1FC1A

Crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
b'PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FC FRAGMENT
publication title Crystallographic refinement and atomic models of a human Fc fragment and its complex with fragment B of protein A from Staphylococcus aureus at 2.9- and 2.8-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 36
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1981-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fc1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fc1A01
1MY7A 4RBPH 3MJGX 4BZ1L 5TH2A 1KFAL 2MCPL 1M6OA 3WSQH 1LK2B 3B9VA 3DX9A 1QEWA 1TVDA 3DUSA 2O5ZL 1T0MA 4IHOA 5EC2A 4PP1C 2EDYA 5AZEL 1CFNB 4JQVA 4MJIE 1UVQA 4PJEB 1BFVH 1ZAGA 1WCBA 35C8L 3LPGA 2A74A 1NGPH 4P5TA 2ZCKH 4LCIH 1KXQE 5DJ0B 1BX2A 1RZIB 1FCCA 2WINB 2CO6B 5FYJD 6CGTA 1CCZA 4HKJA 1XGPA 1BLNA 2Y7QB 2Q86B 1A5FL 4OJFH 4U3CA 3CFCL 1EGJA 1I3VA 4NQDA 1B0GA 5J1AA 4HT1L 4YPGB 5CLWA 3C8KA 4QRRD 5C0EB 1Q72H 4Y4HB 3VJ6B 1BF8A 4G8IA 1G0YR 3MGOB 3JV0A 4NN5C 5CHNB 5F70A 3WFEL 2UZXB 3QR2A 3BPLC 3PHSA 3AAZB 4ODHL 1FRGH 3L9RB 3W0WE 4HWEL 2YA0A 4WWKA 4BH8B 3PL6A 4GXUM 4Z0XA 5TE6L 2XTJD 1F8TL 3BN3B 2XWTB 4UDTB 5EU6E 4JQXC 4I2XE 1GYAA 3RDTC 5E4EC 3STLA 4EN3A 5FUCE 5J7CC 2BRQA 1Q1JH 2E9JA 2E8YA 1AO7D 3QQ3B 5KG9A 1MHCA 3KWWB 3QDJA 1E6JH 4WENB 1N2RA 3HZYA 3KPSE 4WW2C 4XNZB 1RUKH 2CIKB 3AREB 3IU4L 3WIIL 3IDGA 3OL2A 5E6IC 4YHNB 2DJ4A 3D2UB 4R4FL 1HDMB 4PYHA 2BDNL 4J3WA 3MR9B 1J7VR 4HS3B 3T04D 5IMKB 2BSTA 4NHUA 2XA8L 2R0LH 3BZFA 4G8FA 4YHKL 3H7BA 4PV9A 2VITA 2BMKB 5GS0L 4WI6A 2Y6SC 3HN3A 3ARBB 1A3RL 4R3SA 1TIUA 3I6GB 3K2UL 3MBED 4ZNEA 5KN5B 5FO7B 4OLWH 4J3SA 2BSSB 3ES6A 1SJXA 4N9GA 4GUPA 4JG1H 2P5WD 4F3FA 5DFTA 8FABA 5BOPA 2HRPL 3CSYA 4PJ9B 1VGEL 4RGOH 3VXSB 1H3PH 12E8H 5BZDB 1JWSB 1KBGL 1DQLH 3DOSA 1UWEL 1JZ5A 2R2CA 2C3VA 1OP5K 5I9QB 2ZKHL 3SKNA 4BM7A 3LKRB 3EO9H 5FA3B 3CU7A 3LQAL 2F58L 5IBLC 3PWNB 3ZDYF 3ULUH 5DDHA 3ULVC 1YPZB 2EZ0C 4YWGH 4HQQH 3OZ9L 3G9VA 4C4KT 4H0GA 4NQEE 5IMMA 4LF3A 4XXCA 5E5MA 3TVMB 4HS6B 3QO0B 2EYSA 3BDYL 2BNUB 3VXPB 5ALCL 2BVQA 2R15A 1XF4B 2AK4D 2RGSA 3IDMA 4WI7A 2Q8BH 5IWLA 4QGTA 1FAIH 2G2RA 3MV9A 4MSWB 4NT6A 2DTMH 1QSFE 4UT7L 3EOBA 4JFYA 5J11C 4NOBA 2OTWA 1MLCA 5IKCB 4PJDE 3ABZA 5CMAB 1GPOH 4JFPA 5K9KB 1NLBH 1TNNA 3NZ8A 5JR1H 1T3FB 3X12A 4XAKE 4OCYL 5IFAL 4Y0GA 1NANI 4KY1L 4YLQT 4JGJA 3RNKA 1WWCA 3FN9A 1X4YA 2D31A 2CO7B 3HC0B 1NEZG 4HLZH 3LDBC 1CFNA 4LNRB 3C5JB 1YEFL 4IRZH 4PJEA 4ZFFB 3LIZH 5JOFA 4M6OH 5ADPL 3QZWG 1KN2H 5DJ0A 1RZIA 2WINA 4U3HA 3VXTA 3V5HA 3WIHH 2BVOB 2DKUA 4R0LC 2Y7QA 2Q86A 4I3RH 5I8CA 4I3GA 5FM5M 2IAND 2XKUA 5EFIB 1ZHLB 4YPGA 3AB0C 4WUKH 5C0EA 4Y4HA 4LLDB 3VJ6A 5ICZA 4DOHB 2UZIL 4O4YL 3MGOA 2ATKB 2NY3B 3C5ZB 4KQ4H 5CHNA 5ITBH 1NCTA 5E6YA 3AAZA 4DWHA 4PRAB 3O11B 5CINL 3L9RA 3W2DH 2ZUQC 5D2NB 4BH8A 3A6BH 1MEXH 1OAUL 1YA5A 2XWTA 4UDTA 5C0BE 1FYTD 3MLZH 1P2CB 3WE6B 1TJGL 1CLOL 1G7IB 4N90E 5GGVY 1NL0L 1CTOA 3P9LB 3VFMB 3QQ3A 2EDTA 3KWWA 3L3DB 1KTRL 4GG6F 4M7LH 4UU9B 2CIKA 1G9ML 3AREA 4JN1H 3WEXA 4YHNA 1G6RB 3D2UA 3T2QA 1U3HB 1HDMA 1G6RH 1W8OA 4BFGA 2DTSA 1BZ9B 3QUXB 3MR9A 1OW0A 3FQTA 4HS3A 2Y06H 5IMKA 2EDHA 4IRSC 4X6DB 5B8CB 1MCJA 1FO0L 4NKOB 1LP9F 2BMKA 2QQKL 2QQLL 1XGRA 5A2KH 5GS3A 3HB3D 3ARBA 1WSST 1KIUA 5FDYA 3I6GA 4YHPB 5KN5A 1EK3A 2C4XA 3FRUB 5FO7A 2ED8A 1YEJH 3OAUH 2BSSA 2ZUXA 1WFTA 4NFDA 4XVTL 4PLNC 1JZ3A 2HTLC 5K9QI 4DW2H 3S37X 3CPLA 3TN0C 1A7PH 1I9JL 1MJ7L 1RU9H 3D18B 4NNYB 5BZDA 1JWSA 3UTTE 3C5SB 1FC2D 5GJSH 3PWUA 3QUKB 3RL1B 5E00B 4ZD3H 4WUUE 5HHNB 3MCKB 1I3GH 1NGYB 3LKRA 1F2XK 5FA3A 3PGFL 3PWNA 2VNCA 2WSKA 1JPFA 1NCWH 3VGDA 1S7RB 1FVCB 2JCCB 4NQCE 2YN5A 3TVMA 5JPMB 4K8RD 4Y5YA 4C4KO 3QO0A 2EC9T 2ENYA 3PWPD 2BNUA 1KCLA 3QPQD 3V6FB 3VXPA 1HIMH 1WV7T 1XF4A 1GGUA 4N0UB 3C8HA 1H8OA 2DQDL 3BZDA 2JELL 4MSWA 4U3XA 5FUOH 4PB9L 5EBWB 4OIIH 2YPVL 4HFUH 4JY4B 4XZUB 5IKCA 4FP8H 2R29H 4O02H 7CGTA 1P4BL 3DX8B 3GI9H 4JJHA 2YUWA 4PRIA 4U1GC 5CMAA 5K9KA 5EOCL 4DTGL 3ZHLA 1T3FA 4OD3L 1HXMB 4QRUB 2O93L 3MRQB 2NY5H 2D0FA 4R8WL 1OB1B 3KPNA 3T65B 1TTUA 4ZO6A 3QQ9D 4N8PA 2YC1B 3HC0A 1MRFH 2DL2A 1XGUB 1YN7B 3THML 4LNRA 3C5JA 5FUZH 2W65B 4IS6B 1RK0A 1ZLUK 4ZFFA 1S9KC 4GBXB 2FJFB 3O6LL 1J0JA 4WFHD 3BQUC 4G6JH 4HWBL 2BVOA 1I1FB 2YD1A 1FVEB 4NNXA 5CD3B 1ZLWH 3QDGB 4O58L 3KLHD 3VWKB 5E99H 1ZHLA 2WBJB 2VR9A 1BQHG 1RIUH 2LU3A 4LLDA 2ATKA 2RCSH 3C5ZA 1MCNA 4M1CC 3EDJA 4K9EH 3DMMC 3GSQB 3WN5C 3AVEA 1A7NH 3BP5B 3QI9B 3RBSA 2HT2D 3ZHDA 4PRAA 1MREL 3O11A 4K23H 4A6YB 3EJYD 1LO5B 4A6YH 4LIQE 2NY1B 4HS8L 3Q5YA 4OFVA 3WE6A 1P2CA 1XH3B 3QIBC 4HIIB 3ZKXB 1EGJL 1G7IA 1S3KH 1JYNA 2KL6A 4Z76A 4ZTOL 5GRZA 3P9LA 1FN4B 4KK5C 3VFMA 3EDEA 4GXVL 1DL7H 3L3DA 4MX7B 3HE6C 5D9SB 4UU9A 2LVCA 2XRAH 2W0LA 1RZFH 1X5AA 1MFDL 4M8VA 5D7LD 1U3HA 3OSKA 2AQ3A 1BZ9A 4CAGA 7FABL 5JXEC 3QUXA 4NO5A 4LCCB 4QRRE 4X5XB 1ZHKB 5E2WH 2P49B 3NIFF 1BZ7B 3QEQE 1OHQA 4N8CH 4X6DA 5B8CA 4NKOA 4HUWB 1D5MB 5IUSA 5L88H 3IDYB 2YEZB 5DGRA 4D9LH 4OBRA 1IQDA 3TYGH 5KVGL 3F58L 1U36A 5MERB 2XTJE 5HHMD 1HHIB 4JFFB 4KPHH 3C2AL 1EV2E 1K8IB 3FRUA 4D0DB 3ARWA 1S8DB 