1FC1A

Crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FC FRAGMENT
publication title Crystallographic refinement and atomic models of a human Fc fragment and its complex with fragment B of protein A from Staphylococcus aureus at 2.9- and 2.8-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 36
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1981-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fc1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fc1A01
5FGSA 2DQTH 5IB4B 4HH8A 2W60A 3MV9A 4S1SL 3QEGH 1U6AL 4GBXD 1AO7B 3E2HC 3DXAA 4KI5F 1N4XH 4G9DA 3QQ9C 5ICYB 3VXTB 1K4DA 4I0PB 1IAIL 1XR8B 4HPYL 1IL1A 4PRIB 1CICC 1RUQL 3D48R 1H0DA 5ILTH 3TA3B 3AU1A 4QXWA 5FUOL 3BZFB 5JOEA 3F12A 3HI1A 4M8VA 2VDQH 5AYUH 2Y72A 2YS4A 1HSAB 4IIQA 5DJAA 1U3HA 5E5UB 2MKLC 1CU4L 2FBJL 2YUVA 1I9JH 2FH8A 3GMOB 1T5XB 4GRLA 3BAEL 4Y5VC 4UV4H 4WFHD 4MQSB 2FRGP 5DZLA 2UWEB 2DAVA 1MQKL 2AK1L 1IGTB 2IAMB 4NCDA 4JZJA 5I8CB 3PWUB 1X4ZA 1DN0B 4PJBE 2JK5B 4JO3L 4NQDB 5ISZB 3AMLA 2EE3A 3ARFA 5I75B 1D5ZA 4U2ZA 2P7TA 3CXDL 3BO8B 2NW2A 3FT2A 5DGRA 3HLAA 1M6OB 4CBPA 3HR5B 5FEBA 2OL3L 3MJ9L 4F7CA 1XIWA 1AI1H 4JJ5B 4LFHG 1EEYA 1U2HA 5F7LB 4NNYA 3WFCL 4K3EH 3ESUF 2DLFL 3P30L 2QTEA 3L5JA 3OMZA 3WKMH 3TIDB 5KZCB 1UACL 3ULVD 1XCTA 3EZJB 5FYKD 5FYLH 3BEWB 5IVXB 1K9TA 4I2XE 4NQUA 4OUUB 4E0RB 5CILH 1LO0H 1CLYL 2HRPL 2VZSA 3QCVH 4R90L 4TUKH 1G9ML 5F9JA 1UWXH 5BQ7A 4XNUL 2NY6C 4EI5D 5D7JD 4OZIE 3NTCL 1A6VH 4OFYA 1R5IA 2AJUL 3PWVA 4JN1H 1UH4A 1A1OA 5A2LH 4JG0H 2D7OA 4NFDA 4DQOL 3I50H 3C2AL 3RUGA 3DX9B 5J9PA 3MNVB 3OAZH 2IFGA 1JMXA 3QA3B 3FTGA 5ELIA 1I1YA 3MLRL 1W8NA 2FD6H 1CE1L 3AY4A 2NY7H 2OJEA 1H8NA 2Y7QA 2V2TB 4CNIB 4YJZL 4K7PH 4R6UA 1MAJA 5DUML 2E5EA 1QSEA 3DIFB 5E94B 1VESA 3B9KD 4OIIH 4Y4HC 3L6FB 5DD5H 3DUSA 3C5JB 2EH8L 3QDME 4X98B 2KH2B 2R1WB 3AB0B 4S1QH 5JPMB 5JR1L 1R5WA 4UIMA 4WFGD 2J6EA 5CEZE 3CMOH 1KEGL 1PQZA 2DLIA 2JCCF 1UCBH 4JY4B 4L9LB 3MRDB 2ZSVA 1RUML 4YDKH 3IU3B 2FHFA 4WWKB 4Z7UA 3SDYL 1AD9A 4GAYA 4H0HB 5HHVH 1JZ4A 4NRZA 1KOAA 3TO4C 4AMKH 3QB7C 1I1FA 2A0LC 4EI6B 4ALAH 5DJ6A 4OLUH 5EBWB 5BVPL 2HJFA 1B0WA 3U79A 2P44B 1R3KA 5KW9H 2EE6A 1A7OH 2H45A 1JPFB 2LV4A 2OR9L 4QHMB 5D1QA 1T66C 4P3DB 5DEFA 3VD9A 1VB9A 4JFFE 1ORQB 3KPSD 4OFYD 2YN3A 4M48H 5BMFH 1QR4A 1IBGL 4HT1L 1P5UA 1IC5L 5JZ7C 3FJTA 2HFEB 2OK0H 1JNHB 4PRHB 2I07A 1VFAB 4MGXA 2X4PB 3W11C 5I18L 1Q0XL 2VYRE 2OP4H 1KXTB 3U1SH 1IKFH 3RIAK 4B7IA 5FHAH 4OFVA 1MRDH 5F8RC 5HYQB 2X05A 5J11C 4P4KC 2IH1B 3TO2A 3LKQA 1NBYA 4RDQG 3LN5B 4JFZH 4JFEE 4L29A 3MRIA 4HC1L 4K55A 2X4UB 2JTDA 3QUZA 1VFMA 3BT2H 4GLRI 1S5HA 4NZUL 4MLSA 3VG0L 5DYOA 3VMPA 3HUJE 1GZPA 4L1HA 1PVHA 1S5IH 4PJIB 2Q6WA 2XV6B 3C6SB 1V3LA 1YC7A 4Q97A 1RMFH 3KPPA 4Y1AB 1H5BC 2I60L 2VISB 1G7HA 1MAMH 1S7VA 4NM8L 4D9LL 4PTTB 1WZ1H 2AGJH 3L3HA 4TTGA 3QEQA 1IC7L 4FFVC 1RURH 5IMLA 2H9GB 4JFQA 4X6DF 1DFBL 4YXHH 4NUJB 1F6AB 4Z76A 4H5SB 3ILQC 5J0BA 3RHWF 4BSWB 1A6AA 1TETH 3RWIA 4Z0BL 2AXJA 3NCMA 3V6FB 2E7LA 1MJ7L 2A9NL 1ZVSA 3WN5B 3BP5B 3UDWA 5C08A 2A73B 2BSRB 2YUZA 3MRPA 3GMPA 4MD0B 4HV8B 3LRHA 4XVUD 3SQBA 3OKNB 3QULA 1IEBB 5I1AA 1A9BA 4LARH 3DURA 2ED9A 3NFPB 4KKLC 4YDJA 1CYGA 4PJGF 3TM6A 4N0CD 3CC5A 3S36X 4PJDE 4YXKH 3N9GH 4NZRL 5EOCJ 1MLBA 1KBGH 5ADPL 4NIKB 1RK1B 4XCFL 3F5WA 4QRPB 4PJ5B 4G6KH 3LKSB 4LLYA 5KTEH 5GGUA 4P5TD 3BWAB 2QR0A 2PTTB 3SE3C 3N1QC 3EYOA 3GSWB 3QPXL 4PRAB 2ARWA 1NKRA 2G5BA 3W82A 1A4JA 1HI6A 1F4WL 5IK3B 1IFHL 2C3HA 3L7FB 3QDJE 3MROA 3CCHA 1NAMA 1J18A 2GJ6E 3D1MC 3C8DA 4BH8B 1MH5B 4K94C 3O4LA 4M5YH 3ULUC 4JQVC 3HC3L 1OB1B 5GS0D 1AGCA 3QEQD 1MFNA 5TDNB 3S37X 2UY6A 5FM5M 1NFDF 2YA2A 3QDMD 4QGYA 3KJ4C 4L4VE 3N50A 4LDEB 4ZAKC 4OZ4B 4TSAL 5CEZD 1UM6H 1AP2A 1CLOL 3CDGA 3B2UC 3SGDH 3QNXB 3MXVL 3CLEL 3QYCA 2Z8SA 5DTFB 3WJLA 3FL7A 5CINL 4P2QB 3LY6A 3MC0A 2HG5B 3QUXA 3K46A 2DQCH 1V7MH 2KQMA 4X6CE 4MDJB 2YUXA 4X9IA 3SDCA 5K59F 3FB7B 5MI0B 2P45B 3RZCA 5B22A 1LO2H 1VEPA 4JDVB 3RAJH 1AGBA 1Q9OB 3B5GA 3SKNA 5IOPB 4WCYL 1A1NB 4LHUB 1BIIA 4I3RL 2VSDA 12E8H 3BRDA 1G7PB 3J7HA 4JFFD 4YWGL 4HS8L 2X4SA 4Q6IB 3HE6B 2G75A 2ZUTA 5EBMA 2DRUA 2F54A 5DMKA 4R26L 4WV1B 3PV6B 4JFXA 4LLQA 4U6VL 1YC8A 5E2VH 1MCOH 1TVDA 3BMVA 4N0RA 4BA8A 1KNOB 1JRHL 3NH7H 5F6IB 4F15C 4ZSOE 2CR3A 5CD5D 3EHBD 1HHKA 1E4XL 2CKBB 4IBLT 1YNLH 2EECA 4NKMB 1MI5A 4IRJD 4MHHI 1UZ6E 3ARBD 4QXTB 1T7YA 3LKOA 1T83A 5JOFB 1UM5H 5D2LB 3C5ZA 5F7EH 3KJ6H 3RWFA 4JFED 5D9SA 1CFTB 1QRNE 3PQYA 1NLBH 2UVEA 1ZLSL 4U1SB 4OD3L 2ZG2A 3GBNH 1LO5B 2CLZA 2GK0B 1T2QH 4LQFL 1URLA 3NPSB 4UB0L 5SWQA 3R1GH 2UZYB 4CAGA 5HDBE 1KUMA 1UA6H 2YPKB 1WBYA 5D7LE 3HZKA 3G5XB 5IMOA 5F9WC 2P5EA 3WKNA 4F8TA 5DFTA 3RY4A 2BX5A 2XRAH 4ZUWB 2FGZA 5GS0L 5MEPA 1YEJH 1CFBA 3JV6A 3UO1H 2R0ZL 4RMTA 4RAUA 5D1XC 4NNPL 4XPHH 4ZFGL 3O6FB 3TJEL 4LCUA 2DQDL 4M1GH 3EOBB 1C16B 3G6JF 3FO9A 1AFVL 3C60C 4LRIC 5T1KA 4EN3B 5BZDB 2OS7A 5I17B 1F4AA 5CEZL 5L0QB 1DDHB 1UG9A 1MUJB 3BW9A 5HVWA 5I71C 1TQBC 2Q7NA 3M45A 4MNGB 4EVNA 3D9AH 1AQKH 3BRFA 3QQ3A 4OKVA 1KN2L 4P2RE 4LOUC 3P9MB 1EBPA 5E1HB 4KPHH 5C0ND 2G9HA 3LMJL 5C07A 5DWUH 2BY1A 1F11A 1YN6B 3FN0L 