1FC6A

Photosystem ii d1 c-terminal processing protease
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
386
structure length
386
Chain Sequence
b'VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II D1 PROTEASE
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
total genus 115
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc6A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc6A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc6A03
1T2MA 1FC9A 2JWEA 4Q2OA 2ZL3A 2FCFA 2PZDA 1QAVB 1V62A 3K82A 3MH7A 3R0HA 1NF3C 2D3TA 3GCOA 2KOHA 3QK8A 2YT7A 4KFVA 4E3BA 3KTGA 2AINA 3PS4A 3FF6A 3PE8A 4GVCA 3P2LA 4KFWA 1NZYB 4I42A 4P0CA 3CYYA 4NMSA 2H2CA 3O5NA 2RRMA 1X0UA 2A7SA 4JYJA 3FY5A 2EEJA 2KPKA 5HFDA 2X7ZA 4E34A 1UEZA 1SZOA 1RY4A 1TYFA 1GQ4A 4JYLA 4IZCA 3TVUA 2CS5A 2J5II 2D90A 1UYSA 2DLUA 4Q2NA 2ZQRA 5G1RA 3ST9A 1V1TA 4JL7A 3GDSA 4IZBA 3PDVA 1W9OA 3TT7A 5HF4A 1DCIA 1WH1A 1MFLA 1OZIA 1WG6A 4B3HA 4NMQA 5INGA 1WDLA 4K2NA 4U0GH 3GDVA 3ID1A 4Q6SA 2A7KA 3Q1TA 3ID2A 3NGHA 4JFCA 4EMMA 3K8XA 2I1NA 2FW2A 4NMRA 5HFBA 5IKLB 1QAVA 1UF1A 3OT6A 1U3BA 1Q52A 3NJBA 5DTWA 3DORA 1WF8A 4K6YA 5HETA 3KTKA 3Q0JA 2O2TA 1VB7A 4I4ZA 2VSPA 1V6BA 3RSIA 4MOUA 2H3MA 2EEIA 2JILA 2DKRA 3CBZA 5E22A 3WKMA 1GQ5A 1NZYA 3N6RB 1YG6A 3PV2A 5G1QA 3NJDA 3HLN1 3T8BA 1RZXA 4L8KA 2EJYA 2D8IA 3EGGC 5HFEA 5DTHA 4JOEA 3E17A 3U9RB 3ZWCA 2DM8A 3OU0A 3SWXA 4F47A 2LOBA 3OC7A 3PDZA 1XO6A 2OGPA 4WZ8B 3R9TA 2L4TA 1BFEA 2UZCA 2E7KA 4OEPA 4K29A 3MFMA 3PEAA 1VA8A 1XZ9A 2P3WA 2KL1A 4JVTA 3RSTA 3I47A 4QIJA 4R2ZA 1N7TA 1FC6A 2BYGA 2Q2XA 4NXQA 3PV5A 2PBPA 4JJTA 2M0TA 5DUCA 1UYTA 1SG4A 2PG8A 2Q34A 2M0VA 1UITA 2W3PA 2QKUA 3HPKA 3H81A 2L97A 2X24A 2ZL4A 2OPGA 3MH4A 2OCSA 1WFGA 2Z17A 5DKPA 4U0HA 3R0OA 5DTPA 2HE2A 5JBWA 2Q35A 3QJNA 2VWRA 3BF0A 3H0UA 1TG6A 4GHNA 