4QXWA 1D9KC 1IC4H 2VZ1A 5EU3A 5EA0L 4X8JB 4I13B 4Q9QH 5TQ2L 2LTQB 4UILL 3D18A 2HT4D 4MZ3A 3C5SA 1KCUH 1A6WL 3QUKA 3RL1A 2VDOL 3O81A 3QFDB 5HHNA 3SDDC 3MCKA 2XKSA 1NGYA 1MCOL 4LCWE 3MOQA 4L4JA 4MS8D 4GMSL 4MVBD 2MQCA 4JFOB 4WTWA 4V1DD 4G3YL 2QSQA 2ZCHH 4XCCH 2JK5B 1S7RA 3BXNB 1Y6MR 1FVCA 2JCCA 2WLYA 3DRTB 5JPMA 1SBSL 4OM0H 4I48B 1FLRH 3D85B 2X9XA 4K3EL 3V6FA 1UCTA 3EJJX 1ZANL 5HD8C 1G1CA 4N0UA 5D7IE 2Z9TA 4GS7B 3TC9A 1U92B 4Q0XL 4RMTA 3MRIA 3OKOA 1MVUB 5EBWA 4JY4A 4XZUA 5EZIL 4ZPTB 3S5LB 1BFSA 3DX8A 4AENB 1YN6B 1EFXD 4QHLB 2E7BA 1G7QB 4QRUA 4K3GA 3MRQA 3WKMH 3W82A 3TZVB 2IG2L 1OB1A 1S7TB 3T65A 3LN5B 1LDSA 1P69B 3W9EB 2YC1A 4PBVC 3MUGB 4E41B 1DLFL 1MIMH 1XGUA 2A6JA 1XFPA 1YN7A 2NX5E 3B9KC 3K8KA 2W65A 4IS6A 3SBWA 4PJ7A 3L7EB 4GBXA 1KEMH 2FJFA 3MLSL 1U8QB 2NXZC 4EJ1C 3SJVD 1RZ7H 1JF5A 4I18C 1I1FA 1TXKA 4JZOB 5JIHA 4UBDD 1FVEA 1I9IH 5CD3A 3VWKA 4I3SH 3S4SB 2XZZA 2WBJA 2ED9A 3ROLA 5BVJA 1FORH 1SEQH 2J8UB 3UDWC 1JGVH 1BFVL 3O2DH 3V5DA 2PTVA 1NGPL 3GSQA 3RVXD 2ZCKL 2AJZB 3NCEB 4LCIL 3BP5A 2EDOA 1F4YH 3TH2T 5DWUH 4A6YA 1LO5A 4NN7B 1Y18B 1XH3A 3EOTL 4HIIA 1SHMA 4V2CB 3OB0K 1Q72L 1FN4A 2KPNA 2F54B 2FIKB 3G04B 5J1TC 3UAJD 4MX7A 1F5WA 4UIMB 5D9SA 1AR1C 2X4QB 2ZOKA 4JO4H 4P99A 3DV4B 3GSNB 3GKWH 3S3SA 3GSNH 2QEJA 3VGFA 2J88H 4JO1H 4NM4H 1VFUA 4B41A 4KGJA 1ZHKA 3RDTB 5E4EB 3STBA 3L5IA 1BZ7A 1INEH 2YUVA 1TJIL 5F8QC 1EPFA 1Q1JL 1UM5H 2UWEE 1D5MA 5E8OB 4GG6B 3D9AH 1E6JL 3TBVB 2YEZA 5KSAD 2GK2A 3ZZ1A 2J1KA 5E6IB 1UYWH 3ZLQC 5MERA 2FO4B 1HHIA 1KCSH 4JFFA 4LLQA 1K8IA 2E9BA 4D0DA 2BNRB 1FNHA 5JLZB 1S8DA 3L95A 2P8MB 3DXAD 1NUGA 1HSAB 2R0LL 2VXTH 5SX5K 2FB4L 3PE9A 3GJEA 3DURB 1LP9B 3WNPA 1G1YA 5FKAB 1I7ZB 2BJMH 4NM8H 2GTZB 4JKKA 4XNXL 3L3GB 4IOSD 4E42A 1PEWA 1RSFA 3IJYB 5C2BH 4N1HB 5J06A 4OLWL 2GFBB 4U1NB 3UJTH 5D7KD 4BK5A 3LEXB 1AGDB 3IFNH 4JFOA 4JG1L 1J18A 1GZPA 5HHOB 2CRYA 2Q3AA 2JK5A 4QEGA 3BXNA 1H3PL 4Z7VF 5DC0A 4HV8B 1S7WB 4I48A 4XPTH 3D85A 12E8L 4XMPH 1RJZB 4E0RB 2E7CA 2Y1VA 4LRIA 1MVUA 2XIDA 1Q9LB 4ZPTA 3ULUL 3S5LA 5D96C 4YWGL 1PLGH 1YN6A 3QYCA 4S1SH 4AENA 3QEHA 1FGVH 4QHLA 1UA6H 3L5JA 1MJ8H 1G7QA 3TZVA 2QBWA 2Z31B 1S7TA 1TFHA 1CG9A 1QLRB 4JE4B 1ACYL 2X70B 3FAWA 3W9EA 3GHEH 3MRCB 4E41A 1FAIL 3MUGA 5E8NB 4Z7QE 5J11B 2DTML 1WBYB 1J8HE 1JF1A 1NCNA 3QXVA 3K74B 4ESKA 4P3CH 3H0TB 3L7EA 3RVTD 2VDQL 1GPOL 3BEWB 5E08H 2VMFA 1NLBL 3U1SH 1U8QA 5JR1L 3PWPE 5T1LD 1YYLH 2AEQH 1J11A 2BVYA 2BCKB 4JZOA 4GAGL 2CLVB 5JZ7C 3SKUD 3S4SA 1CZ8H 4PS4L 4ZUTB 1XCQB 3O41A 2J8UA 4IRZL 4X9BA 3O2DA 1GCFA 4PRHB 3LIZL 4HUNB 4BQBA 5CAYB 5HVWA 4M6OL 2AJZA 4R4BA 1KN2L 5DMIH 4RFNC 1IAOA 2ADGB 4XP1H 4M1DH 5T1KB 2VXQL 4HFWA 2ORBH 5T33H 4I3RL 1N59B 3AB0B 4RMQA 5LWYL 2NR6C 2H9GB 4KJYB 2F54A 2FIKA 1QR4A 2AEIT 2VZOA 5ITBL 2ZG1A 3G04A 4K3DH 3EKCA 1J0ZA 4UIMA 1WIPA 4L9LC 1X7QB 4DGYH 4GW1B 1EERB 4ZG1A 5CWSB 4ZMAT 3DV4A 3GSNA 1H3GA 3W2DL 1TZGH 3DVFA 5HI4C 3A6BL 4JM4L 3VXNB 5KVMC 4JQXA 2MJWA 3T0VA 3BRFA 1QSEB 2VLMD 3MLZL 4RGNC 4KHXH 3MRBB 2CK0H 5I8KL 5HVHB 2PXYC 4OSUH 1DANT 3EJZD 2CKNA 5E8OA 2AXGB 4GG6A 3TBVA 4M7LL 4HKXA 5KOVC 1NDGB 3T3PF 2OXGA 2GJ6E 5CD5C 3T3MF 4HUVB 1G6RL 2NW3A 1A9BB 1GAFH 2R0WH 2W0KA 2Y06L 5JLZA 4IRSB 3ZSSA 1YMHB 2V2XB 1LQSR 3TBWA 1HSAA 1OOAA 4I9WD 1IT9H 3DURA 1L9MA 4ORGB 1LP9A 4RA0C 1OLLA 5IB5B 5KS9F 4HJ0C 2OSLB 4LPUA 5FKAA 4I0PA 5KSVB 5D7LE 2G5RA 3L3GA 1MAMH 5IW3A 5IESH 3SKMA 3IJYA 1W8NA 2GFBA 1KXVC 5CKGA 1YEJL 1FSKB 4KKCD 1S9XB 2ERJC 3LEXA 4RDQG 5ABDE 1AGDA 4LSSH 5TQ0H 5GGTH 4GH7B 5HHOA 3V8OA 4ZUSA 3TN0B 1E4XI 4H5SB 2DMCA 4P49A 4HV8A 1A7PL 1S7WA 1RU9L 4KDTC 4PJ8B 5GRJL 1MCDA 5GJSL 3S36L 2B5IC 4RBPK 4RQQB 5BMFH 4ZD3L 3RWEA 1MOEA 1RJZA 1I3GL 4E0RA 1AKJB 1REIA 4KUCD 1HXYB 3VRJB 1RUML 3WS6C 1Q9LA 4XCEB 4XGZB 4F15C 4XC1H 3MLTA 3L5WA 2NZ9D 1DVFC 3Q1SL 2Z31A 3JTSB 4MXVE 5TJWK 3UCRA 1QLRA 1XZ0A 1HIML 5KVDH 1ZV5A 5GRVK 1FG2B 2X70A 4OF5A 5CBEB 5C07B 3MRCA 5E8NA 2VDLL 1WBYA 2AABH 5FUOL 2ZUUA 1HWGB 4OIIL 2KH2B 3OJ2C 4HFUL 5DTFB 4FP8L 2R29L 3H0TA 4O02L 4X4MA 5DD3H 3GI9L 3BEWA 5GSVA 5C0AB 2Q76B 4MB3A 3EDDA 2C1PB 2NY5L 4ETYA 4G9DB 2BCKA 5E94B 3T0WA 5L2JB 2CLVA 3MGTB 5ITFA 3MMEB 4J1UB 1KB5B 1RUAH 1MRFL 4FQPA 4ZUTA 5FEBA 1KB5H 1XCQA 3QFJE 3HC3H 3RL2A 4PRHA 3NFSH 4JDTL 5CZKA 1NC2D 2QKIB 3KAAA 3MRNB 4ODXA 2OL3B 4M93C 4YGAB 3X3GH 2OL3H 4NFBA 1NCBH 1WFNA 2ADGA 2XZQH 3MUZ1 2F8XC 5T1KA 2I5YH 4Y4FD 2E8ZA 3GK8H 1A9EA 1N59A 4XPGH 3L3HB 5E99L 1RIUL 4Z7NF 3E8UH 3VGGA 1DUYB 3U0TB 1UENA 2H9GA 2RCSL 1MQKH 1DBJL 4L3EB 3ZKQD 3DMMB 3PABB 1U42A 1X7QA 4RAHA 2YWZA 4GW1A 2FATH 1A7NL 4EI5C 1KJ3H 4KKNA 1VCAA 5CWSA 4K23L 4A6YL 1JPGB 5H37H 3VXNA 4MJ2A 2ZG2A 1QSEA 2V5SA 1U2HA 5H8DA 4JFDD 1PVHA 4HAGA 3FTGB 3ZE1E 3OQ3B 5E8PB 5HHQB 2AXGA 1DL7L 1J12A 1A22B 3HE6B 4P2OC 1NFDE 4PLJC 1NDGA 4ZFZB 3T0EE 3RWHB 2DQIL 4JO2H 3PP4L 2VDRH 4HUVA 3FB5B 5DRZB 1JHLH 1OAZH 1A9BA 5MHSE 5GJTH 4WRLA 5E2WL 3UO1L 1YMHA 4XT1C 4OCWL 2V2XA 4N8CL 1G7JB 2W9EH 1UCBH 2ADJA 4LK4A 5L88L 2OSLA 5KSVA 2DQJH 2F53B 3TYGL 1LK3H 5JMRA 1TCRB 1DUZB 4KPHL 1EEYA 5EZLB 3W5MA 4R2GC 3R8QA 3RFZC 3H9HB 1IC4L 5GGTA 3BJLA 1VB9A 4K55A 4MDJB 4PJGE 5FOJA 4MXQC 5FUCC 