTA 2FSEA 3EHBD 4FFZH 4I3SL 5J6HB 2OXGA 2XN9A 5LG1A 1TCRB 3VA6A 4HEME 1NUNB 3ZE1E 1IMHC 3UEZA 4ZFFA 5DRWB 3T0WA 4GRWB 2RQ8A 4RMRA 3U30C 2RR3A 3CDYA 4OLUL 1M4KA 3H9HA 3HS0A 2YS4A 4LBEA 2BVPB 5EU6D 4X9HA 3VD4A 5E94B 3PHQA 5HHMB 3O9WB 5EU4B 3RPKA 3ZE0E 3QI9D 3DURB 4KUZL 1T83C 4RA0C 4XX1E 2Z31B 2PR4L 5KVFH 1Q72L 1SM3L 2C4FU 1EGJH 5F6IB 3LEYL 4OZ4B 3CVIH 3LKRA 3BPLC 2YPKB 1WSST 4HH9B 2JIXA 1HDMA 3VXUB 2HKHH 1MPAL 2D7NA 2X89D 4M1CC 1IGCL 2BOBB 4TPRL 1UM5H 4PJ5A 4M7ZB 1I9JL 1WBZA 1YNTA 5F8QC 4OCWH 1A64A 2E6QA 4H5SA 5H35A 3PGCB 5C2BH 3LKNB 2EDHA 3WMSA 3ZYZA 4XBEL 1OGAB 3FQNA 1H3PL 1DUYB 4D8PB 1Q0YH 1XR9A 1JNLH 4F15B 3ARBA 2EC8A 5F44A 3IFPA 4HGWA 1WFNA 5JXAL 4LKCA 4AY0A 3WJJA 5DJ0A 5EU6B 2EDOA 3T3MF 1ADQL 3AM8C 2AGJH 3ZT5A 4U1GB 3SDCA 3OKOA 5C0BE 4GKNA 1QFHA 1OF2A 1R3KA 2HLFC 5IMOA 1WAAA 4JAMA 1TTFA 3LIZH 5ACZA 4OCLC 5FDWB 4POZD 2A1WL 1VGKA 4WIQA 2IH1B 2J8HA 2BVYA 4ZS7L 1LO3L 3X11A 1SY6H 3MLTA 5I18L 3T1WA 3FQWB 3PL6C 2FBOJ 4KRMB 4JM2A 1CXFA 2P24A 1D5IH 3GSUB 4QHMB 4NWTH 4Z7VA 5CKGA 1S8DA 4DAGH 1OAQH 3G6JB 5DJYB 4HWBA 3RX5A 1XGQA 1X7QA 4WWKB 1BVKA 3FTGB 4NQUA 3WNOA 3WHE0 2Z93A 3QDHA 4BZ2L 1I1FA 3GHEH 4CADB 5J1TC 2XICA 5EC2B 1SVCP 1DBKH 1N64H 3X12B 1BEYL 1CDHA 5TPWH 4I0KA 4W4NA 1EDQA 3PDOA 4CRPA 5DXWA 5SWSB 4LARH 3RIAF 3GMLB 2GCYB 4DEPB 1DDHA 4DAGL 1FPTH 4AH2A 4LMQI 3LEXA 4JFZH 4PJIA 2PETA 4QRSB 1OW0A 3VCLA 2FL5B 1GOHA 4V2CB 5L2KA 1MCNA 3FT4B 3LPFA 4L29A 5E5MA 3RTQB 4JM4H 3JWNC 4FQLL 3TVMC 3GHEL 4WTZA 5D2LA 3LN9A 4PJDF 2NTSP 1DCLA 1M05B 2FGWL 1XGUA 4Y2DD 1LNUA 1CD8A 4FQLH 3FB8A 1JWSB 2GITB 3M8OH 2V2WA 5DJ0B 2J1KA 3RUGB 4NUGL 1Z5LB 4Q2ZB 2DBJA 4TOYL 2VXVL 3MA9H 3HE6D 3ALXA 3LQZA 1V05A 1ZLVK 4RQQA 3QHZL 4QHLB 5JXEC 2G60H 5MEND 1Q9OA 2LABA 3HE7D 1ITCA 2BRRL 4MQXD 1Z0NA 4FXGB 5HYJB 4QXTA 5EBLB 3FN9A 5HHXH 4X4XA 4QHKJ 1ADQH 1V3KA 2XYCA 3P4NA 3GJFB 5I8KH 5I9QC 5EPMA 1WIOA 5IVNA 3VXME 4RZCB 1B4JH 1ZHNA 4WFHE 2CKBL 2HT4C 1UWEH 3O2WL 3KPQA 5JQHC 5FIEA 2OTWA 5DFWH 3GKWL 5ALCL 1WITA 3VFWB 1TPXC 1M6OA 1FVCA 5KTEL 4PUBL 4NYLA 2VZSA 3SE9H 4WUUA 3TZVD 2E8YA 5JO5A 1PW3A 1I1CA 3FO2B 3QBTB 3TVMA 3CH8A 1K9TA 4DZ8A 1LE5B 5CD5D 4LNRA 2Z91A 4X7TB 2IPTL 3KDMB 4LCWD 1JF6A 4NFCA 3D85A 1G6RH 2AJ3B 3RWGB 2NZ9C 1SYSA 3HAEB 2R0LH 3BZ4A 3FFCD 4QNPF 4LU5L 4PJ5B 3RWCB 4X0KB 2NY6D 1JHKL 1UQSB 1W0YT 4NQDD 1BAFH 5ISZE 4KROB 1TJHL 3RVVD 2CO6B 5EO1B 4MJ6B 3H9SA 5IF0B 3EYOB 3GIZH 4JB9H 4YHOH 1DL7H 5D4QA 3BMWA 5IQ9A 4G3YH 3ZLQC 4S1SH 5DFVC 4OUUA 3FL7A 4LP5A 4EUPH 1CLZL 3B9VA 1KFAH 4FFWD 4W6YB 1EJ6A 1TNNA 4KRPB 1I7TB 2C1PA 5C0BB 3TA3B 2ZSWB 4OZGB 1K6QL 3Q3GB 3PP3H 5HI4C 5E6IB 2UZIL 5IV2B 3DX9B 5EOCJ 5L2KD 1PSKH 2QQLL 3RJQB 4KVNL 1G7LB 1N8ZB 1I1AA 5I73B 4ENEC 2AV7A 4W4OC 4Z95L 4JLRB 4YGVA 3V6FA 2AV7B 3V6ZA 4U1IB 3MFFA 2X44D 1G84A 3QDJD 2NX5D 1DFBH 1FV1B 3QISA 1M7DA 1IGTA 3V5KA 3NZHL 3V4UH 5EORL 4QRPD 1UCBL 3M1BB 2HLAA 3ARVA 3KPLB 4OIBA 3SKNB 5EO0B 4J6RL 3PJSA 1BJ1J 2FB4L 1N5AB 4RMWA 3O2VL 2WP3O 1IL1B 2X4SA 1W0VB 1J8HB 4OCRH 3DVIA 4Y5XB 43C9A 4LLMA 4IS6A 4LRIC 5F7MC 3TH4T 4OZHF 5JMOC 3EUUA 2V5YA 1I7RA 5I1HL 4OFIA 4OCYL 1S9XA 5GGTH 1RZ7H 4OZFB 2K3TA 1B0WA 1KGCD 4RRPA 4PV9B 3CAFA 4UV7H 5C0BD 3RUGA 3TA3D 3E0GA 4X4ME 2IJ0C 1JPSH 4HD9A 1IKNC 2Y36H 1HSAB 1ZT7B 4XMPH 3OF6A 4MJID 3O3EA 4JG0H 4LPUA 2QKIB 1DLHA 1MH5B 1KB9K 3QIUD 4K8RC 3QCUL 3S3JA 3SE3C 1F4YH 5J06A 4ETQA 1L6ZA 4J7RA 4MNHA 3SDDC 1JPST 4DKEH 3VA2C 3OBAA 3WS3A 1I1AC 1X5HA 3QEQD 5E99L 1C5BL 5GHWH 4X8XA 1CGSL 1U0QA 1T83A 3D0LA 4LLDA 3SKMB 1MCBA 3GSWB 2C7UA 4LEXL 2Y23A 3IGAA 5J13B 4X6DB 2H32A 4RIRB 5L88L 1LK2B 2W9LA 5HYSA 4JVUA 4GBXB 4UV7L 4K3EL 2D4FA 2SEBA 1O0VA 3CFEA 3EFFB 1UG9A 4XAKE 5KN5B 1XZ0A 4L4VD 3UPRB 2FX8L 2WIMA 4XC1H 2DQJL 2VSCA 4UV4H 1AGEB 3FQRB 5DRNB 2VDPL 4C83B 2KPNA 4LSVL 4ZOAA 3LQZB 1KNOB 2V7NB 4PJBE 3JVGA 1DUZB 3MLZL 4LVOC 3ARYA 2FB4H 3FQXB 3HE6A 1V3JA 3L9RA 1ZHLB 4YHKL 3T2NH 4KKCC 2FZ3A 3BKJH 4JHZA 5I1LB 3ES6B 2IQ9L 3CLFH 4QWWD 3D2UA 5DQJB 5SX4I 3K1KC 4G6MH 5FUZH 1R0AH 5DMJB 2LAAA 4NKOB 2OP4L 4QRPB 3WNNA 2BSRA 3JWOH 1ITBB 3N85H 3CFBB 2EYSA 4IRJC 4G42A 1B88A 2X40A 3T0EA 1KB5L 1FN4A 5CEZH 5I66A 3BRFA 5D5MA 3RVXC 1A9EB 1RQ5A 3OZ9H 4WHDA 4Y16A 2X6MA 1JP5A 4GBXC 3DYOA 1OCWL 4NRXB 5DR5L 2HT3D 1DBBH 4MD0A 3MYZA 2DF3A 1KFAL 1KOAA 4R2GB 1RZGA 1NCNA 1JWMA 3K2MC 1TZHB 4JFYB 1Q9WA 5BRZB 5I1IL 1NMAH 5D7SH 