1FC1A

Crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FC FRAGMENT
publication title Crystallographic refinement and atomic models of a human Fc fragment and its complex with fragment B of protein A from Staphylococcus aureus at 2.9- and 2.8-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 36
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1981-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fc1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fc1A01
5C92A 3KPQB 4L8BA 3A6CL 4Q9RL 4PJFB 4Z7NF 3ARWA 3SDXE 1UYWL 1FN4B 1UCBL 5IQ7L 3UTTB 4NQEE 2VL5B 5SX4I 1E4XI 2J8OA 4OZFG 4JPKH 4NYLB 1T66C 2R56L 4N90D 4RX4A 4OZFH 5C0NC 4FABH 4OIIL 5JW4M 2Q8BL 1HHJB 4X6DF 4LU5L 4X7EC 4HSQA 2P8MB 2R29L 1MH5A 3K8KA 2DL2A 2V9QA 3MGTB 3TEUA 1A4KA 5EU6B 4L4VD 4UDTB 5FDWA 5IGXH 1QNZH 1KJVB 1KB9K 2CKNA 3NZ8A 4QRUA 4EVNB 3PUCA 4DZBA 4JY5H 2PXYD 2VZTA 4MD5A 4X6BA 4LSRL 1JYNA 2VLME 5FHBH 1X4YA 3BDYH 5LJYH 5DQDL 2R4RH 3AMLA 2G75A 3NN8B 1QFOA 2C1OA 2V6HA 4WFEE 4UI2A 2GEEA 3OV6A 4TVPL 5E24E 4Q9QH 1BD2A 2M1KA 3EYSL 1GGUA 2XWBB 2ATPA 1SMAA 3QDJD 4GKZA 1EEQA 1JWMB 4TTDD 3TP4A 1JWSA 3O6FD 2GJ6A 3TIEB 1S7RA 4P2OA 4Y5YA 5EC1B 3HS0A 2AXHA 4FQLL 1MI5D 1BOGB 4LRIA 3CZFB 2A73B 2OL3A 2RAMA 2BK8A 1WZLA 2HJFB 4H25B 4XPAL 5IW1A 2NY6D 4YXLL 4M9OA 4R96A 1O7VA 5C08B 3SQOH 5ITBH 1J5OL 3GNML 3VGBA 4G8FA 4M48H 1JPGA 2H26B 2E7MA 4JQXA 4U6YB 2N56A 1A14H 1U95A 3C6LA 2GUOA 3AY4C 3VG9C 1HWHB 2R0WL 4FS0A 4FTVB 1I1YB 5INDA 3GBLA 4LPCA 1TVHA 3FN0L 5C0BE 3ZT6A 2AJUH 1CD1B 4DVBA 4JRYA 5EFIB 3VFOA 1YPZF 4UTAH 3O6LL 3U4BL 4TNVF 5F9AC 1NGWA 4WI9A 4NBZB 3BPCA 1CF8H 1FGNL 4ISVB 5IIEB 1I9RL 4FXLA 1KOAA 1V8HA 3UTPD 2X1PA 1KGCD 4G8EB 4GAYA 3E6FB 1T22A 4RBPK 4JVWA 3LS4H 1CE1L 4K3EH 1CLZL 4NO0B 1GRWA 5EU7C 1IM9B 2WQ8A 2DQGH 4RWYL 4OV5B 5GRWA 4TUOA 2Z93A 1T1YB 4HFWA 1UWEH 4ZTPH 1A5FL 3S37L 1J87A 3T0AA 4N8VA 5I19H 1QBML 4D0CB 5IOPA 3W9EB 5DD6B 3OB0H 4A6YL 5J89A 1BFOB 3HPLB 4E41E 3NH7L 4CKVX 3OXRB 1NLDH 2BXZA 1QSEA 1IKFL 4ONGL 2GFBA 4GKOA 4HPOL 5E8PA 3I02B 3F65A 4OZGB 3NCBB 3UXFA 1JGLL 4WI2A 3I3DA 1QLEH 1AGBA 4JHWH 2CK0L 2OTUA 1OAZH 1E6JL 3LKRA 1ZV5A 4GXVH 5E6IB 3QPXL 4PJAB 5C0CB 2AJYL 3OKEB 1OP3K 1KUMA 4RWHA 4ZAKD 3SKMB 1CDJA 3B43A 1AKJD 2BXYA 4L3EA 2EIZA 2N1KA 4JQIL 2H32H 4GBXD 2UWEA 3OKNB 1A2YB 4MJ6A 4J3WA 1P2CA 3ECBA 1YEHL 3O9WA 4QGTA 4RMQA 2Z91B 1QUNA 4K8RD 2HT4C 1F6FB 2DTSA 4XCNB 3UTSD 2VXVH 3MRLB 5FUOH 1ZKAA 2FDBP 4LVHC 3CLFL 3OAZH 4M1DH 2DLIA 4OQTA 3QXVA 4MLSA 4PRIE 4UV7L 2OJEB 5JXEC 1NGQL 3RI5F 3ZE0F 3OAYK 1NC2A 5BW7A 1SQ2N 3IKKA 2IEPA 3EOTH 1WISA 1OAXL 3KR3L 3QIBA 2EYSB 3SY0A 1J0ZA 1W72L 2DQCH 3VGAC 2C3HA 3QIUD 4JM2F 4ALAH 5B38B 3IJYB 1AR2A 3IDJA 3T4YB 5F88A 4G9FD 5GGSB 4OF7A 3BKMH 5DZNA 3GBNL 4LSSL 4AEEA 1MEXH 1PG7H 1WWCA 4MQTB 1U9KA 3GSNH 4H8WL 4Y19E 1QRNB 2AJXH 1MRFH 2VLKE 1CVSC 4HPYL 4HUWA 5FOBA 2BX5A 3U0WL 2YBRB 3T0VA 1T5WA 3PL6C 2NZ9C 1RSFA 5D7IA 3SDCD 3QR2A 3QDGA 2BNQE 5D1XC 4CMHC 5IMOB 1NH6A 2FR4A 3ZE2F 3RZCA 2JLLA 3WN5C 2OZ4H 3IDUA 1A6PA 5ESVA 5BQ7A 5DRXB 1BFSA 4YXHL 2R8SL 2DQEH 1BZ9B 1GC1C 4WUUB 4NN7B 5HHOD 4POUB 2EDKA 5I8EB 3WXWH 1DEEB 4PJ9A 4WO4C 2ADJA 5IF0B 1RZ8B 2R0KH 2XNAA 1K5NA 1KFAL 1J18A 4D3CL 4FQXD 5D70L 4LSUH 1RZFL 3CUPB 3V5HB 5EIQA 3P77B 4OFYA 4U6TA 4Z76A 3PWVA 1ZT7B 2OK0L 2DICA 3VA2C 3DV4A 4YBLC 4AH2A 4FA8A 1BAFL 2XWTA 4WW2C 1E4XL 4POYA 3MNVB 3TH4T 5MEQA 3DYMA 2XZZA 2Q86A 4QTHB 3KPRD 1MIML 1TZIB 1RJYB 4PR5B 1MREL 4LCUA 4XNUH 4F37K 1K4CB 5DRZA 1PQZB 5DD0H 1FPTL 1GGCH 4L3CB 1Q0XH 2D7NA 4LBEA 3LEYL 3GK8H 1WT5A 4HKXA 5T1DH 1SJXA 4H1LA 4X9HA 5TE4L 3DMMB 4HS3A 2KZWA 1MCPH 4IRJD 4JG1L 3S7GA 4CN6A 3T0ED 1J12A 2BC4A 1R24B 3DX7B 4N0FB 4OAWB 3JSSA 3PXJA 5IHBA 5EU4B 4Q58C 3BT2L 1IZJA 1R3KB 2AEIT 2ZOKA 3IFLL 4DK6A 5DMKA 5JQ6H 3T3MF 5BVPL 4XGZA 3RTQD 1J1OH 2HFEB 5IEHA 4WFHE 4OCRL 1KULA 1U3HA 2IPTL 1OPGL 1A3LH 4D8PB 4K3DH 2EKSB 4G5ZH 2C3VA 1JV5A 2R9HC 5DS8A 1NUNB 5HVWA 4X4MA 5D2LF 3FN3A 5I2IA 1KB5A 4I2XA 4KWUA 2VYRE 3D2UD 4M7ZB 4HJGA 3CC5B 2VLRB 1F4XL 4ZUUA 5E8DL 5T33H 2ATKA 5EG6C 2ZUTA 2C3WA 4M1GL 2HVJA 1DBKH 2Y4SA 2C9AA 4XNYH 3IDYB 4XPTH 1KLGB 3WEXA 4NKDB 2COQA 4TVPD 3G5XB 2YKLH 4XP4H 3RJDA 3IJSB 1CDHA 1G9MH 3KPSE 3VXPA 5CSGA 2JTDA 3CFEA 4IIQC 5I8KH 5I1JH 2W1NA 1AE6H 1KT2A 3EBAA 3OHXA 2YRZA 1NFIB 4TSBH 3VWKB 5DRWA 3QUXA 5CEYB 2UUDK 4V1DD 4LLQB 4JPKL 4GSDH 4IDJH 4U0RB 4OCLC 2P43B 5FV2A 4FABL 1UWXK 2FWOB 4QT5B 1ZT4A 5J1SC 4ERSH 1J10A 4EDXB 2Q3ZA 2HFGL 4Z7WA 1MFEH 2R0ZH 4BFEA 1FC1A 1KC5H 1S7QA 3EJZD 5DJDB 3P2TA 4R4ND 2BVPB 4DN3H 4DW2H 5IGXL 3VW3H 2CPCA 3WNPA 3OR6A 3TZVD 2QLVB 5EBWA 4JY5L 4PRHD 2ADFH 2V2TA 2EIEA 4M61B 3DSNA 3T8XA 1J8KA 3BDYL 5EWIH 2D9QB 2R4RL 4Q6IB 2DB8A 5KTEH 1BP3B 4QRRD 5C0IA 1G1CA 3NGBC 1F3RB 2H45A 5GGVL 4ZODA 5I73B 4FXGB 4HGKC 4UOW0 4U7SA 4Y2DA 1PGRB 3G6JF 1JNHB 4NQCE 2FX8L 3F7RA 3VD3A 4IOFD 3AAZB 1BD2E 2NXZB 1FVCA 3QYCA 4OCMC 3S34L 1N8ZA 3P0GB 5DHVA 1IQWH 3GMPA 5H94B 1C08B 1FJ1B 5HY9A 5ITBL 1ITBB 4IRSB 1A6ZA 4M48L 1U91A 4PJ7F 4YR6A 2CKBB 1I8IA 3S35H 4LKXA 1EVUA 4ACPA 1A14L 5SWSE 3MMEA 2XFXA 2I9LA 3S97C 4P3WA 3KXFB 3CJJA 1CXHA 4Z77B 2YHGA 