3VWKA 4OV5A 3JWNC 5DHVB 3T3MF 3L3DB 2XI9A 1MVUB 3NCJH 5I1KH 1BLNB 3OKMB 4ONHA 1AO7E 4R96B 1S7WB 4YHML 1J10A 1SVCP 2ZPKH 5IMMB 2PW1B 1TZHB 5EOTB 5CP3H 2DIJA 5IM7A 4MD4A 1BGXL 5AUMB 4GRWB 3C8KB 4NBXB 2P5WB 3P77B 4PRIE 4LPTA 1JE6A 3E6FA 1QVOA 4LHQB 2FX9H 4TQEL 1JJUA 1S78D 3SKOB 32C2A 4XMLH 4G6FB 3VXMB 3ARYA 3QDJD 1RZIA 2V7NA 1HE7A 2GJ6D 4JO1H 1WBXB 4ESKA 4YHOL 3T77A 3K4ZA 2CIIB 5DMIH 1ZLWH 4BJLA 5IW1A 4OI8A 4LFHD 4JKMA 3ZE1F 4HBQA 5JW5A 4XCCL 4AH2A 1MRCH 1NCCL 3VXSE 4Q9CA 1EFXA 3B2VH 1P4LB 3RWEB 5C0JA 1SEBB 4XP4L 3VGAC 2AK4B 4ODHL 4QWWD 4RQQB 1L0YA 5HVFB 1DTUA 4HZLA 1QYGH 3WE6A 4L4VD 1N7MH 3OPZL 1WTLA 2FHCA 3QBTB 3B8SA 4I77H 5HHQA 4U1LA 4Z7OF 4X9FA 5EU4B 3VRIB 4RSVA 1UB6B 3ULVC 4R2GD 2QQKL 3BUYA 1A6TB 3GJFH 4QXGL 1NBVH 4PRPA 3PL6D 5CZXC 3VU2A 4PJGB 2NY2C 4CVXB 1K5NB 5D5MA 3QAZB 3T08A 4IIQC 2Y6SD 3F62A 3MV7E 2AV7B 1U3HC 5EFIA 4KTEL 3T2NL 5JNYA 4QTIL 4BM7A 1NFIA 1WAAA 3TYGL 2YN5A 4ODUB 1K6QL 1UEYA 2HRLA 4P3CL 3U82B 1I8MA 1BFOB 3JXAA 1QFWH 1WFUA 4HWBA 4KAQH 5IVXE 2FNBA 4GRLC 4RNRB 5IHZA 2J8OA 2XZAL 2OJZH 3NAAH 5CJQH 2MQ0A 4Q9QH 4JZJC 4CMMB 1PW3A 1CIDA 5D7SL 9CGTA 3ARFC 2JELL 1CDIA 2XKUA 3SJVB 4U1HA 5F1SA 1NFDB 4HBCH 5GGTL 4M43L 4X5XA 1BVZA 1QEWB 3UJIH 5IB4A 1DQLL 4JPVL 1BQHG 1EMTL 4K2UH 1X5LA 1XIWC 4JFHE 2CH8A 3CX2A 1C5BL 4LHUG 4XTRD 3ZE2E 3RGVD 1QRND 5ICYA 3VXTA 2PKDA 1UKSA 4I0PA 3SE9L 1XR8A 3WD5H 5L2JB 1VGEL 1A2YB 2VR9A 1T7VA 5E56A 1A14L 4P23B 4PRPD 2CO6B 4NHUB 3TA3A 3MBXL 3BZFA 3KVQA 3FQWA 4O4YH 2A77H 4MXVE 4LPWA 4F7MB 1MCIA 4HKBB 3RVWC 5D7LD 4UIKH 1HSAA 4OSUL 1RULL 4YHPB 5DMGD 1KG0A 3NCYP 2CRZA 4GAFB 4WENB 3LQAC 3NA9H 4NN7C 4Y88A 1RVFH 1UC6A 2NXZB 2FEEI 4X6BB 2CIKB 4YDLC 5CP7B 5LBSH 3OXRA 3AY4C 2OBGA 1INEL 5E8OB 1JPST 1T5XA 1F2QA 4OLXH 5ACZB 2HVKA 2UWEA 2NZ9C 4OQ1A 3DX7B 1UXWB 5GJTH 1IGTA 2IAMA 3BZ4B 3PWUA 2WWMD 4LGRB 1DN0A 2YA1A 2JK5A 4NQDA 3GI8H 5ISZA 3I3DA 4KXZH 2HTKD 4LNRB 1V3JA 3E0GA 2C1PB 3BO8A 5EU6E 3VGFA 2VXTL 4P2RD 4XVJH 2H2SC 4IRSD 1M6OA 1VCAA 3HR5A 4Y0GA 2FGWH 1QFOA 2NX5A 4NQCE 4U6TA 3L5WB 2AXHA 4R8WL 4TSCL 4HZAA 1OWWA 5HGGS 5INDA 1FYHB 4JJ5A 3P40A 1AO7D 2VL5B 4PG2A 4POYA 5IQ7L 3TIDA 3WUZA 1MF2L 3B9EA 3GNML 4PRID 3BEWA 4P57B 3DLQR 4CJ1A 2ORBL 3EKCA 4OUUA 3VWJD 5JDJA 4E0RA 1YY9D 2B4CH 5HVHC 4PY7B 4KQ4H 5D1QC 1HKLH 5C8JB 1J1PL 4X7SH 5F21B 1IC4L 4KKCD 1MPAL 5IQ9B 3DX9A 5HHOE 3RKDD 4M02A 5EZIH 1JHLL 2HJKA 3QA3A 1M4KA 2R1YB 5A2KH 3K0WA 4FQCH 3VXSD 4DEPB 4JHAH 2V2TA 3LAFA 2V2WB 2X9YA 4CNIA 1HIML 4UAOC 1HINH 2HKHL 3CFEB 1GHFH 1QOKA 4BUHA 4LVEA 3PG2A 3UYRH 4Z78B 1KB5H 1N59B 3DIFA 1JNLL 3GGWB 3HI5L 3L6FA 4N0CC 3C5JA 1NLDL 1TQCC 5D7IE 5L9DH 2EYSA 4NQDD 4X98A 3GSNL 5ISZD 2R1WA 3TVMB 5JPMA 3PNWB 5JQHC 5IFJB 1GIGL 1N5YL 5D72H 2Q86B 3QUZC 4HCRA 5FYJE 3K4AA 4FQQB 4JY4A 3MRDA 4M4PA 4JPIB 3O4OB 1AJ7L 4PBVC 2P8MB 3IU3A 4KI5E 4DVBB 3TV3L 1CF8L 1F90H 2O93L 2XWJB 3MV7D 3QHTC 1CZ8L 4U7KA 3LEXA 1C7TA 2X6MA 5JA9A 4DZ8A 1JHKL 4EI6A 4PD4J 3IFOB 5E4EC 3PP4H 1T2JA 4WUKL 1ED3B 1MVFA 4HS3B 3L3KB 2O5YH 3WFEH 4YBHA 5IBTL 4QHMA 4P3DA 4ODSH 1ORQA 4U1MB 1MWAH 4KJWD 3ZL4L 1S3KL 3ULSB 3LVEA 4J7RA 3IVKB 4Z7WF 5I1LA 4PRDA 1JNNH 1K4CB 2JJWA 1A8JH 1MFBH 2CLVB 1QKZL 2KQNA 4S2SB 4PRHA 4CU6A 1VFAA 5MERB 2X4PA 3UDWC 3VFTB 3ARXA 4LLDB 5F7HA 4MNQE 3BE1L 3NFSH 4MA1B 5H37H 1GSMA 1MY7A 2OZ4L 4JFHD 3KPTA 4UT7L 4LVOC 5HYQA 1V7NH 2VDNH 4MAYD 3STLB 3EUUA 2IH1A 1RZKH 4P4RA 1FQ9C 4QNPF 3LN5A 5JIPA 1MCKA 1FJ1A 2V9RA 4OLVL 1IGML 2AEPH 3QG6B 3PGDB 3C8HA 2CPCA 1UWXK 4LAQH 5ADOL 2X4UA 4JFDE 3S88L 1TJGL 3E6HB 2XOTA 2XA8H 2H32H 3LKNB 4D3CL 1N3NB 4WWKD 2XQYK 1S7QB 3M1BB 3OAZK 4JHWH 4PJIA 4X9GA 3C6SA 4XAWH 5I8KL 4Y1AA 2R29H 4FZEH 3V79C 4BZYA 4U05A 2X09A 2VISA 3GRWA 3HS0B 3NPZB 2FYYB 4GQ9L 4PTTA 2J4WL 2DQHH 3N0PB 4OI7A 1UZ8B 1GAFL 2I27N 2NY1B 4Q7DA 3TESA 2H9GA 3VFSB 2IBGA 5MENA 4J8RB 4NRXB 5IG7A 4E9LA 4NUJA 1F6AA 2GUOB 3CPLA 3ISWA 4H5SA 1I3UA 1KELL 3QFJB 3DJ9A 5LQBH 3C5SA 2VQUA 4BSWA 4DW2H 1NH6A 4GAGL 3RNKB 1DP0A 5EU6D 4AM0B 3S36L 2R69H 4JPWH 5K33A 1C12B 4OT1L 1D5IH 2IMMA 3BP5A 1JF1B 1CCZA 2A73A 2BSRA 2ZCKL 3U30C 4JRXB 2BVOB 4MD0A 4Q6YA 4HV8A 3WJLC 1VHPA 3VMOA 1IEBA 4L1DA 3QUXC 3NFPA 3RU8H 3C6LB 3MACL 1BBJB 1FFOB 1NCNA 2SEBB 3SDCC 3BQUB 3E8UH 1I4FB 3RZCC 2XTJC 2JCCE 1FIEA 1RUPL 4U1IB 4JGUA 1RK1A 3VJ6B 5L7XH 2FO4B 4PJ5A 4QRPA 3LKSA 1YN7B 3QNZB 4BK5A 3BWAA 1W8OA 3BOVA 5C6WH 4LU5L 4PRAA 5I73C 3MJ9A 4M7ZC 3DRTA 3PP3K 3S37L 4AG4H 1U0QA 4M7KL 1TITA 5IK3A 5CWSB 3L7FA 4NUGL 1MCCA 1ONQA 2HT4D 4Y1AD 1KCRL 5HHOD 4FN0A 4BH8A 1MH5A 4KHXL 4P3WA 1F58L 1HHIB 4LSTH 1CGSH 1OB1A 1OTSC 3HI6H 4JO4H 4JM2B 5D4QA 5DZOA 2V7HB 5TDNA 5KVEH 3OJVC 3C08H 4OGAD 4U49A 2PN5A 4EIZC 1GPOH 1T83C 4IMKA 1J8HB 4KUZL 3C5ZC 4LBEB 1W72B 4Y16B 3CH8A 2NY4C 4OZ4A 4MJ6B 2DMCA 2IG2H 5DJXB 1LDSA 3OXSB 3THMH 2AJZB 1N8ZB 5FYJD 3IAPA 1A1MA 4MCYB 1S7RA 3OR6B 5DTFA 2GJZB 4P2QA 1L7TH 4KI5D 4CADB 1Z2KA 1CL7H 2HG5A 1G6RL 4QOKB 3BJLA 5LWYH 4OLZL 3VXOB 4MDJA 2NQCA 3EDDA 3FB7A 3MODH 3WIHL 5MEOB 4PLOB 1OCWH 1RZ8B 4JDVA 1Q9OA 1ZGLP 3EFDL 5IOPA 4WU5B 4ZOCA 1A1NA 4KQ3L 4KK9D 4HDIB 1HWHB 1FV1B 2RIKA 5DUBB 4GSDL 1G7PA 4PY8J 2CK0L 2P46B 5DD6B 