2R23A 4MNGA 4PGEB 4PS4H 2QJDA 2Q76A 4D0DA 2DJUA 4LCIL 4I0CC 3UPAA 2FR4A 4EZMA 4I1NB 4JQIH 4DFIA 5HVGB 1ZMYA 4BSJA 2YD2A 4N0FA 2V7HA 4G6KL 1J0JA 5C0AE 5JW3H 4TNWF 3RWJB 5IMLB 1BIIA 4XPGL 2EDDA 4U1MB 3BSZL 5EUOF 5DJXA 5ITFB 1EMTL 2O26U 4EOWH 1F6FB 4GG6F 4JPIB 5ILTH 1IARB 2OCFD 5DEFA 1U91B 2Z9TA 1KJ3H 5T3XD 4JY5H 1DQMH 3RIAK 4IRSD 2JIXD 2YA1A 2AQ2A 5DD6B 2DQIH 3H0TB 4OD2B 2Z31A 3JWDH 4E0RB 3T0XA 3OR6B 4KTDH 3ESUF 1U41A 4X6CB 1DFBL 3CFJA 2UZXB 2KZWA 5JLZB 5F88B 3E6FA 1ORQB 3MREA 4Z77B 5CS7A 2VN4A 4OLWH 3QH3A 4QOKB 3ZDXF 4AT6B 2AXFB 3EJZD 3PV6A 5F9DC 4S1DD 3SGEH 4EJ1C 1LEGB 4DN3H 4KI1A 5DUBA 4WENB 3VXQA 4ZUTA 2EXWD 3QO0A 4KQ4L 3B8YA 3HZVB 3T0AA 1EHNA 3U4BH 1CVSC 1U8PB 3O6KH 4JRXA 1NCWL 2FJFB 2WBJC 4AEEA 4Z78A 4NRZB 2G5RA 1I85A 1QHPA 1FO0L 2W9EH 3ARDC 3P73B 1YJDH 3MOAH 2PXYD 1AD9B 5TF1H 4V1DB 3TBWA 1E27B 1NCAH 1QSEB 3IGAB 1O5DT 2YBRB 3JWDC 1G7HA 3LY6A 3TYFB 5CJXA 1KLUA 1VCAA 4WUKH 1P9MA 4GAJL 4JKPH 1JNHB 4AG4H 4YIQA 3PWPD 3OGCA 3U0WH 4XVUC 4WW2C 2VXTL 1WFOA 4G7VH 2VZVA 1HSBB 4HS3B 3RWEA 4D0BA 4D0CA 4M8QB 3BUTA 4I5BA 4DGVL 1MHPL 3B9EA 2IFFH 2QHLA 5GS1C 5EZLB 1ZT4A 4H88L 4J1UA 4LVNC 2UY6A 3H3BC 2XRAH 1TJGH 5FA4B 3DX9A 4U1JB 4XPBH 3DBXA 5HGDB 4P9MH 1JBJA 3VJ6A 2X09A 1MVUA 5GRWA 4Y5VB 2HN7A 2VDLL 2CLZA 3MGAA 3CXHK 1L9NA 3ZE1F 2X4UA 1MFBL 5EIIA 3MTRA 3SDXB 1XF1A 1U8JB 4NO2B 4YQXH 4U1NB 1CG9B 5K59E 4KJWD 4RFNC 1P4LA 3OKLA 3EFDL 5ICYA 5M94B 4Z8FL 2AJUL 3PV6B 2BDNL 1A6UH 3L3GB 2FHFA 4NQDE 1Q9WB 5BRZA 5ICZB 3TBSB 2ESVD 1R3IL 2VLMD 3P9WB 4FG6D 4Q7DA 1U8NB 4QRPE 4QT5A 1W72H 1JYWA 4F9LA 1A6VL 4M7LL 4OIIH 4Z8FH 4H25A 2NXZD 2UYLA 1PY9A 2ED8A 1CD1B 3I02B 1GCFA 2J8UB 4TVPE 4CVUA 4H1LG 4OIIL 5ITFA 5E1HB 4LSTL 4U6HA 1FYHB 4NKDA 5HHOB 3D39A 4IBLT 1UVQA 5LCVL 1DQDL 4FFYH 4DVRL 1FIGL 5EZOL 5KSBE 5CJ5A 4IOFC 1NBVH 1CIUA 3QQ9C 3T3PF 1HCVA 4KXZI 3NFPB 2WWKO 1BF2A 2YPVL 1MCFA 3UJIL 2H2SC 2WBKA 2F5AL 1LP9E 2PN5A 2X4NA 5JLZA 1K4CB 3KXFD 2P8MA 1F4WH 2W0LA 4J3TA 4UTBH 2DIJA 2WBJA 3WHXB 3ULVC 4M6OL 4YC2B 1JNJA 4Z5RA 1NH6A 3AB0B 3SDAA 1E4XI 3UMTA 5KSAC 1AGBB 4MNQE 4L3EB 5HHVL 3I50H 1U8OA 5CKAA 1E4XL 2CRZA 2K1MA 4J1UB 5DGQA 5DUBB 4LPXA 1P84K 5BQ7B 4YEEA 3U0WL 3MJ9H 3ZKSD 5DEFB 3LDBC 1C7SA 1HHGA 2YHGA 3BHBA 3GSVA 3SGKC 3GMQB 3OF6D 2HJKA 1MAMH 1U36A 4MJIA 3VWJD 2NLJA 4NWTL 3W5NA 1CR9L 4E41E 5D93C 1LWRA 3U4AA 5IHBA 4PJAE 5KVFL 4N0CC 5FYKH 1INQA 3G6DL 4MAUH 4RBPH 2P1YA 4M4PA 1S78D 3TLRA 4NZRH 4S10A 1NCTA 5EFIA 1NGXA 4U1HA 3KPNB 3RDTD 1CLYH 3FQXA 3HE6B 3ZKXC 1U3HD 3G04B 2L7UA 4FHBD 3MV8D 4ELMF 4WW2A 4UAOC 2HYMA 2Q8AL 2C4FT 2AJVL 3SKJL 1U8MB 2W59A 3ZDYF 1ZVYA 1TVHB 1D9KA 2FJFA 4ZYKA 1EHXA 3P0VL 5BW7A 3U1SH 3F62A 4R7DA 5E00B 4NNPH 1HKLL 3T0EB 1G1CA 4YR6A 3U9UA 3VFGH 1U93B 5JQ6H 1F5WA 1CICD 4X9BA 5DZLA 3NABH 4OJFH 4ALAL 5IWLA 3RQ3A 5J12C 3GBMH 3TPUB 4BM7A 3IJSB 4OCSL 1T4KA 2GEEA 1S7WA 5SX5H 4NT6A 2QSQA 3O4LD 3QIUB 1TVBB 2ITCA 4GAGL 3MODL 1CFQB 2NX5A 3OR6A 3K81A 4I9WE 3LN4B 1FNSL 4OD3H 5FDWA 1J5OL 4HPYL 1CVRA 3AUVA 5D96C 4AH2B 3K7UA 4XP5L 4E42A 3BPOC 1QYGL 2V5TA 3FFCB 2NW2A 2ZCKL 2AJSH 5AWNL 2AEPH 5D5ME 5L9DH 3EO9L 3QO0B 1I9RL 4HG4J 3FTGA 5F96L 3BKCL 3LN5A 2AK1H 2B2XH 2HP4A 4P46C 3BHBB 2N7BA 3FRPG 2JB6A 3RWDA 5IIEA 1AC0A 4P23D 3FAXA 1EMTH 1EEYB 1M05A 4JGJA 2YD9A 4X5XA 4XBGB 1BVKB 3NOIA 3T4YB 5C0FB 4HGWB 3U2SB 3T2QA 1KCSH 4PJEB 3HNSL 2MCG1 4DZBA 1A7RH 4RGNB 4M62H 4PJCE 3GM8A 4IDJL 5ANMA 3PWVB 1CS6A 1MWAA 5L2KB 3RAJL 1Q0XH 5EN2B 3QEHB 1ZHBA 1YEJL 4ZO6A 5FYLH 1Y6KR 1G6RA 3QXUA 4Z7WA 5I75B 4NPYB 1A5FH 3ARFD 1BZ7A 5I8CB 4POZC 1P4IH 4CW1A 1AO7E 4P3DB 3VD5A 3W9EA 4HGMA 4M6NL 2GAZA 4OZFH 4FRWA 4MB3A 4AM0A 1WJ3A 1NFDA 3MYJA 4YDJB 1HXMB 2LAGB 5EZJA 2ZUUA 3QQ4A 4EI5B 4M7ZC 3GSRA 1N4XL 1IE5A 3EO0A 1YNKH 4AIZA 1U8IA 3NCMA 3BP5A 5L88H 3KYKH 4K3GA 3B43A 1N4XH 5LAXA 4RAHA 5MERB 1P7QB 2OL3L 3T0EE 4HWEH 4RNRB 1KB9J 3WXVH 4RWYH 1ZLSL 4RGOL 1G9ML 1A3RH 3W0WD 3VGEA 4N8VA 4Q6YA 3HAEA 2E5EA 1CBVL 1FSKC 2UUDK 1LO2L 1SHMA 5D7KD 4PJDB 3O9WD 5ADPL 2CGRL 3VMPA 3JWOL 4JFXA 4WW1B 5EOCL 4IRSB 2E9BA 3N0PB 1BD2D 4HXBL 4YHMH 5JW4M 1KN4H 5EOCH 2OJZH 3C8KA 5ALBH 1KIRB 5T1MA 1MCHA 5D6DC 4X4YA 4OI7A 2PYED 3SDXA 2DM4A 5JZ7D 3MLYH 1J0KA 2YRPA 1NGWA 2NY3C 4O00A 5A2KH 5L8KB 1FLRL 1NCUA 5A2FA 4ESKA 1JUFB 2X7LA 2R56L 1EHLL 3BUYA 2EC9T 4PTTA 3ETBF 5KS9B 4I77H 1ZLSH 3W2DL 3INUH 4C56E 2BNQA 4P57A 4UUJB 