4HGMA 2V17H 4RX4D 1EVUA 2IBGA 3QWOB 5J3HD 1MCWM 4PJ8A 4M62H 5IVXE 2HJLA 1KCUL 4DFHA 4RQQA 3SDDB 4NYLB 1T22B 3JV5A 1PFCA 1AKJA 1HXYA 3DXAE 3VRJA 2VRAA 4XCEA 4XGZA 4ZPVB 4CGTA 3T08A 1C7SA 4DUWA 1JWMB 3MV7E 2ZCHL 4XCCL 5SWZE 4Z7VB 1R3IH 3R06B 3DYOA 3O3EB 1GOGA 4OM0L 5KTEH 3MNZB 1FLRL 5FKPA 3JTSA 3WNKA 1BPVA 5GGVH 2J8OA 4WCYL 1FG2A 1QBAA 5CBEA 4DEPC 5D7KE 5C07A 3I02B 4JLRB 4XTRD 3LZFH 2A83B 1Z9OA 5DTFA 1RAMA 1NFIB 2DM2A 1RMFH 2CDEB 2B2XH 2VO5A 5C0AA 3FFCA 4BH7B 3WKML 4G9DA 1MNUL 1QPPA 1Q0YL 5D1XB 5FYKH 5L2JA 4LLYB 4PJ5A 3MMEA 2Z91B 4TUOB 3BZ4B 1KB5A 5JIPA 1P4LB 1MIML 1XF2B 2Q20A 4WI3A 5FA4B 3F62A 3C87A 3QBTB 2NXZB 2QKIA 2BERA 2OL3A 3B3IB 5JO5B 3WDIA 3EHBD 1A0QH 1RZ7L 3RVUC 5E2TH 5HYJB 3WHE1 5T3ZD 3FHAA 4B7IA 1BQSA 1I9IL 1AR2A 1A6ZB 5CKAA 4UT6H 2MKLC 4I3SL 3L3HA 3LQMA 1AGBB 1A4JB 5SX4H 2P5ED 1KLGB 1DUYA 3U0TA 1T6WA 4TUJB 2E7HA 5DJ8B 4NKDB 4U1SB 1FORL 1SEQL 4P23B 5C0JB 1JGVL 2YD2A 4L3EA 3O2DL 4QTIH 4Y5VB 3PABA 2CMRH 2V5MA 2VERN 3AY4C 4X6EA 2Q6WB 1F4YL 1UXWB 4MHHG 1JPGA 2HVKA 4P4KD 4GRLB 2N7BA 3Q5OA 3GMQA 5JTWA 4LFHG 3FTGA 1XR9A 3VXUD 3C9NB 3A0OA 5HHQA 3EYOB 5JMOC 1RQ5A 4ZFZA 4KRMB 4IOIA 4AIOA 3D0LB 2APTA 4JO4L 1IVLA 4KK9C 3FB5A 3CFIC 5JXEA 3WFZA 3GKWL 2JB6B 3GSNL 3LB6C 2J88L 2VDKH 1OGAB 4HGKC 4HLZG 3ALXA 5EUKB 4OZFB 4OZFH 5IJKA 1RI8A 2VAAB 5BVPL 1INEL 1T66D 5JHLH 1G7JA 2EXWD 1UM5L 2BVTA 3LKSB 3D9AL 5FGRA 5KAQF 3DSNA 3VGHA 2F53A 2XG5A 5TE4L 2VN4A 3HG1B 2FR4B 1UYWL 4U05A 1CLYH 1TCRA 3JWDC 4ZXBC 1CN4A 1DUZA 1KCSL 3NA9L 2QR0B 5EZLA 1J1OL 1S9VB 3JWOC 1FJ1B 3QUZC 3MCLH 3HKFA 3H9HA 4FTVD 3QULA 4D0CB 2OM5A 4MDJA 3C60B 2VXTL 2Y72A 4IOFD 1YMMB 3WNNA 5KS9B 5CEYA 2A73B 3QWOA 2DJSA 4J8RB 3N1MC 2BJML 4Y1AD 5DQDL 4NM8L 1KCKA 4ZNEE 2UVEA 4U0QB 4X6BB 1YZZA 1D6EB 3SDDA 4NYLA 3SGDI 2JJWA 1B4RA 2IPUK 5B3NA 1T22A 3RWFA 1CFVH 3NA4A 3PV7A 5C2BL 2VB5A 5DFVD 5E2UL 3UJTL 1W0YT 4I9WE 5EIIB 4XAWH 3IFNL 1A6VH 4Y4KD 1QYGH 4YBHA 4FFVC 3ZKND 1JWMA 1OPGH 3NAAH 1FC1A 4Z7VA 3R06A 3O3EA 3TBSB 5IV2A 3MNZA 4XPTL 1G7LB 3BSZH 3ZDXF 3BGFC 4P59H 4XMPL 4NWUH 2MSPA 4KRLB 2BXYA 3K3QA 3I02A 4JLRA 3CVHB 1ZLWK 2IFGA 2IBBA 3CVHH 3S8WA 1IC5H 3QNZB 1LEIA 2FX8H 5D96B 1NFIA 1U8LB 2GI7A 2QHLA 1PLGL 2CDEA 3G6DH 4S1SL 1FGVL 1UA6L 2EDRA 4OGXH 4QHNB 1MJ8L 4XB8A 4BH7A 4TOYH 5A3IC 3F7VB 4YC2C 4WFFE 1EFQA 5D1XA 1ZLSH 2IAMD 4LLYA 5L2KD 4YK4C 3V4UH 2DQUL 2Z91A 3GHEL 3FO9B 3LS4H 4TUOA 3BZ4A 1YJDL 4QHMA 1P4LA 1EZVX 1YECH 1XF2A 1F58H 5I71C 2BFVH 1KSRA 5FA4A 4DKFH 3D39D 2WQ8A 5E08L 3U1SL 3B3IA 1QFPA 5JO5A 43CAB 5GRYA 3VFNB 3IKCB 1EHNA 3QISA 2AEQL 5HYJA 3NGBB 4MCYB 1U8JA 5HYFA 3OKEB 5J6HB 3LKNB 1D5BB 1A6ZA 3BW9B 3D69B 2DMBA 4S0TD 3LS5H 1CZ8L 1AGBA 2H41A 1A4JA 5D1QC 5FV2A 4R7NB 1KLGA 5INCB 3WXVH 4F7MB 4TUJA 5DJ8A 3W81A 4NKDA 4U1SA 4P23A 4LEOB 5D2LF 5C0JA 3DX7B 4Y5VA 5C09D 3V0AC 4YZFF 1CWVA 3MOAL 4RFNB 2Q6WA 2AERT 5DMIL 2XN9D 4Q9CA 1UXWA 2G9HB 4XP1L 4M1DL 5D7JC 4K7PL 5D93B 2ORBL 4PLKC 1M05B 4GRLA 3SGKC 1CDHA 4PRDA 3C9NA 3EYOA 1TVHB 4CMHB 5CEZH 2R9HD 4YNYB 4L9LB 4XBEH 2YD3A 3HPJB 4DGYL 2IPUG 3LEVL 4NRZB 1K3IA 4RISH 4UQ2B 5ACMA 2FH8A 2IBZX 4Y5XA 4ONGH 2JB6A 4G8GD 3ARDB 4L1HA 1TZGL 1OGAA 5DD5L 4OZFA 1EVTC 4KHXL 4HUXA 5DD1L 3LRHA 2VAAA 2CK0L 2PXYB 4EDXB 4OZ4B 4S10A 2YRLA 3ILPA 1NLDH 3LKSA 3O2VH 5J56B 1OTUD 4YDLC 3L5XH 3TNNB 4WI8A 2IEPA 3HG1A 2FR4A 3PWVB 3ZSTA 4NKIH 1YNTB 2FRGP 2QR0A 1MRCH 1SYVB 1S9VA 4LKXB 1GAFL 2R0WL 1BJ1J 4TVPD 2GYSA 1IM9D 4D0CA 4DJMA 3ET9F 3C60A 3GBNL 3EDFA 1ZLVH 2DJUA 4BZ2H 3AS3A 4KVNH 5ANMB 2AEPL 1YMMA 2R56H 5KS9A 4OF7A 2A73A 4J8RA 1CFQB 3RNQB 3WD5H 2PCPA 4X6BA 3IDNA 4ORZC 1YQVL 5E8EA 4WI5A 1D6EA 4WJ5B 1MAML 1JE6A 5IESL 1MCCA 3TESA 1R5VB 5IW1B 2ERJB 1K9TA 3D0VB 5EIIA 3PP3H 4HPYH 1UWXH 2HJFB 5TQ0L 5GGTL 4M48L 2CUMA 5I8EB 4UTAH 1OTTD 1Z5LB 1QD0A 2V7NB 4APQD 3VFRB 5GXBB 4LDEB 3X17A 1PKQB 3TBSA 3ZT5A 2BOBB 4OFYD 2DQGH 1G7LA 3K2MC 4JG0H 2XTJC 1X5FA 3SGJA 2HFGH 4FZ8H 4S1DC 1P1ZA 1V5JA 4Z7UF 3QNZA 1LE5A 5JHDB 4XC1L 3RHWK 1DVFB 3GMPB 2GEEA 3F7VA 2KDGA 5IBTH 3RKPA 2HLFC 5F6IC 5KVDL 3OKDB 4MNGB 5C0NC 1I4FA 3CH1B 5K59F 3QDMB 4B50A 2AABL 3IFLH 2NY6D 3IAQA 4KJPD 3VD4A 4PRIE 1HNFA 3OF6D 3BZEB 1T7WA 2APFA 4N8VG 5B38A 3E2HB 4JVWA 1DQJB 5ETUB 43CAA 1IKFL 3SE3A 1UWGH 3IKCA 4MCYA 1L0QA 4YFEA 4TSCH 1A21A 3OKEA 5J6HA 3LKNA 1D5BA 3D69A 1NSNL 5H35B 15C8H 4XX1E 1RUAL 4G8EB 5LQBH 1RIHH 2MKWA 1KB5L 4R7NA 5INCA 4F7MA 3HC3L 3CSBA 4LEOA 5FF6A 1MPAH 2ZP0T 5J9PB 3NFSL 4H1LB 1AQDB 4H1LH 3NCJH 4G80A 5FM8A 3V95A 1N5AB 4Y19D 3X3GL 2OL3L 3VH8B 1X5GA 3EBAA 2G9HA 3D25B 1OCWL 2EDDA 5C0DB 1B0RB 3RGHA 5CGTA 4OIAA 1H15B 4DN3H 5MEND 4HSQA 2HMID 1M05A 3GK8L 3J8F7 1A6PA 4XPGL 1X6LA 4YJZL 1FDLH 5GZND 5C0RL 3FCTB 3E8UL 3S5LG 4BUHA 4PG9B 4F8TA 1MQKL 1TVHA 4YNYA 5SWSB 3K0WA 3HPJA 2A6KB 2VC2H 1QRND 2H26A 5FFLA 2FATL 4NRZA 3I2CL 4ZO9A 4UQ2A 3QAZC 4CL7A 4Z7WE 3ZDZE 3ARDA 1AQKH 4CKVX 3VA2C 1QUNA 1CE1H 1U8IA 4ENEC 1FL3B 1KT2B 2AK1H 2O5YH 2AEWA 5F96L 1JI2A 4XPHL 3BUYB 4RMSA 2PXYA 5DK0B 5DMKB 5GS0D 4EDXA 3RQ3A 4MJIB 4P2OB 4X80H 3WUWB 1ETZB 3FO1B 3TNNA 3JUZA 5ALBH 3PWVA 4JO2L 3KYMA 1ES0A 1U3ZA 2QV2A 2VDRL 2GTWB 5GZOD 5ADOH 1JHLL 4LLVB 4QY8B 