1F8TL 4Q6IA 2FEDC 3VRJA 5I6XC 1YEIH 3FFDB 4UOW1 3VXME 2GTZB 4ISVB 2WP3T 4WV1A 2D2OA 3PV6A 5FYLE 4NQVA 1P7QD 3L5HA 5DA4A 2AEQH 5FUZH 1RZ7L 2HKFH 3OQ3B 1CK0L 4X6DE 4MNQD 5E2WH 1KNOA 1I8LA 5EU3B 3VWKC 2CKBA 4UDUA 5FDWB 4PJFF 4QXTA 2ARJQ 2FH6A 3WIFB 5JOFA 4RGNB 4GMSL 3BKYH 4M1CC 4ODTL 5D2LA 3UTSA 3D39E 1HEZB 3TC9A 4UTBL 4MVBC 3U46B 1CFTA 5GJSL 1N5AA 3VFWB 4AL8H 4GKSB 1WWWX 4U1SA 1B88A 3DHJA 5TE6H 1LO5A 4JFDD 2R0LH 4F7PA 4G80B 4PJGE 5E8DH 4UU9B 1P9MA 2DQJH 3OAYK 2BXZA 2YPKA 2J1KA 1KCVH 3G5XA 1LDPH 2E27L 2BNQE 4I3SH 3FRPG 2C3VB 5FGBA 4BFEA 4TUOB 4ZUWA 3RI5F 1WSST 5E00B 4YHLL 5IV2B 3UAJC 4HPOL 1FE8H 4HC1A 3D18A 4H20H 3F8UB 4LHUD 3L3OB 1MHPH 3O6FA 3TN0B 1C16A 1MQ8A 2H6PA 2EDFA 3K74B 3HE6D 2N4IA 4XTRC 5I17A 5IEHB 4RGOH 4OD1H 5J8OA 1DDHA 4G8FB 5FYJL 1MUJA 4OM1L 4MNGA 5I74B 3JSSA 2PR4L 3SJVE 5HTSA 1PZ5B 3BPLC 5ANMB 2ICEB 3P9MA 4J3WA 3ARGD 1NFDE 2J8UB 1DL7L 2XZZA 1A3RL 3LS5L 5L2KB 5DVOA 1M7IB 5B39A 3T2PA 4OCXH 5DHVA 2L7UA 4WTWA 4YFLI 4NQTA 5I66B 3L3DA 1RJZB 2Q8AL 1MVUA 4YPGB 1BLNA 3OKMA 1S7WA 4Z9KB 3S96B 1OY3B 1UB5B 2PW1A 5CBAB 5T5NF 1TZHA 5EOTA 4HIEB 1T1WB 4X4YA 1MFEH 5ACMA 4QRTB 3VG9B 3QEUB 4DGYL 3C8KA 1TNMA 15C8L 2P5WA 3P77A 4NWTH 3BDXA 3L3JB 2EDLA 4TRPH 3X13B 1AKJB 4OZFA 4WGWB 5JHLH 3FN3A 4XP1L 4WRLA 5K59E 1RZJH 5GSRA 1JIBA 2EO1A 2BVQB 1KF9B 1T03H 4X8JB 4V1DB 1BMGA 1FRGH 3CGTA 3X3GL 4YUEL 4ZO6A 1WBXA 3CNKA 3SKMB 5DRZB 2CIIA 4HWZB 1G7IB 1X5AA 2DQGL 1EAPB 4KDWA 2ZWLT 3CUPB 4XWGL 1DN2A 2MNUA 1XGTB 3F58L 3RWEA 3QUYB 2AK4A 3LHPL 2HWZL 4RQQA 3QDHA 4LSRH 4PIRF 4U6HB 3O81A 5D1ZD 4DZBA 4EN3D 2VXQL 1T80A 4PJXA 3HAEH 5J6GA 3VRIA 4I0PC 1UB6A 2G2RB 2VC2H 1FH5H 4TYUA 1CDJA 1BQUA 2ZUSA 1A6TA 3ILPB 4MMXC 3ZE0F 1HN1A 4P9HC 3TA3C 4WTZG 3GMLB 5HDOA 1KTRL 4O2FB 1K5NA 4K3JH 4XCEB 1JPGB 3FHAA 1DBBH 1S9KC 2D4DA 4GW5B 1RIVH 3V5HB 3U0TB 5HVGB 3B9AA 2AV7A 2IALB 4MA8H 4LHJB 3FZUD 4ODUA 4XC3L 3E3QC 4FQ2L 5D96C 5C0BB 2KL6A 2P5WD 1BFOA 3OGCB 4RNRA 4XBEH 2VH5L 1HYSC 3TT1L 5JXED 3MRGB 2C7UB 4OCYH 3UPRB 1DQDH 4HXAL 4KROB 4YXLH 2IAMC 5FAAA 1T04B 4CMMA 3VXMD 3DYOA 2J8HA 1Q72L 2WSKA 5I75C 4LEXH 2AABH 3V0WH 2YR3A 3G6JE 4OZGF 1OT2A 2VKXA 3IKKA 5T5FH 3VA6A 4H8WL 1QEWA 2ZSWB 1HILB 4LKCA 4HLJA 4OQTL 2AK4D 1YYLL 4LASL 5DK2B 4A6YL 5I1EL 1IAKB 2DQTL 3L3IB 3D39D 5DO2C 2ZP0T 3P4MB 4KHTH 4D8PA 4PG2C 5DVMA 4P5MB 5HY9B 3QEGL 3QIWD 5T3ZH 2C3WA 3LPGA 3NIGF 3VXRB 5L2JA 1A2YA 5C0CB 1JZ2A 1N4XL 3IDYB 1BZ9B 5C71A 4NHUA 4NQEE 5JIIA 1HQ4B 2HMIC 3T3ME 4WDIB 1KCKA 3TH2T 4F7MA 2DI7A 4QT5A 4HKBA 2I25N 1MCNA 2HT3D 1XGYH 4OFDA 5ILTL 1ZLWK 3K1DA 1HK6A 3RX8A 2VKWA 2BNQD 2QSVA 3OKDB 1PX4A 4YHPA 5AYUL 2VDQL 4WW2B 5CP7A 3X12B 4X6BA 2CIKA 2FECL 1G7JB 1FLRH 5ALBH 4DOHE 4DUVA 2JB5H 3IJSA 4XBGB 3JUZA 3CJJA 4UOJA 3K8MA 2QADB 5E8OA 3BZEB 5J1AB 2GFBB 1D5MA 2AERT 1AIFB 4QF1B 5FF6B 5ACZA 1ZV5A 5IMKA 3EJYC 4Q0XH 1I9JL 2W0LA 2P1YA 1C7SA 1UXWA 3DX7A 1SEQH 4UV4L 3IDUA 3QI9B 4F33B 3BIKB 2LFGA 3AB0C 2DJUA 4LNRA 3ZE1E 5DJYB 1FNAA 1F3JB 4IDJH 3ZLQC 2C1PA 3B5HA 1FPTH 4NO2B 3SJVD 4ENED 1FAIH 4GFTB 1WFOA 2FHBA 3LKPB 4KKBD 1BFVH 2PW2A 2VZVA 1UGNA 1FG9C 5E99H 4WIQA 4IOIB 4Z7OE 4B7LA 2E7BA 3WNLA 1PYWB 2VL5A 1HNFA 2YPVH 1AI1L 5EZOH 3BP4B 3W0WE 1MCLA 3FQXB 4K3EL 1P84K 4PJCF 4PPTA 3H6JA 4P57A 1AE6H 4P23D 3WKML 5DVKA 3UTTE 4PY7A 5FA3B 5BXFB 3MCKB 5FYLL 3HMXH 5C8JA 1TTUA 2P43B 4WI8A 2EO9A 1LO0L 1C1EH 3QCVL 4TUKL 5CILL 2DLEA 5FKAB 3ZKND 5A2JH 2D9CA 5FOBB 4NYLA 2ERJB 3ZKMC 5IQ9A 4W6YB 1A6VL 4XCYA 2H2PC 4JN1L 2FIKB 3UZEA 2R1YA 4RFEB 4WEBL 4PGJA 5I15L 4JG0L 4MCZB 3I50L 1Q8MA 1RU9H 3FCTB 4LPXA 2V2WA 3VFMB 2HFTA 2FD6L 2NY7L 1N59A 1NEZB 3GGWA 4K7PL 3TVMA 3GJEA 3PNWA 3IRZA 3IAQA 5IFJA 4OIIL 5DD5L 4WO4B 1VGKB 2Q86A 5C7XH 2HN7B 4FFWC 4S1QL 1K3ZA 1KJMB 4JPIA 4YBQC 3T0WA 3ARWA 2D0FA 2P8MA 4DVBA 3CMOL 3U0WH 1DUYB 5GHWH 1NDGA 3IDIB 1UCBL 1OAZH 1T7WA 2XWJA 3V9FA 2R23B 2C5DC 4L8DB 4K94H 4YDKL 3ULUH 5HYSB 3IFOA 3H0TB 1ED3A 1VFOA 5HHVL 4L4TB 3NIFF 5J89A 2HAZA 4AMKL 1E4KA 3HNSH 5KBNC 4ALAL 3Q48A 4OLUL 5B3JF 1BIHA 4TVPH 2OX5A 4U1MA 5KW9L 3WLWC 5T1LD 1I8KA 5HYJB 3ULSA 1A7OL 3IVKA 4M93B 3WHE0 1NC2D 5HDLA 4QTHB 1I7TB 1K4CA 3FQTB 2VXVH 3CSYA 4M48L 2CLVA 4S2SA 1WC7B 2EDOA 5E03A 4F2MB 5BMFL 3WN5C 2V2XB 5MERA 3VFTA 1RUQH 4LLDA 5C09B 3BXNB 2OK0L 3PXJA 1BHGA 4JAMB 1KENH 4K07A 2OP4L 4HK3J 3U1SL 2M1KA 1IKFL 4C4KO 5FHAL 4PR5B 5I0DA 1FAKT 2CDFB 1MRDL 3QG6A 4JB9H 3KPLB 4NQED 4XI5C 3WMSA 4JFZL 3NMEA 3E6HA 1ADQH 2K7QA 2ATKA 1YUHB 4OJFH 3LKNA 1N3NA 1Y0LB 1S7QA 5I19H 3M1BA 3BT2L 4HKJB 4QOKE 5FV2A 4I3GA 2YUWA 1XF2B 3QXWA 2VO5A 4IOSD 1INQB 2NLJB 3HS0A 1ND0B 3LB6D 4EOWH 2R2EB 2FYYA 4NKOB 4P46D 4N8CH 1RMFL 1IVLA 2VR5A 1UZ8A 2WLYA 2C4FU 3VFSA 4J3TA 1MAML 1B90A 4NRXA 1ITCA 1WZ1L 2AGJL 2GUOA 4LEOA 3QFJA 4IMKC 3MQIA 1RURL 5ALCH 4OZGB 3EAKA 1WFNA 3IRPX 4C56E 2DIAA 2ZZUT 1I8IB 3RNKA 2Q7YB 3DPBA 4AM0A 1C12A 1GOFA 1FFPB 3FOLB 1T1YB 1TETL 4UV7H 1JF1A 1JUFB 3VFGH 4JRXA 1YNTB 2BVOA 5GISH 5EH1A 2FJHB 5T3XH 1CLYH 2VITB 4XVSH 4OIBA 4HGWB 3C6LA 1BBJA 1FFOA 2SEBA 3BQUA 1I4FA 5GPRA 5MI0C 1RPQA 4PJEF 3WFBH 5GGRY 1PDKA 3W0WD 4PJ7B 4LARL 5E24E 1P6FA 2J7LA 4U1IA 4KZDH 1JYNA 3VJ6A 2FO4A 