3MGOA 3NZ8A 4OIAA 2O5ZL 1JI1A 1UADC 2CDFA 4ZSOB 3QR2A 1P7QD 1XGPA 4ONHA 1NAMH 3KYOB 4N0YL 1K85A 2OR9L 1RIHH 2OL3B 5DSCB 2VMFA 2HTKC 5F3BB 4XCEA 5DZNA 1D5XB 4ZTOL 1ORSB 3EOAA 4UDUA 5IHUL 2DN7A 4A6YL 4JJ5B 1VENA 3IDGB 4YHIA 1F4XH 5E94A 5B4MD 5HHNB 4B41A 5HDBE 2V5RA 3C5JB 1U3HA 2VLKA 5D7IB 5F1OB 3MBEC 4GW1A 5J9PA 5E56A 3QEQB 4GAGH 1JNNL 3O3BB 5EBWB 3NCJL 5I1DB 5TQ2L 4XCFH 3DV6A 2WP3T 2GW5A 3WDIA 5I1JL 4OCSH 4I0PA 2FX7L 4Y2DA 4ZODA 1CLZH 5L2JB 2AK4A 1PQZA 5GJTH 4NT6B 3QHFL 1A1OB 2DQTL 3UYOD 4JM2C 3IB4A 5D2LE 3CU7A 4DQOL 2I24N 3JVGC 4ODVH 3EYQD 4P99A 3C8DA 4YHYC 2WNGA 1FDLL 2ESVE 2PXYA 4X99A 1GGUA 4G6JH 5K9KB 4WFGE 3ZKNC 4G80A 3RI5K 3W0WB 3OGOE 1XR8A 4YXLL 1ZTXL 3QUYC 4Y5VC 1NGQL 3KLSA 3F7YA 2E3VA 2HVJA 3SE9L 5EZJB 1PZ5A 4CNIA 4PTUA 3H9YA 1BD2B 2BNRE 2CQVA 1AHWB 3JZ7A 3FT2A 4NQCD 4F7PA 1OY3B 4NJ9H 3KGRA 3X17A 4NNPL 4JHBA 2GCYA 4G43B 3CH1B 3MPCA 3RPIB 2D7MA 3TEUA 3MJ9L 3S34L 5HJ3A 4PLKC 3HMXL 1H8OA 3LEVL 4WEMB 3MV8E 3IDJA 3SKJH 3UYRL 4P59L 5LVEA 1S7TB 2O61B 3SN6N 5T3ZL 2QR0B 4ENED 3SPVA 4XXDB 4ZPVA 5CBEB 3OKYA 4U1MA 5BRZD 3V6BR 1OP9A 4D0DB 3G5YB 2EIEA 4QRRE 5E4EC 3EO0B 4MS8D 1EFXB 3T4AA 1MIMH 1MEXL 1JGUH 4XAKD 5MENB 1DVFA 3CZFA 2EKSB 3MUGB 3PHQB 4XBGA 2GSGA 3AGVA 3BEVA 3EOTH 4KROD 3I6KB 4PYHA 2AJVH 3B4NA 4DFHA 2Q6WB 2XWBA 4YXHH 1DBML 5CJBA 3T0EC 4HFUL 3LHPH 2IPTH 3C9NA 4YWGL 1F2QA 2PTTA 4D9RD 1Y6NR 4L3ED 5DRNA 2G60L 3THML 4PV8A 2R2HB 3L3DA 5HSFA 5IBLD 3OL2A 5DWUL 3PWPB 4AK1A 3HC0B 4B5EA 5FECA 1WTGT 2YN3A 4JZJC 2XT1B 4QHMA 3QPQC 5EPMB 2BY3A 3FN3A 3PL6D 3QA3B 1UWGH 3TZVB 4XVJL 1JGLH 2R0ZH 3GDBA 3SE8L 1T2XA 4IMLB 1RJLA 3MRLA 4NDMB 4XPFH 4U1LA 4RDQG 1OGAA 3FQNB 3ABZA 2NW3A 3ARPA 2OM5A 4PRHA 3EDKA 1PZ5B 4ISVB 4CNIB 4OAWB 5DJZA 5IMKA 5CZXC 2BRRH 3BXNB 3MRRB 5GRZA 3AY4C 4Q9CA 2BC4B 1P1ZB 1WK0A 5D8JL 5FM5M 2VDOL 1YEEL 1AGEA 2DD8H 1KYOK 4R3SA 4Z7UE 3VFPB 3DNKA 3HN3A 3KPPB 5IK3A 4G8GD 4TTDC 4HIIB 3ARBC 2AABL 3MA9L 3KPMA 1HH6A 1T1XB 4FNLH 3MC0A 5GGRA 5KG9A 5L0QC 3AROA 1TMCB 4NQVA 2VZOA 3D3VE 4ZSOA 5T1LA 1CE6B 3VXPB 4K71B 1CFVL 1AGFB 1AXSB 1GVIA 5C0JB 4OQTH 1XGTA 3QDMD 3WO4C 1IC4H 2DMCA 2VXTH 4DWHA 4PRNB 5KAQG 3UTQB 4W6XB 1QBLH 3QEUB 3QEQA 5F1NA 2CRYA 1NEZB 1OGTA 3IF1A 4DTGH 1Z6JT 2CLVB 3BP4B 1S7UB 4GAJH 5ADOL 1NLDH 1QNZH 1S7UA 4GRWH 1NFDF 3L5WB 4GW5B 2CH8A 4HAFA 2F19H 5DRZB 3EGSA 3GO1H 3OKOB 4HJGB 4U7KA 1IKNA 3Q6GL 2BMKA 5JTWA 1RJYB 3V0AC 4JRYE 2Q86A 5DHVA 3WFCL 2YWYA 1MREL 1BGXH 2E9IA 1HI6B 5SWSD 5T3ZH 1HI6A 2J88L 1J1PH 3B9KA 1IGFH 3DX8B 4NBXB 1OP5H 2HJLA 2OL3A 4GXUM 1N26A 3CX5K 4LFHD 4LF3A 3U7AA 5TE7H 1U2HA 3BAEL 1OAYH 5IR1A 3BH8A 1ZKAA 4BQBA 3EKCA 1QD0A 2DTMH 4KK9D 1FL5B 1TIUA 4DVBA 4HT1L 2FIRT 1B2WL 3I6LD 1SJHB 2W65B 1FORL 1YN6A 3HZMA 3FQUA 2EE2A 4J4PA 3UYPA 4QTIH 1BD2E 2BNRB 4LFHG 5IOPB 2YUVA 5DRXB 4R4FL 3ZO0A 4KTDL 2OXHA 3JWDL 5MEPA 3RY6A 2H8PA 1QFWL 3G6AA 4XHJC 3T1FB 1YQVH 2IWGA 3IAQA 5MHSD 2BVEA 3K4DA 4UBDC 2E27H 4TSCH 3VFVA 2IBGA 5KW9H 1PKOA 3T0VA 4GRLB 4YBQC 3BD3A 1ORSA 3I3BA 4ZAKA 4F7MA 2NZ9D 3UBXB 4WUKL 1HINH 5HHQA 4F2MA 4OFPA 5BCAA 2P45B 3H9SB 1J8KA 5C0CE 1OP3K 4JQIL 2VITB 2R2CA 4PRHD 2X4SB 4ELMA 2LU3A 5E1AB 2NY1C 4X98B 3MV01 3OMZA 4F7CB 3W82A 5KVEL 1ZGLA 5FYKU 1YEDB 4RFOH 1WAAE 4PLNC 4PGBA 1SJEA 3T77B 3OKMB 15C8L 4IM8A 2JCCE 4FFWC 5CILL 4Y4KB 4UB0L 4XCFL 2D3VA 3NCJH 1MCOL 3PIQB 2D7TL 1OWRM 4U6VL 2BNRD 3MACL 5D71L 3VWJB 2X70B 4XPGH 1EX0A 5GGSB 4NJ9L 5D5MF 5JW3L 3DETC 4EN3D 5CUSL 4XCYA 3NPSB 3K46A 1TITA 1QBML 3QRFM 2BHZA 4NFBA 4MAYA 2VYRE 1PKQE 4EUPG 1FFPA 3IJYB 4X6FB 3IDJB 4HJ0D 3HKFA 3N9GL 3DPBA 5EDXA 1EXUB 3ZE2F 3MV8B 4OGAD 5IHZB 2Y72A 4R4NC 3S37H 1SJXA 2PYEB 4JKLA 4WWID 1Y0LA 5FGBC 1KXQE 4WFGD 1WZMA 5CJ8A 5E03A 1F45A 3BSZH 5E9DA 4PRHB 5IWLC 4X8JB 3V4PH 3W81A 3WKML 4AEHL 3WIIL 5HTSA 3I02A 4FABH 4IMLA 3LS4H 1DQLH 2XV6B 3ZZ1A 4YFLF 1HWHB 1GSMA 3VFOA 3OG6B 4KRPD 2P43B 4P9HC 1DBAH 2Y6SD 3WNMA 3GSNH 3BEWA 1HWGB 3CLFL 3EDDA 4NHCH 4D9RE 1PGRB 3QEHA 4P2YA 1QTYT 1S7TA 2Q7NA 1T1YA 1DBBL 5D7JC 4DN4L 1CGSH 3RI5F 2WUBL 2HJFB 5C1MB 1UWXH 3O6MH 3KR3H 4NIKB 3ULVL 1JNNH 4PJ7F 2VISA 3QDJB 4EKXA 3ES6A 3OR7A 5C0IB 1F4YL 4X5WB 4S1QL 3GSUA 4PRDB 1E28B 4KJWC 4KQ3L 5DJCA 4TUJA 5FXCH 1INDH 1MJUH 4TUJB 3MLXL 3UCRA 4TNVF 2A0LC 4UV4L 2P5ED 2K7PA 3OG4B 5HVWA 3NFNB 4OB5H 4BSVB 2IQ9H 1PLGL 4PJFB 2ESVA 1PYWA 3JV4A 1AE6H 1J0IA 2VL4A 4NC1C 2R1YA 