1NUNB 5I1EH 1SYVA 3S4SG 2GKIA 4LKXA 3RA7H 5GJTL 3GHBL 1Z9SA 3H9ZA 2Z8VC 4X6DE 1MHPH 4YXLH 2BOCB 2RJMA 4J6RH 4O2FB 2W9EL 1UCBL 5ANMA 3FN3A 3LKPB 3ISWA 2DQJL 1CFQA 3RNQA 1IFHH 1LK3L 3C2SA 1FG9C 4RZCB 4DGIL 5AAMA 1FVDB 1IGIH 4XI5D 3FOLB 2B7DT 3O4LA 1LNUB 5DURD 1R5VA 3BGMB 3WFDH 4X9IA 3G9AB 5EU6B 5IW1A 3AU1B 1CXKA 5E70A 3T2OA 2A77H 2HJFA 3IS1X 4LSQL 4EBQH 5I8EA 1WICA 3C09B 2V7NA 3VFRA 4JM2D 4NZRH 2V5YA 2OI9C 5AYUL 2E5EA 4KDTA 1TVBB 1PKQA 3VI3F 5DA4A 2YD9A 3KPSB 2BOBA 4NQVB 3BI9X 5DJXB 4M62L 5IM7B 1BEYH 2C9AA 2V2WB 1VKXB 3LY6A 1WC7A 3S9DB 1MFCH 4CADA 2NTFB 4F9LC 4TTDD 3EAKA 5DUBB 4PY8J 2W0FB 2I26N 5IB4B 2VIRB 4ALAH 3SDCD 1BAFH 4Z6AT 3HLAB 1DVFA 1R3IL 3GMPA 5TFSH 5KTEL 1EO5A 4YIQB 4W4OC 4BFEA 1N6QH 5GGVL 4N0UE 4DEPB 3KPLA 1ZVYA 2PTTB 4ZS6D 3OKDA 4MNGA 4Q6IB 3CH1A 5EU4B 3QDAA 3FQXB 3WHE0 3WS3B 1BF2A 3LZFL 1E4KA 5AAWA 1T20B 1T04B 2B2XL 3O8XD 3N85H 5ETUA 1DQJA 3S37H 3HB3C 4OGAC 4URTB 3CGTA 4JRXB 1BREA 1U8HA 4X6FB 5FYKL 2JB5H 3X11B 3QIWD 4U6YB 4RCAA 2I25N 5H35A 3BN9C 2PYEA 1KGCE 2V6HA 4PJ7E 4BQ8A 2M8XA 5J9PA 3REVB 4M6ML 4H1LA 3N1GC 4PP2B 1N5AA 1V8HA 3U0WH 3VH8A 3UJIH 5JA8B 3D25A 1A0QL 5E2TL 1B0RA 1H15A 4ZAKD 5D1ZC 1UJ3C 4UT6L 4G7YH 3RY6C 1ZTXH 1QSFB 3D39E 3FCTA 4NC0B 4PG9A 4WO4C 4P48A 5C0IB 4PJDB 5SWSA 3OKMB 4QTIL 2CMRL 2A6KA 3HCVA 3B6SB 4K8RC 4KMTH 2YOCA 2FJGB 4M1GH 3V7AG 3VGEA 4OKVB 4HIEB 4M5ZH 2QSVA 2E7LA 3FOMB 3P73B 3RVWC 4FQXB 1FL3A 1KT2A 5CJXA 1JTTA 3BUYA 1MFBH 5DMKA 5C09E 3LRGA 4MJIA 1OD7A 3WUWA 1ETZA 1KELH 5J1SC 2EECA 3FO1A 3DVGB 3I3BA 2GTWA 5DVMA 1MAKA 3FB8B 1QOKA 2VDKL 4LLVA 4QY8A 3L3KB 4LLMB 4HHAB 2GSIB 5HGBB 3OAZH 2BOCA 2HJKB 3HE7C 1BOYA 4M7ZC 4X5WB 1BP3B 5C8JB 4O2FA 4OT1L 3K8MA 2YWYA 3RGVB 3H3BC 3LKPA 3BKCH 4LPWA 4R90L 2BHZA 1BMGA 3W39B 1CLYL 4JFFE 4RZCA 3FOLA 4UNVA 2BNQB 4XNQB 3KLHC 1LNUA 3GMLB 3JWOH 4FQQB 4KRPC 5EU6A 3JWNC 3MCLL 4W70A 4P3DB 3NH7L 2CUHA 2WP3O 1M4KA 5TF1H 2EDJA 4PJHF 1LHZA 1TVBA 3R8BB 5CJBA 3KPSA 2HT2C 2M26A 4NQVA 4JKMA 5DJXA 3S36X 3O9WC 5IM7A 2MOVA 3C6SB 3EJYC 1XIWD 2J3SA 4QHUA 1H3XA 1VKXA 1QTYT 9CGTA 3L5HA 4KTDH 4TVPE 1CFVL 1NGZB 5IOPB 1BFTA 1AJ7L 4BELD 2NTFA 1UG9A 4M6NH 3EZ8A 5DUBA 1A6VL 2W0FA 3QEGH 3VXMD 1QYGL 3H9SD 2VIRA 1OPGL 3NAAL 4OM1H 3HLAA 1HOCB 1EZVY 4YIQA 1LO4H 3DVNB 4X4XB 4P59L 2PTTA 4WY7L 4NWUL 4Q6IA 2ICWA 2R2BB 4PBXA 1HN1A 5EU4A 4Z7UB 3CVHL 2DI7A 3ZDYE 2I27N 4N1CA 3WS3A 1IC5L 4P5KA 2FX8L 4B53A 5EULV 2UV3A 1F97A 3NABH 3G6DL 1DZBA 5DR5H 1T04A 2LE9A 4OGXL 3F7YB 2F9BT 5IVOA 4YC2B 4TOYL 3O6FB 3ARFD 1NMCC 4JRXA 4U6VH 4ZDHB 3UTTB 3O2WH 4YK4B 3X11A 2R2HB 3V4UL 4E41E 1RK1B 2OJZH 2XNAB 4L8BB 3LS4L 4U1IA 1J0YA 3ZE0F 1YECL 3GEWB 2NXYD 5FCSH 2E6PA 2BFVL 1BQLH 4DKFL 2UY7A 4FHBD 1YEHL 2B1HL 1INQB 2XXCB 2X4UB 4TNVF 2HT4C 4NQCB 2B8OT 2C3HA 2APXA 5BJTA 5D1QB 5A2LH 4MS8C 3DUUB 4MVBC 1QSFA 3QCTH 1CIUA 4F9PA 1RJLB 2D7TL 4S1QL 3WXVL 1P9MA 4OV5B 5C0IA 2R1XB 3D3VD 4PJDA 5T1MA 3OKMA 1MAJA 1ERNA 4YPJA 1UKTA 4P46D 5BW7C 3B6SA 1EO8H 1ZSDB 3HFMH 1XGQB 4XMLL 1SQ2N 1JPSH 2AGJH 5D7JB 4OKVA 2YZ1A 4M61A 4DZ8B 5J12C 4LKCB 2EE9A 4FQXA 4H0IA 2XA3A 4GO6B 5IJVB 1AXTH 5IG7B 3V4PH 1WUNT 4Y19E 3IRZA 1NQBA 4XBEL 3DVGA 4M7JH 1KCRL 3UP1A 1EDQA 5MENE 5FHBL 2W60B 3FB8A 4CRPA 4ONGL 1ZT1B 3L3KA 4HXAH 1C5DB 4LLMA 3GM8A 2GSIA 2H3NA 4PY7A 5HGBA 2XPGA 2HJKA 4OCNC 2XYCA 1O0VA 3OR7B 2OR7A 4X5WA 4X6CF 5C8JA 4GG6E 1KXTB 4YDLB 3NCFB 4L5FH 3RGVA 5K9JH 3L5XL 4QRQB 1C1EH 4HUMB 3JBG7 3P4NB 3W39A 1T89A 3M07A 4UBDC 4NKIL 4Q58C 4ERSL 2BNQA 1QFUH 4LIQH 4XNQA 3GMLA 4FQQA 2CDGB 1DE4B 4P3DA 1KB9J 4HMEA 1BFOB 1F3RB 4JZNB 1LP9E 4CBPA 3WO4C 4BZ2L 4KVNL 5AUMB 2R56L 4PTUB 4M5YH 1G9MC 1YEEL 3WD5L 1AD9B 3C6SA 1WTGT 5H37G 4JY6B 1ND0A 1V3LA 3T0EC 4N68A 1IGML 2NCMA 2OP4H 2EEAA 2XICA 3D48R 4FQLH 5IOPA 4QRRB 1YNLH 3O0RH 5DJ2B 1B9ZA 5JDSB 4HPYL 3WJJC 3LEYH 2DBJA 4F2MA 3TO4D 4UTAL 2FEDD 5HJ3B 3UC0H 3UAJC 5E8DH 1X9QA 2HAZA 1HOCA 1JJUA 3FJTA 5F1SA 3MV9D 3DVNA 2XTJB 5HGDB 4Z0BH 3IT8D 4RSVA 2R2BA 1F02I 5IROA 5F7DB 2HFGL 4FZ8L 3NACH 4Z7UA 4LLAA 3X3FH 4UV4H 2ZSVB 1AO7B 2AI0H 2G60L 2H1PH 3UTQB 1NANH 5LCVH 5HI5C 5F9DC 5I8OL 5T1DH 3F7YA 3HZKB 3JV4B 5J6GB 3B8YA 2Z93A 3O6FA 4QXUH 3UTTA 3MACL 5IBTL 4BJLA 4NCC2 2R2HA 1KCVH 2XNAA 4L8BA 5EORH 2BXZA 3IFLL 4EIGB 4LCUB 1INQA 1EAJA 2X4UA 5HHVH 4HEME 4YDVB 1TZHB 4NQCA 3UTOA 4QXTB 4C57C 3HNSH 1UWGL 4QXGL 3MBEB 5DO2C 4TSCL 2LFGA 1GH7A 3PIQB 3MRHB 5IFHL 3OKYA 5D5MF 5D1QA 3S98A 3U30C 1ITBB 5D7IB 5LQBL 1RIHL 1X5KA 2A0LD 2P5WB 1RJLA 4HIJB 4WI4A 1U9KA 4OV5A 1MPAL 2J6EA 3B8SA 2YK1L 3NCJL 3LH2L 3ZT7A 3EDKA 1LGVA 1XGQA 4XVSH 1UC6A 1QBMH 5ISZD 5D7JA 2RB8A 5DD0L 5JW5B 3MC0A 3TCXA 3SE9L 1VEOA 3ILQC 4DZ8A 4DN3L 5LAXB 4LKCA 1KPUA 4FXGA 4J3UA 4Y16D 3FN0H 4ZODA 5IJVA 1FDLL 4YHMH 5JW4N 3ARTA 2AJYH 5IG7A 3S6CA 3SY0B 4KC3B 1R3HA 2VC2L 4M8QB 3QAZB 4U6TA 3S7GA 3BVNA 4Y88A 1T7ZA 4R26H 2W60A 1GGCH 1AQKL 1T21A 4FRWA 3H42L 1CE1L 2X1QA 1C5DA 2ICCA 3BH8B 2AK1L 1UEYA 1Q9OB 3OR7A 2CJUL 4JQVC 4NO3B 4ISVB 3RVTC 1XF3B 4H20H 4X80L 5E56A 3BOVA 3KHOA 5KOMC 4QRQA 5ALBL 4YDIH 5DI8B 5F89B 3P4NA 3VCLB 1U6AH 5FK9B 2DM3A 2JJSA 5ADOL 1OQXA 5I1EL 3U48A 4YHYC 3NIFE 5BV7B 3RA7L 5BV7H 2CDGA 