1FYTB 3QUZA 1RUMH 2AJUL 3Q5TA 2BY1A 2YC1B 3MLYH 1IC5H 5MERB 5IMMB 1AQDB 1REIA 3QJHB 2QKIB 4R97B 5F1NA 4HGWA 3TBVB 4MX7A 2FBOJ 2RBLA 4JRYE 4XP5L 5ACMA 1CF8L 4AJ0A 1XGTA 1D3CA 4QO1A 1HHGA 2ZOLB 3CPLB 4RFEA 2W9EL 3K8LA 3WJLA 2D31B 4YAQB 3OMZA 4F15B 5JW4R 3LS4L 4K3EL 3D25A 2AQ3A 1CDUA 3ARDA 3BUTA 2B1AH 2IALA 4ZTPL 3HR6A 1G7JB 3EFFB 5DUPH 4NQVB 3V6OA 4DJMA 1OW0C 5I19L 2XY2A 3JVGC 4EJ1C 5I1HH 5ITFB 3IXTA 3MUY1 3V79C 4MD4B 2OS7A 3JUZA 4OCNC 3RL2B 2G5BA 5C09D 2P8LB 1ZHLA 4JHWL 3V2AR 1OAZL 3IDIB 1QSEE 5HPMB 3QEUA 3CDFA 3TT3H 5KVGL 4MQ7A 1Z9SA 3DXAB 3QG6B 1LO0H 1BBJB 2ZCKL 3JWDH 4LCCA 4XP6L 3GSQB 1PW3A 3TO4B 4Y16B 3NIGF 1I75A 4APQC 1HHKA 3RVXD 3V5KA 2H3NB 3FFCD 3MBEC 1JPFB 4L3EE 3K8MA 3HRZA 1UM4H 3BGMA 4RQQB 5ID0A 3O4OC 2UWEE 3NACL 4XAKE 5JW3H 4GFTB 2FD6H 3X17A 3V6ZB 1NAMA 3JTTB 1SYVA 4M1DL 4HCRA 4OFVA 3WS3A 4MJ2A 1VSCA 5E4IA 3O4LA 3RU8H 1H15A 4Z7UB 3VXRA 4Z78A 3WNMA 3KNBB 2IAMB 1RULH 5E6IC 1F4HA 2DQCL 3PQYA 4PJ5D 4K7PY 4OLWL 1RZGA 5F9OH 3VXOB 2A6DA 2FH8A 3WLBA 3DWTA 2EYRB 3BKML 2XZAH 3RWDB 1NJ9B 1XFPA 1MEXL 1HXMA 1MCJA 1T04A 2NXYC 4O2FA 1H3GA 3GSNL 1XCTB 4N8VG 4NM4H 1N5YH 1MRFL 2ED9A 5H35A 3F7PC 5T1LD 2C3XA 3QXTA 2GK2A 5BRZB 4NIKB 2HAZA 1T7VA 9CGTA 3FFDB 2HWZH 3O3AB 4BUGA 5KAQG 3MV7D 3IDNA 1WICA 1S7UB 3TPUA 3VFRA 5IWLC 1ZWIA 2Z8SA 3BKYH 5E1AB 5EOQH 4K94C 2OZ4L 1KPUA 4JFFB 5D7IE 3QDGE 1T3FB 5FKPA 4R90L 2C7UB 3JV6A 1XIWA 2NY3C 3HZKB 4JM4H 2P7TA 4BYHA 5C0AD 2DQEL 2XXCB 4MAYB 1ZLUH 3WXWL 4TSCL 4JM2D 4U1KA 1CD8A 2EXYC 1QG3A 1AGDA 5IBUG 4ZFZB 2R0KL 1FVDB 1ZE3C 3TV3H 5IVOA 4LSUL 2P49B 3EJJX 1GGBL 1G6RA 5DR5L 5D5MA 4BFBD 4JN2B 4JZJA 1SYSB 2GJZB 3WCYA 4MJIA 3NZHH 1MFBH 1F11A 3U6RB 1S3KH 5IT2H 4OQTH 4U6XA 2RQ8A 1DVFD 2IMNA 3IETA 4EN3C 2HTLD 3OB8A 3SOBH 4HIEB 3BAEH 5JNYA 4XNUL 3HE6B 1B9ZA 2EDRA 4UTBL 3MACH 1YY9C 2EDLA 4R7DB 5DD0L 3W11D 5D1QB 1GGCL 1Q0XL 4G8IB 2VZUA 3MROB 3QIWA 1WZKA 1Q9LA 4AIZA 1V7MH 1QSVA 1D5IH 4KGLA 4FXKB 3C5JA 1UA6H 3SO3B 5JW5A 1MCPL 5JOFB 3E1F1 1T89C 2YS4A 3RNQA 3ULUC 3BP6B 2FL5B 5I8OH 4X6CF 5J12B 3DRQB 5GZNC 3QQ9C 4BZ2H 5I6XB 3EO9L 1KN2H 5BJTB 4GW1A 1FFQA 2BJMH 1VA9A 1J1OL 5AD0A 1KJ2L 5KN5B 3RX8A 3Q6FA 3FCTA 1A1MB 4LCYA 1MJ8H 2X10A 1TMCB 2CK2A 4DEPB 1AR1C 5E2UH 3EFDL 4LVOC 5ESQB 5LG1A 4BSWB 1LQSR 2VUYA 1W0YT 4JHBA 5GSRB 1U8IA 3L3DB 1EMTH 3RWEB 5J0BA 1RZKL 5EO1B 2A77L 3A6BH 3LHPH 5E0QA 2DLEA 2VE6A 3AS1A 4QOKA 5EUKB 5T33L 1IC4L 4X4ME 2IG2H 2JJWA 4XNYL 2CDFA 4QXUL 4DCQB 3HAEA 4I2XE 4XPTL 3I6GB 3UROR 5HGHB 4NQSA 1I3GL 1R5VB 3QAZB 5HDQH 3ZDZE 4GRLB 5AWNH 3THML 2YKLL 4MQXD 4XP4L 3RUGB 1G9ML 2BOBA 4ODTH 4LGSB 5HHMB 3FZUC 3LRSA 1XF5B 5I8KL 1HKFA 1AE6L 1T2JA 4TSBL 1SVZA 4Y4HB 4GSDL 3W9DA 1S8DB 3BH8A 3CX5K 4IDJL 2R0LH 4J3UA 5DHYA 1MCHA 5IB1B 2NX5B 2V2XB 3MLPA 3KYNB 5F71A 4ERSL 1G7IA 5HYSA 4XCEB 2R0ZL 1EX0A 5IKCB 4H1LG 3F6LA 4I1NB 4MD0B 1KC5L 4NHUB 5ERWA 2X40A 4DN3L 5F3BA 3FQTA 3MRQA 2ADFL 4Z7WE 1BQSA 4Z7VB 3K7UA 5EWIL 2GI7A 3TNNB 5FYKU 3H7BB 5KTEL 4IOIA 1DL7H 2Z92B 5GSVA 1PG7W 4Y7MA 4JGJA 4K3JH 2YD7A 2APWA 4WIQA 4HBQA 3VWKC 3CDYA 4JFXA 1X5GA 3EKCA 1MVFA 2WSKA 4WY7H 2OMNA 2EICA 1HSAA 2DTMH 2FO1A 4YGVA 3VXSA 5HHNB 5I16B 2AERT 4AIOA 3L3OA 4QEGA 1UKTA 3QUMA 4EUPB 1R5IB 1TXKA 3GUTA 2IANA 1VGKA 4HEME 2VLMD 1DBAH 1IQWL 1KB5H 1LP9F 2DWEA 4R6UA 2YZ8A 3WFEH 3P40A 4Z0BH 1UZ8A 1A4JA 4L4VB 2JELH 1BECA 4X99A 2APXA 3S35L 2PXYB 2HT2C 2VQ1B 4WU5B 3RY6A 2GY5A 5I73C 2IC2A 4UQ3B 4I0KA 3B5TA 4XMLH 4C55A 7CGTA 2VUOA 2NR6D 4PP2B 5HTSA 2VZVA 4NQXB 1RUML 4NBYB 3MLYL 2OSLB 1O7SA 3JWOC 3NPZB 3I6KA 4XP9L 1H3UA 3OZ9L 3HZMB 3C60A 5L9DH 1CK0L 1S7VA 3BGFB 3QDJB 2AXFB 3KJ6H 1IC7H 3BYTA 4L3AA 5BZDB 2H6PA 1FIEA 4JGMA 3MRMB 3DX8B 5C0EA 1MHCB 1MI5B 3M1BA 3G5YA 4IRSC 5D4QA 4QXTB 4I0PA 1YN6B 2NY6B 4HFUH 5B8CB 5C0BD 2KL6A 3SKNB 5JORA 5CWSA 4AZ8A 2NY2D 1MCLA 3HI5H 4KK9D 4YDIH 4XI5D 1ZEAL 3QA3A 3DNKA 5FXCH 5JDJA 5DUPL 3CU1A 4AG4H 4JFOB 3LQAH 4JB9H 4OLYH 1BVLB 5I1HL 2DQJH 4Q74A 5TDPB 4R97C 3I6LE 4HKBB 1M6OB 2HVKB 4M8QA 1RPQA 4JDVA 5E8NB 3HZYB 5JW4N 1KTRL 4NP4L 3PJSB 4KTEH 2NW3A 1IEAB 2Q1EA 3PP4H 2WWKT 3WHXB 4G6JH 2OL3L 5DHVH 4JO4L 3JUYA 5CKGA 3TT3L 1GIGH 1LO0L 3C9NB 3HG1A 3JWDL 2PW2B 5FCUH 2WIIB 1AGEB 1RFDH 5I66A 5FM5M 5D1ZD 2DYPA 1QVOB 3QHFL 3VRLF 4EKXA 4UNVA 4ZUWB 5A2LH 1H3PH 4PB0H 1XF3B 5GGVY 1UM4L 2R1WB 1C16A 4N5UA 4HHAB 4NZUL 5F89A 4S1DC 2FD6L 4MDIB 3V7MA 2VC2H 3QQ4A 1LDSA 3P9LA 4OGXH 5DJAA 3QQNA 4MS8D 2B39A 4XMPH 1Q9KB 5EA0H 1LEKB 1N6QH 1JHLH 1QFWH 2GK0A 3H2WA 3HNSH 3O4LE 5D93C 5F9OL 4O5LH 3V6FA 1B4RA 1AIFB 4QYOB 3RDTC 3VXRE 1F00I 5DJ8A 4Y1AA 1DTUA 5FK9B 3TO4C 4Y16C 3U0PB 1EHXA 3PQYE 3VXNA 2XZAL 3UC0H 2X42A 1KPVB 1ORQB 1AGFB 4ZAKB 3STLA 2BNUB 4NM4L 1VPOH 3ULVF 4GBXB 1RQ5A 4GG6A 1P5VA 5IJVB 43C9A 2VDLH 2P42B 2DIBA 1CICC 5IFJB 2PNDA 4RDQG 2HWZL 2ADGA 3MRRA 1RZJC 5EDXA 3ZT7A 1R3JB 3L6FB 3PWPE 3UTSB 4PRBB 5DHXB 2Y25A 4LEXH 5IMKA 5EOQL 5IESH 1MSPA 1NDMB 1IGCL 4U2YA 1ZANH 1ZVSB 3WFCH 4FQQB 4BH7B 1TCRB 3EDEA 4JM4L 4Y19D 4NO3A 1LEGB 1RIUH 2DWDA 3QIUB 3O3BA 5DTFA 3T65B 2MWCA 4HEPG 5C0DB 1R3IL 5HDBE 5JMRA 4G9FB 4X6CA 3HE7C 2BNQD 5DD5H 3CCHA 4AENA 3IFNH 1KJ3H 1NUGA 4CW1B 1VEOA 