1XIWB 3DHJA 4Z7NE 3CMOL 2XFXB 3WIFA 1WWWX 1AE6L 1MSPA 5EC2A 1RSFA 3TNMB 4TULH 3S96B 4U1SA 4XVTH 1K4DB 5C08D 8CGTA 3Q5OA 1P1ZA 4R7NB 1ZT1B 1CGWA 2UWEE 4NRXA 3FFCE 4S1QH 2XWJB 5HGBB 1P4IL 2WUCL 4XVTL 4GKNB 2QADD 1RUKH 3ARDD 3R06B 2FHBA 2NPLX 4GW4B 3MO1A 1TQBB 3QQ9D 5BVJA 1CK0H 4R8WH 5SWSE 3IETA 2J8UE 5HGAA 5H35B 4U1LB 1KN4L 2FRGP 3H3PH 4RMVA 4P2RE 1A4KB 2H2SD 3QPXH 3UTSE 4XP6H 1E6OL 3AS1A 1IGJA 1KT2A 4DKFL 2CPCA 1YMME 2YMXH 5GRUL 3IDIB 1C5BH 4RFNB 2D7QA 2NLJB 5IP4A 2PNDA 4GRWE 3WJLC 2HRLA 4ZS6C 1GGTA 4KPHH 1KJ2L 2XXCB 3GMMB 5CGYC 3K1DA 5BXFA 1U3ZA 4AJ0A 5T3XH 4PV9A 1MHHB 4GBXD 4JFOB 3KYAA 1G9NC 1IBGH 1KCUL 1NLBL 1J1OH 4RFOL 2F9BT 3SDCC 5FUOH 4LCWE 4OZ4A 1S7XB 4QF1B 4OZIA 1I9RH 4TUKH 1WC7B 3I2CH 3TFKD 5F88A 5D2LF 3FN0L 4P2QE 4P4KC 2OLDA 3TA3C 3G5XB 1MCKA 4D94A 5E2VL 1RK0B 3P4MA 2Y07H 4H8WH 4DOHB 4KKLC 1I8IB 4PG2C 3V4PL 3WKMH 4X83A 2MHAA 1U91A 5CD3A 4UIKL 4QRTA 2YUWA 3VXRD 5J11B 4HKXA 1MF2L 3QWOB 4JJHA 3VU2A 2VR4A 2X89A 4A6YB 3H7LA 4LLWB 5AAMA 2YD7A 1B9ZA 2MKLC 5IW3A 7FABH 2ZUQC 4XCYB 1CFNA 4WHYG 3SOBH 3U7YL 4MJIE 1PKQB 3WLBB 1KJ2B 3E6HA 1WQVT 4R96B 3ZL4L 4O51A 1RUAH 5IB4B 3VH8A 1ZLVH 2NNAA 2ZCHH 4GRLA 4JQVA 2NXZB 2AJYL 4BFGA 1QPPA 3EOAB 3SDAC 4HC1H 2XTJE 4Z76A 2VB5A 5LBSL 2H9GA 5IF0A 3GJEA 2PCPA 2ADIB 5DRWA 1NDMA 4L3CB 2R0WL 4X7FC 4ZFOL 2LVCA 4QRPA 5IHLB 3PWUA 2YBRA 1NEUA 4TYUA 2AJSL 3L95A 3FOLA 2J6EL 3UO1L 4JE4B 3SEPA 5KANI 4MZ3A 1MCIA 3PDDA 1MI5A 3P11H 4TUOA 2I9LA 3QI9B 2FO4A 1QNZL 3PXHA 1LMKA 1JGEB 3LMJH 3FHAA 2ZJSH 1FFQA 2F5BH 5EIQA 2B20A 1AJ7H 1OQOA 1OGAE 5AEAA 4KJPC 2P47B 3MFGB 1UKQA 4XMLH 2Z35B 1N0LA 3PF2A 3BZFA 5L0QB 3PGDA 5KS9A 3SBWA 1JYVA 1U8QB 3PABA 4RX4D 4LPTA 4NO2A 3E3QE 1QSFE 4FFVD 3NIFE 1JPGB 5IESL 3ULUL 3H6JA 2HT3C 4M43L 1ZK9A 4NRYA 5AAWA 3A67H 1X5GA 3C8KB 2FLRT 5A16A 3QXDA 1VFBB 5F7YC 2KDGA 1WBXB 2R69H 2A77H 1QVOA 5JHLH 3Q6GH 1YEKL 4YDLB 2GJ6B 4QHKI 1B2WH 2W0KA 3HRZB 1UM4L 1A4KA 1OTTC 3WN5A 1I7RB 3VJ6B 4L4VA 2EH7L 4GG6E 4EUPB 2O5YH 2IAMA 1VFAB 5HI5D 1EV2E 1QSEA 4WU7A 4XBPA 2VNCA 5L6YH 1F4HA 1HNGA 4WHTA 1H15B 4QRUA 5DD5L 4F8QA 4V1DD 3IXAA 1LE9B 4NQEA 3UDWA 1C08B 1DE4B 1F58H 2GFBA 4LQFH 2CK0H 2G9HB 4QHNA 3RFZC 1YEFH 3A6CH 5D1ZA 1R3JA 3VW3H 3O0RH 1EO8L 2V17L 4HS8L 4AZ8A 4CDHA 3PNWA 4CMMB 1FP5A 4NUGH 2JCCA 1MJ8L 4G9DA 1A6UL 5I2IB 1UC6A 4P49A 5C0AD 4XPAL 1SY6L 5AD0B 5HYEA 1JHTA 1YEFL 3A6CL 1G7JA 5DA4A 3I3DA 4HXAL 3S98A 2AKRA 3WO3B 3BPNB 2WINB 2WWMD 4OZGA 1K3IA 1MNUL 4O2FA 3TCLA 4NNYA 4Y5XA 3IS1X 5DTFB 4HX1B 4UTBL 3ZSTA 1A9BB 2EIDA 4OF3A 4PJBB 5E2TH 3MRIA 4NZTL 5DA0B 3SQOL 4PB9H 5T3ZD 5JXAH 2XZAH 3UJJH 3QYCA 2BMKB 2YPLA 4WFFE 5CJOH 3KPPA 5GGUA 5MEOA 1V7NL 1A0QL 5AUMB 5ID1B 1XF4A 5GJSH 4R9HA 5D8JH 1X5IA 3R1GH 4WV1C 3QUYA 4G6AD 3G5XA 4NO5A 2IAMC 3DVGB 1J7VR 3NFNA 4JO3H 1MCCA 3GBLA 3GFUA 1A3LH 4CVZB 2ZUVA 4RAVB 2VTFA 4YDVA 2XWTA 4CVZA 4YWGH 1IAIM 3LKNA 1XIWA 4NN6C 5DJ8B 5I17B 4NO3A 5IIEB 3ZT7A 1JV5A 5BOZG 2ZG3A 3NCCB 4O02H 5CAYB 1GC1C 3EOTL 2WZPD 1TENA 2A73B 4LCYA 1SM3H 1FZKB 3ULSB 3H9ZA 1VEOA 4JG1L 5FO8B 1CTNA 2EE9A 4X6DA 1FVDA 3RY4A 5IB2A 2P42B 3VI3E 2AJUH 1LO3H 1I3RA 3CFCL 3PWPE 3THMH 4HUXB 1YMMA 3DECA 3ILQC 2RB8A 2O5XL 5T33H 2VLJD 5DC4B 5I75C 1HIML 5IEKA 1N6UA 2OR7A 1OW0C 2G75A 4TPRH 1UGNA 3LSOA 2C5DC 3BP6A 2JCCB 4HUUA 3ZSSA 2H45A 1ERNA 4PB0L 2A2QT 4G6JL 1LD9A 2GY7B 2DLEA 2ATPB 3MNVA 3RGHA 4K3JL 5KSUB 1OSPH 2B4CC 3DUSA 1FNAA 1FQ9C 3QEQE 1JVKA 3EZ8A 3GMRA 4QCIA 3W0WA 1R24B 3S36X 5GS0H 3BI9X 4M3JA 1CDBA 4DCQA 1GC1H 3SOBL 4GRMB 5FCUH 1UCTA 2PR4H 4PJAF 2OTWB 2YD4A 1NKRA 4LSQL 4MA3B 5TGBA 3T2OA 3TV3L 4TNWK 3MRFA 5FGCB 5IESH 3ULUH 5JOFA 2EEDA 2VDQL 2H2PD 2D7OA 2I60H 1MFNA 4HAGA 4F58H 5E8NA 4P2OC 3RZCC 5BJTB 2DS4A 4Z18A 3S35H 2XTLA 4XAWH 1VEMA 4DZBB 1K5NB 1UM6H 2B1HL 5B3JF 2HFFA 4U6TA 4Q0XH 4I4WA 4EDWL 4X80L 3VCLB 3GB7B 3V4VH 1BOYA 1AR2A 3MO1B 4AEFA 1BFSA 4YH6A 5A40E 3FN0H 2GTWB 1VFBA 2XZZA 3DRTB 4K8RH 2H26A 4ZUSB 5GISH 4U3XA 3ISWA 2R4RH 3HZMB 1BQUA 5E0QA 1NMCC 4O58L 3FB8B 4EI6A 4AL8H 4I77L 3W2DH 5J56B 1IFHH 2J8UA 4UNUA 3W39B 5E2JA 2P8PB 5C0BA 3TA3A 3S4SB 1V7MH 5HYJE 2R56H 4GMSL 3D1MC 5DUMH 4YJZL 1KC5H 2BSSA 1JRHL 1U6AH 4JRYB 4LAQH 4XVSL 5CEZL 1IAMA 1ZS8B 3TH2T 4KI5C 2A6IB 2J5LB 2NNAB 5E5UB 1MCLA 1H3WM 1ZWIB 1LO4H 1X6NA 4HUVA 4ZAKB 1WZ1H 4EDXA 2DAVA 1MRFL 2XQBL 5J3HD 3A6BH 2I26N 5B8CB 1T66D 3STLA 4QHNB 1EEUA 