3DJ3A 2J5IA 1OD4A 4KNPA 1TE0A 5CTBA 1UM7A 2J5GD 2EGKA 2PNTA 1B8QA 5INIA 4E35A 1EY3A 3MH6A 3H02A 2Q3GA 3CBYA 2FBMA 2VSUE 3H0JA 2Q9VA 5FHTA 1YBOA 4UU6A 3KHFA 1MFGA 3DJAA 3R69A 1SOTA 1UFXA 4KWBA 4EMPA 3M6MA 2JIKA 2EV8A 3I1EA 1X6DA 4NNMA 4ELWA 4RCNA 3KTHA 3L3SA 3LNXA 5HFCA 1WHDA 2C8TA 2GTRA 1HZDA 4ZDBA 4ZU2A 3BPPA 4FNDA 2I0LA 5DZKA 3TZ3A 5GNDA 2KRGA 2LC7A 2HW5A 4JOTA 4QFEA 3ZRTA 3PZKA 4FZWC 2QKVA 3QYRA 4NXRA 5E0SH 3Q0GA 4YYXA 2K20A 1LCYA 2J5SA 1X5RA 3B76A 4PQWA 2EDPA 1UIYA 4ZDFA 2VRFA 1DUBA 2R4HA 4EDJA 4K72A 2EEHA 4FN7A 3DJ1A 4NNLA 3GF7A 3R68A 1D5GA 3EGHC 4K76A 2QQ3A 1KWAA 3QXZA 3R6HA 3QGLA 1IHJA 5HFFA 1OD2A 4HNKA 4JCQA 1QAUA 3AXAA 5HEYA 3KTIA 4JOJA 4JWVA 4FJWD 3TV5A 1Q3PA 5DU8A 1PJHA 4I52A 2ZL2A 2FE5A 3QMJA 5DZKH 1Y7NA 2KAWA 4MI2A 4WCZA 4ELSA 3GJ9A 1WFVA 4Z0MA 1VCWA 2KQFA 3LNYA 2AWUA 4OAJA 1WIFA 3PV4A 4HOPB 3TRRA 4OEOA 4F8KA 4ZDEA 2LC6A 2VSSE 5JXBA 2EGNA 3WKLA 2KYLA 2DMZA 4WYTA 2QKTA 3NFLA 3KZEA 3CBXA 3CC0A 2CE3A 2IEXA 2EGOA 4Q0GA 5DU4A 4ELXA 2OSGA 2ZQQA 5B6LA 2ENOA 2OMJA 2OZFA 3K1RA 4KD6A 3STAA 1N7EA 1UEWA 2V1WA 2AWWA 3TLFA 4Q2QA 4EMLA 4NEKA 3GKBA 3PGQA 4FNBA 2VSUA 4K78A 2UZFA 3LKEA 3I18A 3GDUA 2KJKA 4RYFA 3TDCA 3DIWA 3U9SB 1RJNA 1M5ZA 4KPKA 4FGMA 4L8NA 5EYZA 3ISAA 3RLEA 5KDRB 2L4SA 1FC7A 3OMEA 2F0AA 2CSSA 2F9IA 2VSUF 1HNOA 1VRGA 2KPLA 2FZSA 3TSVA 4MPAA 4WYUA 3IB9A 1HNUA 1OBZA 4K75A 4RI0A 3JU1A 3R9QA 2EDVA 1Y7OA 4AMHA 1GM1A 1UJUA 3SLLA 1TP5A 2VREA 3VQGA 1RGRA 3NFKA 3OTPA 5C90A 1X8SA 4IC6A 4OG1A 1I16A 3ZW9A 1RGWA 4HOPA 4UU5A 2DJTA 2DUBA 5HF1A 2CBYA 2EAQA 2J5IB 1WI4A 3SOEA 2NP9A 3IAVA 1MC7A 1ON3A 1UEPA 5E21A 1W9QA 4Q3HA 4REYA 3RL8A 4RYFH 5C9GA 5E6PB 3R9SA 2IWOA 3G64A 1OBXA 1TP3A 5GLJA 5G1SA 1UJDA 3RRVA 1FCFA 1QLCA 5EZ0A 1Z86A 4JOPA 4JOGA 4O06A 1N7FA 5JBXA 5DU6A 2DLSA 4OMRA 2YTWA 1PDRA 3TMHA 1MJ3A 4P2AB 