1NEUA 1DE4A 1MHPL 3CLFH 4PJ9D 4YXLL 3VXSD 4JZNA 4J6RL 2SEBB 2IPKA 4NQXB 4JFHE 1N4XL 2D0HA 5AUMA 3DTXA 4MA1C 4O51B 4PTUA 4QNPF 4MNHB 5ILTL 4X7TB 3X13B 1AD9A 1IFHL 2VL5B 5CZXD 1YEKL 4KI5D 1IC7H 1IGIL 1K6QH 2IANB 2EC8A 4WWKC 3PL6C 4CU8A 1G84A 3WFDL 4QRRA 3NIDE 2DQTH 5DJ2A 5JDSA 1XR8B 3IKKA 2DQCL 2A77L 4EN3C 3QNYB 3V79C 3I84A 1F42A 3MLUH 4EBQL 4AT6B 5HJ3A 2OI9B 4NZRL 3G5ZB 2OJEB 3CSGA 5F9WC 3PV6B 3C08H 5E5UB 1MSPA 1QLEH 5HGDA 1QFHA 1FYTB 1VEPA 4OZFG 1MFCL 1PDKA 4H25B 3TA3D 5IB2B 1KJ2B 4JHAH 1KJ2H 2ZSVA 1AO7A 1SEBB 1ROWA 4PGCB 1ZS8B 3UTQA 3V7MA 1CQKA 4G5ZH 3CFEB 4G6AC 4ALAL 1QPXA 1BAFL 2ILLA 2WLZA 3HZKA 3JV4A 5J6GA 1N6QL 4KKAD 4X9GA 3V2AR 5BQ7B 2DWDB 1JGUL 2ZPKH 1U58B 1PSKH 2BRRH 3VXME 2X4TB 3GMMA 2NTSP 3H9SE 1ZOXA 2PW2B 4LCUA 2OTUB 3QHTC 4BQ6A 1OAYH 2F5BH 4BA8A 3FFCE 3N85L 2OCFD 4YDVA 3S37L 4QXTA 4XP9H 3MBEA 2X7LB 4PJ5E 4FG6C 2J7LA 3DX6A 1MCRA 2GJZA 2JB5L 3PIQA 4PREB 3DWTA 3MRHA 4WWID 4LP4A 5DRNB 4KKCC 5D7IA 4XNMB 2P5WA 4HIJA 3MRJB 4RAUB 3SDXF 1KUMA 2X9YA 4JZJB 43C9A 4JN2B 4CMMB 3OPZH 5ERWB 4XXCC 2ESVD 1AE6H 1KENL 3UJIL 4K7PX 4Z7OF 5JW5A 3BP6A 2N1KA 1UJ3B 5LAXA 2J5LC 1P7HL 2WAHA 5IWLC 4ODWA 1WAAF 4G7YL 3VA6A 4XCNB 1N8ZB 4N5ED 4NWTH 1JNNH 1J8HB 1H8SA 4L3EE 4IRJD 3C6LD 1Z2KA 4JFEE 2W9DL 2Y5TB 5C9JB 1ZLVK 2YBRB 4M8QA 4PGDA 2NZ9C 3GSXB 3KPOB 3PWPB 4K8RH 4KMTL 1KB9K 1U8PB 4M1GL 2AK4A 1UM6H 2GIYA 1V7MH 4M5ZL 2EDLA 5FCUH 4LQ1A 1Q9OA 3ELAT 2NPLX 1A6TB 4HULB 1DN0B 3PP3K 4UDUA 4NO3A 1UWXK 3BD5A 4ISVA 1U95B 4KJWD 3DIFA 1KELL 3H7LA 2AJXL 3T0BA 5DRXB 2RAMA 5DI8A 1R24A 5F89A 3EYFB 3VCLA 1XGYL 5EDXA 4H26B 2DIBA 4CU7A 5FK9A 1A5FH 3UTZB 4PIRF 3VFTB 3FQWB 4DKEH 3HE7B 1IILE 3CZFB 4M7ZB 4PR5B 2SEBA 1AC0A 4KHTL 5T5NF 4O51A 3MJ6A 4MNHA 3BKCL 2VYRE 3X13A 4ODHH 2VL5A 1EBAA 3CUPB 4D9QD 1MLBB 2IANA 2FECL 4UT9H 4MQXD 1BWWA 3OAYH 1S7UB 5EC1B 2ZOLB 2BHYA 3QRGH 4G9FD 1BBJB 1NGXB 2FLRT 1XR8A 2EE2A 1RD6A 4LVOC 1YY9C 3QNYA 4PJXF 1X5HA 4AT6A 5TF1L 4PJHA 1GOFA 3G5ZA 2OJEA 1W0WB 1OP9A 2A2QT 5E1AB 3IU4H 3PV6A 1UKSA 3AREC 3QSKB 3MFGB 3BEVB 2BDNH 3U9PL 1FYTA 3HI1B 4KTDL 1NPUA 2FDBP 4H25A 1OW0C 1JHTB 1FNGB 5IB2A 1JYWA 1KJ2A 4PJBF 2ICES 1CT8B 3A6CL 3VGAB 2XA8H 1SEBA 4X98B 4FFZH 4PGCA 1ZS8A 2YUXA 4TULL 3MV8D 4YO0B 2ARWA 5DEGA 4Z7VE 3CFEA 4OM1L 2XWJB 3SDAD 4W4OA 5D7LB 4GAFB 3ARBC 4ZUWB 1LO4L 5BQ7A 2DWDA 3I6LD 3L3IB 3V6ZB 1U58A 3MRGB 3BYYA 4CN4A 5I1AB 2E7MA 2X4TA 2VL4A 3EYQC 2PW2A 2OTUA 2EDXA 4Q2ZB 2ZUTA 3NABL 5DR5L 1MI5D 5EWIL 3G6AB 5F71A 3VGBA 3IB4A 1K4DB 1NMCB 5HHMB 3TFKC 4I0KA 5A2JH 4POZD 5K9OB 2X7LA 3QDGD 4U6VL 3O2WL 4PREA 4KZDH 1BECA 5DRNA 1MF2L 5I9QC 2ARJQ 4IBLT 3VFUB 3MRJA 4NGHL 4RAUA 4J4PD 2DF3A 1BQLL 1HI6B 4JZJA 3QI9D 4JN2A 4CMMA 5J3HC 4JDVB 5I18L 5ERWA 1GOHA 1MUJB 3BDYH 4Y5YC 4OGZA 1E28B 1Z0MA 5ACLA 1UJ3A 3JVGA 4KUCF 4JAMA 4XCNA 1N8ZA 5JW4Q 4K07A 3QCTL 4V1DB 3RJQB 3KS0J 2Y5TA 1N26A 3OJVC 4YFDB 2YZ8A 2J6EL 1D3CA 4Z78B 2YBRA 4OCYH 1Z6JT 3QUMB 3GSXA 3KPOA 3PWPA 1EO8L 1IBGH 4OKDA 4UOW0 2E6JA 2HWZL 3N1PC 1AXTL 1MHHB 4LAQH 1A6TA 1BIIB 1CGVA 1A6UH 1DN0A 4JDZB 3QFJB 4LQFH 3V4PL 1U95A 4NQSA 4A2MA 4OUUA 5FECB 2EH8H 5ISZE 4JR9H 5DRXA 3OWEA 3EYFA 4M7JL 2H6PB 4H26A 5EZJB 3MYJB 1OGAE 3UTZA 3MJ7B 1F3DJ 3TH4T 1C5BL 5L6YH 1C16A 3VFTA 4HXAL 3PHQB 2YD8A 2CRIA 4P3WA 1YDPB 3TPKA 4PR5A 2Y25A 4O4YH 1TMCB 4XCYA 2AV1B 1YEGH 3KLDA 4H1LG 2NY3C 3FRPA 3C5ZC 1J10A 2NY4D 3T3PE 3VH8G 5K9JL 1MJJB 1C1EL 4WHCA 3T3ME 3T1WA 2IF7A 1MHEB 1ZEAL 4D94A 4TNWF 5IW6B 1EMTH 1MLBA 1JBJA 5K93A 1XEDA 1QFUL 5EC1A 1S7UA 2ZOLA 1BBJA 1NGXA 2C4FT 1GGYA 4BSVB 1HYSC 3R4DA 1FNLA 1SVCP 4HMDA 4DUVA 1YMME 5KS9E 3TT3H 5F3HA 1W0WA 3UTSD 1D6VH 5E1AA 3AGVA 1NKOA 1NFDB 5EN2B 3MRMB 5FYJL 3TJHD 4R97B 3T0EB 4WI2A 3BDBA 5IMOB 3DRQB 1JK8B 1U3HC 3BEVA 3GDBA 1PD6A 4P4KC 3HI1A 5E2VL 4OD1H 3QUXC 1JHTA 2R39A 1CT8A 1WBZB 1YNLL 3O0RL 5B39B 4X98A 3HAEB 3KDMB 3LEYL 3HAEH 3TO2B 2VDMH 4YO0A 3MNWB 3WUWG 1H8NA 3UC0L 2XWJA 5E8DL 3JTTA 3CDGB 5FV1L 4JJ5B 5D7LA 4ZUWA 1WIUA 4LOUC 3WLWC 3V6ZA 4Z0BL 3MRGA 1IGTB 5I1AA 3NACL 4XVTH 4RIRB 4UV4L 3QRFM 5KANI 2GY5A 2AI0L 2H1PL 2IADB 4PJGB 1EJOH 1VEMA 5KAQG 3IJHB 5FGCB 5LCVL 4DVRL 4DZBB 1LEGB 2VKXA 3G6AA 5T1DL 1JZ2A 4DCQB 3QUYD 1T03H 1IL1B 1K4DA 5K9OA 4GMTL 4QXUL 2VABB 4PP1D 5IVXB 2C3GA 2VQUA 1KCVL 5EORL 1FAKT 1XCTB 3JZ7A 3VFUA 3DXAB 2OZ4H 3L6FB 4FXLA 5F1NB 2CLRB 1HI6A 3MRDB 4GFTB 1KIRB 1C08B 4IOFC 2COQA 4KTYA 4PJIF 1FZOB 1I8MB 4JDVA 5HHVL 1XF5B 3LV3A 1MUJA 3HNSL 1IAKB 1E28A 4RRPG 4JGMA 5EU7E 1CXFA 4K94C 2DLEA 1QNZH 2EIZA 3U30B 4G6KH 4D3CH 3SN6N 2YPVH 3ARQA 4V1DA 3W11C 3OAZK 4Y4KC 3IDXH 1X4ZA 3ZKNC 4YGVB 2OXHA 1N5YL 2ZNXA 4Z78A 1VPOH 3QUMA 3P0YH 3I75B 1QBML 4HLJA 3UPRB 2AJSH 3RDTD 1OL0A 1IQWH 3EO0B 4LSUH 4Z7NE 3HNTL 3HMWH 2F5AH 3FN0L 5ICXB 1MHHA 5DHVB 4YHML 1AI1H 1BIIA 3CU1A 5DHVH 4JDZA 4HKZB 4NO2B 3PF2A 2AJYL 1EFXA 4LP5A 2ICWI 5E6ID 4GBXC 5FECA 4X99B 1BHGA 4HWBH 2H6PA 5EZJA 3MYJA 5TH2B 2BNRD 4R26L 1P6FA 4QRTB 4YDKH 1AC6A 1I8KB 1T0MB 4IHOB 2BVEA 3VWKC 1YDPA 2WBJC 3IRPX 1UVQB 2AV1A 2Y6SD 3OX8B 5LXGH 4Z5RB 2AXFB 5T1LB 2A74B 4H20L 4X7SL 4F7PB 3SJVA 4Q7DA 4LHUD 3ALPA 4HKJB 1MHEA 1XGPB 1PX3A 4TSBH 1U6AL 2NY1C 4YHYB 