1S78C 5FM5O 3VXUA 3ARXA 5K59F 1VADB 4ZUUA 4XZUB 1IAOB 4LEOA 3DYMA 1UZ8A 1UXSA 1OAZL 5LQBL 1UZ8B 1NDGB 1U3HC 3MV11 5INDA 3CCHA 1U95B 4ZQKB 4JDZB 5BQ7A 1NGYB 5IUSA 2E7HA 4C57C 1RJLB 3MRLB 1CT8A 1SJHA 2KH2B 1IM9D 5B38B 1KJMB 2JB5L 3STBA 1MFEH 5EO9B 2JELH 4OD2A 4LK4A 2V9TA 4LMQE 3CUPA 4EUPA 4NNXB 5ISZA 2OR9H 1DN0A 5D1QD 3C60A 3MRJA 1DEDA 5FUCE 2AK4B 3IRPX 5DRZA 1HHKA 1CICA 1CG9A 3IDYC 3D0VA 4N8VB 1OGAD 5D7LE 1INDL 4Z7VF 5D96B 1E6JL 4WI2A 4ODUB 1OAZH 5LQBH 3O6FB 4MB5A 4NWUL 5FGCE 1JGDA 2DL2A 2YKLL 4KVCH 3TESA 4BKLB 1BWWA 4WU5B 1E6JH 5EU5B 4IRSA 4PJAA 4WEBL 5KVMC 4MLSA 1QOKA 2WAHA 3TO2A 5C0ND 4MNQD 4OLVL 3EO1B 4UDUB 1TTGA 2DRUA 3BE1L 3HNTH 5F1KC 3QQ3B 3GSNL 5DD6A 3RVUC 3AXLB 2P5EB 4XTRD 3AREB 2ZUWA 3QFDB 3BKYL 1RZ7L 1TCMA 4RNRA 4Z0XA 5I1GL 4MA3A 4PJDE 3U9PH 5I1HH 1CQKA 1OLLA 5B39B 4X5LA 3P4LA 3QXTA 4EVNA 1DLFL 4KJQD 2BFVH 3C08H 3FFDB 5DHXB 5ESQB 4DGYL 1FC1A 2BHYA 3I6GB 4QXTB 4YE4L 1LP9F 1UEYA 4O4YH 3W11D 1RZJL 3KXFE 1C16A 5J12B 1A8JH 1JK8B 4FN0A 5E6IC 1WFTA 2COQA 3DVGA 2DQEH 1HH9B 1WCBA 2JB5H 5FF6A 1Q0XL 1LP9B 5CP7A 5J57B 3MNVB 2Q20A 5ICZA 4JFXB 4OD3L 4WNQA 1G1YA 5KZCB 3GSXA 1E4JA 3TBVB 1X4YA 3LQAH 1ZLUH 1II4E 4MNQB 3O11B 4U3HA 3D5OF 4LHQB 4TVPL 4DJMA 3WFEH 1G7PA 1BREA 5D72H 1SEBA 3F58L 2R1YB 5I1KH 2IANB 3Q2CA 1CGXA 2R0KL 4V1DE 1IGMH 5EU7E 4LGSB 5EIVA 4I4WB 2AVGA 3MOBH 4ALAH 3C6LB 2MQ3A 3X13A 3N1PC 2X4OB 1J05A 4WFFD 4YGAB 1FFOB 1WC7A 5JMRA 4ZO9A 5D1QB 2BSTA 4KKNA 3JUYA 4G9DB 2VLME 4JEGB 5CWSB 3KLHC 4G8EB 2WSKA 3BOVA 3ZT6A 2AV1A 3QXAA 1HYSD 5I71B 2X1PA 2IBZY 1MWAH 1Y0LB 3IT8D 4KXZH 3HE7B 1F90L 2NR6C 2VDQH 4WWKA 3DVFA 1TFHA 1NBYB 3EO9H 5F7UA 3RWFA 1LK2A 5HYSB 5BXFB 3JXAA 1YC7A 5AWNH 1RMFH 3FOMB 3V95A 1QUNA 4MAUL 4MLIA 4U3CA 5T3ZE 1X3DA 4OZGE 2CSPA 3MRKB 4CN4A 1DSFL 1FNSH 1UM6L 2X4RA 3F7VB 3I6GA 2R9HC 2NYYD 4YHNB 1T89A 4JO4H 1ETZB 2G2RB 1XIWC 2EZ0D 3L9RB 1IGFL 1XF5A 1F97A 1RZ8A 4NRYB 5BZDB 5DT1L 2CLRB 3HC0A 5FECB 4K7PY 3ARRA 3RX8A 2IBBA 3O3AB 2DI9A 4NCDA 2MCPH 4C56A 4LCWB 3CFCH 3O8XC 5EWIH 1A0QH 1KBGL 3QDGE 5DHYA 4R7DB 3L7EB 3SGJA 4YLQT 3TNMA 4PJFA 3ZKXB 2P7TB 1JGVH 3VFNA 3I6KA 4OGAC 4Y4FA 4WO4C 5IB3A 4GQ9H 3G08B 3HR5A 5EFIB 2B5IB 1FO0B 5KZCD 1GHFH 4O9HL 4FXKB 2X2YA 1YNLL 2NY0D 5JHDD 1K4CA 1E0OB 1RHFA 2DYPA 3T0ED 2IH1A 3TIDA 2DI8A 1IC4L 5B39A 4YBLB 4JQVC 4NKQB 3WBDA 1CICB 2ZNXA 4UINH 2OQJA 3WJLA 4JFFA 2GSIA 1S9VA 5GZOC 2EC9U 3Q48A 4NQXB 3HZYA 1OM3H 1YMMD 4MJIB 1CE1L 5CZVH 4HC1A 5E6YA 5CJOL 3L5HA 4EN3B 4YBHA 2C3VA 3TZVC 4NQTA 1MI5D 1U8LB 32C2A 2E6JA 4GLRI 4MQTB 3UTTD 2YWZA 4MXVE 5MEPB 2GI7A 1FCGA 3E2HC 4Y16C 2DQCH 1FH5L 4O2EB 4C55A 3G9AB 2M26A 3ARFB 4LP4A 4NGHH 4PP1D 1BGXL 4XI5C 4Y4HB 5K93A 5IMMB 5C0GA 3RBGA 2EH7H 1FE8L 4OZIF 1MRCH 4C83A 4TSBH 1J11A 3NCBB 4PJHA 1A1MA 3BJLA 4GMTL 2GJZB 2R0ZL 1P4LB 3OKLB 5ICYB 1RK1B 3LZFH 4ZMAT 1UWGL 4WUUE 3MRBA 5F9OL 5KANG 1A2YA 5HHOE 3SGDI 5CLTA 5DD3L 3K3QA 5BMFH 4HBCH 1TZIB 3KHOA 3HUJF 2PF6A 5DFVD 2ITDB 3QUZD 3S97C 3S88H 4YDIH 4YDKH 4QT5B 4WWKC 1FLTX 1KULA 4GAFB 3MUHL 2HJLB 5BO1L 5DD5H 1GPOL 3MMEB 4OBRA 5JO5B 4QYOA 4PJ9C 4YDKL 4N8CH 4AG4L 3EO1A 2ARJB 4HUWB 5FK9B 2PYEE 1S9YA 5DEZA 3DYPA 1XMWA 4LOUD 2YD6A 2PW1B 3B83A 1I1YB 1D6EB 1MI5B 4YK4C 4HIIA 3DWTA 4M7KL 4HJ0C 1V5JA 2J12B 4DUXA 1U8KB 4MHHI 1BHGA 1EAPA 2YEZA 4LKXA 3UBXA 3OXRA 5HI3D 4PRAA 4EQ2A 2A83B 4OCWL 5L6YL 2VITA 1M1SA 2DQDL 5LBSH 3FRUB 5F3BA 1U92B 5KSUA 4QRQA 5I1CH 3KPRD 3KXFB 3WUWA 3KXFA 1KV3A 4R2GD 3P4MB 4KDTC 1F42A 3HFML 1X5AA 3FOLB 1HXMA 1UJ3B 3WIHL 3U6RA 2MWCA 1W72A 1PEZA 2WV3A 3MR9A 3G9VA 5C0AB 2V2XB 2YUZA 2IFFL 3HA0A 5JW4N 3O3UN 4HJGA 1FG2A 3VWKB 4W81A 2C3WA 3NACH 1X6LA 4LLWA 4Z7QE 2V2TB 3ULUF 2A1WH 3S5LA 3LS5L 3ZDYE 4YXLH 1U42A 3L5IA 2BVQB 2IPKB 3QSKB 4O51B 4ZOBA 4A2LA 1ZV5A 3RDTB 5GXBB 2X5PA 4X7CC 3ZTNH 2D0FA 1KG0A 3L3IA 3TO4D 1N0XH 3P0GB 4M6ML 4YHNA 4DK6A 1EK3A 3GK8L 2H6PB 1KJVB 5CIPH 1Q0YL 1KBGH 2HKFH 3MJ9A 3TT3H 1A7OL 1NMCB 2IADA 1HYRC 2NY1D 2YXFA 3FKUS 4O5LH 1NLBH 4JDTL 4CBPA 3X3FH 3O4OC 1BIIB 1NGWB 4ONOA 3EYSL 5DO2D 2X4PA 3UYRH 2NMSA 2R2EB 4OT1H 4PPTA 3MLPA 5ERWB 1TVDA 2JKXA 1AIFB 3WFDH 3S5LG 3OZ9L 2E7CA 3EJYD 2P46B 4U1SB 1LDPH 2F53E 3OWEA 3LVEA 3PHOB 4HK3J 3BT2L 1GRWA 2PYFB 1FRGL 2KQNA 5GRUH 4NZDA 4D3CL 3HUJE 1R0AL 3CFJB 2FL5A 3SDYL 4N5ED 1HH6B 1RZGB 2HFGH 2VWEC 5ESVB 2GK0A 4L4TA 3RU8L 1EIBA 4GRLD 2DQIL 4NJAL 