3MRCB 1YN7A 3QNZA 3RFZC 1T6WA 3I9GH 4YXKL 1YMMA 1T22B 2WWKT 3N9GL 1KBGL 3UTTD 2ICES 4U0RB 5KTEL 4G6KL 3MJ8B 4Q6IC 5EORH 2ZUYA 4PGDB 1WT5A 2AI0H 1ZGLM 4JKPH 4Y5VB 5CWSA 3TNMB 4TNWF 4ZTOH 4J6RH 4WV1C 3K8KA 3ULUF 5FM8A 3KAAA 1V8HA 4NZTH 4FG6D 2ZCLH 1HHIA 1RJYB 4CVUA 1F00I 2XN9E 4KTDH 4CJ0A 2HLAB 1LO3H 4JM2A 1I8LC 4E41B 5DJ8B 5F6IC 5EZJB 1F6FB 2YXMA 5CZVH 5BV7B 4M5YL 4Z7WE 4JRYE 3Q5TA 3NZ8B 5SWZB 1J8HA 2Y07H 5DD3H 4LBEA 3DECA 4B50A 1W72A 3RA7H 4DKDC 5HHMB 4MJ6A 3W9DB 5DJXA 3AS0A 2GCYB 2QBWA 2AJZA 1K8IA 1N8ZA 1LGVA 3J8F7 5D8JH 4MCYA 1HH6B 3OR6A 2GJZA 1C8PA 3NPSC 1Q9WA 4YHNA 1UM6L 4CADA 4QNPE 1P9MC 2EH7H 3MLSH 4XWOD 2GIYA 3MRFB 3O8XB 5AWNH 4YE4H 3VXOA 1BP3B 4U7MA 5CBEB 5DGQA 5FGBC 5CFHA 5MEOA 4KZEH 1OGAE 1RZ8A 1V7ML 2DQCL 4M3JA 4EUPH 3A6BH 3O3BB 4WU5A 3C87A 4EDXB 3DMMD 1SVZA 4HDIA 2ZJSH 1LO2L 2GTWB 4N1CA 3O6FC 1FV1A 3RAJL 5C2BH 1KJ2H 3T8XB 5DD6A 2I9TB 3RY6A 1NFKA 1UH3A 1DQQA 5SX5K 4EN3C 12E8L 3FFDA 3ULVH 3O9WB 5L0QC 3PGFH 1GGIH 3PXHA 3O3AB 2GTZA 4ISVA 5FYKH 3T04D 1MCSA 2H26A 3VGEA 4LCWA 4N0UE 5GGSB 1FYTE 3IGAA 4ZMAT 3JUYA 2XFXB 3QCTH 4PGBB 5E2VL 5EU3A 5HYSG 1MCOL 2OXHA 2YHGA 5FDWA 5MEQB 3NH7L 3WIFA 1CVSC 4PUBH 4S11A 1YNLL 4Y16D 2V5MA 3VFWA 4U1KA 1UM5L 2CLRA 3KJ6L 3U36B 4U6YB 4U3XA 3M17B 1RHHB 1NLBL 4G80A 4U31A 3L1OH 3UYOD 4UU9A 3GBNL 4XPAH 4PRBB 3NABH 2VWEC 4QOKD 2QQQA 1T2QL 4NC1C 5HI5C 4TPRH 3R1GL 3STBA 2O5XH 3MLTB 4NCC2 1Y18B 1UA6L 2C3VA 4B0MM 2Z91B 2GEEA 1MCBA 2B8OT 1H3WM 4D94A 3EOAB 2P8PB 5TF1H 4KVNH 3HE7B 4O2EB 4UBDC 3T65B 3B9VA 2XRAL 1DVFA 3TN0A 1YEJL 3UO1L 2ICWB 5CMAB 1BPVA 5GS3A 4XPHL 4JN2B 2VLKA 4M1GL 3ARVA 5IEHA 3NBNA 3FN9A 1Z9OA 4C56D 4K71B 4G8FA 3ARED 3MTRA 1J0HA 2ADGB 4KRLB 2VR4A 4U0QB 5KVGH 4ZO9A 1NCAH 1PZ5A 2PO6B 3MV11 2ICEA 4OCWH 5ANMA 3MMEB 2J8UA 2BSSB 2VB5A 3D9AL 1AQKL 3C09B 2VLME 4HIJB 5L2KA 4HUXB 2EDXA 1M7IA 3AXLB 3QAZC 4HKXB 1SJHB 3N06B 3RY5A 5I66A 3BHBB 3LQAH 4KPHL 5BRZE 1RJZA 5BS0E 3ZKQD 4RGND 4YPGA 4IDLA 3MRKA 5DWUL 1NANI 3S96A 1UB5A 5CBAA 5GXBB 4HIEA 1T1WA 3N1FC 4X0KB 4QRTA 3QEUA 3NCJL 5I1KL 1B0RB 5F9DC 2ZPKL 5JIKA 3L3JA 5DQDH 1H5BB 3X13A 1AKJA 2UUDK 3V4VH 4X9HA 1JMZA 4C83B 2B1HH 1MREH 3VH8G 1RIHH 2HT2C 1XGQB 2BVQA 1VERA 2VLJE 1LD9B 4X8JA 4V1DA 3GSVB 2FX9L 4ZOEA 1W0VB 3BKJH 3SKMA 5DRZA 1SJVA 4HWZA 5F88B 1G7IA 4XMLL 3D3VE 1V3KA 1J1OH 1EAPA 4JO1L 1CLOH 3UP1A 3CUPA 2F74B 1I7RB 1XGTA 5DMIL 3L7EB 4F7EA 3QUYA 4JRYD 3HTLX 4U6HA 4HEME 3DX8B 4P2OB 3B2VL 3BSZH 5E6YA 7FABH 4CKVX 2F8OA 3EW3B 3EYSH 1BD2B 1FCCA 3ESVF 3OB0H 2G2RA 1QYGL 3LS4H 1TENA 2ESVB 1N7ML 4PLKD 4FXLA 3ILPA 4I77L 1MRFH 5CGYD 4PJFE 2YD5A 3GMLA 4O2FA 1F42A 4XCEA 1JPGA 1LK2B 4TNVK 4HK0B 2NW3B 1NBVL 4YWGH 3ARQA 3QUMB 3V5HA 1OTTC 1OL0A 3IXAB 3U0TA 1PZUB 3SE4A 2IALA 3KR3H 1NBZB 4UT6H 2AAVA 1T1XB 2NXZC 4JCLA 5C0BA 5IVZA 1DBJH 4FMFA 3OGCA 1UH2A 1KJVB 4QHKI 2ZUVA 1QZ1A 1JGVH 4KJQC 3MRGA 3UPRA 5JUEH 1QFWL 4KAQL 2JB6B 3MREB 1T04A 2EE2A 1FFQA 4K3HA 4YDVB 2WANA 1I75A 1NC4B 2OJZL 2WNGA 3NAAL 5CJQL 1MFAH 3MCG1 4Q9QL 1BECA 1T0PB 1WWCA 2ICWI 1FYTD 3VXNA 4MJ4A 2PCPB 3HPLB 1VEMA 2DQUH 5F1NB 2ZSWA 1HILA 5DK2A 1T21B 1IAKA 4HBCL 5GQBA 2HJLA 4EJ1C 3L3IA 1S7SB 3JWDC 3UJIL 1E4WH 3P4MA 5D7KE 4LKXA 4K2UL 5IB3A 4JFPB 4P5MA 5HY9A 3W39B 3VXRA 3IJYB 2XY1A 5C0CA 1DQMH 3ALPA 1CGTA 5EU5B 2E8ZA 1HQ4A 3DVIA 4WDIA 5HPOA 3ARDD 3WD5L 4EQ3A 2DLGA 5FOJA 2EIZB 2CD0A 1TVHB 4R4NC 4ZFOB 5DJZB 2DKMA 3RUGF 3OKDA 2OXGA 4O4YL 1MEXH 2A77L 3DV6B 2NY3D 4L3EB 3FFCB 4K8RC 4WW2A 4UIKL 4Y19A 3X12A 2I5YH 1G7JA 4XBGA 3VDAA 8FABB 1CWVA 4L4TE 4TUJB 4DEPC 5J1TC 3NA9L 3BZEA 4L3CB 1RVFL 5J1AA 4RIRB 2GFBA 1P7KA 5LBSL 5FF6A 1AIFA 3SQOH 2W07A 2WBJB 1NCDH 4R7NB 1CQKA 1EV2E 1DANT 2VQ1A 3VXUE 5J7CC 5K9JH 4OLXL 2RBLA 3BIKA 3TVMC 1EIBA 5DJYA 1CLZH 1F3JA 5DMYA 4FHBD 5GJTL 4FP8H 4NO2A 3SY0B 1OSPH 4KU1A 1WISA 4R3SA 4GW1B 3GI8L 3LKPA 4WI7A 3TH3T 3QIBD 4Z7UF 2VLMD 4YGAB 3O4OC 2FX7H 4XVJL 4IOIA 3MUGB 1KXQE 5DEGB 5BRZD 5BS0D 1NAMH 2FGWL 1PYWA 1WK0A 5DK3A 5C0RH 4A2MA 1S7XA 2CUHA 5J56B 1U2CA 3ZE0E 2QQLH 3BP4A 4GG6B 5F96H 3FQXA 3VXRD 5C0CD 2A6DB 1E4KC 4WI6A 4KRPB 1M1SA 3WLBB 1XH3B 5BXFA 2YA0A 5FA3A 3X11A 2VLJD 3V6OA 3T1WA 2ADJB 2B4CL 5FOBA 1D5XA 4KQ4L 3WUWB 1HKLL 4PRNA 4UUJB 4G9FE 4X7SL 3P4OB 3D3VD 3GO1H 2FIKA 4RFEA 3JTTB 1I7ZA 4MCZA 2DM2A 4MA1C 4EIGB 5EZIL 3DSFH 3VFMA 4Z7VA 4R9HA 4FQCL 2APXA 1ZK9A 4JHAL 5DHYB 1NEZA 3D6GA 3P11H 1QLRB 1EUUA 1HINL 3GIZH 3QI9D 1GHFL 1QHPA 3TCLB 5J3HD 4NT6B 4KY1H 5JW4Q 3UYRL 4NPYB 1KB5L 3BRGC 5ESQB 1DUZB 1VGKA 4WO4A 4FTVA 1K6QH 5L9DL 2HN7A 4F57H 2FZ3B 5IGXH 1KJMA 2QHRH 1PKQE 4YAQB 5D72L 5DC0A 5AEAA 3I02B 1U58A 1DUYA 3MV8B 1ZHBA 4ZNEE 3IDIA 2B2XH 3PWPB 3NIGE 5AG9A 2R23A 2AQ2A 4H1LB 4L8DA 5HYSA 1F90L 3QWRD 3MRJB 5TPWH 4FG6C 2VL4A 5GRUH 4GJTB 5EOCH 2NY1C 1AY1H 3PP4L 1YEDB 5JHDB 4PJ8D 2Y4SA 4OCMC 2O5YL 2VSCA 3KNBA 4X99B 2WZPD 3WFEL 5I1JH 5HYJA 5CIPB 2IPKB 4QTHA 1F4HA 2X89A 4ODSL 3FQTA 1MWAL 1WWAX 1WC7A 3OV6A 2AXFB 2V2XA 4N5ED 1AR2A 1JNNL 4QRSA 1TVBB 4KWUA 3SE8H 1K4DB 4E41E 5C09A 1MFBL 3BXNA 4X7CC 1WVZA 3ETBF 2WIMA 4LSSH 4JAMA 2XWBB 2CSPA 3BEVA 3C6LC 3NFSL 5K9OB 2XZQH 3H7LA 4N9GB 5D7KD 3QRFM 3BQUC 