1CGSH 1EGJH 5IHUH 2R4SL 5BV7L 3C8KB 1E4XH 4BSVA 3CLFL 1CL7I 1SBBA 4NDMB 4G8IB 5ANME 4C83B 4MD5A 4MA1B 2WBWB 5CP7B 1DQML 2JE8A 2VTFA 1JRHI 1NFDA 4EIZC 5EN2A 3MRMA 1OT1A 4GKNB 5L8LB 1QLFB 1U93B 5IMOA 1JK8A 3KPRD 4NKMB 2X89D 1K6QL 3O4LE 3QXDB 4Z0XB 5IBLD 1ZT4B 4MYWB 1FGNH 1NCAH 3ULVD 2EZ0D 1WBZA 2DQTL 3BJ91 5B39A 4XVJH 3MBXH 3KDMA 4QTHA 3BP4B 3U83A 3MLUL 1CD8A 3MNWA 3HMXH 2R9HC 5D6CB 1DQTA 1N2RB 1UZ6F 1PKQE 3IDYC 3RVVC 5C9KA 3CDGA 3F58H 4JJ5A 3C08L 3UYPA 1CIDA 2VXVH 4LSTH 1QLEL 1DEEB 4ETQB 2YPLD 3FO0H 4D0BB 4N0YH 5ESVB 2VAJA 4JHAL 4RIRA 1KJ2L 2C4FU 5EA0H 1TZIB 4P4RB 1S7QB 5EO0B 4D9RE 5ESQA 1OTUC 2IADA 5KSAA 3IJHA 3RZCD 4DZBA 4PV9B 4G5ZL 3QG7H 1LEGA 2VITB 4N9OB 1IAII 4AQOA 4DCQA 4EOWL 2LTQC 1GL4B 1IL1A 4YBQC 3RZWA 4PRBB 2VABA 2VDOH 5F7MC 4UIKL 5IVXA 4MNGE 1A7QH 5EOQH 3FQUB 5GGRY 5F7NC 1MCOH 2ZPKL 5F44A 1XCTA 1PSKL 5DT1H 5MP6H 2FECI 2OZ4A 4GUPB 1A64A 3MV8E 3DXAA 5DFWH 5F1NA 2CLRA 3MRDA 1QG3A 5C1MB 1C08A 3P4OB 1I8MA 1J0KA 3NIGF 1FZOA 5JQHC 1VHPA 1R5IB 1YEDB 2F5BL 3MXVH 1XF5A 4XP9L 4PTTA 5JW3L 2APBA 5J0BA 3MUY1 2PYEE 3SKNB 4KGLA 5HSFA 2OQJB 4Q0XH 1GJIA 4GS7C 4TN9A 4ZFOB 2E27H 4LRIC 1U41A 1FFPB 4LBEA 3U6RB 5I75B 1OTTC 3BISA 1EUTA 4LF3B 4G6FB 3MNVB 3OPZL 5I1LA 3MGAA 3I75A 2O61B 1AE6L 1VESA 3TZVC 2YSSB 4I4WB 3CXHJ 2XXMB 2J5LB 5FAAA 2CR6A 3EO0A 1WAAA 1T80A 5ICXA 5DHVA 4GLRH 1X44A 1MLCB 2QTEA 4HKZA 4NO2A 1Y6KR 2HTKC 4JFPB 1QFOA 3NZ8B 3KLSA 4X99A 4YHIA 3CDFA 4K8RL 3Q3GB 5LBSH 1QVOB 1H3VA 3WLBB 5GIRB 3RNKB 1UM6L 4QO1A 5F7LB 1BBDL 3B9DA 4JKPH 3BKJH 1V7ML 4IRSD 4P2QD 4QRTA 2D31B 5C3TA 5FCUL 5C2UB 1I8KA 5F72S 2NY6C 4KJPC 3SE8H 4O9HH 2JTDA 3S97C 3OX8A 4Z5RA 2AXFA 5JOFB 1T1ZA 5F8RC 5T1LA 3HZMB 4F7PA 1JN6B 3VXTB 3CC5A 3V5HB 5IQ7H 2AJUH 5KSBF 4OZHF 4NN7C 1SMOA 1V7NH 2XY2A 5I8CB 3EOTH 2VZ3A 4XPAH 1HHHB 3O3AB 4A2LA 2FHBA 4DKEL 3TN0D 4KJQC 5ICZB 4NDMA 3TM6A 2FEEI 4C83A 1NC2B 1X5XA 5CP7A 4P2RD 4JPIB 3VFWB 3MX0A 4GKNA 5MEPB 3WHXB 1QLFA 4PBWD 1U93A 4JQIH 4LAJH 4NKMA 2DD8H 3QXDA 4PJCF 4UT9L 1ZT4A 2HMIC 5JUEH 3CD4A 1KOAA 3QRGL 1QKZH 4J12A 4LVOB 1TJIH 3RTQD 4LGSB 3BP4A 3HMXA 5D6CA 1Q9KB 1ZHBB 3WBDA 3WEXB 4O00A 2ENSA 3HI6H 5C07D 5EBGA 4LASH 2DI9A 1DEEA 4ZOAA 4ETQA 5IFJA 4PGEB 4FQCL 3QXUA 5EBMB 3FQTB 4D0BA 5ESVA 2HVJA 2PW1A 4JFDB 1J1XH 1TZIA 4P4RA 1S7QA 3RI5K 3CDCA 5EO0A 3CMOH 4FFZL 2FB4H 3P77B 3UTSE 1I75A 3IDUA 4M7KH 2J4WL 1XGRB 3HS0B 4I0PC 3ZDXE 3UYRH 4PRBA 4XNXH 3QJFB 3OHXB 5GZOC 3FQUA 1RPQA 3N0PB 5IBUB 4JANB 3BHBB 3CFBB 3RY4A 4PJFF 4KFZC 3BQUD 3P4OA 1UH4A 4AEIH 1R5IA 1YEDA 3CPLB 4MNQD 4S1RH 1DQQA 3I50H 4JRXE 3PWUB 1W2KT 4XI5C 1CFSB 3NFNB 4KZDL 2OMBA 2OQJA 4M1CD 5EO1A 4ZFOA 2FGWH 3DMMD 4CN6A 4OF0A 1FFPA 4Y2OA 3U6RA 3QNXB 1YUHB 1JPFB 1D7FA 2JIXD 4F37K 4PJIB 1JHKL 1MQ8A 3MNVA 3U7WH 4Y5YB 2O61A 5B4MD 3QIBD 2Z31C 2YSSA 4I4WA 5DGQA 1R3LA 5DMYA 3F5WB 3U36B 1ACYH 1KF9B 4KWUA 4KROC 4KK5D 3T0DA 1YJDC 3FONA 3MV11 4LRNL 5I19H 3B4NA 1IGFH 1MFAH 3CX2A 4TTDC 5D2LE 3HE6D 2VDQH 5FYKU 4YZFE 4PRIB 4OQTH 3SDCC 4L4VD 3Q3GA 1IBGL 3QUML 1QVOA 3WLBA 5GIRA 3KPNB 4GAGH 2MPAL 1GGIH 4H8WC 4EEEA 4POUB 3U4EA 2H2PC 3EOAB 3GSUA 4PS4H 4RGMC 4YFLI 2L0DA 4LAQL 2NLJB 3JUYA 1KYOJ 3QXWA 1A6UL 4LQFL 1RK0B 1G6VK 5F9AC 3O8XC 2EH8L 3HZMA 1JN6A 3GJFB 4MXWL 4GQPH 4JR9L 3GJFH 3SDYH 5IGXL 2CSPA 3G6JF 4WGVB 2VXQH 3VFVB 4ODUB 1D9KD 4GAJL 3QIWC 1I8IB 1ORSB 4NNXB 2PF6A 5L6YL 2B0SH 1HHHA 3O3AA 2Z8WC 5LWYH 1ORQB 3LVEA 4M00A 4OTXL 5IVNA 4EQ3A 1NC2A 1YEGL 1UM4H 2AQ2A 1F00I 1O7SA 3FMGH 4OLUH 4AEEA 5AD0B 2YA1A 4JPIA 4K2UH 3VFWA 5J4MA 3WHXA 5MEPA 4JRWA 4Y4FA 4Z7WB 1EMTL 2BNQE 4JM4H 1F3JB 5C08D 2Y36L 2P5EB 5F7YC 4Z76B 5I8KH 4W6XB 4WDIA 4J2XA 1ZT7B 3QH3A 5HVHC 1CLZH 1Q9KA 3HHRB 3TT3L 1I3UA 2YHGA 3G5XB 1D6VL 1ZHBA 4F80A 2AAVA 3IU3B 1TLKA 4P4KB 3PGDB 4NO5B 4PGEA 5EBMA 4OD1L 3EGSB 4WV1B 2CGRL 4B0MM 4JFDA 2YD6A 4MA3B 4JRYD 3P77A 4F7TB 2VDML 1CE6A 5EBLA 3VW3H 2W07A 5EIQA 1OAQL 5FYKD 1IQDB 3HS0A 1Y0LB 3KPRE 5I1CL 3FZUC 3MREA 3QJFA 3OHXA 2D7PA 4FXKB 2NW2B 3ULVE 3B9KD 2X4PB 5K9QG 3F7PC 4Z7UE 4JANA 4IMKC 3ARGD 5DJCB 1FSKC 3BHBA 3CFBA 1WFUA 5EU3B 2NXZD 5L9DH 4XPBL 2VUOA 3CXHK 1EJOL 5GRJH 2ZSWB 5CSZB 1T03L 2EH7L 4XWOD 1JYVA 4PJ8C 3S36H 4IIQC 1CFSA 3TYFB 3NFNA 5K59E 3EIFA 4FTVB 1EUUA 1RUMH 5GS1A 4XXDB 1FHGA 2OZ4L 4GSDH 4S2SA 3QNXA 1YUHA 4JM2F 3DVIA 4RX4A 2C26A 4PJIA 1FV1B 1W72A 4F57H 3Q1SH 1WISA 2WMPA 3F7QA 3F5WA 3U36A 5GRUH 4K94H 1N3NB 1QNZL 5EOCJ 3U7YH 1U8KB 2AJ3B 2VDLH 3PDDA 4G6KL 4G42B 4D3CL 3MRIB 3VMOA 3OKOB 1CDGA 4Y4KB 5JXAL 3SEPA 3MFFB 3IDXL 4OQTA 4YR6B 3P2TA 3GB7B 1X6NA 2JF1A 5C0CD 1VPOL 2EICA 1DBMH 3P0YL 4WU7B 4YUEH 4L4TD 3V6OE 2AJSL 4XNYH 4I5BB 4UAOB 1IQWL 3EOAA 5DJYA 1X5JA 2GCYB 2BP3A 1B88A 4LSUL 2DIAA 2A6JB 3HMWL 2F5AL 1CDJA 2NLJA 2R0KH 3OAYK 4QHKJ 1AI1L 4AM0B 5E9DD 4PJ7B 4JDTH 3HG1D 4NJ9H 2VN7A 1GZQA 3GJFA 1N64H 3UJJH 1RZGB 3ARFC 3DV6B 4GRWF 4OF3A 2IAMB 2R4RH 3VFVA 5L2KB 5DZNA 2YPKB 4ODUA 1I8IA 1ORSA 4YDKL 1JNHB 3U2SA 1A1NB 3QB7C 3PWJB 1ORQA 3ROLB 3D39B 5BVJB 1I8LA 1Z3GL 1HQ4B 1DBJH 5LXGL 3V5DB 3LPFA 5AD0A 3SQOH 4K7FB 1QBLH 1F6AB 2YR3A 1CXIA 2PYFB 1AGCA 5KSBB 1FZKB 5IEHB 4TSBL 4Z7WA 1PY4A 1F3JA 1RFDH 5F97E 1CGSL 