2X89A 4P2RD 5DJZB 4PRAA 5K93A 4QY8A 1BWMA 4NUJA 5FA4A 1NAMH 3NZHL 1MFBL 4HIJB 5EO9B 4EI5D 4HCRH 1S3KL 3SDCB 4OQTL 3MUHL 3RGVD 5IT2L 1OB1A 1CE6A 1QFWI 3SKOB 5D5ME 1JMZA 3ULSA 4MJIE 3X13A 1ZHNB 4LCIL 3SOBL 1CXLA 2MPAL 3BAEL 1BQHB 2BY3A 3MACL 2E9BA 4MAYC 4C83A 1JNNH 1S7XB 4WJ5B 5F7DA 1MRDL 1Z0NA 2CXKA 3QSKB 4C56E 2ZUUA 2XZQH 1Q9WB 1MWAA 1VCAA 4CADB 1D5IL 5DO2D 1UA6L 5MEOB 5HHOB 1CFNA 3CVHB 5E03A 1H5BB 1AO7E 4WI4A 2IPUG 1ZAGA 1DQQA 2AGJH 2JK5B 4TPRH 1I9IH 3O8XA 1KN2L 4YO0A 5CSBA 5T3ZD 1CT8B 4FQXB 2BJML 2CQVA 2X4TA 2Y36H 1I8KB 5J1AB 3LQZA 2ICEA 3EGSA 4JQVC 5KSVA 2Q7YB 1MJ8L 1AY1H 1CXFA 4OSUH 3HCVB 1CDBA 3MFFA 3PWJA 4LEOA 3B6SA 5E2UL 3KLDA 4FZEH 3V8OA 2AKRB 4TRPL 3RPIA 1RU9H 3EAKA 1UB5B 3A6BL 3LHPL 3MOAH 3KPRB 4WU7A 2M26A 5DJXB 1AFVH 1WBXB 4BFIA 1K2DB 5J6HB 1YEGH 3MNWB 3BX7C 4NZTH 1ZLVH 5J12C 2KDGA 1CGTA 3C2AH 5AWNL 3O3EA 3GGWA 5IFHL 5EU3B 5IK3A 3T0EB 4LGPB 4J4PA 3C5SA 1DUZB 4ODTL 3L3JB 3F7QA 3NPSC 3O11A 5F97E 3QNZB 1M4KA 3CFJB 1G6RH 3S8WA 3GJEB 3LN5A 5C9KA 2O5XL 3DI3B 1UM6H 4HMCA 3PWNB 1ZLWH 3RTQB 3IDXH 1T20A 2R0LL 2WBJA 4XPHH 4KRPD 5IR1B 2BFVH 1Q9OA 1HN1A 3QFDB 1NMCC 3SDDB 1JMXA 1HH9A 3LN9A 5EZLA 3W2DH 4NN5B 4WDIA 1UACH 1I1AD 3HLAB 4LHQB 5FYJE 4BKLB 3D2UB 1KG0B 3OKOA 3ARTA 4GRLC 1DFBH 2V7NA 5JDSA 4ZFOA 2A6IB 5A40E 1DL7L 2Z35A 3D0VB 4MNGB 3VH8B 4KHTH 5ISZD 4K3JL 4QXWA 1GZQA 3GZKA 4MJ5B 5HGBA 1U8KB 4WY7L 1EEUA 5EN2A 5IM7B 4LSVH 4BSVA 3CFBA 4HF5H 4V1DB 4LIQH 1MHEB 4L29B 2FX7L 2X2YA 3VXSE 5ID1A 1DBAL 3TBWA 4M3JA 1RURH 1KB5L 2CDEB 3V0VA 2AV7A 3WFEL 3HAEG 4Z0BL 2IANE 1QO3A 1A0QH 1CVRA 4ODXA 5ICXB 5IW6A 3QULB 2DJ4A 4O9HH 3S5LA 2BVOB 2JELL 3HAEH 2X41A 2GIYA 2DQDH 1MCNA 1PSKH 3KYOB 4NQCD 4PRHB 2MFNA 1X7QA 4OCWH 4OFKA 2J12B 4F7EA 5DEZA 1BD2D 4X9FA 1S9KC 4HG4J 4KH2A 1NEZB 1BVZA 4QRRB 3KG5A 1IARB 1ZSDA 4GRWE 2X4NB 2WUBH 5L9DL 1IGJA 1ORSA 3BRDA 4OZIF 1EXUB 5D2NA 4U7KA 4YUEH 5HYSG 2UZYB 3KJ6L 1UJ3A 1IC7L 2A0LD 2SEBB 3RWFA 1P7QA 1KIRB 5F7KC 1KCLA 5FYJH 2XQBL 1FNGA 3H3KA 1WC7B 3AU1A 4BQ6A 1A8JH 4DTGH 1IL1B 3O81A 3KLAB 5SWSD 1FL6A 4FQPA 3DLQR 4X0KA 3QNYA 1OTSD 3D3VA 4AM0B 1AGCB 2G2RA 4P3DB 3NFPA 4GUPA 4RMWA 4AYFA 2GAZA 1QFHA 2R23B 3KYAA 4X6DB 5J11C 3HI5L 5JXAH 4YDIL 5I1KH 2EH7H 8FABA 5GRJH 4AY0A 4FQCL 2CO7B 5FO8A 2AEQH 1E28B 4MQSB 3FKUS 4AG4L 4YDLB 3DV6B 4WV1C 4JY4B 4ZUTA 2B4CH 4JB9L 3G5ZA 4ONOA 2CRZA 2A6KB 4H26B 2DQJL 4A6YB 5TF1H 3WKMH 3P4NB 1RHHB 4I3RH 3OG4B 4PRNB 3KS0H 5LXGH 2AJ3A 3B2UD 4ORGA 4KK6D 5TPWH 4KTEL 1MCBA 5JHDA 2F8OA 4WW1A 4HH8A 4QRTA 4G6JL 3DUUB 3QUYB 1SJEB 1CTOA 3REWB 1E4KA 2FB4L 3EDDA 4YHIA 3GKZA 1TZGH 5B8CC 1YNTB 4P9HC 2EDWA 1N0LA 3UBXB 1GHFH 4PJEF 1BGXH 3VDAA 4NKOA 1EZVX 1MQKH 3HG1E 1H3PL 4GRWH 2QHRH 4ONHA 4PB0L 5DQ9A 2EIBA 3GSUA 3WJJA 4PJHA 1LO5A 3MZTA 4YHKH 1BIIA 1QSED 3AS0A 2VC2L 2WP3T 4OGXL 4NFDA 5C0RL 3S4SA 4L8CA 5GZOD 3MRNB 5T1MA 5GS2D 4I48B 3MRJB 5DK2B 4EIGB 5EA0L 4GXUN 1N6QL 3PGCA 1QFWL 1W72B 4EDWH 5FB8B 4K9EL 1FFNB 3HNSL 4WHDA 5C09B 4O5LL 1VACB 1YPZB 2DI9A 3V4UL 5D6CA 2O93L 3UO1L 4FMKA 3VD9A 4HUVA 2YZ1A 3HFMH 1R3LB 2ZCLH 3G9VA 3UC0L 1T0MB 4XAKD 1FGVH 3CGTA 3IXAB 2HFFA 3O9WD 3BEVA 4NRZA 4Y1AE 1G7HB 3UTZB 5GRYA 2VDLL 3WFHB 4BA8A 1J8HA 3FFCB 5EBLB 4YHNA 2BSRA 4G7YL 1U8HB 1QFUL 2PF6A 3P9MA 4GG6E 4YZFF 5AUMB 4TNVK 4U0QB 4FP8H 3S36X 3LV3B 5GS0H 3LPFA 5BMFL 3S88H 4M3KB 4YHYB 5SWZA 4LEXL 3FQXB 2MNUA 3DURA 5C3LD 3RNKA 4ODWB 1ZANL 3OKMB 4CRPA 1CLYH 5H37G 1KNOB 1S7WA 1RIUL 5FA3B 4PJ5B 1LGVA 2FEDC 3BN3B 5JO5A 1XR9B 4ZAKC 3LN4A 2XACC 1KLUA 1PYWB 1FNEB 1OAQH 4NRXA 4LF3B 1UADC 3WSQH 1GXEA 4DKEH 2K3TA 3SKUD 3N85H 5KS9B 3B3IA 1XGQB 1MF2L 1IJ9A 1M71B 3HUJB 3QDGD 3LSOA 5SV3A 3ELAT 3T08A 5T1LB 5C6WH 3CSYB 2HFTA 5DRNB 1JTTA 4L4TA 2VAJA 1QHPA 3GKWH 1NAML 3UJTL 3RZCD 3GIVB 1X3DA 3C6LC 1RZ7H 1CDGA 3CFKB 1TTFA 3QO0B 3MV7B 5F9DC 4U33A 3L3HA 2NTFB 1EO7A 4QRQA 5GGTA 1NFDB 3NFNA 1M7IB 3DTXA 1K8DA 2CO6B 3PF2A 1DN2A 3QIUC 1JNNL 1UG9A 5HI5C 3FRUA 5GIRA 2YXMA 4I3GA 4PJ9D 1EEZB 3VGGA 4F7TA 1CQYA 2XZQL 5C0AB 2PYFA 2CD0A 1G7QB 4YHOL 2DF3A 2VXTL 2X9WA 4R4BA 2XYCA 1ZA6A 3R06A 4Y4FA 5F1IB 4JM2B 4I5BA 4P2CG 4PJ8B 2R1YB 1JL8A 4PJFF 2PTTA 4JKMA 2AGJL 1N2RA 3AY4A 4ZG1A 3BWAA 4TPRL 3MXWL 4UUJA 4XVJL 4G43B 2CUMA 3LKPB 1RUPH 3KYKH 1KEMH 3T4AA 2Y36L 1H8NA 4P5KB 1GCFA 1DSFH 1HH6A 3FQNA 1AY1L 2AJVH 4OSUL 5GGRA 1JHTB 4MNQA 4PREB 1BEYH 4JLRB 5BCAA 1I8LC 3QDMA 5K9JH 1RU9L 4U1GB 5HYJD 2PKDA 1DVFB 1DQDL 1EPFA 4OCSH 5J6GA 1F3DJ 2ICCA 1HOCA 3MOAL 2I26N 4X6FA 3H8NA 1YN7B 1ZGLP 2E27H 32C2A 5J1TC 3CMGA 4UDUB 1AFVL 3T1FB 1H3TA 1XEDA 1NANH 1YEGL 4NZTL 1R3HB 5FUZL 3C2AL 4HS6B 2YD3A 4ZDHA 2XZCH 4UAOC 2F9BT 4WHYG 3VGDA 1LE5A 1MJUH 1A7OH 2Y07H 1U3HD 2HKFL 2NY5H 2XG4A 3OL2A 4G8GA 1G6RL 4NRYB 1I9EA 1CFQB 2VWEC 4JZOB 4OCYL 3ISWA 2C4FU 3PDDA 4UT9H 5D8JH 1VENA 3W39A 1MFNA 2CRMA 4GW5A 3IDXL 3U82B 3TA3B 4KRNA 3OKDA 4HS8L 3B9KC 2YR3A 4HWEL 1H9VA 5CILL 2JB6B 5HI4D 5C6TL 5CJ8A 5J4MA 5I1EL 2OTWA 3W2DL 1UACL 3M17A 4JPWH 3EYOA 1EEYB 1ACYH 3P73A 3G04A 1MWAH 2AXJA 1DFBL 3LKNA 1FSKB 4CUCA 3DRTA 3DO7A 3WLWC 1YYLH 3IGAA 1ZS8A 3U36A 5E00B 3MRFA 1DBBL 1U8JA 4OKVB 2OP4H 4KHTL 1CDCA 4PTUA 5MENA 4QHMB 