4Q2PA 2IWNA 3RL7A 3WG5A 1UHPA 2HGAA 1XNWA 2KV8A 5KJPA 3KZDA 1I92A 4JOKA 4B3IA 5FIFA 3GSLA 5E0NX 1ZUBA 5KDRA 4JCSA 1K32A 2VSSA 3LAOA 3T89A 5A2PA 1N6EA 4H11A 3TSWA 2JOAA 1V5LA 4JOFA 2F9YA 4MXIA 3QJMA 4U19A 1UEQA 2X58A 3KTJA 4G2RA 2Z9IA 1EF8A 1U38A 2MHOA 2OQSA 3QDOA 2VSSF 2GZVA 5CTCA 2EJ5A 2M3MA 2KBSA 2M0ZA 1NTEA 1VAEA 3GLMA 1WJLA 2H2BA 4U0GA 2KG2A 1N6DA 4JCTA 3H0SA 2CSJA 3STJA 5FUSA 2EDZA 2EEGA 3HP0A 2F9IB 2F5YA 1TQ3A 1U39A 4Z33A 1PIXA 4OLQA 2W4FA 3T3WA 2VPHA 1Q7XA 1WI2A 4GM2A 4YDPA 2HE4A 1P1EA 5H3JA 3BEZA 4LK5A 3V5IA 5F3XA 3GCNA 4ASIA 2DC2A 4JORA 1IU2A 1YG8A 4NMTA 2LA8A 3TT6A 1SOZA 2KOJA 4Z8JA 3CS0A 5D13A 2DAZA 4U18A 1WF7A 3FDUA 3QKAA 2ZPLA 3H0QA 4NMVA 2IWQA 2DB5A 3MOYA 1UM1A 2FN5A 4U1AA 1X5QA 1P1DA 4NNQA 3L4FD 3QXIA 3VQFA 1ON9A 1XNYA 4K3WA 4N6XA 3QE1A 5DL1A 2OS6A 3GMAA 3HE2A 2I0IA 4Q1IA 3TSZA 2KA9A 1R6JA 3I4WA 1Q3OA 3ID3A 2VX2A 1W9EA 1XX4A 4L6WA 3MT6A 5HEDA 2I4SA 2YUYA 2JINA 2QBWA 3T8AA 2FNEA 1XNVA 2KJDA 2VZ5A 2AWXA 3QIKA 2EHRA 3VIVA 3SFJA 1VJ6A 3O46A 2JXOA 3T88A 1X5NA 4JOHA 3HVQC 3CH8A 3GGEA 4HC8A 2YT8A 1Z87A 2REYA 3SHUA 2G5MB 1O8UA 1U37A 2LUIA 4GVDA 3IBBA 3KQFA 4ZDCA 3HRXA 3P5MA 2F6QA 2F9YB 5FB8C 2ZL0A 2VSUC 3P85A 2PKTA 3QWDA 4NMPA 5F67A 5G1DA 2M10A 5I7ZA 2M0UA 1RJMA 4JSBA 2RCZA 2KJPA 1WHAA 1JXZA 2MX6A 1K39A 3ZWBA 4Q6HA 1WDMA 3SHWA 1N99A 2EXGA 3M6NA 1EF9A 3GF3A 2K1ZA 2I6VA 1J7XA 2A81A 1UYVA 5HJ1A 2QG1A 4XHVA 1OBYA 5E11A 3ID4A 3QO6A 3K50A 1UJVA 1WDKA 1Y8TA 1Q51A 3HPMA 4NMOA 3SUZA 3QREA 2G2LA 2QT5A 2WTBA 1BE9A 3U9TB 4IZDA 4LMMA 4WYOB 2VSVA 2H3LA 4JCRA 2PA1A 1L6OA 4ZDDA 1G9OA 2R3YA 5HDYA 3TVWA 5MGBA 2PPYA 3BPUA 2JREA 1UYRA 1W2XA 3V5EA 4B3JA 2J5GA 5E0SA 5E1YA 5HEBA 2PKUA 2W7RA 2DEOA 3JXTA 2ZPMA 4NXPA 2F6IA 1IU0A 4QIIA 2PDZA 2YUBA 1KEFA 2KOMA 1WZ8A 3HINA 3Q7HA 3ZWAA 4FB8A 1KY9A 1N6FA 1X45A 5INFA 2I04A 5G1EA 4DI1A 4G69A 4FZWA 4FN8A 1ZOKA 5DUFA 4YLHA 2IWPA 2BZRA 3MYBA 2D92A 1V5QA 2WL7A 2V90A 3ZW8A