2P5EA 5IHUL 1E4XL 2HRLA 5GRWA 1ZT7A 4P9MH 5C09B 5H94B 4WVRA 4P0DA 5FYJE 4XCFL 4U1LB 4KK6C 2XN9B 3G5XA 2ZOKB 3QWRD 2DQIH 3PP4H 3IU3A 4P4KA 1YYMH 4NZUH 3PGDA 4NNPH 5BOZG 1M7IB 2X40A 1MY5A 1T7VA 1FFOB 1FGNL 4OD2B 1NCAL 3EGSA 4WV1A 3SPVB 3ZE2F 3UO1H 4XVJL 4OCWH 3VXUA 5IJKC 4MA3A 5EOTB 2QSTA 3MBXL 4HIXH 4N0FA 4F7TA 4JFXB 4OLZL 4JKWA 1LE9B 3HMXL 2HFFB 4ZUUB 3VI3E 4DKAA 5CCKH 3CXDH 1JVKA 4QYOA 1Y0LA 2ZG3A 2L4OA 4FXKA 4RWYL 2NW2A 2VXVL 2ITDB 4LSTL 4QRPD 4LLQB 3X14B 4ELMF 2X4PA 3FO0L 4N0YL 2UUDH 5ICYA 5DJCA 1AO7E 3L95B 3CMGA 3NIDF 4YEFA 3FRPG 2GJJA 3GJEB 3DETC 5CJQH 2DYPD 5H2BA 5J89A 3QG7L 4R6UA 2PO6D 2ZSWA 5CSZA 1HHJA 3KLAB 5JZ7D 4HK3N 1D5XB 1CDYA 1FL5B 1MCBA 1A7QL 5EOQL 3TYFA 4E42B 5DHYB 4FTVA 3MRRB 3S96A 4TVPH 1L7TH 5DT1L 5LGJB 4JPKH 5MP6L 4YE4L 3AS2A 4XXDA 2VJXA 4I1NB 2VLRD 4PJFB 2FLBT 1K8DB 1GZPB 4CVWA 2GITB 1FV1A 4IDLA 2BSED 4Y1AA 3MXVL 5FIEA 4W6YB 4N0CC 1KYOK 3P0GB 2VLJD 4WCYH 1CD1B 2NR6D 4MA7H 3RWIB 1N3NA 1U8KA 2AJ3A 3ZHKA 4IJ3C 3HRZB 4G42A 2IJ0C 2FYYB 2P5WE 5CEZD 4Y4KA 2E27L 4ZFOL 3VFPB 3VG0H 1TTFA 3MFFA 4APQB 4YR6A 2FEDC 3QEHB 3GB7A 3GZKA 4LCYB 3Q6GL 5E95B 5HI4D 1V3KA 4WU7A 1MNUH 1Q0YH 4LEXL 4RGND 1CG9B 3TNMB 4FNLH 4I5BA 4QOKD 5D72H 2FD6H 1U91B 5D1XC 3SOBH 4DGVH 4DK3A 4Q6YA 2PXYD 3KVQA 2MFNA 1VFAA 2GCYA 3R1GH 3S88L 1JF1B 4AM0A 3MZTA 5BRZD 2DN7A 2AK4E 1RZGA 5LBSL 3DV6A 2DMKA 2IAMA 2QADD 4MB5A 5L2KA 1OWWA 2YPKA 4JKPL 3NCYP 2EKSB 3BKJL 4WFED 1AHWC 1JNHA 1A1NA 2NY6B 4ZTPH 3PWJA 3O41B 4RMUA 4HJ0D 2FCBA 4R9HA 5B22A 3D39A 4O9HL 5T5FH 3SE8L 1HQ4A 2DKSA 4Y2DD 2X1XR 4P23C 3B43A 4F7CA 1I85A 4HC1H 3BX7C 4Y5VC 1CU4H 4GAYA 4K7FA 4R4BB 1F6AA 4MD4B 2QJDA 4LDOB 2PYFA 4XH2B 3PDGA 1IAOB 5IQ7L 2AJUL 1FZKA 4XP4L 5KSBA 5IEHA 4HFWB 1CF8H 1V7NL 3U9UB 3RIAK 4XPAL 2IWGA 4GRLC 3SKJH 5KVEH 1H5BA 2A0LC 4OZIF 5C09A 3T77B 5H94A 5IVZB 25C8H 4Y19B 4U1LA 2XN9A 3T0AA 3K4AA 5ENWB 2IANE 4JQIL 5MENB 4Y5XC 1M7IA 2DD8L 1FFOA 4OD2A 3SPVA 2NY2C 5JUEL 3WXWH 3KXFD 1QKZL 5JHDD 5BVPH 5F7WC 5EOTA 4PJHE 4JFXA 1LE9A 2HFFA 1TPXB 4ZUUA 2PKDA 2XG4A 4HKXB 4TVSa 5TE4H 1SJEB 4G8GA 3HI6L 4TUKH 1FYTE 5C08E 2NW3B 2ITDA 4LASL 3X14A 3MXWH 3NA9H 3CIQA 3QDMD 4OI9A 3KJ6H 1BM3H 1J1OH 2VE6B 1AH1A 1NDMA 2ZUVA 3DPBA 4TSAH 1J1XL 4GOSA 3TBWB 3CMOL 6FABH 4XHJD 2CH8A 3C60C 4M7KL 3T2NL 1INDH 4I0PB 1R3JB 5DQDH 3KLAA 4MCZA 2QQNL 2WUBH 3UYRL 5I0ZA 5I1GL 1D5XA 2ZNWA 1FL5A 3SKMB 4UQ3B 1A1MB 5DHYA 5E2UH 1WITA 3MRRA 1IM9A 5LGJA 4AEHH 4LNVA 1DBBH 4JRYE 1BIHA 2VLKD 4PJFA 1K8DA 2GITA 4ZUSB 2RBLA 4AEIL 4NO0D 4S1RL 3I50L 1J0HA 2ARJB 3EFDL 5HBBA 3MCG1 1CD1A 4L8DB 3RWIA 3RWEB 4X4YB 2EXYC 4PJAF 5DURB 3SGJC 3ZE0E 3HRZA 3ZKMD 5B39G 3RWGA 4AIZB 2FYYA 3SGEI 3HAEG 5AYQA 2FGWL 3GSRB 3VFPA 1PG7X 2X1OA 4EI5D 4APQA 4JM2B 1ZWIB 4LCYA 4AL8H 2R2EB 2MWCA 3MLTB 2NNAB 4OFYA 3U7WL 3L5WB 1W72L 1HKFA 2AW2A 2Z0BA 4KZEL 3TNMA 1XZ0B 5KW9H 4KROB 1U91A 2DQUH 4KKLD 1YJDH 1FFQA 1S78D 5I19L 4P2OD 1IGFL 1MFAL 2DRUA 3M17B 4PLJD 2CXKA 1GC1L 5HGAA 3SDCB 4OQTL 1DTUA 5GSVB 5FYLD 1QP1A 2P47B 3SE3C 1PG7W 1AXSB 1CD0A 3NGBC 4H8WH 1GGIL 1UZ8B 2EKSA 1NBQA 1A1OB 3OJDB 3P4MA 4OQ1A 5ITFB 2JKXA 2WWMC 3IGAB 4PJEF 4RGMB 5DLML 1JIBA 5EU7C 2VOTA 5A2IH 1EX0A 4KKBD 3RPIB 3LKOB 4KK8D 4HCRH 3OF6A 3U7AA 1OLZA 3KPTA 3RL2B 5CJOH 5DC9B 1RZKH 3O8XB 4HC1A 4ODXB 4E9LA 2GY7B 3ZKSD 5GGRB 3MOAH 4MD4A 3W0WD 3SDYL 4XH2A 1OAXH 1A47A 1WZ1H 4R2GD 4PRPD 3QIWB 4K7PH 3VRIB 4KAQH 2FHFA 3U9UA 5D93C 4OLVH 4FFYH 1A9EB 2B0SL 4MXQD 2GW5A 2CDFB 4LSRH 1CYGA 3MSPA 5E9DE 5FO8B 1ZMYA 4X6CE 1FE8L 4Y89A 3T77A 1DBKH 4HUUA 3WDJA 5IVZA 1UM4L 1OAKH 4WFHE 4CMHC 4Y19A 3FMGL 4LPXA 4OLUL 4K2UL 4MJ6B 3LEVH 1X5LA 4NHCH 2W0PA 5ENWA 4OF6A 2YUZA 1PAMA 3GM0A 5DMJB 1JV5B 2OTPA 5MENA 5T3ZL 4ZAKB 1J9CT 2CD0A 3ARDC 5DD5H 3NPZB 4R7DB 3QIUC 2YS4A 1U8NB 5DD1H 4U31A 1WIOA 2PNDA 1T5XB 1CD9B 1K4CB 4IRJC 3C6LC 3F8UB 1CLZL 1IGYA 4KH2A 4ODVL 1QRNA 4PPTA 2IGFH 1SJEA 3IVKB 1UB6B 4UUJB 1NMBH 2MHAA 1LO3L 3V5KB 2VE6A 2APVA 3T1FB 4UB0H 5F9JB 5IHBA 3RU8L 5EG6C 3GBNH 4LARH 3EFFB 4KJWC 5DQJA 2AEPH 3B5TA 2ADJB 3VW3L 1R3JA 5KBNC 1D5ZB 3G5YB 2ZCLH 1ZA3B 3DBXB 1RIVH 1QFWL 1YQVH 1I7TB 4AH2B 3MYZA 4YXHL 1EEYB 4ELMB 4UQ3A 1A1MA 1TTGA 4FFWC 2Q7YB 5L9DL 4P2YA 4NQED 4M48H 5T5NG 3K4ZA 3CZJA 4LLUB 1NGQH 3RVUD 4F58L 5HHME 4NRYB 2XV6B 2ARJA 4IIQB 4KI5F 2FNBA 2HJLB 2M1KA 4L8DA 4AY0A 4X4YA 3ULUF 1IKNC 1YPZF 2RR3A 3FB6B 4AIZA 3LRSB 2H32B 3DROB 3GSRA 3MROB 3GIVB 4GSDL 2A6DB 4JM2A 1ZWIA 4U7KA 4XAKD 2R2EA 2NNAA 1XIWB 3O6ML 3MUHL 4F57L 5FKPB 3PXJA 4MWFB 2BHUA 1L6XA 1IGCH 2WIMA 5D5ME 5GRUL 4K94L 4U1HB 3U7YL 1HWHB 2VLRE 4YBLB 4V1DE 5C92A 3VXMB 3M17A 1E4KC 3H9SB 3SDCA 1KN4H 4KK9D 3J7HA 4J23A 3LB6D 3FO2B 1FQ9C 1DFBL 1DBML 3FFCB 1IKFH 2VLJE 2X42A 3E2HC 4YUEL 5GISL 3CFDB 4XNYL 1AXSA 5GHWH 3Q6FB 1UZ8A 4PJ5B 4YAQB 3OJDA 1A1OA 3VDCA 1NSNH 1T6VN 3IGAA 4Z8FH 1U8OB 3RPIA 3GSOA 5K33A 4HCRA 2R0KL 3LKOA 3QHZH 2PETA 4YXKH 4K3HA 5DK2B 3PQYD 3O8XA 1VERA 4KDVA 4NJ9L 3ARZA 4ZXBD 2JJVA 5GGRA 5DJ6B 3GI8H 3ARFB 1N64L 4OLEA 1OCWH 3UJJL 3QUZD 2R4RL 5C0BD 3QIWA 5IT2H 3VRIA 1JWUB 4N90D 4OZGF 2J2ZA 2NXYB 2CDFA 3KHQA 5C0RH 5FO8A 3UPCA 4J4PC 5BRZE 3VE0B 4QLRA 4JFEB 2ZUYA 1P84K 