5B3JE 4M1GL 2APWA 3BGFB 1CK0L 3HMWH 5BV7C 1I7ZB 4JHWH 4JO1H 4X9FA 5CBEA 4Y1AB 3KPQB 3B9AA 3HUJB 4HCRA 5I74B 1JZ5A 1XGUB 3SKOB 3ROLA 3IDIA 4LCCA 1YEIH 4GG8A 2AKRB 4QOKD 5FYJU 1OARL 2A74B 5MENA 4HEPG 3GIVA 1N6QL 2I5YL 1KIPA 3MLYL 3UTTE 3ZDZE 4LCIH 3VFUB 3BWAB 4S1RH 3MREB 4QHLA 4P0DA 35C8L 1DUZA 5GIRA 4YXKL 5E08H 5GJTL 2VLLA 1NC4B 3BFOA 1EFXD 5BOPA 4PRIA 2GUOB 5C07A 3P9LB 5LWYH 1MJUL 4G8GE 3HTLX 2PXYB 4WY7H 3O3AA 4X99B 6FABL 1QSED 3MLZH 5BV7H 3GSNB 2Y5TA 1P84J 3D3VA 4ZSOE 1AFVL 1PDKA 1X4XA 3VD7A 5FO9B 3KR3L 5DYOB 1OAKL 5HHPA 2A73A 2XWTB 5F72S 3QDME 3QG7H 4JFDE 4Y5YC 3IU3B 4FQCH 3VXMA 5B38A 1DBJH 1XR9B 4ZNCD 5I0DA 4IDLA 1I9EA 2XOTA 4QXGH 1A7QL 2NY3B 4OM1L 1URLA 4Q6IC 3S3PA 2VXUH 3IJSA 1REIA 4N0YH 4GW1B 2ZUTA 5J9PB 5DMGC 4O4YL 1TZHA 2NXYB 4JFYA 1ZANL 4RBPK 4XNZC 1QHOA 1S7QB 3STZB 1J10A 3DUUB 4FQIL 4NCC1 3NPSC 3D25A 5ACZB 1IC5H 2H41A 5HDLA 1F00I 5IFHL 4JRYD 3UROR 1OAUL 3O6FA 4K7PX 2O61A 3MXWH 2IPUG 4ZAKD 4DN4H 3PDGA 1XGQB 1BF8A 4MXQC 4LLYA 1S3KH 1NGZB 4YHLL 1J8HA 1PYWB 4JN2A 1EEZB 1SMOA 1NGZA 1IC7L 2H6PA 4R6UA 4E41A 4IJ3B 4X9IA 5AZ2H 1I3GL 4G6AC 1B0GA 3P30H 4NN5C 4ONFL 2XPGA 1A1NB 3BDXA 2P5EA 1N2RB 5IVXB 3LRSA 4NUJB 4JDZA 3OKDA 4L4JA 2BX5A 2IALA 1HK6A 2DWEA 3CC5B 3O45B 1ZVHA 4PY8J 2QQKH 3KG5A 4FFVC 4W70A 4UILL 5JNYA 3S6CA 4FQQB 3QP3A 4CU6A 2YZ1A 1V8HA 3BZFB 3S35X 1RHHB 4HWEL 2NY5C 3EYFB 5IGXL 3CFDA 3DSFL 5F7HA 1NSNH 1Q9LB 1T20B 4LDOB 4NJAH 3TGXA 3KYOA 1LEIB 2ZCKH 4QTHB 3TBYB 4CU8A 4HIHA 3K2UH 1Q38A 3GJFK 2Y6SC 3RKPA 5HHOD 4MA7L 4HH8A 2VIRA 3KPOA 3F6LA 1NANI 3ILQD 1XT5A 4Z7VB 2CUHA 3WIIH 3D0LB 2ORBL 3HG1A 4XMKH 3BT2H 4FQXD 2AXJA 4L8SC 5D7JD 3BIKB 4RCAA 2JJTC 4KKLD 2QQLH 4U6XA 3DXAA 3I85A 4KZEL 5HYJD 2GY5A 1D6EA 2DJSA 2XZCH 3C5JA 1MCOH 1NC2A 3OX8A 1RUMH 1MHHA 3LD8B 3F12B 5H2BB 4I3GA 3BGMA 2P5WE 5IMMA 3PWJB 4XCNB 3G6AB 1ZLWH 1PVHA 3IF1B 3NZHH 1Q94B 3TJEH 3G6JE 2E7BA 3QFJA 4K71C 2RAMA 1HSBA 1QRNA 2Y5EA 1BX2B 1ORQA 4RDQF 3GKWH 3LKPA 4L1DA 1JGEA 4JFDA 2HFFB 1JJUA 3D85B 2E7LA 1JRHH 1U6AL 4MA1C 4IHOA 3EIFA 1CE6A 4WI6A 5FO7A 3SY0B 2JJWA 4POUB 5TE7L 2Y06H 3O4LB 4F9PA 4LHUG 4WU5A 5SV4A 3WXWL 4LLMB 4H20L 1FL6A 4JPWL 5DS8B 2ADGB 2Y5TB 3RWDB 1TXKA 3UZQA 3PWUB 4Y4HD 1JFQH 4KTEH 4Y4FD 3CD4A 1YDPA 5C08A 1NL0L 5L9DL 3QIWC 1NMBL 3T65B 2F74B 5FOJA 4ZFZA 2F19L 1TJHH 5MI0C 3RIFF 4KI5E 5IVZB 4M6MH 4WFED 3WE6B 2IGFL 3DVNA 4G5ZL 3B2VH 5ADOH 4PD4K 3WEXA 5JDSB 4PYGA 2DICA 4XB7A 3BXNA 3CVHA 2R0LL 2Z0BA 2FH6A 3NA4A 1G7LA 3CLEL 4YHZL 2CMRL 4LSSL 4X7TA 1EBAA 1RD6A 1A02N 3U0PB 1FL3A 5I8KL 4H1LH 5CIPA 5CGYD 2WW8A 5DI8A 1RFDL 1KUMA 1BZ7B 5DD0H 3PQYA 2MPAH 4HDIA 5SX5K 2CK2A 2GTZA 3QUMH 3ULUD 5JQ6L 4OCXH 5L7XH 3MRPB 5GS0L 1KT2B 4BK4A 5DYOA 2RBLA 3HUJA 1WISA 1G7IB 1CTOA 4HT1H 2APBA 4IIQB 3QIBA 1RIUL 3BGFC 4XC3L 3OXSB 2GK2A 2BC4A 4PB0H 1DANU 3TPUA 3MRDA 1AQDB 4PJHF 3H7BA 4N8CL 3IAGC 5DLML 4F37F 3H7BB 4PJEA 1WICA 5CINH 1RZIB 1Z3GL 1G0DA 5IROC 3ZKQD 4EXPX 2VR5A 1EEQA 4LNRB 1CLYL 5E9DD 4KHXL 2R1WA 1HHIA 4YDIL 2APXA 5F8RC 3SE8H 4Q9BA 1X5XA 3MXVH 4YFLI 4HULB 4M7KH 5KSAB 4PGJA 4K2UL 4PJFE 5CJQL 3IAPA 4HWNA 1H0DB 2J5LC 3RWIB 5F9OH 2N1KA 4Y4KD 3O0RL 3C5ZB 1IAKB 5TDOB 3FFCA 3FMGL 1L7IH 4MAYB 2EE3A 2H2PC 2XNAB 3NTCH 4LARL 1CLOL 1YEEH 2VZ1A 1C5CH 1FE8H 1UB6A 5C0FA 2J4WL 4WI3A 5B8CC 4IS6B 4NDMA 1Z3GH 1OPGL 1FH5H 1DBMH 3HRZA 4DK3A 3S88L 4M6OH 4BZ2H 5E8EA 5IEHA 1FYTE 1WLHA 3E2HB 4GKSA 3X13B 3VD3A 4Y4FB 3G5ZB 5JR1L 1XF4B 4L9LB 1JF1B 1JGUL 3QDMA 3RVUD 1T21B 2OZ4H 1INEH 1KLFA 3WLWC 4R90H 5DK3A 1SBSH 4M5YL 5DURB 2DD8L 2GFBB 2DI7A 1IAII 4BFIB 1FYTB 12E8L 5C09E 4TVSa 2VDKL 1RZKL 5E1AA 4X6BB 1GZQB 3TIEB 3DUSB 3R8BB 5IB5B 3VRJB 3F6IA 1ZA3A 3AMKA 4NQSA 3HPJA 2CIIB 3HMXH 4HUUB 2MFNA 5J8OA 1C5CL 4OQTA 2CMRH 1T5WA 1AI1L 2W9DH 5DTFA 3OR7B 5TDNB 2PO6D 4OTXH 4AQOA 1NC4D 2C7UB 4Z7NF 4JKPL 5C92A 2P8LA 2ZJSL 2VKWA 4L8BB 2AAVA 1G7PB 1XCQA 5F9AC 1WWCA 1NFIB 4LPVA 3O8XA 5D5MB 1OF2B 1R3KB 5HYQA 3EBAA 5MP6L 2W07A 3PL6A 2PTTB 1N3NB 3KS0J 3FRPA 4HIXH 4W4OA 2BY1A 3PGDB 3U4EA 1KF9B 4CKVX 4YXHL 3DROA 5CCKH 1ACZA 3QT2A 2W92A 5C3TA 4GQ9L 1FL3B 5KAQF 1IQWH 4IMKC 1VPOH 2LU4A 2OYPA 5DJYA 4CJ0A 2NXYD 1MIML 4UU9A 4MSWB 4OLWL 4ZFFB 3LD8C 4MXWH 1QVOB 4HKBB 3RA7L 4OUOA 2ED7A 2P8PA 4H88H 4LBEB 4NKMB 5JIHA 1OAXL 1MJ7H 1T22A 1YY9D 3ARGB 4X7EC 4M00A 3KLHD 4M3KB 2QADB 1RFDH 3TN0D 5F3HA 1UH2A 4G7VL 4KZDL 3CPLA 