2AK1H 1JI2A 1FBIL 3VXMA 2GW5A 4GQ9L 4YHPB 4P5TC 4H5SA 3QEQA 4HAFA 2P45B 4LSVL 4LARL 5AYQA 4HF5L 5CD3A 3D9AL 3IDGB 3TPKA 5E9DA 3SDDC 2FSEA 3DVGA 3TBTA 5C2BH 1WUNT 1G7LB 1J11A 1I7RB 1GPOH 3TESA 1RJZB 4NN5C 1F3JA 4P3CL 1T1WA 1CGVA 1RURL 1F2QA 1MVUB 4KC3B 4HKJB 1NANI 3BP5A 4M93C 3MA9L 3QH3A 4YX2H 4HJ0D 1C7SA 3S96A 3VXUA 2X4PA 1XGPA 5HYQA 4XPBH 1QKZH 5BZWB 5F7EL 3SDXB 3FMGL 3FO9B 3VFMA 2DQDL 5D2LB 4M1CD 1PSKL 4LLYA 5GHWH 2AXGA 4X80H 1JGEB 1F4WH 2W65B 3EO1A 3TN0D 1FZMB 2HLAB 2J4WH 1CIUA 1HDMA 3LPGA 5JOEA 1BZQK 3F5WB 3PIQB 3PL6A 4IEFB 3BKJH 4QHLB 1Z2KA 1XR8A 1Q72L 1WZMA 4P57A 5ALBH 5A1AA 5E8OB 2WUBL 5D1XA 3VDBA 4KV5F 4RGMC 1P53A 4OZGF 4YUEL 3MRGB 4BZ1H 5E7FA 3WN5A 3HC0A 4KK8D 5CSZA 5EB9A 2NY0D 5FYJL 5LKNA 2I5YH 1VGEL 4P99A 4P48A 1DBJH 5D2NE 4WWKC 1JPSH 3FT3B 4CU6A 4PJAF 2X4OB 2GCYA 5SWQB 4ZSOA 5FO7B 4KAQH 4NKIH 4O51A 4N1HB 3VWJC 1HNFA 4WO4A 4GW4A 4ZFFA 3HNVH 1LDPH 2EECA 5JXAL 3D3VE 2VISA 5CJOL 5DJYA 3RWGB 4HH9B 5CGYC 5GRJL 4NPYA 3QUZD 2AEQL 2FIKA 4OZ4A 4YPGA 5GPRA 3UPRB 3ZSSA 4OD1L 4JG0H 1LMKA 1IQDA 5TF1L 3NCFB 3WKML 5IV2B 4WW2A 4KGJA 3WE6A 2C4FT 1O0VA 3QUML 4NKQB 5DQJB 2I25N 3IAQA 1P6AB 5CBEA 4JO1H 4U05A 4U31A 1DDHB 4GLRH 3U9UA 3TC9A 2VNCA 5L8KB 4LHUA 3S5LG 1JGVH 5ENWA 2YWZA 1TZGL 1RHFA 3KPMB 5JHDE 2YMXH 4AEFA 4XCFL 4Z7QE 1C8PA 3P4OA 5IVZB 3QWRA 4MSWB 4D9LH 1GHFL 3MNZB 1BGXL 3I6LD 2QV2A 5C0BB 5EPMB 1S5HB 1MQKL 3EOAA 4E0RA 4LLDA 1B2WH 2NY2B 4XCYB 3BDBA 5JLZA 2YEZA 1NLBH 2ZUWA 4XNZC 4KROC 2BRRH 2IADB 4WUKL 4PJ7B 3D85D 2APVA 2ADIA 1IEBA 2CIKB 3E6HB 5ALCH 4OI7A 4PJHE 5HDLA 1UZ6E 3U7WH 4WRLA 3B9AA 2CJUH 3QUYC 1TVBB 4EDWL 1WTGT 3ZL4H 4JFEA 3QUXC 2VERN 4PLOB 2QADD 2EO9A 5DK0A 4K7FA 3WHE0 1TZHB 1AP2B 1JGUH 2YD4A 1WEJH 4TSAH 3HFML 1A1NA 3MRKB 4BQBA 1S7SA 2O5ZH 5TH2A 1NCAL 2X4RA 5GS1C 4F3FA 2W91A 1FGVL 4OZHF 4RCAA 3S9DB 2IGFH 4WHTB 2DBJA 4WTWA 1PKQB 5KVEL 3LIZH 2ESVA 4PJBA 3K74B 1QLRB 5D1ZB 4PG9B 5EIIA 4BJLA 2JJTC 4IIQA 4U1IA 4AL8H 4M02A 3O4LD 2F54A 5ETUB 4FP8L 1NDGB 4LOUC 2YPKB 3M45A 1J8HE 3P0YH 2F5BH 5GS0L 4Y0GA 2Y7QA 3T77B 3OJ2C 4YHLH 3LEXA 1A1OA 3LQAC 3PQYD 4GLRI 5C2UB 4LNVA 12E8L 1A6VH 1KB9J 5A2JH 1S9WA 4LPUA 4Y2DC 1CLYL 1X6LA 4S1SH 3ILPB 1MFDL 5SWZE 3UAJC 3TYFA 3PDOA 4AQOA 1ZT1B 3FQWA 1MCIA 3V4VH 3DX9B 1OAQL 3WSQL 3RVXC 4DKEL 3PWPD 3E2HC 3Q2CA 3N85L 3HPJB 3HN3A 1FN4A 2VO5A 3EZ8A 2IQAB 4XC1L 5CZKA 1YC8A 3S4SG 2VL5A 1I7ZB 4IHOB 4R2GD 4FFWC 4NYLA 3GKWL 3RL1B 4YHYC 3T2OA 3KPNB 1RZ7L 5J3HC 3VE0B 1XIWD 3ROLA 2ZNWA 1HHJA 3BP7B 4EQ3A 3U4EA 1XH3B 4HX1A 4M7LH 5EU6A 1NAKH 2J6EA 5H8DA 1M1SA 3GSXB 2D9CA 4UDTA 5E5UB 1KJVA 4B0MM 4EVNA 5KZCD 4Y19B 1I7TB 4X98A 1TIUA 3QCUL 3RGHA 5GRUH 3NN8A 3TBSB 1C5DB 4GH7B 3S37X 1FFOB 4I18C 4N9GB 3WJLC 4I4WA 3ET9F 2BNQB 4HZLB 3WKNA 1IE5A 3WMSA 3D5OF 4MJID 3KYKL 4HIHB 1KEML 1KJ2B 3CFDB 5C0FA 2YA2A 4P2RB 2NCMA 1DSFL 2GTWA 3VJ6A 5I15H 3TIEA 4XCCL 3AROA 5E5RB 5HJ3B 4GMSH 2DI7A 3BN9D 4C56D 3V6OC 4ZOAA 4MDJB 4HDIA 5TDOA 1BEYL 1BOGA 3CFCH 1YUHA 3CZFA 5FF6B 2HJFA 3RGVB 1KTLB 1KIQB 2V5SA 4X4XB 4G7VL 5JW4Q 3IDMB 5IQ9B 4MNQE 1AO7D 2E27L 2EE9A 1NGZB 3U79A 5J13B 3QDME 3FO2B 3JZ7A 3QBTB 1QQDA 1II4E 4JM2C 2EEBA 1U8NA 4PJ8C 1QR1B 2JIXB 2XZCL 3BESR 4FTVA 3K0WA 3I9GH 2R69L 5EU7E 2CDGB 3RRQA 1OW0A 1A7OL 1KPRB 1MJUL 5F7LB 4DOHE 4JCLA 3JVGA 5DYOB 2UYLB 2CLVB 3MLWH 4UT9L 2PW1B 4U6HA 3G6DH 3NAAH 3L5JA 4G8GE 4U1GC 1D5ZB 4ISVA 2W9DL 5IIEA 1KYOJ 3UYRH 3NCJH 5CMAB 2P8PA 3TNMA 4GKSB 1U42A 4NO0A 1IM9A 3TIDA 5HD8C 4XBEL 3LRGA 43CAA 1MWAL 1T1YA 1CFVL 1A6UH 4PGDB 1I7UB 1T5XA 4LLVA 5KG9A 1YEDB 2EXWC 2XG5A 1N0XH 1YYLL 4APQA 2R2BB 3GHBH 4PD4K 1NCUA 4YEEA 2GTZB 3QDAA 2OP4L 2EKJA 3P4MB 2VKWA 5DUML 1WLHA 2AK1L 1B90A 3QWQB 2V7HB 5GJTL 5DD6A 1BFOA 1WCBB 3HPLA 4PBXA 5I74C 1L7TH 4CNIB 1EAPB 3HRPA 3O2DA 4I9WD 1IT9H 1JF6A 2G9HA 5MENE 1A9EB 3TA3C 3B5HA 3I02A 4MVBC 4V2CB 5CD5C 1M7DA 3QI9D 5C2BL 4Y5VB 1GPOL 3QEQE 1U93B 4KRPB 4N0UB 3BW9A 4K23H 5E6IA 4PJAA 5E9DE 1XGUB 2V9TA 1UFUA 5DSCB 5I30L 4YX2L 3SEPA 5BV7C 4X6EA 2CR6A 2ITCB 4ZFGH 1I1AB 2FJFB 1P1ZA 1QKZL 3P4LA 3OKNA 1HXYB 4G9DB 4HUMB 3UZVB 4WEMB 4JFDA 2BDNH 2MTPA 3V4PH 4ONFL 4X80L 4L8BB 2ITDB 4MQXC 2LAGB 3B9VA 1OWRM 4QXGH 4I0CC 4MMZC 4PJDA 2NYYC 4M6OH 5FO9B 4P2YA 3E3QC 3VXSD 3GSWB 5ISZB 4L4JA 3L5WB 4I3SH 1ZA3B 2OJEA 3WL9B 2IAND 3QT2A 2LTQC 5IWLA 4QHNB 2A9MH 3QXWA 1JFQH 2MCG1 4OI8A 3Q3GB 1UT9A 2BMKA 1TTGA 5B38A 4F7CB 2HA1A 1DBJL 1MH5B 1QHOA 3FO0H 4UBDD 1WZ1L 4C58B 5BO1H 1A4KB 3T4YA 4DKDC 1GAFL 1NUDA 1VB9A 5FDWB 3R8BB 2XWJA 4XP1H 3L3GA 4OD3L 3OJVC 1T6WA 1RVFH 4X6BB 1CU4L 1QRNA 4AEIH 5DA4A 1LDPL 1T21A 4ZFOL 1FRGH 4ZSOE 1QLFB 4DK3A 1C7TA 4NQCB 1SBSH 1BD2B 4JG0L 5E8EB 2DMBA 2ATPB 3GI8L 4GKZB 2E8YA 1QEWA 2YUWA 1FZJB 1VFAB 2XTLA 4BQ9A 2ZWLT 4Y5YB 1DLFL 4EN3A 5IB5A 1PZ5A 1FAIH 2OL3B 4RIRB 4O4YH 4I0PD 5IB2B 2EZ0C 3ZSTA 5HPOA 3T0BA 5IW1B 1BZ9A 4DVRL 1Y0LA 5I8EA 3QHTC 2YMXL 4MA8L 3QXAB 1U41A 5SWSB 4JN1H 1JPGB 5IF0A 4H0GA 1RZ8A 4D9LL 3X14B 1WWBX 1DQMH 4CJ1A 3BZFB 1MY5A 1J9CT 1D5BA 4OM1H 1LP9B 3V5HA 3UX9B 3L5XH 2GUOB 3AXLA 1B2WL 3P77A 5INDB 3EJYC 2CLRA 1TVHB 2NR6C 5IHZB 5B3JE 1Z3GH 5GS0D 1NBYA 3NIDE 5L2JB 3VFOB 3D69A 