4OBRA 4PR5A 3EDKA 2P4AB 5CEYA 4PYGA 2CDFA 1VDGA 1V7NL 2VDNL 4YFEA 5L8KB 3L5XH 4I9WE 1RZKL 3DX6B 3KPLA 5IW6A 2V17H 1SYSB 1YUHA 3W9EB 1FVDB 2AEPL 1X5KA 1Y0LA 4LAQL 1KPRB 4HKJA 2XA8L 1WT5C 3VFNB 1TLKA 4PJCE 1LK3H 4FQHB 3QCUH 1INQA 4HHAA 1RJLB 2NLJA 4BQBA 1ND0A 4JHWL 5AG8A 4JZJB 2R2EA 3LV3B 4JE4B 4NKOA 5ID1B 3U0PA 3IDXH 4L4TD 4XAWL 2Y25A 1YEKH 2R29L 4FZEL 4JM2C 3O6MH 1WTGT 3GKWH 1HHGA 2DQHL 3VXUD 4XNQB 4ZUVB 4OZGA 2QSCH 1I8IA 2Z9TA 4RMSA 1XIWB 4XP6H 1ZEAH 2D03H 3HC0B 5LQBL 1UWGH 1FFPA 3FOLA 1T1YA 3GSQB 4DW2L 5GRVK 1JUFA 5F89A 3T0BA 1I1AD 4KK6D 3TBSB 4YO0A 4D0DB 2FJHA 2R69L 4JPWL 1D5IL 4NFBA 2VITA 2D7PA 1JN6B 4HGWA 5F6HI 4BFBD 4JY6B 2EXYC 4D9RE 1WUNT 4PJ7A 2B0SH 1Z9MA 4J4PD 3RU8L 5JMOC 2B7DT 4Y4FD 5DQJB 3MRCA 3E8UL 3ZYZA 1T22A 3STZA 1FBIH 2XG5A 1GC1C 2R9HC 3QP3A 4YDLB 4Y2DB 4WFEE 1T0MB 3VFUA 3RY6C 3OKLB 2H1PH 4PGDA 5T3ZE 4LGPB 2A6IB 2IWGA 5EULV 3NIFE 5F7FA 4AG4L 3DBXB 3H8NA 4G9FD 3OTTA 3VGGA 4LRNH 3FQRB 1J0IA 5B3JE 2ZNWA 1J5OH 2HLAA 4XBPB 5DJ8A 5EZJA 1EGJA 5BVJB 3F7YB 3AFLA 4M6AA 4LSTL 1CGSL 5AZ2H 4Z6AT 3GSUA 3HI6L 4JO4L 5C6TH 1I3RB 4RGNC 3NZ8A 5SWZA 2OR8A 3I6GA 3M07A 5KVEL 3VD4A 3C08L 3SDAA 4PJHB 4Z7UB 3W9DA 5I0ZA 1GPOL 4HWBH 2RR3A 2VXUL 4DTGH 3KPRB 2GCYA 3EYQC 4PP1C 1HH6A 3QQ9D 4YHKH 2IG2L 4HG4K 3THML 5GRYA 4F58H 3CVIH 1OVZA 2IF7A 2Q8BH 3MRFA 3O8XA 1CICD 3TZVB 1CGUA 2YWZA 1GGTA 1L7TL 5CBEA 3EYUH 1CL7L 5LWYL 3OZ9H 4OI9A 1UQSB 2W65B 3ABZA 3O3BA 1J0YA 2VABA 3MODL 1BX2A 1DVFC 1QHOA 1OCWL 4W68A 2GTWA 3TN0C 3MLWH 5EN2B 5HBBA 4WUUB 1A21A 3T8XA 3ZZ1A 2I9TA 4OCNC 3P4NA 1D5BB 5TQ2H 2Z8VC 2DDQH 2W38A 3O9WA 4HX1B 3O3AA 1PG7X 4WU7B 4HIXH 4TTDC 5I74C 4P9HH 5FV1L 4PLKC 1YEIL 3ZTJG 4I8DA 5GGSA 1X44A 4JFYB 1Z3GH 2Y36H 2XFXA 3TPKA 4CN4A 4E41D 2AEQL 4PGBA 5FHBH 5FUZL 1A6WH 1MFDH 2HKFL 1AHWB 5MEQA 1FC1A 5E2WL 1E27B 5ENWB 3KXFB 4YHZH 4DJMA 3ZKXB 2IPUK 3QO1B 4I9WD 3VG9C 1GZPB 3BKYL 3U36A 4U6YA 2XYCA 5L8JB 4LSVH 5TE7H 3M17A 1RHHA 4AL8L 1F2XK 5E4EB 1D6EA 4PBXA 1G7HB 5TE6L 4PJEE 4PRBA 2EIEA 2F9BT 3LOWA 3L3HB 3O8XD 2R0LL 4YX2L 1FNLA 1NMAH 1QFHA 3MLTA 5E8DL 1Y18A 2DQJL 2Z91A 3G9AB 1BZ7A 1YMHB 2NY6D 4YDIH 1BVLB 1KCVL 3EOAA 1LDPL 2BOCB 5HDQH 3HE7A 3LKRB 1Z5LA 4KRNA 4O2EA 4I3SL 1A6AB 1KIQB 1QSFB 2RQ8A 2ZCKH 5FFLA 2Z31B 3CFJB 4GLRH 2DLHA 2ICWA 5CMAA 2W0FB 3QUYC 3OB8A 3UROR 1MCFA 1FE8L 2I9LA 4I0CC 4H20L 4JN2A 3ARTA 1I9RH 3ULUE 3MRPB 1MHPL 3GMPB 4GAJH 3VFPB 3KYKH 2ADGA 2UZIH 5CHNB 4QHNB 4JO2H 1YEGH 1WF5A 4RGOL 4OD1L 4Y4HD 4J23A 4TVPE 2PO6A 3OWEA 1G7QA 4XMKH 1P4BH 5D5MF 3MMEA 2BSSA 4HIJA 2IQ9H 4HUXA 4BFGA 3AXLA 1OTUC 4WY7H 4LLYB 4M7LT 3G9VA 1SJHA 1EPFA 3BHBA 4D9RD 2RAMA 1WAAF 3SE4C 1OAQH 4OCXL 2QQNH 1IAIM 4XXDB 4X0KA 4OF7A 2UYLB 5HI4C 2O5ZH 1B0RA 5JO5B 4XPTH 3R8QA 3TO4D 4MJIB 2X4QB 3ORJA 1MFEL 1DLFH 4C83A 4WFED 1U8JB 4NWTL 1FN4B 1XGQA 2VLRE 5T3ZD 3EZ8A 2FL5B 4KROC 4TRPL 1AGCB 1LD9A 3CVHB 5JHLL 4HMDA 3KPQB 3GSVA 1RZJL 1W0VA 2EDKA 1BF8A 2X7LA 3O41B 4N9OB 1T66D 4HCRH 3WO3B 5FUCC 5F88A 3V7AE 4TN9A 4YHYB 1T03L 3LDBB 3X17A 2W9LA 1FRGL 3S7GA 1LO4H 4JZNB 5JZ7D 1Q0YH 2F74A 5E08H 1I7RA 4MXQC 3L7EA 4LVNC 4QKXB 3W11D 4BQ9A 4AENB 4P2OA 1WIPA 4FXGB 4AJ0A 4HG4J 1U8IB 2EE9A 4L5FH 1BD2A 2IANE 4LSRL 3QUXB 3GUTB 1IARB 2ESVA 4P4KD 3EFDH 3SDCB 5KVMC 3MLZH 3IDYC 1T1ZA 3RZCB 2VC2L 1SYVB 1FH5L 4LIQH 3FO1B 5TFSH 1LK2A 2O61B 3DOSA 3MA7B 3QR2A 2BY2A 4HK0A 2NW3A 2FATH 3VGDA 4H26A 3ZMRA 1RFDH 3QUMA 3IXAA 1DSFH 2JIXB 4K3JL 2BNRE 3RQ3A 1DBBL 2LVCA 4WW2C 2BP3A 5KSAB 5I9QB 1NBZA 1RIVL 2NY5C 1T1XA 4KUCF 5T3XE 2F54B 1CK0H 4HJJH 1J0KA 4MA8L 2QADC 2UWEF 4JVPA 3GFUA 1KJVA 2R4RH 3VE0B 3RTQA 3QH3B 3A6CH 5C86A 1H8OA 4HJGB 2JB6A 3MREA 4H88H 4XBEL 4YDVA 2NNAB 1NC4A 1UJTA 2Z92B 1ZWIA 4OCYL 3ZHLA 1DQDL 4CVWA 4YXLL 2YMXH 2VZ1A 5J6HA 4HGKC 3EYVB 2PCPA 3HPLA 2NY4B 3RPIA 4LEXL 2AABL 3V0WL 1XFPA 3U7WH 4M4RA 5T5FL 1T21A 1P7HL 3E1F1 1S7SA 1OP9A 1CGWA 2VLLA 3GRWH 2DQIH 4JFPA 4ZXBB 3W39A 5CSZB 2EZ0C 3OG4B 3IJYA 4KKLD 3BD3A 2J88H 3R8BB 2YD7A 4P48A 4KHTL 4X9BA 5EU5A 2F19H 4AEEA 5T3ZL 1Z6JT 4F37F 5EC2B 3FOMB 2EIZA 2W92A 1TVHA 4RAUB 4KJYA 3V6OC 4ZFOA 2C3XA 5DJZA 2YC1B 4WHCA 2X9WA 1SM3H 3DV6A 4L3EA 3FFCA 1WJ3A 4Q9RH 2ERJC 1RZGA 1MCQA 1QACA 1XGYL 3IKCB 3FO9B 2DM4A 1OP3H 4D0BA 4WGVB 1L6XA 3ZO0A 8FABA 5EUOB 2PXYB 1XEDA 4ACPA 4TUJA 4I4WB 4L3CA 4RIRA 4WI3A 2WBJA 1FLRL 5ALBL 1G0YR 2JB5L 3IXTB 4R7NA 1XT5A 4QRRB 2PETA 5F1KC 3DRQB 3ULUD 2EICA 3OB0K 4YK4B 4H25B 3U9PH 3RVTC 2OQJA 2BOBB 3MNZA 4Q0XL 1IEHA 3MV9E 5E9DB 3BH8B 3SY0A 1NGXB 3QIUA 2F53B 3I85A 4WO4C 1SEQL 3DTXB 4TVPD 4QHLB 4ONHB 4XC1H 1FO0B 1R3IH 3B3IB 3DXAE 5E6ZA 4IDJL 1O5DT 3TFKC 1FPTL 1F97A 5KS9B 4ZFFB 1FAIL 1J7VR 1JHTB 3ULVE 1BFVL 5DEGA 5FYKE 3B2UD 3EFFB 4XAKE 2BHZA 5E99L 2VAAB 4XMPH 3X3GH 1CTNA 1JPSH 2NPLX 1WZKA 3OKEB 1YQ2A 3UTPE 4GG6A 1M71B 2ITDB 3S98A 1RZIB 2YPVL 5FB8B 5EZOL 1ULVA 4LSDA 3WLBA 1U8MB 5JW3H 1XH3A 3QWOB 4LSUH 1B9ZA 1SJEB 2W0PA 2VLRD 1AE6L 7CGTA 3G08B 1KN4H 2ADJA 4HWEH 1SQ2N 4LCIH 4M93C 5SWSB 4APQB 4Z7NF 1OM3H 2DJ4A 3HMXL 3WUWA 4KGLA 4UUJA 3P4OA 1C1EL 4JQXA 1MHHA 3WE6B 4MZ3A 4QRUB 4U1LB 1MELA 3NIDF 5K9QI 3O6KH 3BUYB 4WFGE 4JANB 2WM0A 4WEUD 5DHYA 3IFNH 