chains in the Genus database with same CATH superfamily
1T2MA 1FC9A 2JWEA 4Q2OA 2ZL3A 2FCFA 2PZDA 1QAVB 1V62A 3K82A 3MH7A 3R0HA 3D03A 1NF3C 2D3TA 3GCOA 2KOHA 3QK8A 2YT7A 1X9ZA 4KFVA 3IHBA 4E3BA 3KTGA 2AINA 3PS4A 3FF6A 3PE8A 4GVCA 3P2LA 4KFWA 1NZYB 4I42A 4P0CA 3CYYA 4NMSA 4DGFA 2H2CA 3O5NA 2RRMA 1X0UA 2A7SA 4JYJA 3FY5A 2EEJA 2KPKA 5HFDA 2X7ZA 4E34A 1UEZA 5EUXA 1RY4A 1SZOA 1TYFA 1GQ4A 4JYLA 3EH7A 4IZCA 3TVUA 2CS5A 2J5II 2D90A 3V97A 1UYSA 2DLUA 4Q2NA 2ZQRA 5G1RA 3ST9A 1V1TA 4JL7A 1WXXA 2B78A 4AEJA 3GDSA 4IZBA 3PDVA 1W9OA 3TT7A 5HF4A 1DCIA 1WH1A 1MFLA 1OZIA 1WG6A 4B3HA 4NMQA 5INGA 3OIRA 1WDLA 4K2NA 4U0GH 3GDVA 3ID1A 4Q6SA 2A7KA 3Q1TA 3ID2A 3NGHA 4JFCA 4EMMA 2JSNA 3K8XA 2I1NA 2FW2A 4NMRA 5HFBA 5IKLB 3ZXNA 1QAVA 1UF1A 3OT6A 1U3BA 1Q52A 3NJBA 5DTWA 3DORA 1WF8A 4K6YA 5HETA 3KTKA 3Q0JA 2O2TA 1VB7A 4I4ZA 2VSPA 1V6BA 3MGLA 4MOUA 3RSIA 2H3MA 2EEIA 2JILA 2DKRA 3CBZA 5E22A 3WKMA 2ZO9B 1GQ5A 1NZYA 3N6RB 1YG6A 3PV2A 5G1QA 3NJDA 3HLN1 3IF5A 3T8BA 1RZXA 4L8KA 2EJYA 2D8IA 3EGGC 5HFEA 5DTHA 4JOEA 3E17A 3U9RB 3ZWCA 2DM8A 3OU0A 3SWXA 4F47A 2LOBA 3OC7A 3PDZA 1XO6A 2OGPA 4WZ8B 3R9TA 2L4TA 1BFEA 2UZCA 2E7KA 4OEPA 4K29A 3AGDA 3MFMA 3PEAA 1VA8A 1XZ9A 2P3WA 2KL1A 3AGEA 4JVTA 3I47A 4QIJA 4R2ZA 3RSTA 1N7TA 1FC6A 2BYGA 2Q2XA 4NXQA 3PV5A 1SBOA 2PBPA 2M0TA 4JJTA 5DUCA 1UYTA 1SG4A 2PG8A 2Q34A 2M0VA 1UITA 2W3PA 2QKUA 3OIZA 3HPKA 3H81A 2L97A 2X24A 2ZL4A 2OPGA 3MH4A 2OCSA 1H4XA 1WFGA 2Z17A 5DKPA 4U0HA 3R0OA 5DTPA 2HE2A 1T6RA 2Q35A 5JBWA 3QJNA 2VWRA 3BF0A 5EUSA 3H0UA 1TG6A 4GHNA 3DJ3A 2J5IA 1OD4A 4KNPA 4JC0A 1TE0A 5CTBA 1UM7A 2J5GD 2EGKA 2PNTA 1B8QA 5INIA 4E35A 1EY3A 3MH6A 3H02A 2Q3GA 3CBYA 2FBMA 2VSUE 3H0JA 2Q9VA 5FHTA 1H4ZA 1YBOA 4UU6A 3LDFA 3KHFA 