2XQYG 4N9OB 5ALCL 4HK3J 4JDZB 4OCXH 1YY8B 1OAKL 1MFAH 4HUUA 3GSRA 3BQUD 1NGWB 4FQ1H 3U7WL 4JKLA 4QTHA 1TZIA 1TQBB 3HC4L 4D9QD 1TDQA 2NZIA 1PQZA 4FG6D 4LKCB 2R2EA 5B39B 3HG1D 4GAYB 3ZT5A 1C5BH 1WEJL 1JIBA 1T22B 2DQFA 4TSAL 5CZXC 1GC1H 2O5ZL 1KENH 3TLRA 1P7HL 2KQNA 2Z93B 5IVXF 3G6AA 4V2BA 2NY2C 4KK9C 3U9PL 5EU4A 1EBPA 4XI5C 5GGUB 3U1SH 4BUHA 3BD4A 5KBNC 5DI8B 3FAWA 4M62H 4N8VB 3EYFB 2HFEA 4DKFH 3GHEH 5IOPB 4AL8L 4D8PA 4ELKA 1YNLH 2ESVE 4PJBE 4YH6A 3P0YL 5F1KC 1QSEB 3BPOC 1FNAA 2GFBB 4L9LC 3RVVD 1G0XA 5E8PB 1RUKH 3ZHDA 4YHLL 3C5ZD 1XF4B 3UTQB 5HVHB 4LHUG 2B4CC 2F54E 4MA1B 1AGBB 2CUIA 4YK4C 1HYSD 1JZ2A 2VLRA 4W4NA 1BJ1J 4Y1AD 4JJHA 1RIVL 4S1SL 1FL3A 5KW9H 3FTGA 1BBDH 2DQTH 1JNLH 1KLGA 1WBZB 4PPTA 4ESKA 4NKDA 3WXVH 3G5XA 2P24B 2UWEB 5FGCB 1OT1A 4XXDA 4LRNH 1PJ9A 1P2CB 2A1WH 5ADOL 4IJ3B 3O9WB 4M5YH 5IBUB 4K2UL 2DQIH 2DIAA 2AJSH 1NFIA 3VWKA 4FQ2L 4LLQA 4JDTH 2VZ1A 1EERB 3WDJA 5T5NF 2FWOA 3HR5A 4MS8C 3GEWB 4KKLD 4EDXA 2XTJC 2HT3D 3TH3T 2W0PA 3D18A 3SY0B 5DJDA 5I1DA 4M7LL 1OT2A 1NAKL 4ZUVB 2Y72A 2BVPA 4KUZL 2AAVA 3OSKA 3T2NL 3HNTL 3MRHA 1LK2B 5F88B 3L9RA 3CLEH 4GG8B 4M61A 3GMRA 2D03H 5EU6E 2XY1A 4QWWD 2MJWA 4NO2A 2OCFD 2VDPH 3AB0C 5GRUL 2YXFA 3RUGF 4M00A 4Z5RA 3V8CA 1MAKA 4FFZH 4WENB 4U49A 3FO1B 1P69B 2G5RA 2XN9D 4LPWA 4XWGH 1T1XB 3QDGB 5I15L 4ZO6A 5I0DA 3LQMA 4EIZC 3VFVA 4P23B 4Z7OF 1AH1A 3RZCB 4ZO9A 5I1AA 1D6EB 3OGCB 5ESVB 1F58H 4G6AC 5BQ7B 1KCSL 5B3NA 1KLFA 5H94A 1FE8L 1C08A 1AXTH 1QP1A 3E8UL 1L9NA 1B0RB 3KPLB 4IRSA 4JO3H 4YBQD 4CVZA 1AQKH 4XTRD 3R8QA 1ZK9A 1EO8L 2CKBA 4PJ9B 2ADJB 4JGUA 4OUUB 5LQBH 2YUXA 2PTVA 2H8PA 3O8XD 1K5NB 4NGHL 4FZ8L 1FLRH 5DFVD 3KXFA 3I9GL 1FYTA 3GMNA 1S78D 4IM8A 4Z76B 4Y89A 3MLWL 3RVWD 1AQDA 4FTVE 5HGAB 2E3VA 3DV4B 3QJHA 2QKIA 4MAUH 5FKAB 4U1SA 5DFTA 2L7JA 2XWTB 4JHAH 4PGCB 4NN6B 2FZ3A 5GGTL 3K4ZA 1BFVL 3EYVA 3CPLA 4UILL 4R0LC 3UYRL 1IM3A 3NCJL 5DRZB 2J6EH 2D31A 4YAQA 5HYJB 4A2MA 1CCZA 3F58H 4PJGA 4LBEB 1C5CL 5C07A 3TO2A 3PABB 4HWBL 4H1LB 2AABH 1A6UL 1VADA 1PG7X 4HS3B 1G7JA 1N0XL 3GHBL 2DLHA 3QWOB 3EFFA 4NQVA 1NFKA 2VZSA 3IFPB 1FAKT 1N59B 3BYYA 1CXKA 2ZOKB 4R7NA 5DMKB 3DYPA 4I13B 1L7TL 4XGZB 4ZS6C 3MTRA 4MD4A 3PP3K 4LVNC 1OTUD 3L1OH 3RL2A 3Q6GH 4JKPH 3DSFH 5I1GH 1URLA 3VI4E 2H2PC 3LH2L 2P8LA 1R5WB 2C3VB 3FONB 3O6KH 1JV5B 5AZ2H 2AP2A 3IDIA 5DS8B 3FB5A 1CLOH 1SM3H 5I2IB 4K23L 3LVEA 5DMIH 4I2XB 1MCWW 2I60H 1A6TA 1I1RA 1BBJA 1JYWA 3C8KA 5IBLD 2IPKA 3TO4A 4P46D 4Y16A 4JEGB 1QTYT 2BDNL 1JPFA 3V4PL 4MXWH 2VLLA 1J0HA 2R2CA 4XBGB 2XPGA 1CDIA 3O41A 3VXPB 3EYQD 1YMMD 1T80A 3CFEB 4JFDE 4M6OL 4TUJB 1CICA 4RBPH 3L7EB 2DM3A 4F33B 1AC6A 3TCLA 1IGTB 4I3SL 1DEDA 4NCDA 3WNOA 4PJDE 1ULVA 1D5XB 2LU3A 4Z7UA 2MQ3A 4Y5VC 2A9ML 2EDNA 3KNBA 2NY5C 5C86A 1ITCA 3VXOA 4EOWH 3ARZA 3IT8D 1RUQL 4NO5A 4Z7WB 3FO0L 3IVKB 4MA3B 1S7QB 3S36L 1N3NB 2EYRA 4XP1L 3GB7B 3RWDA 1EO5A 1T83C 2F74B 1IAIH 2OX5A 2V2TB 1CFSB 5HHPB 4AEIL 3LB6D 1P4LA 4LSQH 1BF8A 1FRGL 4Q0XL 5C0IB 1GGIH 1NCBH 5BRZA 1SBSL 1QRNE 3FFDA 3O3AA 1OP3H 2KKQA 3TN0B 3DGCR 3W82A 3QXDB 2RJMA 1VFUA 1RZIA 4YE4H 2QR0A 1S7UA 3IU4H 1P7QD 5E1AA 1T3FA 2C7UA 1FVCB 1FHGA 3HZKA 1DLHA 4P4KC 5JMOC 1HE7A 1FAIL 2X9XA 3DX6B 2PO6D 4RFNC 1N8ZB 5B3JF 4LLUA 4O4YL 5EU5A 4ZQKA 5K33A 4F58L 3SBWC 3D3VD 1VESA 3B83A 3GMPB 4MAYA 2GQHA 2NY0B 5HY9B 1P9MA 1A6ZB 4D9RE 4KVCL 3CXDH 1U91B 3OAYH 1DQML 2NY4C 2OI9C 2X1XR 4JRXB 1FVDA 3MQIA 1I8IB 4QCIA 2QQKH 1OAUL 2DM2A 5LGKA 3MMEB 3L5XL 2XFXB 3EOYG 4S10A 1IVLA 2J5LB 4JJ5B 2X4QA 3RWJB 4JN2A 3QUZB 1SYSA 1Z3GL 3ULUE 1JZ8A 1KTKE 5KSAC 4PGZA 1IGYA 2KUTA 2NQCA 3U6RA 4JQVA 4KZDH 2KZ1B 4H0HB 4JCMA 3N06B 2YD1A 5JHDD 2Y06H 1U58B 5B38G 2P47B 4FQ1L 2XKUA 3OXSA 4HIEA 3VCLB 1AHWC 1XGTB 5D1QA 3GO1L 4G8IA 1MCRA 2JCCA 4RFEB 1J86A 1IAII 4ZNEA 4FXKA 3VFSA 1GC1L 1KENL 1TJGL 1FG9C 3CK0H 1MNUL 3KHOA 3BP6A 2FL5A 1WQVT 5EUOE 3DRQA 2IALB 3MLTB 1PLGL 3U1SL 3HB3C 5BJTA 1U8QB 4M62L 4DKFL 3VXQA 3GHEL 5KN5A 2CH8A 2CMRH 1NCNA 4FRWA 4YFLF 1P4BH 3D85B 5CEZE 5ESQA 4BSWA 3B2UC 1JF1B 2GJJA 3WNLA 1DJSA 5GSRA 2DQUH 3RWEA 1JPST 1ZHLB 1L6ZA 2BCKB 4UOJA 3FHQA 1QR4A 3LKSA 5HHXH 5DFWH 3U4AA 3ALWA 5DEFB 4MQ7B 2QADB 3ARYA 3TWCH 2Z8WC 4DCQA 1TVDA 4LCCB 1JNLL 2VZ3A 2VLRE 5HGHA 1FDLH 1EFXA 1CGYA 3WXVL 4GRLA 4AIXA 1PBYA 3V5KB 1J8HD 3DECA 3ULUH 1IILE 4LRNL 1LO2H 2A1WL 3HI1A 4M5YL 1XF5A 3HRZB 3BGMB 2RR3A 5MI0C 2AJSL 2FIRT 1NAMB 4JDTL 4PJEB 5CGTA 5SWZD 5I71C 5F9JA 3L3KB 5C0ND 3WS3B 5HVHC 5I17A 5GZOC 3O4LB 4GS7C 4MA1C 1RMFH 5GJSH 5IB1A 2V2XA 4PLKC 1H15B 5JR1H 1DBMH 4Z78B 3FT4B 3KYNA 2P48B 2WV3A 1GZPA 4XCEA 2QQLL 1ZHBB 3OKKB 5BS0A 5JZ7C 3PQYB 3MLSL 3F7VB 2JJSC 3BUYB 3WLBB 1ZVYA 4QTIL 4Z7VA 2D03L 4LP5A 2FECI 2Y6SC 1T04B 4O2FB 1YEJL 4HWNA 3H9SB 5ADPL 4JO2L 5H35B 3MA7B 1DR9A 4HMDA 3PWPB 4Q6YA 1T7WA 5CEZH 1D6VH 3WIIH 2IH3B 4TUKL 2VABB 3ALXA 4XWGL 5EOTB 2Y9RT 3IDNB 5LCVH 4R2GB 1KBGL 1SMOA 5HVFB 1YEFH 4EUPA 5T3XE 1R5IA 4CDGC 4RGND 4KTDH 4HLZH 3MRPB 2ZSWA 3WHE1 3QZWA 1KPUB 5FKPB 4KJQC 2VITA 1XIWB 5ESAA 1OARH 1AXTL 2P7TB 2MKWA 4JO3L 5E4EB 2IPUK 3KAAA 5HI3C 1AQKL 2UUDH 3K3QA 4L4VA 3VXTA 5J57B 4U1KB 2J8UF 5KZCB 2PXYA 4NCC2 4JPIA 1UWXH 