1DANU 1RU9L 5AYQA 4BQCA 1QLRA 1T4KB 3TCLA 1JGDB 2IAND 4NT6A 4JLRB 4NPYA 3LPWA 4HSQA 5ESQA 3REWB 5FO9B 1DUZA 2DBLH 2RFXA 3D85D 2FSEA 2XQBH 5EFIB 2FZ3A 2DF3A 4FA8A 3ARUA 4X6FB 1NMCC 5E6IB 1IILE 4YAQA 4N1EA 3KYOB 4GG8B 4PJIF 1T20B 4Y8AA 3ECBA 3I02A 5C7XL 3MV8A 3PWPA 4LMQI 2BNRD 4S10A 4H1LA 1D9KB 5HGHB 3WYRA 2DD8H 5GRVL 1ZT7B 3U0WL 4Z0XB 5GHWL 3MRJA 1OAZL 5T3XD 4K94L 2CKBH 2CRMA 5M95B 4UI2A 3ULUL 3KHOA 1HDMB 2AEWA 1YEDA 3RUGE 5JHDA 5DD1H 1NUNB 3B5TA 4P0DA 4X99A 5D1XD 1E4JA 1Q94A 5E95B 3HNSL 1L9MA 4X5XB 5CIPA 4TVPL 2IPKA 1CG9B 4LSPH 1B4RA 3C60D 2AXFA 1QSEE 3B4NA 1MLCA 3MBEB 2R2CA 1TVBA 4O2CB 1F02I 2VXVL 3NCBB 2XWBA 4LOUD 5K9OA 4N9GA 3T2QA 4NO0B 1NGWB 3FQWB 3MO1B 4X7DC 2OSLA 1IGYB 2DTSA 3MJ7A 1KENL 3Q2CA 4Z7UE 5I1CH 3DX6A 4RX4D 1LE9A 1KG0B 1SYSA 3W9EA 1FVDA 5SV3A 4U0RC 4EZMA 4JB9L 3OXRB 1KPRA 1QO3A 5D96B 3V95A 5KAQG 1ADQL 1FVEA 2DMKA 4LPCA 3PWPD 4OJFL 3VFNA 4WI5A 3DETC 2HVKB 4FQHA 4BSVA 5I19L 2XPGB 4YEEA 4FQ1H 1RJLA 4IM8A 3LV3A 5ID1A 3MOAH 1ZGLA 3AGVA 4NJ9H 5DHVH 2BVTA 1MFCH 3IS0X 1LP9A 1R3HB 3RPKA 4EOWL 2X1QA 5BV7C 4N8CL 4NN5B 3ALWA 1ORSB 4R7DB 1LEGB 3BGFB 4OLWH 1C5DA 4XNQA 4ZUVA 2NX5B 1OLZA 1IAOA 4GRWH 1S9WB 3MV9D 5INDB 4J3UA 1G9EA 1A7BA 3HC0A 5TDOB 4U1NB 3D69B 4G43B 5ALCL 4MB5A 3GSQA 5IROA 2R0WH 2YD3A 3DXAD 5D2NB 1MIMH 3TBSA 4D0DA 5C70A 5GZNC 3LSOB 4UV7L 3O8XC 1JN6A 4XAKD 3VFGL 5GISL 5CZXD 2NY2D 1ETZA 4JY6A 5T3XL 4XVSL 2OMNA 3RVVC 3NOIA 3UTPD 4M8QB 4XX1G 3K80A 1OAXH 5DQJA 1X3DA 4WEBH 5I15H 5DQ9B 3WFBL 1U3HD 3H9SB 5TH2B 1MCRA 1J86A 3CSBA 2XTLA 3BGAA 3VI4F 4KZDL 3FQNB 4Y2DA 2HJKB 3SGEH 4JG1H 1T0MA 4KFZC 1F3DH 2BMKB 3I9GL 3OKLA 5FO7B 4JJHA 3WNKA 2A6IA 3QEQE 1IC1A 4GRLD 3O9WC 5FM5O 3DBXA 5EORL 5FIEA 2AI0L 3FQRA 4K9EC 4JKPL 2BCKB 2WQ8A 4CU8A 4ZTOL 3QDGB 2DI9A 2EYSB 3B6SA 4J6RL 4XBPA 3ARFD 5KSBB 5BVJA 2GY5A 3F7YA 2EKJA 4NZTL 2ZCLL 5FXCH 5D2LF 4KTDL 3UC0H 3BMWA 1LO3L 1I3RA 4DN4H 1XZ0B 3P2TA 5C08E 5CZVL 2Q3ZA 3LCYA 3CZJA 4P99A 1N6QH 4AK1A 4PGZA 4ODXB 4PJHA 3QPQC 1EVUA 1XIWD 3CZFB 3N1MC 2R2HB 4JFOA 2Y07L 3KPRA 5DD3L 3RA7L 4PGEB 2AQ3A 3LEXB 4DZ8B 3TYFB 3RP1A 3O2DA 4XB8A 2M2DA 4ODWB 5D8JL 3TZVA 3V0VB 2OMBA 4IRZH 4FFYH 1I85A 3VDBA 4MLIA 2BNUB 1QBBA 2EH7L 3MLSL 3RVWD 2BVPB 1KB5A 5AWNL 4YE4L 1PG7L 4FXKA 4ELKB 1JGUH 1UQSA 2MPAH 2W65A 3HE7C 2GQHA 5F72S 5FGCB 3TJHC 1KJ3H 4QO1A 5I1LB 3O2WH 4KZEL 4PRDB 2QSQA 1UVQB 2BJMH 3SGJA 1BWMA 5EN2A 4IMLB 3A6BL 4WUUA 3MRBA 3O4LE 1D5BA 2ZJSL 2GITB 1I1RA 5ESVB 1I1CA 3HZYB 1JFQH 4HX1A 4K71C 1B4JH 5C2BL 1KJ2L 2WUBH 2D3VA 1N6VA 4OFPA 1AD0B 4WU7A 3VW3H 1F3RB 4P9MH 3KLDA 2NZ9D 5DR5H 1IQDB 5F70A 1QSED 1X5HA 3HG1A 3ULVL 4P4RB 3PGFL 1GGIL 4JFYA 1OSZB 2PO6C 4KK8C 5IF0B 5D6DA 5FYKL 5F7MC 1FJ1B 3KYAA 1IGCH 2CUMA 3SDXB 1EFQA 2CR6A 3C09C 1ZLUH 1AHWA 4HAGA 1X5YA 1KULA 3QCTL 2H2SD 3H3PH 1E27A 5ENWA 1RUAH 3I6LE 2WV3A 3KXFA 4WI2A 1ZA3B 5AZEH 4GRWF 3QO1A 3CX5K 4D2NA 5IHBA 3KPRD 4PUBL 3F65A 1KYOJ 2R2BB 4FABH 2HA1A 2XTJE 3AUVA 2PYEB 3TZVD 3L1OL 5MENB 4XPAL 3DVGB 5D1QD 4DKEH 5I1GH 5IG7B 1YMHA 3NABL 1BVLA 4BH7B 1TJHH 3CPLB 4TPRL 2BOCA 2F8XC 2O5XL 3LKRA 1UADC 3C5SB 1KIQA 1EHXA 1QSFA 1T89A 2F54E 2Z31A 3CFJA 5TF1L 5GZOC 2W9EH 2P8LB 4FQXB 4KVNL 2W0FA 3RIFF 4PYHA 3JWDH 4N1HB 3B43A 5TE4H 4PJXF 2DYPB 2VN7A 4QXUH 3T0EB 4P2OC 5KSVB 3PJSB 2MSPA 3KG5A 3VFPA 1KIPB 3F7QA 4ZS6C 1GVIA 2R0KH 1MI5E 3PDGA 5CHNA 4QHNA 1U42A 5B4MC 4RMQA 2EIDA 4H0GA 5CJXA 4IJ3B 4Y4KA 3PQYE 1B2WH 5IBLC 3IYLW 5KVGL 2HFGH 1NCAL 4OCWL 3QUZD 4BZ1H 3D87B 4G7YH 5DRWA 4IOFD 1MHEB 1J8KA 3DRTB 2CXKA 5DXWA 4XXDA 2UYLA 2E9JA 3LQAL 5JO5A 1X6NA 2P5EE 4GRMA 1ONQB 3BI9X 4MJIA 2X4QA 4ONFH 4RMVA 3RTQC 3X14B 2Z35B 1U8JA 4G8GB 4GQPH 1FN4A 1UEMA 5DQDL 1YPZB 5HHNB 2FL5A 3U2SB 3CVHA 3V4VL 2WUCH 1GH7A 2XXMB 2HLFC 3KPQA 3OX8B 2B1HL 1MREL 5FM4A 3EDFA 3O41A 1RIHL 1G1YA 4ZPVB 2UV3A 4N90E 1YNKH 1MCPH 2A1WH 3T3PE 2J6EL 1FNFA 3BKJL 4JZNA 4HJ0C 1G7LB 4HQQH 1ITBB 2IFFH 3OR7B 1J1OL 1PSKH 2QKIB 1A1MB 5C08D 4AENA 1S7RB 3S35H 2V5RA 4FXGA 4GBXB 1JPTH 1F4XH 1U8IA 4NBZB 2GSIB 5C07E 1JGEA 4Z95H 3GUTA 3BSZL 7FABL 2CMRH 5DRNB 3EYSL 4HUWB 3UTOA 4FQIH 1KLUB 1SYVA 3FO1A 4EQ2A 1S7UB 3LS4L 1OPGH 4OFIA 2O61A 3MA7A 3O6LH 5EIIB 1IJ9A 3A0OA 1C5CH 1MRFL 3G6DH 3DI2B 4ZQKA 1PLGH 2JIXA 1BZQK 3BYYA 5KSAA 2A6KA 3LZFH 5HJ3B 1E6JH 4PREB 3VRJB 1IAII 4DK3A 2P42B 1RUKH 3KR3L 4BK4A 1RY7B 2FWOB 4UT6L 4NQVB 3UPCA 3BN9C 3VE0A 3QH3A 2WBJC 4MXWH 3LH2H 1ZVHA 5DUPH 3O4LD 1DBJL 4HJGA 1QTYT 1CLCA 1JGVL 2NNAA 2Z92A 4UDUB 5JUEL 3MGTB 2BDNH 3QIUC 3BESR 1VEOA 5F71A 1UENA 3UTSB 3EYVA 1I3GH 4NCC1 4O58H 2JF1A 2HFFB 2CK2A 3ZTNH 1GGCH 1MFAL 1N5AB 3CX5J 1G7MB 5IJVB 5BW7A 3VGHA 3I6LD 2DQUL 4F7PB 4PRPE 2VOTA 5EDXA 4LLAA 2BRRH 2WWKO 4ZXBA 2PTVA 5CSZA 5D5ME 3QUXD 3SKJH 1E4WL 5ACLA 4IHOB 1N2RB 4K3GA 2ADIB 2ZG1A 3SDCD 2FX8H 3RZCD 2XTJD 4KRPC 5EC2A 1BQSA 5TDPB 3FOMA 2FJFB 25C8H 3VA2C 1DQML 1WAAE 3K4DA 2UZXB 5D7JB 1KIUA 3D18B 4B53A 1SBBA 2YC1A 1TJIH 1JZ6A 4XT1C 5IR1B 5C2UB 2JIXD 3BD5A 3FT3B 3IKCA 2H6PB 3CFBB 1CDGA 5C0IB 1MEXL 5EUOA 2PXYA 2VIRB 2F54D 5EU7C 4I4WA 4M00A 2I5YL 3IXTA 4QRRA 5GGQH 1X7QB 3DRQA 4H25A 1OTSD 5IIEB 5A43C 2BOBA 2XG4A 3SQOL 5KN5B 1NCDL 