4MB4A 2JJSC 1L4IA 5LJYH 1S9YB 4WHTB 4Y4HA 4X7DC 1BZ9B 3CLEH 4YHZH 1FO0A 5IROA 4LPCA 2VQTA 3E6HB 3GB7A 3HB3D 4ELME 5EUOA 4XX1G 5FM8A 5D6CA 1T1ZB 5IW1A 5F7NC 3ARUA 2HFEA 4Z5RB 2HFEB 4JN1H 1PY4A 3AS3A 3MLVH 4XT1C 3VXPA 2J3SA 2EDKA 2IAND 4X9GA 4MHHG 2IG2H 4WHCA 3EYVA 2APTA 3LKSA 1KPUA 2WMPA 4I13B 4L3CA 4YPJA 1ZOXA 1MWAL 4OBSA 5HDQL 4JRXB 3V0WH 3V9FA 4QLRA 3PWJA 4KY1L 3CGTA 1U2CA 1H8NA 5F7EH 1QLEH 1G7QA 4KMQA 1CFBA 2V5MA 3CC5A 3O45A 1KJ2H 1MFDH 1FDLH 4U1JA 5HYQB 1QFWI 3CX2A 2XA8L 3QJHB 3KDMA 4HUVB 1PG7X 1L0XA 5IVXE 3TN0B 3FQTB 4A6YH 2NY4D 4G6ML 5FUZL 1KCRH 3HG1E 1R5WB 1T7XA 4B53A 5L2JA 5IEKB 4L8SB 4LRNH 5KVDL 3UJTH 4BSWB 5H37G 5FHAL 4ZUUB 4G9FB 3WLBA 4MQXC 5EO0A 5D72L 5ADPH 1RUML 1S9VB 3NAAL 5B4MC 1EH9A 5D2NA 4X6BA 4OM0L 1KTDB 3RWJA 5IMLA 2VAAA 4QY8B 3CK0L 2GJJA 3IDGA 4WDIA 5E8EB 1BM3L 1T2QL 1XFPA 5FA4A 5GZOD 3RTQC 1JNHA 4ZTOH 4PG2A 1LO5A 1DN0B 1UKTA 1ZWIA 4ELKA 4PP2A 1RURL 1NSNL 4ONGL 2ZSWA 3TYFA 3IDMA 3D18B 4AIOA 2OR8A 4QF1A 5EUKB 3CJJA 2QV2A 4MCYA 3VXNA 1YC8A 3EYUL 3RL1A 5I8OH 3INUL 4LSUH 2XKNB 4Y16D 1TTUA 5KVGL 2FD6L 1AFVH 1GIGL 2NY4B 4MZ2A 4D0CB 5C71A 3VFMA 3TWCH 2EECA 2QQQA 2VDMH 1AD0A 5MI0B 3IU4L 3W9DA 2IBZX 4G9FD 1VGEL 3GMRB 1UYWL 2UWEA 4RA3A 3DO7B 1QRKA 3TJHD 4XP6L 1NFDE 5GZNC 4OSUH 2N7AA 4PRPA 3CVHH 1VGEH 4HJJL 4RGMC 1FNGB 3LV3A 3TWCL 4HHAB 4KKAC 4OF5A 5GGTL 2LVEA 2VZUA 2ZNWA 1XIWD 1CBVH 4HKJA 3L6FB 4AEHH 2EDQA 4MQ7A 4XRCB 4LSUL 1CGVA 3QUKB 3RGVD 4XNQB 4HWZA 1YUHA 5T1KB 5FOBB 3GSNA 1IAKA 3LKQB 3BKCH 3O8XD 1QSFD 3HMWL 4OQ1A 1FYTA 3V7MA 3UPCA 3W11C 3IVKA 4HKZA 1YEJH 4MMZC 2GTWA 3DRTA 4OZGF 5F1SA 4FQCL 1KJVA 5BVPL 4FQJH 2DDQH 3B9DA 3GSXB 5GRYA 3VXSB 1TVHA 4AMKH 4TVPD 3I9GH 1NC2D 3HPJB 4N0UE 4IRZH 2ICWJ 4XPTH 5FV1L 5E9DB 5GSRA 3WS3B 1LK3L 4G8GB 4M62L 5K9OA 4IIQA 3VXOB 1H3XA 1MFDL 5KN5A 4NP4H 1ND0B 2IANA 3UAJD 2WUBH 2R2EA 4MJ5A 2KZ1B 5HHOA 4AL8L 3JTTB 2V2TA 3N1MC 5I8OL 4FTVD 5IMOB 3O3EB 4P5MB 5E9DE 2XWBB 1QBBA 1I7UB 4M1DH 3VWKC 4I48A 4PG9B 5K9JL 2F53A 2EKJA 1KTLA 1DBAL 1ETZA 3QPQD 5I1AB 4PY7B 4IHOB 4EXKA 1QLFB 4LLUB 5FF6B 2GT9B 3PWLB 3GK8H 3VI4E 1QFUL 3S36L 4KMTH 5IG7B 5D6CB 2WBWB 1OARH 3NIGE 4M61B 4GLRH 1QSFB 3BX7C 4ZNEA 4Y19D 5F7EL 1NDGA 3OKEA 5D2NC 5DVNA 1XR8B 1P5UA 4M9PA 5IFJA 1TQCC 1W0VA 1Y18A 2DLFL 2LQRA 5ENWA 1G9NL 5IQ7H 1A21A 5F96H 1DTUA 5EBMA 3SQBA 5F9WB 1NGXB 5IJKC 1J0HA 3QXWA 5J13C 5E2WL 3ARGA 3QI9C 1JUFA 2J2ZA 4FP8H 4WCYL 1FZMA 1AQKH 5F1IB 1QBMH 4G42B 2G9HA 2ZPKL 2IAMB 3NABL 4OJFL 1IC1A 1I8KA 4EVNB 3BVNA 1H15A 1QPXA 4QRUB 1FVEB 1HDMB 2IMMA 4YEFA 5D1QA 1AHWC 2DQHH 3FO0L 3C5ZD 5EUKA 2X42A 4ZXBB 2ENYA 1B4JL 3QO1A 1S7SB 2WANA 2NYYC 1FFOA 4BFEA 4F58L 4JY6A 3O4LA 4N5UA 2HLAB 2DTSA 4N1CA 1AGBA 4P5TC 5EC1B 4G7YL 3H9HB 1MCRA 2PYEA 3X11B 2WQ8A 1N5AA 3TBYA 1QSZA 2FATH 4KK6D 3CXHJ 5DRXA 1I9IL 3OKNA 2XQYG 2FIKB 4LLQB 2X1QA 2SEBB 3CFEB 3UJIH 1U93A 3OX8B 4MXWL 4X98A 3GMQA 1KCVL 1S7VB 1MCPL 5FFLA 2D03L 2CXGA 5JXEA 4XCNA 2X1OA 3LRSB 4NUJA 4HGKC 4PJEF 5DURD 4P2QA 1X5LA 4DTGL 2I9LB 1P6AB 2NY2C 5HGGS 3RL1B 1HEZA 2BNQB 1P4BL 3P9MA 4M7JL 1C12B 3OAUH 3AS0A 3P9MB 2HFTA 2Q86B 5HYIA 4BK5A 3FT3B 3ILPB 1LO0H 1JZ2A 3SY0A 4OZIB 1MFCH 4OF7A 1QFWH 3DV4B 4Z7VE 5DMYA 1F02I 2BXZA 3ELAT 3HZVA 1P69B 3G6DH 2PO6B 12E8H 5MEQA 4XZUA 1N5YH 5A3ID 1A2YB 4X7SH 3BPCA 4OLYH 1F2XK 3D85D 3VFSB 4F3FA 2FLBT 5AZEL 1FJ1A 5IFJB 1DZBA 1D9KC 3HFMH 1DQTA 1ZE3C 5EBMB 1MRCL 5JNYB 3V7AG 4W6WB 1N64L 3ARQA 3ARFA 4LSTH 3VWJA 2H1PL 4UBDD 1P5VA 2IALB 4GS7C 4JPKH 4ZUVA 4A6YA 5D1ZD 3MX0A 1MCJA 4LAJH 4JKWA 3DMMC 3G5VA 1C8PA 1IEHA 3C87A 2YPVH 5FYLD 1ZGLP 2R15A 2VZ3A 1CCZA 5CZVL 5DMKB 2JJTA 4JANB 2A6JB 1WBZB 4APQA 4NQXA 4X7SL 5KG9B 2V7HB 5INCB 4Z76B 1NLDL 1Q9LA 1T20A 5LXGL 4OFYD 4PRPE 3F7QA 4FXGA 5DWUH 1MFCL 1Q1JH 2H9GB 3ZDZF 4M8QA 1VHPA 4XNUL 1FZJA 3BKMH 3MLWL 3U79A 3JUZA 4PJ8D 3QIBD 2B4CH 4QCIB 2VL5A 1Q1JL 4MCZB 4O2EA 4OZHE 5DHYB 3WN5C 4WTXA 4MD5B 1NFDB 3MYJB 1IGYB 1TPXB 1Z5LA 1FSKB 3GHBL 5J6GB 1GGCL 3UC0H 3H9SE 3VDBA 1MHCA 4XPBL 2PXYC 4FNLL 5IJVA 3QI9A 1K5NA 1UM4H 3EGSB 2VXQH 4JZOA 1JF1A 4NYLB 1DEEB 3MXVL 3OKKB 4BJLA 4Z7OE 4MQ7B 2XG4A 2HJFA 1F58L 4LQFL 2AXGA 3B5HA 4GKOA 4YQXL 2FEEI 4Y1AD 2F8XC 5HY9B 3CSBA 1MFBH 4J3UA 5CINL 5DD0L 3O6KL 3QNXB 1LHZA 4K9EH 4RRPG 2BERA 2C3HA 5DDHA 4XH2A 5E8PA 4BUGA 1RUQL 5FYJE 1WZLA 1DVFD 2L0DA 4X0KA 2HG5B 3QG6B 5CP7B 1BQHA 5A2JH 5I17A 