2R1XB 4WU5A 3IS0X 4XB8A 2Z4QA 5HGDA 1FLRL 1JRHH 4LQFL 4PP2A 3DVNB 4NQXA 2AK4A 1MLCA 3NFSH 3OWEA 1BWWA 2X7LB 1G6RB 2OSLA 4WV1A 5ELIA 3ZE1E 5D5MB 1J7VR 3HZMA 4JZJB 4P23C 4FFYH 3ULVC 1EHLH 4MJIB 4MNQD 1FYTE 4OLUH 1F11B 4L1DA 3QDJA 2AXFA 3DBXA 5F7MC 4M03A 1XT5A 1N6VA 3QDMD 1KIPA 3SCMC 3BVNA 3MGOA 3MRMA 4C56B 4YHMH 1MI5A 5GRXG 3VFTA 4TNWK 3DETC 5INCB 4OB5H 2J6EL 2RGSA 1YN6A 3CH1A 5CEXA 5B8CA 3EHBD 2J88H 2W0FA 4AIZB 5FYKE 3SKNA 1AO7B 2AABL 4QGYA 2EDEA 3N9GH 1UCTA 5C7XL 1I8MA 3I3EA 1JUFA 5F7HA 4PJGE 5C07E 4L1HA 4JFOA 1YJDC 4G8GD 4KKNA 5T3XH 5TDPA 3WNKA 2OXGA 4HKBA 1M6OA 2HVKA 5DVNA 4PRPA 4P59H 5E8NA 3JWOH 3L1OL 3Q6GL 2DJSA 4NN6C 4JKPL 3DSFL 4KQ4H 5I1GL 5FECA 1IEAA 3BXNA 4KQ3H 4M7LT 3O6KL 1MJJB 3BZ4B 5AZ2L 3WHXA 1CLOL 1SM3L 3ARQA 5DMIL 2JJVA 1FFRA 2I60L 5A16B 3HC3L 3MCLL 3MOBH 1AGEA 4N0YH 3MUGA 2CDFB 4JAMA 2CKBH 3WYRA 1JRHI 1B6UA 3QPQD 5MEND 1XF3A 4MXWL 1HIMH 3IRPX 2R1WA 3MRIB 1HINL 3STZA 3ZKMD 5MEPA 5F7YC 1G0DA 1F42A 2K7PA 1WBYB 3SGKA 5JXED 5E9DD 3WFDH 3W9DB 3LKOA 3S98A 5DLML 4WEBH 1MLBA 35C8L 3QI9B 5CP7B 1G7IB 1AIFA 5FYKH 1P7KB 3SGJC 2HN7B 3H42H 2QTEA 1F8TL 3U0PA 1JN6B 2DLFH 3WO3B 4XMKH 3FQTB 5DUBA 4E9LA 5JIPA 1KPVA 1BHGA 3TT1H 1ORQA 1AGFA 3MRQB 4ZAKA 2BNUA 3OKLA 5AAWA 1WIPA 1UKSA 4IOIB 4LSQL 1GGIL 1IBGL 3PL6D 4PGEA 2NZ9D 2YD5A 3C2SA 3RQ3A 1CGSH 4XC3H 3ZLQC 4YE4L 4GKNA 5BRZE 4Y4FC 3IU4L 3O2DL 2CUHA 2CIIB 4YGVB 2H2SC 3VXSB 1NDMA 1S7TB 5C6PB 1VFBA 5EZIH 3HTLX 1QBLH 3QUMB 5IMLA 5KSBF 3SDAD 2IANB 3A67L 3U7YH 4H20H 4X5WB 4UINH 4D0DB 1LEGA 4LASH 3MRBA 2DWEB 3QIUA 1G9EA 2F5AH 3T65A 2NNAA 4NZJA 3ME0A 1Q1JH 5C0DA 1UZ8B 3ARRA 1A4JB 3DGGB 4X5LA 4X99B 5E7BA 4CW1A 2HH0L 2QQKL 3V95A 2HJLA 4XZUB 4DGIL 4RMTA 2BRQA 1GJIA 2CGRL 3F8UB 2AV1B 3G08A 5TE6H 1EBAA 4K7PX 1SY6L 1JVKA 4PIRF 5DJ0A 4KZDL 1EZVY 1O5DT 5EUOF 5F6IB 2B2XH 1RZJH 3VD4A 1W8NA 2GY7B 1S7VB 2ZUSA 1KN4H 2KPNA 2P5EA 4K94L 4LHUD 3KLHC 1D9KC 1I8LA 1S7XA 4F57H 2NY0C 4WJ5A 5A3IC 3PWUB 5JUEH 3G5YB 3BIBX 4QHUB 5FGRA 1WAAA 1Q9WA 4I0PB 3ZDXE 3MJ9H 4KXZH 5MEOA 1MCEA 4JFPA 1T2QH 2JCCE 5CWSB 4NC0B 5CLWA 3KJ4C 2P5WA 1CL7H 4ZNEE 2RB8A 1RY7B 2JK5A 5KS9F 4RISL 3L3IB 3BH9B 4IOSD 3HUJF 2R4SH 3FQRA 25C8H 5J1AA 2CMRL 4S1RH 3HCVA 4XWOC 3SE8H 2ZUYA 4M8QB 3MPCA 4HK3N 2R9HD 5D96B 1NFDF 1JCKA 4ELMA 2AKRA 2DQUL 2F53A 2NW3B 3AC0A 1T1ZA 5LAXA 2EDDA 1UB5A 3B9KA 3BQUB 4L8SC 1PEWA 3CX2A 4HBCL 3KPRA 3LD8C 5DJXA 1X5YA 5DD1H 5HHXL 1WBXA 5D7SL 1AXSA 1CD9B 1K2DA 4XX1E 3RX7A 3HG1B 1YYML 1NCDH 2VR4A 2N4IA 1FDLL 3QG7H 3L95B 1A3RH 4WGWB 3UZEA 5I66B 5DJ2B 1HILB 3I2CL 1Q94A 4YXKH 3T0EA 3ULUL 3RAJH 1LO2L 1AD0B 1NMAH 2YPLD 3L3JA 1K9TA 4PJXF 3QNZA 1P84J 1C16B 4WTXA 2F54D 3PWLA 5F89B 1IGIL 1S9YB 3PWNA 5HHME 2Q7NA 4P5TA 5BVJA 3AFLA 3KWWB 3WUWA 5GJSL 1RMFL 1DBML 2VXUH 4WI7A 4KI5F 3SDDA 1F4YH 1U8LB 4M7KH 1J1XL 2M2DA 4NNPH 3C5ZB 4PJIA 1V3JA 1CFBA 2GK0B 3FB7B 4KXZI 3SJVD 4BKLA 5DJ8B 4M6AA 1FIGH 1X5HA 1NEUA 3QEHA 5BS0E 1T4KB 3EUUA 2PYED 1CL7I 2A6IA 1FNSH 2Q76B 4HGMA 3U0TA 2X9YA 5IJKC 1G6VK 4Z7VE 4GG6B 4PJCA 4PV9A 43C9B 2R2HB 3RWCB 1TFHA 5CEZL 1WIUA 1IKNC 1BREA 3IU3A 4OZHB 2ADGB 3MRRB 4JR9L 5LCVL 2FRGP 4LSTL 1HQ4A 1YEFL 2XI9A 4V1DA 1MHEA 4XX1G 1A7NH 3MLZH 4KTDL 4ZYKA 4X5XA 1DQJA 1NSNL 2FGWL 3FB6A 5CINH 2J3SA 3MC0A 3T3PE 1OARL 2XXMB 1BJ8A 2EC9U 4ODSH 4WWKA 5F72S 1ACZA 3MYJA 1N7ML 3O3BB 2CRYA 4Z95H 1LEIB 4Y4KD 2O61B 4QRPE 3RIAK 3VWJA 2VB5A 4PRHA 4K07A 1W8OA 4KZEH 4L4VE 5E08H 2Z31C 3N1QC 4OUOA 2DBLH 5HDOA 4ENED 3NFSL 2YA1A 4MYWB 4PRAB 3DIFA 4ODVL 2X4NA 7FABH 5FA4B 3UPAA 2IF7A 4G6FD 4NJ9H 1EHLL 5JIIA 4OLUL 1EXUA 3WO4B 3P30H 5LGJB 2AK4E 2XN9B 3BWUC 1LWRA 3GMMB 2SEBA 3OX8A 1OB1B 4G3YH 1KIRA 4L8DA 4KJWC 3NABH 5GISH 3ULSB 1OGTA 3T0WA 2V5MA 4YHML 2GSIB 3D87B 4NWUH 3KLAA 1OQXA 2V5YA 3QDJE 1V5JA 5E4EC 4CJ0A 4AM0A 4KUCD 2ILLA 5EIVA 3BIKB 1AGCA 2K9UA 1DQTA 1OHQA 4P3DA 1IGFH 1MI5E 2J88L 1T0NB 2FBJH 5LVEA 3BI9X 3SDXF 4X6DA 3D1MC 1G84A 2VDRH 4U6VH 1CFNB 1CR9H 5I18L 4R4FH 4GAGL 3PE9A 1G9NC 3FJTA 3N1FC 4DGVH 4J2XA 1DQQB 3O8XB 4YO0B 4JREC 5HGGS 4H26A 5F1OB 4ZXBC 2VTFA 5T3XL 3VRIA 4D2NA 3RWHA 3P4NA 3HA0A 2X4TB 1RHHA 2E7BA 5ACLA 5IG7A 3BMWA 3EGSB 3MLVL 5KSVB 4PRNA 3QZWG 4K71B 4YDJB 3JWOL 4FQJH 5DGQA 4HIIB 4KQ4L 1QFWM 3PWJB 4EUPH 5J7CC 2X70A 4OTXH 1JF5A 3ARGC 4PRPE 2VLJD 3QUYA 3VFNB 2Z8RA 3BMVA 4QNPE 2BP3A 2VQTA 3X12A 1YNTA 3BGAA 2IWGA 4WU7B 2WP3O 1U92B 1QSFD 2VSDA 2JKXA 1M05B 1DANU 3MOBL 4ZPVA 4APQD 2Q8AH 2CKBL 5GS1A 2VKXA 3MBED 4OM0H 1N64H 4XPGH 1HIML 3GGWB 2IFFH 1K4DB 1LHZA 3C5SB 1QNZL 4X83A 5B4MC 1XMWA 5DJ6B 2EDXA 3PV7A 2JJTA 5FHBL 1HKLH 1OGAD 2N7AA 2NY7H 4UT6H 4U2ZA 4I48A 1BVKB 2BSSA 3UMTA 2C4XA 3CVIH 2DKMA 1Q9OB 2AQ2A 4Q9QL 5FB8A 4OT1H 5FYKL 1YPZA 1HH9B 1UB6B 5EZLB 1T03H 4R8WH 3V0WH 5L2KD 4LMQE 5D72H 4M8VA 2VXQH 1T0MA 4JFDD 2QBWA 2W0KA 2XRAH 3OKOB 4PG2C 4XMKL 4P9HH 2NXYD 4JY6A 4N0CC 3TVMD 4X8JB 2YPVH 1HHHB 3MJ8B 2GJ6E 3N1MC 4P46B 2ZUQB 3VDCA 4F8TA 4ZFOB 2DAVA 3FFCA 5EBLA 1ODAA 4L9DA 4TYUA 1JI1A 3SQOL 1GZQB 3LPWA 1BF2A 2D3VA 3DVIA 1CGSL 1FYHB 5HGBB 4XC3L 2OBGA 1YMMB 5EN2B 3LV3A 3QCTH 3IAGC 2VIRB 2CLZB 1RD6A 1OSZB 5KOVC 4ZS7H 3FQXA 4B5EA 4BSVB 1CGUA 2WK2A 