3CIQA 1G1CA 2OI9B 5B39B 2RGSA 1MI5D 3JZ7A 1NMBH 5E9DA 3BH8A 1NGXA 2F53A 4ELMA 4GH7B 5K9JL 3DTXA 4WJ5B 4QHLA 1ZT4B 3C5ZD 1FO0A 3B3IA 1CLZL 3FRUB 2NY4D 3PQYD 3QHFH 4FP8L 4X4YB 1OSPL 5KS9A 4G8IB 3K2UH 4JKKA 4ZFFA 3CDYA 1JHTA 4OD2B 3MZTA 3EFFA 4MHHG 2J3SA 4HFWB 4OZFB 1U3JA 1MOEA 2VAAA 2FX7L 3JBG7 4S1DC 5GSRB 2ZOKA 4G6AC 1PFCA 4ZXBD 3OKEA 5EUKB 5IB2B 1NAML 1M71A 2ITDA 4U4BA 5A3IC 5C0RL 5I8EA 4YPJA 2P5ED 3HNTH 2BVEA 1A4KB 5FB8A 4NRYA 2QQLL 4UMGA 5F96L 1U8MA 3QWOA 1QLEH 1SJEA 2D4FA 5LJYH 1W72H 1EHLH 3E3QE 3G08A 3KPSB 4X6EB 4ZFZB 1X5GA 2GAZB 5HGDB 4APQA 5SWSA 5FKPB 3V4PH 1KCSH 1NCTA 4M61B 4N90D 2UWEE 2FEDD 4DZBB 5T1KD 5DVNA 2ZCHH 3V8CA 4PJXB 5F9OH 5J6GB 4QRUA 1U3YA 5ISZE 4NQDE 5E4IA 3GO1L 3SBWA 1PY9A 1NDMA 1U95B 4JANA 3VI3F 5E2UH 3VD3A 1T4KA 3IJHB 3DSFL 1JGDA 5C07D 2NX5E 4CVZB 4JVWA 3VWKD 4JLRA 4CU7A 3REWA 2EYTB 5FO9A 3P11L 1GC1H 3GIZL 4M1CD 5IFAH 2WMPA 3C9NB 4KY1L 2CDEA 4MVBD 4DAGH 2VNCA 1KV3A 3NGBC 4X6FA 5FECB 5E6IA 2BXYA 4MNHB 3KYOA 4GG8A 1T20A 2JE8A 1ZMYA 4F57L 5IGXL 4KMQA 1OHQA 5FK9B 2QHRL 1HH9B 1D9KA 2DMBA 5HGHA 3TBWA 1A7RH 4RFOH 1ZT7A 4MB4A 4POZC 1M7XA 4PD4K 4HLZG 3JV4B 2IPUG 4Z0XA 2B2XL 2R8SL 4NSKB 4M7JH 1HDMA 4XXCA 1X4YA 5TPWL 3ZDZF 1WBZB 4MJ2A 3UAJD 1YJDC 2VJXA 5GRUL 3FO0H 5EOCL 1AY1L 1EFXD 3BPNB 1ES0A 4LKCB 1CG9A 4JHZA 2XIDA 5I1JL 2P49B 3UJTH 1MHCB 4L4JA 5HYIA 3IS1X 5IROC 4D8PB 3MBEA 3LN9A 3S6CA 4O2CA 2PNDA 5EZLB 1IT9H 3A67H 2AW2A 2FJGB 5ITBH 3SE8L 1P5VA 3BPOC 4W6XB 4NO0A 1NGWA 5GSVB 3MO1A 1IGYA 4QT5B 1RQ5A 1HNGA 5DC9B 4LSSL 4LLVB 4TSBH 2IH3A 2FO1A 2XZQL 3TBVB 4NQSA 1OWRM 1LHZA 4I2XB 4P5TB 1N0LA 2DM7A 3BVNB 1ZA6A 3L5XL 4Y2DC 4DKAA 3JWOC 3IJSB 3RWDB 4OZIB 2V17L 4NQXB 1JYXA 1NEUA 1D5MB 4AIZB 4CW1B 4QGTA 2KDGA 5IMKB 1I9IL 5C0AA 3U4BH 3RIAF 2XPGA 3RNQB 2K9UA 4JM2F 4LIQE 1UFUA 1LK3L 3ZSTA 5DJDB 1GYAA 1H3TA 3QCUL 2HH0H 4JM4H 1J87A 1KIRB 1R3HA 1R3LB 4Z7NE 3IDXL 4R7DA 1ORSA 3OKYA 2VDRH 4PRHE 3ROOB 1LEGA 1YEKL 5ESAB 3O6ML 4UINH 2PW2B 4U6XB 4YFLF 3IFPB 1KC5H 3GKWL 3QDMB 2JKXA 1S9WA 2QV2A 5TDOA 3NIDE 4U1NA 3D69A 4G43A 2QSCL 1MJJB 5D2NA 3GMNB 4XP6L 5CSBA 2RB8A 1ZEAL 2D03L 4I0PD 1UWGL 3LSOA 3BP6B 3S9DB 2AJSH 3L3GB 2X10A 3IDGB 3TIEB 3TZVC 1ZANH 1TZIA 2APFA 3QG7H 3WS3B 4OZHA 3TA3D 3SPVB 1I85C 1ZOXA 2BSED 3G5YA 1S9YB 2GHWB 5HYFA 1IE5A 4M8QA 2JJUA 2NTFB 5DQ9A 5BZWB 3U4AA 4PJIE 3H9SA 4NYLB 5TH2A 5GS2H 5B39G 2B0SL 4Y1AE 1EERB 3SGJC 4XCYB 5C1MB 3FQNA 1KTLB 2YRPA 3EJJX 2AVGA 4OCSH 4JFFB 2BMKA 5F1OB 5FO7A 1FBIL 4RAHA 2FIRT 3CXHJ 1E6OH 4KUCD 5DDHB 4M03A 1JWUB 1HYSD 2WW8A 5MENE 3MGOB 2H1PL 4JGMA 1IMHC 4XNZB 2IAMD 2BCKA 4OZFG 3QDGA 3QDAA 5D6DC 4R4BB 5KSBA 3GJEB 4LRNL 3BKCH 1AHWC 1AQDB 1J5OL 4IRJB 3ARBB 1XZ0A 1TTFA 1KLGB 4IOFC 1Q1JH 1F5WA 2NX5D 2OTWB 3ZKXC 4ODXA 4RA3A 5AZ2L 4JFEB 5HGAB 5C6TL 3CZFA 1OF2B 2R2HA 1NDGB 5BOZG 4OBSA 5C0GB 3TGXA 5DO2D 3U9UB 4PGEA 1ZS8B 1JRHI 3FAXA 4HWBL 4LP4A 4X7FC 3TYFA 1X5XA 4JKLA 5KZCD 4DTGL 1E4XI 3HUJB 2EEAA 3KPOB 4JVUA 4ODWA 2E9BA 4J1UB 3S3JA 3V0VA 4QRPE 4PJ5E 3O2VH 4DUXA 1YEEH 1AR1C 2YOCA 4G3YH 4YHKL 3TT3H 2C4FT 2HMID 4F58L 3CVIL 2BNUA 2Q8BL 2UY7A 2BVPA 3P9LB 2ZUWA 1I8KB 2YPLA 5DD0H 4ELKA 2ADFH 1WCQA 2V5SA 1RZKC 4URTB 5F93C 1HHJA 3Q1SH 3EYUL 1B3JA 1BM3H 3TPUB 1T89C 1UVQA 2Z31C 3O45B 2E7LC 3OZ9L 3CSYB 4IMLA 3MRLA 1II4E 4LCCA 3SGKA 1CGVA 1QBLL 4MWFB 2GITA 5ESVA 3HZYA 3QEHB 3DNKA 3MLWL 5KVFH 5LG1A 1UYWH 1AD0A 3EJYD 5LXGH 4NO3B 1IGIH 5TQ2L 1IQDA 2R1XB 3RWGB 2DDQL 3CSPA 2J8UF 1OSZA 5IF0A 5LGHL 3QDGD 4HIXL 5CJXC 4Y4KC 3SDXA 4P9HL 1MNUL 1CTOA 1DLHA 1Z3GL 2Y36L 1JI2A 1HXYB 5FCSH 1REIA 2ATKB 5FHBL 2NY5H 4PBWD 1A6WL 3RHWK 1MFDL 1ZA3A 3KLSA 4P2QE 5F7KC 5JQ6H 4PJDB 1BBDH 1DCLA 4ZAKA 4CN6A 4YHZL 3HB3C 1INDL 1CS6A 2R2BA 5A2FA 4X80H 3PABB 1A64A 2PYEA 3UJJH 4LSVL 5TE7L 4MQXD 4OF0A 1HSBA 3VD7A 5HHPB 1ACYH 1L4IA 2MHAB 3QDJB 3DVGA 4LLUA 2GJ6B 5DVLA 4BH7A 3OHXA 1RJCA 4LEOB 4YHYC 2V9QA 4OB5H 1NMAL 3LDBC 3SN6N 1FDLH 3G5ZB 1KT2B 4YDIL 2EDHA 1HOCB 3ZKMD 4PB0H 2P8LA 4FQXA 5HDQL 2H2PD 4QLRA 4PRHD 1TNNA 4I1NB 4ZODA 4WNQB 3Q3GB 1FFRA 2DYPA 3T0EA 5KSVA 1QP1A 3PJSA 3VRLF 2APBA 5F3BB 1YYMH 1KIPA 3DV4B 1I9RL 2B39A 4R2GB 2CJUH 4GAJL 1S9VB 1K2DB 1BVKB 3FB8A 3UTSE 5D2LE 3KYKL 3PL6B 2UZIL 5EB9A 2N56A 4A6YH 4JO2L 1YEGL 1CIUA 5ICXB 1R6VA 4BZ2H 2YD2A 1ZHKA 4XMKL 1HYRC 1P4BL 3MLYH 4FFWD 1YMMB 4X6CB 5HSFA 2IQ9L 3RL2B 3TEUA 5DK0B 1MHEA 2OL3A 3MRMB 4YBQD 5DRXB 1FZKB 4WY7L 5I9QC 5KSAC 4MYWB 1LWRA 4KJPC 3PV7A 5I1DB 1EEQA 2Q20A 2BVUA 4FS0A 1OAQL 2QQNL 3RDTB 3HZVA 3VD5A 35C8H 3X14A 2O5ZL 1A47A 2Z35A 4G8GA 4XPTL 5IKCB 1YPZA 5HHNA 3U2SA 1EO5A 4ONOA 1DLFL 3JVGA 1IEAB 3OX8A 3W5MA 5MEND 2KZ1B 1NKOA 4ZPVA 4Z18A 3WLWD 1UJ3B 3HMWH 2IQAB 2VXUH 1JBJA 1ZLUK 3OJMB 1U8LB 4NKIH 1G7LA 5CUSH 4HCRL 4ZSOB 4FQXD 4MNGE 3OR7A 1IM3B 4YQXH 5BW7C 3KLAB 4HH9B 1K8IB 1LO4L 2QKIA 1Q0YL 1Q38A 2DYPD 5E08L 4GBXA 1Q9WB 4YHNB 5SX4I 3HRPA 3RGVB 2GSIA 4ZXBC 1QRNB 2QL1A 3HHRB 4PG9B 5DRNA 4L5FL 3IU4H 4HUWA 1KLUA 1QNZL 1SMAA 1S7UA 1NPUA 5EIIA 3MLZL 1U9KA 4QRPD 4PJ5D 5I1HH 4GRWE 2R4SH 5D7LB 4XI5D 5E5MA 2P5WE 4WW2F 4LIQL 5TFSL 5ECJE 4MJ5B 3SHSA 1I9EA 3DWTA 3OJDB 5F7WC 2DI8A 2DWEB 2FATL 3S35X 1RFDL 