1MFGA 3DJAA 4HYLA 3R69A 1SOTA 1UFXA 4KWBA 4NARA 4EMPA 3M6MA 2JIKA 2EV8A 3I1EA 1X6DA 4NNMA 4ELWA 4RCNA 3KTHA 3L3SA 3LNXA 5HFCA 1WHDA 2C8TA 2GTRA 1HZDA 4ZDBA 4ZU2A 3BPPA 4FNDA 2I0LA 3DUPA 5DZKA 3TZ3A 5GNDA 2KRGA 2LC7A 2HW5A 3GVLA 4JOTA 4QFEA 3ZRTA 3PZKA 4AE2A 4FZWC 2QKVA 3QYRA 3C0KA 4NXRA 5E0SH 3Q0GA 4YYXA 1V0FA 3LKLA 2K20A 1LCYA 2J5SA 3BPTA 1X5RA 3B76A 4PQWA 2EDPA 2OASA 1UIYA 4ZDFA 2VRFA 1DUBA 2R4HA 4EDJA 4K72A 2EEHA 4FN7A 3DJ1A 4NNLA 4DGHA 3GF7A 3VSEA 3R68A 1D5GA 3EGHC 4K76A 2DXLA 2QQ3A 1KWAA 3QXZA 3R6HA 3QGLA 5IL9A 1IHJA 2RRLA 5HFFA 1OD2A 4HNKA 4JCQA 1QAUA 3AXAA 5HEYA 3KTIA 4JOJA 4JWVA 4FJWD 3T6OA 3TV5A 1Q3PA 5DU8A 1PJHA 4I52A 2ZL2A 2FE5A 2GEFA 3QMJA 1Y7NA 2KAWA 5DZKH 4MI2A 4WCZA 4ELSA 3GJ9A 1WFVA 4Z0MA 1VCWA 2KQFA 3LNYA 2AWUA 4OAJA 1WIFA 3V8VA 3PV4A 4HOPB 3TRRA 4OEOA 4F8KA 4ZDEA 2LC6A 2VSSE 5JXBA 2EGNA 3WKLA 5ILBA 2KYLA 2DMZA 4WYTA 2QKTA 3NFLA 3KZEA 3CBXA 3CC0A 2CE3A 2IEXA 2EGOA 4Q0GA 5DU4A 4ELXA 2OSGA 2ZQQA 5B6LA 3IHAA 2ENOA 2OMJA 2OZFA 3GABA 3K1RA 4KD6A 3STAA 1N7EA 1UEWA 4DMGA 2V1WA 2AWWA 3TLFA 4Q2QA 4EMLA 4NEKA 2DXNA 3GKBA 3PGQA 4FNBA 2VSUA 4K78A 1BPLA 2UZFA 3LKEA 3I18A 3GDUA 2KJKA 3JU4A 4RYFA 3TDCA 3DIWA 3U9SB 1RJNA 1M5ZA 4KPKA 4FGMA 3NY7A 4L8NA 5EYZA 5EUZA 3RLEA 3ISAA 5KDRB 2L4SA 1FC7A 3OMEA 2F0AA 2CSSA 2F9IA 2VSUF 3NCVA 1HNOA 1VRGA 2KPLA 2FZSA 2VY9A 3TSVA 4MPAA 4WYUA 3IB9A 1HNUA 1OBZA 4K75A 4RI0A 3JU1A 3R9QA 2EDVA 1Y7OA 4AMHA 1GM1A 1UJUA 3SLLA 1TP5A 2VREA 5HUQA 3VQGA 1RGRA 3NFKA 3OTPA 5C90A 1X8SA 4IC6A 4OG1A 1I16A 3ZW9A 1RGWA 4HOPA 4UU5A 2DJTA 2DUBA 5HF1A 1VC1A 2CBYA 2EAQA 2J5IB 3GMFA 1WI4A 3SOEA 2NP9A 3IAVA 1MC7A 1ON3A 1UEPA 2KA5A 5E21A 1W9QA 4Q3HA 4REYA 3RL8A 4RYFH 5C9GA 5EUWA 5E6PB 3R9SA 2IWOA 3G64A 1OBXA 1TP3A 5GLJA 5G1SA 1UJDA 3RRVA 1FCFA 1QLCA 5EZ0A 3KDGA 1Z86A 3MOGA 4JOPA 4JOGA 4O06A 1N7FA 