5EZIL 1A7QH 4ODWA 1QBLL 1WCQA 3B9EA 2NY3D 3OKMA 3WNNA 4H20L 2BSED 4UINL 5ID1B 2HP4A 4IMKA 1KNOA 3ZMRA 3RKDD 4XVUC 1PAMA 4KMTH 3V0VB 2AV7B 4UTAL 1HEZA 3KPPB 1XR9A 4ODBD 4WTZA 4MXVE 1QO3B 1PYWA 2EXYD 1LD9A 4ODXB 5IW6B 2FHBA 5EH1A 2H41A 2V2WB 2DN7A 5L0QB 3K2UH 4IDLA 1NL0H 4F7EB 1X7QB 3RVTC 3LS5H 4F7MB 1M71A 4I18A 3C09B 3QFJD 4E5XA 1A7PH 5T1LA 5BOZG 3CSYA 4JFQA 5EBMA 5DRNA 3C8DA 2DQGL 5EC2B 3FOLA 3GIVA 4E42A 4W68A 1UWEL 2QQQA 1NC4A 2B2XL 1IGJB 1RZJL 3QO0A 5DVOA 2KQMA 3QEGH 2NMSA 4EN3D 4S0SD 1M7IA 5D2NB 3HMWH 4D9RD 2WINA 3DHJA 1P7QB 3HI6H 4HT1H 2O26U 5C0JB 1YY9D 3BJLA 3M8OH 4F57L 2WQRA 1FNGB 3AU1B 2YN3A 5JUEL 2MSPA 4YIQB 2PO6B 1EEZA 1NLDL 1NPUA 3DROB 1FL6B 4LLMA 5C0AA 2P5EE 3QNYB 3D3VB 5C71A 1SJHB 3F6IA 5D7LD 1KACB 3VRJB 1QLEL 2GAZB 4JM2A 3I75B 1WAAE 4PJ8A 2R1YA 1CL7L 2CR3A 4GXVL 1MPAH 1F6AB 3DYOA 3CMOH 5C9JB 3MZGB 2EEDA 2R4SL 2BOCA 4S1QH 4P5KA 25C8L 4EBQH 2P5WE 4K8RH 4S1RL 4HG4K 1JHTA 1AR1D 3SE8L 3NIFE 1UGNA 2PETA 1JGDB 2ZKHH 4ORGB 5E2JA 4D0BB 5JHDB 3BPLB 2VWEE 2LFGA 2YA0A 1CGWA 2VXVL 5FUOL 1CYGA 2ICES 1KTDB 5DD1L 4YHIB 4ELME 4UDUA 1K3ZA 3T1FA 2F19H 2F53E 4OLZH 1MCOH 1EH9A 3DJ9A 1NCDL 3KPRE 2OR9H 4FFVD 4HS6A 3EOTL 3QG7L 5HYIA 4NKOB 5IB4B 5E99H 4ALAL 4J3OC 3NCMA 1B0WA 3FZUD 4ONHB 2BVQB 5CIPA 3GSUB 1TENA 1XAUA 4NRYA 4PJHB 1CFQA 5FM8A 3LCYA 4TOYH 4RSVA 3RA7H 1PG7L 5K9OB 1J0IA 2X09A 4DQOH 3ARBD 3TA3A 2AJXL 4LMQI 4L8CB 5DGRA 3RKPA 4HAGA 4DN4H 2VXUL 3U46B 2VLRD 2DIJA 3MRCB 4CAGA 4W6YB 1EK3A 4M7KL 4NNPL 5MP6H 1K8IA 4FG6C 4PFEA 3DPBA 1A21A 5D6CB 5DWUH 3MSPA 3O3DB 4YFDB 4PJIE 3BDXA 4GQPH 2W07A 4YHZH 4OJFH 2IBZX 1B6DA 1FNSL 2V5TA 2HFFB 3V52H 4NRZB 4I77H 4BK5A 4YQXH 2X4UA 1INDH 4YHNB 1WGOA 4YHPA 4HXAH 4PJCE 5IVXB 1N6UA 4IS6A 1A7NL 3MLZL 2P46B 4NNYA 5SWZB 4OGAC 3DURB 1G7LA 1JWUB 1I7RA 1CN4A 3C5ZC 1EAJA 3RNKB 1N4XH 1MVUA 5GRVK 3U48A 4V1DE 4HKJA 1EHAA 2H1PH 3ZKND 4ODSL 1H3VA 3L5IA 4KI5D 3OAUH 5DVLA 5FYLE 1KLUB 3FO9A 2KH2B 5D2LA 2HT2D 1JGEA 2W65A 2GYSA 4Q9RH 4KZEL 4NN7C 5T3XD 4PLJC 4ETQB 2DM7A 3F5WA 3GK8L 2DBLL 2FYYA 3MO1B 3PIQA 4PRHE 4QHLA 5T1DL 4J3VA 7FABL 1E27B 5E8OA 3WUWG 1EUUA 4CMMA 4JKKA 1ZLSH 3RVUC 2W60B 1U8MA 1MY7A 5FUCC 3CH8A 4IMLA 2LVEA 4G3YL 3NABL 2XA8H 4XVTH 5GISL 3DTXB 3IF1B 4RGNB 4KKLC 4MGXA 4NOFA 5CFHA 5JQ6L 4NWUL 4RNRA 1IZKA 3FT3A 4FQIH 4Z7NE 2X4OA 2VMFA 1W0WA 3FRUB 5L7XH 5GIRB 3PNWA 1A3LL 1F02I 4K3DL 4F7TB 2FBJL 4G5ZL 2PYFB 4LSRH 4WNQB 2A83A 2GT9B 4LCWA 2VDRL 2DOCA 4QWWC 5DQDH 3V6BR 3F12B 3UJIH 3R06B 1FYTD 5F1SA 5DC4B 2UZXB 3KYMA 4PB9H 4TVPH 1N2RB 4X6DE 3BWAB 3VG9B 1A6WH 3DMMC 4UUJB 3RY4A 1DBKL 1Z5LB 1I85C 3WO4C 1K6QH 5GGQH 5DJCB 4GJTB 1MFCH 5GRZA 4H0IA 3FQNB 3HKFA 2PUQT 1NMBH 1FO0B 3ES6A 4ZOEA 4MNQB 5FYKD 1JTOA 2WLYA 1MJ7H 3F7YA 1B0GB 3P9WB 5I1JL 3QDMB 4XPAH 2PCPA 5FYLH 4K7PH 3G6JA 5C07D 1TJIH 3KPMA 1HOCB 1J5OH 4X6FB 1RJLA 5MHSE 5IVZA 3M07A 3D48R 4MSWA 1BLNB 3HZVA 4XTRC 3OQ3B 4M7ZC 4DOHB 2ICWB 4OM0L 1N64L 5SX5K 1MFEL 4XCYA 4XPGL 4UIMA 2R0WH 3LMJH 3KS0J 2IFFL 4M7JH 5DFVC 3JTSB 4DW2L 3IDYC 1LE5B 3VW3L 2IADA 4S1DD 1S78C 3N1GC 4PJ7A 2FJHA 2PTUA 2CIKA 4Q9BA 4NQED 1WTLA 1T7YA 4UT6L 3W39B 3LDBB 3R0MA 3RIFK 4Z0XB 3CVIL 4L9LA 1TVBA 2NLJB 4NQUA 1SHMA 1DCLA 2YWYA 2OYPA 4Y5XB 3DARA 4P4RB 1U8PB 2QSTA 4OT1L 5ICZA 3RDTD 1TZHA 1T03L 1AP2A 4U0RC 2BSTA 2ZG3A 3MRKA 4HK0A 2Q6WA 1OP5K 1XF1A 2VXQL 1CLZH 4UQ2A 4M6MH 2XRAL 3G04B 4P9HL 1YPZE 5T1KA 2YPVL 3DRTB 3DO7B 1WVZA 4FQHB 3K1DA 3TJHC 1PKQA 1ZS8B 3U36B 1RIHH 1ZGLM 5F8QC 1U8JB 1FLTX 4WFED 1CICD 4BK4A 5MENB 4MXVF 1V3LA 5ABDE 1FQ9C 3Q0HA 5JOPE 2HRLA 1OWWA 4OI9A 3QNXB 3MV8A 5ETUA 4Q6IC 3NH7H 1NDGA 2YPKA 3D39A 1HQRB 3FFCE 3QCTL 1I1FB 3T77A 1W0VA 4LVHB 3BZDA 1NBQA 5F6HJ 2P4AB 5E9DB 2FSEB 3DVGB 3TBTB 3QO1B 2RFXB 4XPFH 1F3JB 3ILPA 3H6JA 3VGFA 1IC5L 4KMTL 4WFFE 1A3QA 1ZT1A 2AJYH 2NXZC 5M7QA 1YEKH 2YD2A 3DX9A 4M4PA 2X4PB 3KPOA 3O6FB 1JZ5A 3HE7D 5HYQB 5TGBA 1WIOA 2FX9H 4LLYB 3K2UL 1NL0L 3HPJA 2IQAA 1S9XB 1A7PL 5I8CB 5D7JD 3GJFB 4IHOA 1HDMB 6CGTA 3ARED 3PL6B 5TQ2H 2B1AL 3KPNA 4NQTA 2BY2A 4P2QA 4CMHB 5KAQF 3BP7A 1WFOA 2D0HA 3HMWL 3HI6L 1W72H 5CSZB 3M8OL 3GSXA 1X4XA 1YEIH 3IJHB 1GH7A 3VFUA 4NWTH 3SDAB 4OF3A 5C8JB 3GJFK 4KRMB 3V6OE 4QLRA 2WLZA 4P9MH 4U1LB 1OTTD 1QA9A 2I9TA 3X3FH 2MCPH 2F8VA 4ZSOB 3I85A 2Z0BA 1C5DA 4GW4B 1F2XK 2VDMH 2UWEF 4H8WH 4BQCA 2J2ZA 4LPVA 4N9GA 4Y8AA 4LDLB 3ZE0E 1DE4B 5F96H 1HZHH 2VISB 4RA3A 3U0WH 4F15C 1MPAL 4NPYB 2B0SH 3MCKB 2I07B 4U3HA 2FIKB 4HIHA 2HG5A 4EBQL 4P2RA 2HMIC 4W6XB 1X5XA 1IQDB 2L0DA 5HJ3A 3FOMA 2Y5TB 4E41D 4M43H 3ARUA 4MDJA 3K1KC 3JV4B 4WW2B 1EGJA 1KTLA 1KIQA 1NGPH 3ZTNH 4TTGA 3TBYA 4X4XA 2P44B 1ZGLA 5CBEB 4WTZG 5JW3L 2PO6C 1OM3H 4YXHH 1GOFA 3U9UB 4R0LA 4LHUB 2V5RA 5DZOA 5ENWB 3IFOB 2F19L 1XGRB 4BQ8A 3FO2A 3RU8L 4OLZL 2OR9L 2OTPA 2JIXA 1RULL 4CU7A 3ZE2E 2YOCA 5E99L 4X7FC 2DMKA 1RZFH 3NBNA 2CDGA 5T5FH 3CFIC 4Y88A 1FCGA 1KPRA 4N8PA 4RMSA 1NCTA 1BX2A 2YEZB 5DYOA 2CLVA 2OK0H 5F9WB 3MGAA 4MCYB 5D7IF 4NZRH 3RA7L 2BNRA 1AKJB 3I3BA 1GVIA 1PX4A 5E95B 2PW1A 5SX4H 1N5YL 3EOBB 1Y6KR 3MREB 4PRID 1D5ZA 4U1HA 4XVSH 1MIMH 1CXEA 3RPKA 4UT7H 5MP6L 4QRSB 5CMAA 1FPTH 2LU7A 4GKSA 5DK0B 3DUSB 