4GQPH 1UACH 5I76B 1FVCB 4K3HA 3B2VL 4CN6A 2A74A 1OM3L 4X8JA 3X12A 4HWBH 4WFEE 2P7TA 3A67L 3UZVB 3VFNB 3QIBB 4WCYH 4LSRL 5GGQH 5DJ6B 3CDFA 2JJVA 5SWSA 3O6FD 1YJDL 4KUZH 1PG7W 3MNZB 2L4OA 3MRMA 3VGBA 1JFQL 3IXAB 5T5FH 3E3QC 3VXNB 2FECI 3VRIA 3IFLL 4NZUH 3QJFB 3PWPA 4K9EC 1WF5A 3MJGX 1ZVSA 5GGSY 3WUZA 1U8OB 4KDWA 4K55A 5K9QI 2GT9A 3ULUE 2EH8L 4EEEA 5IVXF 3BQUC 4PLJD 1IEBA 3L7FA 3TZVA 1KCVH 3BD4A 4HK0A 3RVVC 1W0WA 2DKUA 1JK8A 2YUXA 4DGIL 5GS0C 3MOBL 3VRJA 1DVFB 3CZFB 1T7YA 4K94L 5I8EB 1A6PA 1MI5E 4R0LB 4FA8A 1XGRA 5F71A 1XF2A 5DT1H 3DMMA 4EI5C 1DP0A 1JCKA 3RWFB 3EFFA 4JGUA 1R5IB 4GG8B 5TJWK 5DO2C 1D5ZA 2X9WA 2WBJD 5ILTL 4LSSH 3A0OA 3O11A 1YYMH 1S9XB 4CMHC 2DQHL 1XH3B 2DKSA 3B3IB 3QDGA 3N85L 3ZYOA 5BZWA 3ZL4H 1UWXK 3QUKA 3K0WA 2J6EA 1AGCA 5DQDH 2E7MA 5ACMA 5DJAB 1KENL 1KN2L 3LEXB 1AXTH 4ZFOA 1HE7A 3G04A 2BOBA 1RY7B 3WFBH 2BCKB 5DQ9B 1I4FA 4L8CB 4HDIB 4X6DF 4H5SB 3SKOA 3EOBA 4TSAH 1GL4B 2QR0A 1VSCA 4ODXB 1S5IH 2GJ6A 1H5BA 4V2BA 2WLYA 1QZ1A 5BS0D 5HHNA 3VFSA 4F3FB 3SO3B 2AERT 3L1OL 1G7QB 1LILA 1BFTA 2P44B 3PE9A 4Y8DC 4ODSH 5IBTL 1PZUB 1CDYA 1E4KC 2VXSH 5I1GH 3QZWB 1QFUH 3Q5TA 4XBPB 4RX4A 5J7CC 3D18A 1PKQA 4JFFD 3QXVA 1IQDA 2VE6A 4P2RB 4IRJA 5D9SB 4NOFA 2MQCA 5C6TL 1ZAGA 4FZEL 3K8LA 3V6OA 4B7LA 3QPXL 4WTWA 1C1EL 4I0PC 3WHXA 4LEXH 4F57H 4PRBA 2X4TB 1JZ4A 1JWUA 2EDRA 3BN3B 3HCVA 1Q8MA 4PJAB 4WJ5A 3EYOA 1HOCB 5EU3A 2XZCL 3FQWA 5CEYA 2ADIA 4KPHL 2XTJD 3QNXA 1ROWA 3O3DA 2FD6H 1KPUB 1NQBA 1JTOA 3U7WL 1G9EA 5C2UB 2HRPH 4JGMA 5JW5A 1F4XL 4QY8A 2Z31C 4RWYL 2VN7A 4MSWA 5ENWB 3IKCB 2VABA 3REVA 4DKFH 3LKOA 2OL3H 4P4RB 1CF8H 1J9CT 2EDXA 2FJGA 3BJ91 2YK1L 3MA7B 5I1LA 1S3KL 4ODTL 5IM7B 3UTQA 3TBVA 1RURH 5GS3A 3CMOH 1ACYH 2D0GA 3DSFH 1BD2A 1IGYA 5D7IF 2D31B 2NXZC 1CF8L 1IEAB 3ARWA 4JO2H 1T7ZA 2Z8SA 2OBGA 5E99H 5GHWL 2C26A 2GJ6D 3U7WH 3PXJA 1LQSR 4UILH 2BRQA 1HCFX 3F5WA 5B38G 5DUPL 2HTLD 4Y4HC 2BNUA 4XP4H 3O6ML 1YNTB 3M17B 5C0CD 3BH8B 3X3GL 1NJ9A 5INCA 1EXUA 5TH2B 4Z7OF 5LWYL 4BSWA 3RJDA 1QO3B 4ZUSA 3D87B 3WLWD 4QRTB 4E41B 4MJ6A 5E4IA 3P77A 5IT2H 2YK1H 4U6XB 5HVHC 3GEWB 4YDJA 1MY5A 3ORJA 2DIBA 1WUNT 3IU4H 3QDGD 3NGBB 3RL2B 1Y6MR 4KQ3H 2EDBA 5D2NE 3KPRA 1A7PH 4JREC 4MD5A 2ZOKB 1ZLWK 1SQ2N 4QHUA 1DJSA 5IFHH 3SE4A 5LGJB 1YJDC 3ARED 4L4TD 4ORZC 3Q6FB 1A7BA 1I7UA 4A2MA 4RGNC 1ZANH 3O2VH 1KXVC 5E08L 3HAEH 2R2HA 1G6RB 1IEBB 3R4DA 4PY8I 2C1OB 4U0RC 3KPRE 1IT9L 4ZFOB 2R1XB 4OCYH 1JHKH 3FCTA 4F2MB 1J5OH 5IBUG 3P3YA 3PWNB 1XGTB 1OTTD 2BJML 3O6LL 3MBXH 3ZE0F 2ITDA 3FONA 3S37X 2IC2A 3PQYE 3NA9L 4E41D 5ANME 2RFXA 4U6VH 3PG2A 2CDEA 3HR5B 3JV6A 3LH2H 1CDCA 5GGVH 1RJYA 1CDJA 3MROB 1H3VA 4UOW0 3VFRB 3QDGB 3SJVA 3S96A 5GGUB 3EYFA 4Q9RL 1A9EA 2FGZA 3QZWA 5KTEH 4XNQA 3NMEA 1XAUA 2EIZB 5IKCA 3HI5H 4NKIL 5DQDL 4YHOL 1FRGH 4P3CL 3HI1A 3LN4A 1SYSB 4MA8L 5D6DA 2Y7QA 1A7RL 4M4RA 1QLFA 2XA8H 1QSEE 2ADJB 2ZOLB 4NM8L 4OZFG 1R6VA 1FL5A 3WFDL 5HGAB 1EA9C 3FB6A 4NC2B 2BVTA 4U0RB 5F7WC 1X5JA 2XNAA 4NPYA 1OQXA 4U31A 4JN2B 1ULVA 5HDQH 3WFHB 3TNNA 1BBDL 3IDYB 3BISA 3MSPA 4Y89A 1U9KA 2VAJA 5D70H 1ED3A 4ORGA 1R3HA 3TO4B 2AEPL 3WYRA 3DIFA 1EFQA 1PAMA 2EXYD 2W1NA 3GGWB 5A2IH 5MERA 3GGWA 2EH8H 2D9QB 1XGYH 3O4LE 1SY6A 4LCYB 4Z9KB 4BELD 4ETYA 5B22A 2AS5M 3AY4A 4P48A 4XWOD 3NBNA 2G75B 1NBQA 3MRDB 5F93C 3V79C 4Y1AE 3K80A 2WIIB 3MUY1 3H42H 2KKQA 1JYNA 4YUEL 3L5JA 1YQVL 2DQDH 4XH2B 5E8PB 3NACL 4X5WA 2DLHA 4QO1A 4BH8A 5DJXB 4D9LH 1A14L 3VG0L 5DJ2B 1NJ9B 3B9KC 2E8ZA 1GC1L 3MQIA 4GOSA 4CDGC 4ZFZB 2ADGA 3ULUC 4LASL 1CL7H 1EJOH 5I6XB 2HA1A 3DARA 2AEWA 3T04D 4GKSB 3UC0L 3U48A 4BQCA 3SDDB 1BQHG 3SGKA 4I2XA 5EUOE 5CCKL 4K7FB 5H94A 4UT6L 2Z4QB 1DR9A 4K9EL 3NIGF 2HAZA 4LLAA 4UT7H 5C6WH 2HVJB 1J1XL 3VFVB 3LS5H 1BX2A 3FZUD 1AHWA 2DMBA 4GW4A 3VMOA 4LCUA 1TJIL 2MOVA 3MV7D 2I07B 4U2ZA 1VA9A 1GAFL 4P2QD 4TOYH 1D5IL 5FYKL 2BXYA 4GUPB 5I1AA 5BMFL 2E9WA 4UDTB 3OJMB 2AK4D 1ZEAH 4ELMB 5M95B 5FYJL 5DS8A 4PJXE 3V6OE 2AV1B 3QXAB 3VMNA 5CLWA 3ALPA 4LLDB 3WO4B 4X4MA 5JW4Q 5B3NA 5D2LB 1RZFL 4RIRA 3BKML 2D7PA 2ZSVB 2H32B 5KSBA 3JWOC 4HMCA 7CGTA 4JM4L 3HB3C 1CN4A 2VDLH 4Q58C 4M48L 3DJ9A 2P5WD 3Q5YA 1CT8B 5GRJL 5CHNB 2JJUA 2DLIA 5IJVB 2ICCA 3I75B 3PUCA 1QBAA 4M02A 1CFNB 1GGBH 2B7DT 3ZE2E 5AYUL 1OAQL 1BQLL 4HFWB 4HS3A 4XVJH 3RWEB 2GJ6E 5DK0B 1GGBL 2PUQT 2VDOH 1LEKB 1N5YL 1I8MB 4OGXH 4XXCA 1X4ZA 1T1YB 2I25N 2QQNL