3SJVE 3SQOL 1JNLH 4MJ6A 1QHPA 4X6EB 1QBLL 3I2CH 1T1WA 3GBML 1JV5A 3DSFH 1G7PB 4ZAKA 2HVKB 4R7DA 1U8NA 1RFDL 2E7LC 4X0KB 2V2TB 2YD7A 3MO1B 5F96H 3MRKB 5CJXC 4XPHH 3GMQB 2X1WL 5DYOB 4EKXA 3Q48A 1T5XA 4OZIB 2W92A 1K4CA 3D3VB 1T2QH 1XR9B 4P9ML 1FPTH 2CPCA 4QNPE 4P46B 1CICD 4IOIB 3IVKA 1UB6A 4UUJA 5AEAA 1UJTA 1YYML 3GFUA 4NNPL 4NZUL 1GHFL 1A4KB 3V5KA 3FQNB 5D6DA 3T1FA 3GHBH 1DJSA 4AQ1B 5F9JA 1EO7A 3EFFA 3B5GA 3MA9H 4HIXL 5CCKL 4ELKB 3CXDL 1D5ZA 2DQHH 3G5YA 1ZA3A 3CJJA 3DBXA 3S34H 2O5XH 4WUUD 1I7TA 4DGIH 1IM3B 4AH2A 4ELMA 4IMKA 1NAMB 4FS0A 2Q7YA 3M8OH 3QULB 4LSQH 5FGCE 1NCDL 4LLUA 3C09C 5CJQL 4HF5H 2NY4C 4ZOEA 5CEYB 1AY1H 1PZ5B 5AYUH 4BUGA 2Z8SA 4NRYA 3AROA 4IIQA 1IJ9A 3DLQR 2X5PA 1S9WB 4MQ7B 4WTZA 4G43B 2P24B 4WEBH 3RWFB 1KIPA 1P6AB 3FB6A 4GKZB 4TVPL 1L7TL 3LRSA 5CS7A 2H32A 3DROA 4JPKL 1L4IA 3MROA 3GIVA 4FQ1H 2JCCF 2A6DA 5A2FA 2BSRA 4ZNCD 5IV2B 1XIWA 4PLKD 5TPWH 5J13C 5FOBA 2P48B 3CLEL 5LGHH 4MWFA 3GJFK 4YEEA 2D4DA 4FABH 4MAYD 4K3JH 2V9TA 4MA7L 4PJAB 5TDNB 4U1HA 4IJ3B 1YC7A 4PB0H 5TDPB 4GW4B 1ZKAA 4Q6IC 4KTEH 3VRLF 2VLKE 3SDXE 3VXMA 5J57B 1LEIB 3TO4B 3VG0L 2MTPA 4QWWC 3H9SA 1RY7B 1FZMA 5JDJA 3ME0A 3PJSB 1MCLA 3FO2A 1MCKA 4ZYKB 4Z7OE 1LO2H 4XP6H 3I85A 2OYPA 3CFDA 4RA3A 3Q6FA 1J05A 4FNLL 4YAQA 5D72L 3VG9C 4J3OC 2FD6L 1N6VA 3SOBL 4DGVL 5IBUG 1WAAE 4XMKH 4QHMB 1U8OA 3R1GL 4WNQB 5DK2A 3KPPB 4M6MH 1HE7A 1KEGH 3WUZA 5C86A 1PJ9A 3UBXI 3ARUA 4LU5L 3UZVB 3QUYC 2AV7B 5DJ6A 1SJHB 1WLHA 3ARFA 3MPCA 5L8KB 5I74C 1U8JB 1YNKL 3I3EA 1JWUA 1AHWB 2RQ8A 3IDJB 4ZTPL 4HGWB 1ADQH 5T5FL 3CVIL 4F9PC 4NFCA 2OR9L 1P9MC 3K1DA 3VE0A 2DBLL 2JJTA 2K9UA 4JFEA 5FYLE 4HC1L 1CU4L 1I1AD 3BESR 2WW8A 3V4VH 1G7PA 1CF8L 4RFEB 2IPTL 5DJZB 3AFLA 4X0KA 3RUGF 3QEQD 3MO1A 2V2TA 3MRKA 4FQXC 4U1JB 3SKJL 5DYOA 5J8OA 5KVEL 3BKML 4OZIA 4PRDB 4CNIB 3D3VA 5EB9A 2EDQA 1MCEA 4CN1A 25C8L 4P46A 4PFEA 4XRCB 2VSCA 3RIFK 5ISZB 3MJ9H 4PRPE 5D71H 4FQIH 3TIEA 2IMNA 4LSPH 5CLTA 2MQ0A 1URLA 4S1DD 4Y5XB 5ESAB 1A4KA 2NY2B 4Y16B 3FQNA 4HUXB 4XX1G 3WXWL 4YHZL 4PJXE 2M2DA 3MLYH 4Y7MA 3ILPB 3B9EA 4OT1H 2EYRA 2ATPB 4W4NA 2XY1A 4R90H 4ELKA 2HLFD 3RGVC 2DLFH 4OFIA 5C0ND 5DVLA 1UEMA 5C71A 2ADFH 1OSPH 1IM3A 1T89C 4TUKL 2VLME 4LCWD 3MXWL 4ONHB 3E0GA 3KJ6L 1BM3L 4PJBE 4X9HA 1VFBB 2WBKA 1NAMA 3NH7H 4TSAL 1IZKA 2DOCA 1GRWA 3Q2CA 6FABL 2KUTA 1PZ5A 1INDL 1CGTA 3BO8B 2EIBA 2PCPB 4MB4A 2WUBL 3IDNB 4QF1A 4XBPB 5E8EB 3V0WL 1FYHB 1S9WA 4MQ7A 4G43A 2P24A 3SQBA 4WHTB 1AJ7H 1WZKA 4GKZA 2R23A 1J87A 2W59A 2E3VA 4MMXC 1DBBL 5CGYC 3V6BR 4AEHL 2VZSA 5F6HJ 4U6HB 3VI4F 2FX7L 5FM4A 3BIKB 4RFOH 4AMKL 3Q0HA 1PKOA 4WY7H 5FB8B 2YD4A 4PJAA 5TDNA 1QSZA 2WV3A 5TDPA 4GW4A 2EEBA 2NX5D 1P1ZB 4U7MA 5IROC 5HDBF 2CKBA 2I07B 1EXUB 4OAWB 4HXBH 1LE5B 3TO4A 1FBIH 4AL8L 2X4OB 4AIXA 3PJSA 2IMMA 1RURL 3HI5H 4TQEL 5DJDA 4ZYKA 1F4WL 1ZGLP 4DN4H 8CGTA 3BMVA 3FT2A 4ENED 3O6FC 3TIDB 5KW9L 3WDHA 2R1WB 3ALWA 3TA3B 1QFWI 5F7KC 1BQUA 1I4FB 3NCCB 4FN0A 5BS0D 3SE4A 1I7UA 4WNQA 3KYOB 3KPPA 1YEHH 3RZCC 2B1HH 1LK2A 1I1YB 5B38B 2H2SD 1VFOA 2P46B 2AV7A 4L29B 1SJHA 3D87B 4ZSOB 1J0IA 4H8WL 1AHWA 3IDJA 2J8UF 4FQJH 3TEUA 3RHWF 1ADQA 4HGWA 5GGUB 4FA8A 2D7TH 4S1QH 4HCRL 5FF6B 5CJOL 1RZKL 4L8CB 2X4RB 4G80B 1T5WB 3E6FB 4XMLH 2ICEB 4WW1B 4P2CG 1F11B 1OAXL 4P57B 1IC1A 1WZ1L 3LSOB 4RFEA 3V6OC 4KAQL 1UH3A 1HK6A 1TCMA 4MQTB 5DJZA 4OLVL 4OZGB 4FFYL 4U1JA 4LSRL 3PQYE 5F1KC 2UUDK 4CNIA 3KYNB 5FXCH 4KI1A 1DBKL 3H2WA 4XRCA 1OAKL 4JPWH 4ZS7H 2ESVB 3VDAA 2H26B 3MJ9A 3SCMD 3DUHA 5ISZA 2EO1A 1KCRH 2NYYC 1I3RB 3HPLB 4NHCL 5FHBH 2LU4A 3QCVL 5ESAA 2YA2A 3QIUB 4L3CB 4Y16A 1OM3H 1K85A 1VADB 1U8IB 4TPRL 4ONOA 5CSGA 4WW2F 5AWNL 3DJ9A 4IRJB 5DC4B 1VENA 3C6LB 2ATPA 3ARRA 4NUJB 5IIEB 2IGFL 4CVZB 3LAFA 4BSJA 2B1AH 1NMBL 3KYMB 1ES0B 5CGMA 4IDJH 2GSGB 1SYSB 4ERSH 1ZK9A 4ONHA 2JJSC 2XI9A 1VFBA 4JFDE 3PDOB 4UB0L 4NBYB 3VFSB 4HK3J 3O6KH 4LARL 4OGAD 5I2IB 2P44B 5ELIA 4BSWB 3BO8A 3MOBH 1YEEH 1OARH 2ZCLL 3TWCH 2Q7NA 1RIVL 4OCRH 4XBPA 1IGMH 4HKBB 3BN9D 2WZPD 2BVPB 2LABA 5TGBB 1EA9C 4WHTA 4C59B 3O4LB 1RZJH 2C5DC 3FHQA 4PJ9A 1AIFB 3VXSA 1JFQH 4NZTH 2GT9B 5TE7H 5T3XD 4U6HA 1O5DT 1NGQL 2Q8AH 2MCG1 1WT5A 5JOEA 3BIKA 5D1ZD 5FB8A 2QL1A 1F6FB 1WC7B 3ULVF 4WO4D 1J8HD 1YPZA 4CADB 4G9FB 1RUPL 3VMNA 3BPOC 2I07A 4O2EB 2R69H 1EXUA 2G60H 4OAWA 3RTQC 4JPVH 4PJIE 4HS6A 2EO9A 4PRNB 4JB9H 4XPFH 2X4OA 3MODL 4NQTA 5I8OH 2D7MA 3CFKB 1EEUA 3RVWD 4OGYL 3MACH 4X9FA 1TJHH 3TIDA 5HYSB 1IGCL 2Z8RA 3KPLB 4F33B 5I1IH 2R1WA 3TA3A 1P7QD 4OIBA 3CSPA 4LVHC 3HUJF 3KYOA 4JO3L 3MV8B 2HFTA 3MRPB 2OLDA 4ONFH 1KN4L 4EXKA 1I1YA 3SDAB 1F13A 4L29A 5D70L 4ZSOA 1GSMA 4QXGH 1U8HB 2QQQA 2PUQT 1EAPB 3MBEC 1LVEA 5DK3A 5GHWL 3ZTNH 1BVLB 3GMNB 3HE7D 5IFHH 3GO1L 4Z8FL 2PYEB 5E7FA 5GGUA 2I60H 3QHZL 4YXKL 5M7QA 3FB7B 1MI5B 2YK1H 3WIHA 4L8CA 1UQSB 2X4RA 3LH2H 4NKQB 4ZQKB 1T5WA 3E6FA 2ICEA 4KMLB 4WU5B 4WW1A 3GI8L 4KVCH 3IXTB 5DD0H 5EFIA 4KRPD 1F11A 1U0QA 4P57A 3LSOA 1U3JA 1EHAA 5IT2L 3SE9H 2GK0B 3NTCH 4OZGA 3STZB 1JZ4A 4F7EB 1K5NB 3KYNA 2XQYK 1LWRA 3O9WD 2B20A 3G08B 5D2NA 2ESVA 3HCVB 2GJ6D 4WHYH 1JNLL 1I3RA 3HPLA 4UINH 4CUCA 5B4MC 5T3ZE 2Y5EA 5F93C 3DSFL 3QIU