3GKZA 5HJ3A 4PREA 1DQQB 1W2KT 2VWEE 5HD8C 4NC1E 1DSFL 5E5RB 1JWMB 2VXSH 2PXYC 4WHYG 2KBGA 3GHBH 2FWOA 2H26B 1QRKA 1JGLH 4LCWB 4OAWB 4V2CB 5EA0H 5EG6C 2DWDA 1LEKB 3IGAB 4HJJL 4G7VH 4YK4C 1RZFH 2BHUA 4RISH 5J12B 2R4RL 3A6CL 3MGTA 2AK4E 1QG3A 4H88L 2FB4H 3W81A 2VDLH 4ZUSB 3EOTH 2HFFA 4PJXE 4IRSB 1FC2D 2EDRA 2YMXL 4U1KB 4WHTB 1G7MA 3EIFA 5IJVA 1EJOH 1PD6A 2H8PB 2CLRB 1KXVC 1H8SA 2EXWC 5DFVC 3Q6GH 3QQ4B 1F3DJ 4L8SB 4NBYB 5IFHH 4YX2H 3BDYH 4P2QD 4X5WB 2BFVH 1KJ2A 3U7WL 3ZYOA 4XH2B 4OGYH 5IWLA 1F13A 1HHHB 2AJVH 1N0XH 2VN4A 4IHOA 1N2RA 3V5DB 1KEMH 2ADIA 3GRWL 4ONGH 2DQIL 1DBAH 5TDPA 3VWJB 1IKNA 2FJFA 2J88L 1ZT1B 3QNYB 4XVTH 4EI5A 2F19L 5D7JA 1U41A 1DVFB 5IR1A 1CD8A 4APQC 3FKUS 3FT3A 4P2CG 2IPTH 2FCBA 3CFBA 3ZSSA 2VLKB 3PGCB 5C0IA 4M6MH 1HQRB 1IM9B 1SM3L 2NR6C 4Q9RL 2VIRA 4Z7VF 5JLZB 4HF5H 3VXSB 1R3JB 3WNPA 5A40E 5CEXB 3SBWC 4OGXH 1X7QA 2G60H 5IIEA 4TOYH 1RZJC 1FNGB 3B9KA 4F3FB 5KN5A 4LLWB 5H35A 1PX3A 3U9PL 4JR9H 1XAUA 4BSJA 4WJ5A 1ZT4A 3MRKB 3DUHA 3UTSD 4MMZC 4X4MA 1J0JA 1N26A 3FRUA 5E1AB 3S34H 5E6IC 4DK6A 4G8IA 4PJAA 4OD2A 1WIOA 4XC1L 1A6UH 3K8LA 5DS8B 4N8VB 4YEFA 1R3IL 3P0YH 2A9MH 2XY2A 1Z9SA 4JZOB 4HFWA 4NGHH 1TMCB 1OD7A 1D9KC 3MV7B 4HAFA 5EUKA 3U4EA 5IB2A 2F5BH 1EGJH 1SY6H 3V2AR 1ZSDB 2W91A 2VTFA 1CE6B 4XMPL 4X7EC 1A4KA 5BV7H 1JPSL 4Y5XB 1H3VA 4NDMA 4XXCC 1F4YH 4HKZB 1NL0H 2WIIB 3RBSA 4F8QA 3KPSA 4X6EA 4GKZB 4ZFZA 2GAZA 5HGDA 5JW3L 3O6FD 4HUUB 4LSUL 4F7EB 5FKPA 1NANH 4KK5D 4M61A 5LKNA 1KN4L 4HWEL 4BELD 4LCIL 4TULH 3MBEC 1OM3L 2QSTA 4AY0A 5CJOH 3GB7A 1NGQH 1IRAY 1U95A 4X4XB 4MA3B 2X1XR 4MAYB 3IJHA 3QRGH 3O6KL 5F97E 4CVZA 2B1AH 2CGRH 1A7NH 2VRAA 2PTUA 5CCKH 2VZ3A 3EGSB 3IFNL 3TP4A 2EYTA 4A2LA 1U93B 3EO1B 5ITFB 3VCLA 3C9NA 5FECA 2VDPH 4MNHA 1TZGH 1UWEH 2DBLL 1EBAA 2XQBL 5IVZB 1HWGB 2C4XA 3QJHB 5FK9A 3MXWH 1ZLVH 1HH9A 4K9EH 2XACC 2NXYC 1G6RB 1DE4B 3JV4A 4HULB 4KVCH 5GRXG 2Q76B 5HI5D 2EDBA 4NSKA 4G6FD 2D7TH 1AXSA 2DD8L 3P0VH 4RAVB 5DC4B 4N8PA 3TWCH 1WBZA 3B83A 4NN5C 3RWCB 3VXNB 1FL6B 5CZKA 2CKBL 3BGFC 4UBDD 4XNXH 3HA0A 3EJZD 2IC2A 2IBBA 3I6KB 5DD1L 4PJBA 4LVNB 3MLUH 6FABH 2A2QT 3PP3H 4ODVH 5E2TH 1MHCA 2YEZB 1KPVB 2HJLB 3H9HB 4N0FB 5EU6B 5I1IH 4ZYKB 4LKXB 5D2NC 5IB3B 4LSPL 1NCUA 2DKSA 4NQCB 1KCUH 5EZLA 1VFBB 3GZKA 2FJGA 2BHYA 2D7MA 4PJ7F 2DICA 5GSVA 1A7PH 2D9QB 2KZWA 4LLVA 3N85H 1V05A 3H42H 5IVNA 4ZD3H 1YZZA 3TBVA 2DS4A 1L0XA 4IEFB 2NMSA 4XB7A 2AXGB 4I2XA 4P5TA 4Y19B 3BVNA 5DT1H 5I1CL 2IMNA 1EHNA 3RWDA 2EKSA 4OZIA 4NQXA 1P7KB 4AIZA 4CW1A 3WFHB 4EXPX 1MIEH 3KYNB 3EO9H 2HT2D 4UOW0 3RNQA 4CMHC 2VQ1B 5HHOB 5DJDA 3GJFK 4FNLH 4U1GB 1H3UA 1FZMB 5CKAA 4FQ1L 1Y6MR 4HUNB 1KIRA 4HIHA 1R3LA 3T2OA 3GDBA 1H15B 3MOAL 4R3SB 1G0XA 3ROOA 5ESAA 4NJ9L 1AGDB 2ZOLB 4U6XA 3IFPA 1MFCL 4QY8B 2QLVB 5D7IB 1A0QH 3QDMA 1AC6A 1OW0A 4X7TA 1PBYA 4OLWL 3V7MA 3LEYH 1MJJA 1S7XB 4OFKA 5IUSA 5IB1A 1ZVYA 3GMNA 3VI3E 2XXCB 2FEEL 2ZUUA 3D0LB 3BP6A 2R0WL 2X9XA 3L3GA 3BIAX 3IDGA 4MQXC 3RWHB 3TIEA 1AH1A 4ZUTB 1MIML 1G9NC 1ERNA 3WS3A 1Q9LB 3SPVA 4OF8A 4RA0C 3X11B 1S9YA 3HNVH 5DJ0B 1OTTD 3DO7B 2NTFA 5BZWA 1D5XB 2VZUA 5IESH 1W0WB 4PRNB 2NXZD 4I0KA 1KTLA 4LCCC 1OAXL 3SGKC 3DVFA 4PLJC 4JFFA 3T0XA 1I7ZB 5DDHA 2NZIA 1JWUA 4Z7VB 5JDSA 3T0VA 4JG1L 5T1DH 4KJQD 3MGOA 3OAYH 5E7FA 3X3FH 4N8VG 1P7QB 5DLMH 4I5BB 3ZDZE 3QFJE 4PLNC 1CN4A 4R4BA 3GIVB 1A5FH 4MNQB 1MCDA 5ERWB 3QUMH 3SDDB 2N1KA 1R5VA 3OAUH 4FTVB 1AQDA 4IRJA 2F5AH 3ARBA 1KLGA 1PJ9A 2L4OA 4JRXE 2OTWA 2H41A 4RBPH 3UC0L 3H9ZA 4JFEA 4JEGB 5HGAA 4Q2ZB 1U58B 4DN4L 1ZHBB 2A6JB 1OF2A 4OF6A 5C0GA 1N6QL 3U9UA 3D2UB 1ZS8A 4JFDB 1VA9A 2Q1EA 3QXTA 3HUJA 3KPOA 3MV01 4J1UA 3FB5B 3QO0B 3CAFA 3IDJB 1AXTH 1YMME 5LVEA 4ZG1A 3P9LA 3KNBB 4R4ND 4WFFE 3CLFL 4IRZL 4FFYL 3FHQA 4OIAA 5MHSE 1X9QA 4XNMB 3UPAA 3EO0B 1BQHB 4DVRH 2EC9T 4BKLB 3TPUA 4K8RD 3O45A 4FQXC 3AS2A 1JGUL 2MPAL 3L9RA 3NCEB 3UYPA 1KJ3L 2Y06H 4MWFA 3O2WL 2XNAB 4QRSB 1YEHH 3T0EC 3MPCA 2BJML 3QEHA 1OGTA 2YK1H 5HPMB 3MZGB 2EDYA 4NO3A 1VPOH 3MA9H 3BEVB 2R1XA 3RWGA 1JFQL 4P59H 1OARH 1B4JL 3H3BC 1GL4B 1J8HE 2WUBL 4PP2B 5CEYB 3VW3L 3TVMD 4P9ML 4IJ3C 5CLTA 3ARGB 5DR5L 4KMLB 3QJFA 2AKRB 5IW6B 1HXYA 2XKNA 5GGTA 1IGCL 3PIQA 1NMCB 1FSKB 2F8VA 5JORB 4NM4H 2F58H 4PJDA 3MOBH 2JCCB 3RVXC 4A6YB 3H3PL 3MRRB 2OCFD 1EO8H 1RUAL 2VMFA 2A38A 5AZEL 4M6OH 2X4TB 3PABA 3GBMH 4HHAB 5C9JB 5FYKU 3U0PB 4FABL 3JVGC 4KKAC 1NQBA 5HHPA 3Q0HA 2ENYA 1G9MC 2MHAA 3QDJA 1NAKH 2ITCA 3ES6A 4OCRH 3MRNB 2GJ6A 3QFDB 1HHGB 3H2WA 3Q6FA 1AGEB 1YDPB 2JJVA 3VMNA 3BKMH 1N64H 5HI3C 4DKEL 3V5KB 3G5ZA 4CL7A 1KT2A 3W2DH 5GRWA 5I1GL 5D71H 1HOCA 1TJHL 4XHJD 1A3QA 4XRCA 4NZJA 5LCVH 3RL1B 4LCWE 1QFWM 4WNQA 3Q3GA 5F89B 3GSXB 1LVEA 4NNXA 4GBXC 4YO0B 2W9EL 5D1ZB 3JWDL 4L4VA 5F3BA 4S0SD 5TE4L 3DV4A 4JHBA 3HC4H 4QXUL 4OUOA 4DGVH 5B21A 4RGNE 5IB5B 1S9VA 1K2DA 1BVKA 1U8QB 2D31B 3PL6A 2R0KL 1MCWW 4WEMB 1FORH 5ICXA 1ZHNB 1WWBX 4KMTH 1N6UA 4PFEA 2CQVA 5T33H 4KDVA 5FO8B 2W59A 1EO7A 4X6CA 3STZB 4POUB 3RL2A 1B2WL 1S8DB 5DK0A 5DRXA 3MRMA 4I13B 1EXUB 2HFGL 1FZKA 4NKQB 4ZUUB 1NGYB 3VFUB 4K8RL 4BZ1L 5I1DA 4G7YL 4O00A 2NY0B 1T6VN 3DARA 1OQOA 3FT4B 4Y2OA 3RDTA 3MUY1