4R3SB 5DWUL 1EFXD 3BKYL 4GRLD 1S7SB 4PGDA 2IAMC 1YEDA 4YHZL 5EOCJ 2GTZA 3V52L 3MV01 5TDNA 2VLKD 3BT2H 2DD8H 2V7HA 2OQJB 4S11A 4PJBB 1INDL 3IFLH 5EIIB 3NCEB 4OFIA 4CNIA 3QQ3B 2DM4A 2YPLB 1LK3H 5I76B 1FZKA 2F54B 3KLSA 3BO8A 1IAKA 5EZJB 3WIFB 2ZUVA 5I9QB 3TV3L 3OR7B 3ZHKA 2DLGA 4Y5VA 5BS0D 3OPZH 3E3QE 5C70A 1QPXA 2FCBA 1U93A 4R9HA 4N0UA 1N4XL 5F7WC 1S9WB 5DEGA 2F58H 5J9PB 1F4XH 3CXHK 2H1PL 1HSBA 2ITCA 4M1GH 4YPJA 5FV1L 3PDOB 3OAUL 2FJFA 3NVQA 1TNMA 3FQWB 3SJVB 1T83A 1G7PA 4F2MB 1TLKA 2ITDA 4HUXB 2PYEB 5FCSH 1D5MB 2IBGA 4HD9A 4OQ1A 3KHQA 1ES0A 5FO9A 1P9MC 1NUFA 5D2LE 3NGBB 4CVXB 1MAMH 3GSWA 5ISZA 1V7ML 5CIPH 1BOYA 2IMMA 2NW2B 3L5WA 1ZA3A 3WL9A 4O02H 4K3GA 1ZLSL 5I8OL 4QHNA 4J8RB 4KKCC 3Q3GA 2H9GA 3AM8C 4BZ2L 3ROLB 1KIUA 2XA8L 4XVTL 2NPLX 3OJMB 2ERJB 3U4EB 1LE9B 4QRPD 2ARJA 2HFGH 4F7CA 4P4KA 2BERA 3GM8A 3WDHA 4HX1B 3LY6A 4FQIL 3SBWA 5JA8B 5L7XL 5DD3H 3ZDZF 3MV9A 4X98B 5BV7H 5FEBA 4PP1C 5IW3A 3HE6C 3ILQC 5F3HA 1UXSB 1EMTL 2WMPA 4ORZC 4Y4KB 2QJDA 5D1QC 3UJIL 1QLFA 2AK4D 1IAOB 4NQCA 4LIQE 2X44D 2YUVA 4PB9L 5GGVH 4WHCA 4I4WB 4LCWE 2EH8H 1A6WL 4C4KT 4OBSA 5E8EA 2IG2L 3SO3C 3QRFM 4Q2ZB 1TTUA 1K6QL 3MODH 1RK1A 5C0FB 2DDQH 4WFHD 5GGQL 3VJ6B 5KSAA 2FX8H 1MFCL 2GTWB 1FZJA 1VFAA 4QOKE 5HDQL 3GSVA 5I6XC 1NMBL 2HLFD 4XRCB 4IRJB 2DS4A 4G6FB 4HDIB 4RGNC 5TDOB 2DMCA 3DHMA 1YUHB 1MJ7L 4KRLB 3S34H 3CSPA 4RIRA 5IB2A 2X4SB 1MHHA 3IKCA 1AHWA 1DUYA 5FYLL 4K7PL 4Z7WF 1X5JA 2VXSH 4DEPC 1ED3B 3W0WA 1TJIL 2C1PB 2AJZB 3QXAA 5SWSA 2AI0H 3TF7C 3Q1SH 4YJZL 4YNYB 3X14A 1FV1B 3G6JE 1NBVH 3BZFA 1QQDB 1U8NB 3L5HA 1LP9A 3PV6A 3SHSA 4NC1C 4HKZB 5E94B 3LMJL 3ARFD 4M7JL 3KPSD 5IHZA 4S2SA 4PRPD 3QAZC 5L2JA 1HI6B 2J8UB 3QJFB 1X5KA 4RAVB 2IBBA 4JDZA 1YY8A 5F8RC 4KPHH 1AD9B 1MCWM 4PJ7E 4U6HB 4N5ED 1VKXB 4XP5H 1A9BA 4J3XA 1A64A 3NA4A 3UZQA 1OVZA 4G42B 4LKCA 3ZKSD 4NFBA 5B39A 4Y4HC 1ZHKA 4RX4D 2VLJB 2W9EH 2DTML 4OBRA 2P8PB 3TNMB 5CKAA 4AQ1B 5HYFA 1VEMA 4M6ML 3TIDB 3EHBC 43CAB 4J3TA 3UPCA 3G5VA 3ZYZA 1QSFB 1T5XB 4LLVB 5KG9B 5E56A 4YBHA 4APQB 5GGUA 1RIHL 5IUSA 3MBEB 5DI8A 3EYFA 1YDPA 3O4OB 1Z9LA 1PKQE 4B50A 3LDBC 4X7CC 1ZMYA 3TZVB 2ZNXA 2G9HB 3JWNC 1XF4A 1M7DB 4Y5XC 3UTQA 1OGAB 4KMLB 4XMLL 1L0XA 3MV8E 3KGRA 3PHQA 2EYTA 1G7MA 3D39E 4F7PB 3VFWA 4XPFL 1NGYA 1C12A 2GJ6D 2ZSVB 3BW9B 4P2OD 1NGXA 2FEDD 5KVGH 1T0PB 1KYOK 4PGBB 1F90H 2ZCKH 1YEKL 1HNGA 4X6EB 4XP6H 2JJSA 1IAMA 1WBZA 2XTJE 5L2KB 1P1ZB 2A9NH 2OJZH 2P24A 4JFDB 4ZOBA 3B4NA 2FX9L 3D6GA 1EA9C 2NTSP 2NXYB 1U3JA 4OLVH 4PV8A 3QPQC 4RA0C 4XH2B 3TVMB 3SGDH 1J05B 2RIKA 2NY1D 4RFOH 3NACH 4PJDB 2FO4B 3P3YA 4HFUL 4KJYB 3ZKMC 5TQ2L 2MHAA 2M8XA 2PXYC 5HHVH 3C6LD 4RAHA 4RDQF 3ROOB 1CI5A 5I1LA 1KJMA 3GMOB 2YD9A 3NIGE 2ZUXA 4JRYD 1UJTA 4XNXH 2BMKB 3LQAL 2VAAB 3HMXA 4OLYL 4OLWH 4ZUVA 2IH1B 5HI5D 1YEIL 4P2QE 4NWTL 2NY3B 1CFTB 3BGFC 1LK2A 4GRMB 4P9ML 4PRDA 4TTDC 3O6FC 1HCFX 1S9VA 4GG8A 3X3FL 2XWJB 2MCPL 4KY1H 4LDOB 3L3GB 4X4YA 4ZNCD 1Y18B 5FAAA 3RWIA 3GSOB 2VDML 3PP4L 1Q0YH 1G0YR 3K81A 1TPXB 1T21B 2WBKA 1HZHL 5F96L 4EXPX 1N5AA 2NY6C 4WGVB 2B0SL 1GIGL 1KXTB 1EUTA 4W81A 3FO1A 5FCUL 4EEEA 2HTKD 1T1XA 3QFJB 2B7DT 1A47A 1XF2B 4XBPB 5DT1H 1FVEB 1RFDL 4P23A 2D0FA 4M43L 1QEWB 2E7LC 2P5ED 1L9MA 1D6EA 1UXWA 4P2RE 3OGCA 2FJGB 3QUKA 2VSCA 4R90H 2A74A 3VD5A 1NGPL 2A2QT 3ZTNL 3SCMA 3SDAC 4EN3B 5IEKB 5IB5B 1PZ5B 3L7FA 1OM3L 1EJOH 1B0RA 3KPLA 3K46A 5CHNB 1FL5B 1Y0LB 2Q3AA 4TSCH 4XMPL 2VJXA 5E2WH 4OUUA 5KSBB 2P5WD 1JHLL 3SGDI 3SN6N 4LPTA 5D7LB 1RK0A 1D5BB 2GHWB 1X6NA 5T5FL 4L3ED 3AXLB 3SGEH 1GGBH 2CLRB 1OD9A 2DL9A 5DR5H 5HGAA 3O45A 3MLXH 5FKAA 2B20A 4NZRL 4N1CA 3R1GH 1NBYB 3D69B 4PGCA 4ZPTA 1VPOL 2F53D 3MR9A 4HUUB 2VDKH 3B9KD 3GSRB 5T3ZE 2DQHH 4LVOB 4XVSL 2BNRE 5AG8A 4LVEA 4UTBH 4OGYH 4UT7L 2D7TH 5DDHB 3SGKC 5HYJA 2R2EB 3FT2A 3WS6C 5HDBF 3D0LA 3MJ6A 1SVCP 4KVNH 5EUOB 1NC2D 3PABA 1ONQB 2LV4A 2DQFB 3QIBD 5IESL 4YC2B 3WLWD 3CU7A 3QWOA 3WFCL 5JPMA 2OR8A 3G6AB 4ZOCA 4BELD 3IFPA 1N59A 3EO9H 5SV4A 2DD8L 4O2EB 4TNWF 1KXVC 5F9WC 2ZJSH 1KJ2H 4U1MB 5D5MF 4P5TD 1LK3L 3MUZ1 4GBXC 4ELKB 1MCSA 4RZCA 5FIEA 5DD5L 3MV11 1WWWX 3EFDH 3IFNL 1KJ3L 3SDDD 1R5WA 3FONA 3OPZL 1EGJH 3ARBB 4X6CE 1RZKH 4K8RC 2A77H 5HVGB 1RJCA 4JFHE 2F58L 4KHXH 2EDQA 1FL3B 3SGJA 1IC4H 4PY8I 3FTGB 4HCRL 4N0UE 4QXUH 1Z9MA 5DMGD 3PHOB 5A2KH 1I3GH 5D9SA 3THMH 5F6HI 1WITA 3SGEI 4XBGA 5C0GA 4XXDB 4OD2A 2JE8A 4LFHG 4AK1A 2D0GA 6FABH 4TUJA 3L7EA 1CS6A 1MAML 4LLAA 2E9IA 4F33A 3T0DA 5T3ZH 1IGTA 3FQUA 1SEBA 4GT7A 5I9QC 1UH4A 3S3JA 1D5XA 4O02L 2QSCH 4P5MA 5ISZE 4OFYD 3BP4B 3HR5B 5FYLD 3KPTA 1I9IL 4NSKB 4PJXB 3EO0B 3UDWC 3V5DB 4WWKD 3VFGH 4XXCC 2LQRA 3D18B 4JVUA 3IVKA 1WFUA 4MA3A 5I1DB 4NZDA 3SDCC 1N3NA 2FLRT 1JNJA 5DD3L 3GB7A 4GO6B 3MRHB 2F74A 5FM5O 3VWJD 1UVQA 3L9RB 1CFSA 5BV7L 5EULV 4FZEL 3EDFA 3GMRB 5D7KE 5HHPA 2UZIH 4NO2B 3NCYP 4DZ8A 1U8OB 5CGYD 4KKBD 2GSGB 3MV9E 3VD7A 4YGAB 4Z5RB 4QF1A 2W0LA 1EVTC 2EH8L 1UWGH 3TN0A 1MUJB 3QXDA 2D4FA 1CQKA 3MODL 2Y1VA 2DDQL 5AEAA 4NT6A 1H5BC 1TETH 5ANMA 4XHJD 3SE9H 3VFVB 2ERJC 3MLUH 3QRGH 3X11B 4FQXC 1KF9B 1XZ0B 5H2BA 5I1AB 3DX6A 3U30B 1PKOA 2GKIA 3MRDB 4NQDA 1JYXA 4GXUM 1D9KA