5B42A 5JBXA 5DU6A 2DLSA 4OMRA 2YTWA 1PDRA 3TMHA 1MJ3A 4P2AB 4Q2PA 2IWNA 3RL7A 3WG5A 1UHPA 4XS5A 2HGAA 3GHFA 1XNWA 2ZOAA 2KV8A 3GVKA 5KJPA 3KZDA 1I92A 4JOKA 4B3IA 5FIFA 3GSLA 1BUZA 5E0NX 1ZUBA 5KDRA 1H4YA 4JCSA 1K32A 2VSSA 3LAOA 1TILB 3T89A 5A2PA 1N6EA 4H11A 3KDKA 3TSWA 2JOAA 1V5LA 4JOFA 2F9YA 3GK7A 4MXIA 3QJMA 4U19A 1UEQA 2X58A 3KTJA 4G2RA 2Z9IA 1EF8A 1U38A 2MHOA 2OQSA 3QDOA 2VSSF 2GZVA 5CTCA 4J2UA 2EJ5A 2M3MA 2KBSA 2M0ZA 1NTEA 1VAEA 3GLMA 1WJLA 2H2BA 4U0GA 4HIZA 2KG2A 1N6DA 4JCTA 3H0SA 2CSJA 3STJA 5FUSA 2EDZA 2EEGA 3HP0A 2F9IB 1WXWA 2F5YA 1TQ3A 1U39A 4Z33A 1PIXA 4OLQA 2W4FA 3T3WA 2VPHA 1Q7XA 1WI2A 4GM2A 4YDPA 2HE4A 1P1EA 5H3JA 3BEZA 4LK5A 3D3UA 5F3XA 3V5IA 3GCNA 4ASIA 2DC2A 4JORA 1IU2A 1YG8A 4NMTA 2LA8A 3TT6A 1SOZA 2KOJA 4Z8JA 3CS0A 5D13A 2DAZA 4U18A 1WF7A 2CWWA 3ZTBA 2AS0A 3FDUA 3QKAA 2ZPLA 3H0QA 4NMVA 5EZBA 2IWQA 2DB5A 3F43A 3MOYA 1UM1A 2FN5A 4U1AA 1X5QA 1P1DA 4NNQA 3L4FD 3QXIA 3VQFA 1ON9A 1XNYA 4K3WA 4N6XA 3QE1A 5DL1A 2OS6A 3GMAA 3HE2A 2I0IA 4Q1IA 3TSZA 2KA9A 1R6JA 3I4WA 1Q3OA 3ID3A 1THNB 1W9EA 1XX4A 2VX2A 4L6WA 3MT6A 5HEDA 2I4SA 2YUYA 2JINA 2QBWA 3T8AA 2FNEA 1XNVA 2KJDA 2VZ5A 2AWXA 3QIKA 2EHRA 3VIVA 3SFJA 5EUUA 1VJ6A 3O46A 4JJ0A 2JXOA 4QTPA 3T88A 1X5NA 4JOHA 3HVQC 1AUZA 3CH8A 3IH9A 3GGEA 4HC8A 2YT8A 1Z87A 2REYA 3SHUA 2G5MB 1O8UA 4L1CA 4HDTA 1U37A 2LUIA 4GVDA 3IBBA 3KQFA 4ZDCA 3HRXA 3P5MA 2F6QA 2F9YB 5FB8C 2ZL0A 2VSUC 3P85A 2PKTA 3QWDA 4NMPA 5F67A 5G1DA 3LLOA 2M10A 5I7ZA 2M0UA 1RJMA 4JSBA 1TH8B 2RCZA 2KJPA 1WHAA 1HF2A 1JXZA 2MX6A 1K39A 3ZWBA 4Q6HA 1WDMA 3SHWA 1N99A 2EXGA 3M6NA 1EF9A 3GF3A 2K1ZA 2I6VA 1J7XA 2A81A 2KLNA 5HJ1A 2QG1A 4XHVA 1UYVA 1OBYA 5E11A 3ID4A 4FLNA 3QO6A 3K50A 1UJVA 1WDKA 1Y8TA 1Q51A 3HPMA 4NMOA 3SUZA 3QREA 2G2LA 2YJGA 2QT5A 4JJ3A 2WTBA 1BE9A 3U9TB 4IZDA 4LMMA 3IH8A 4WYOB 2VSVA 2H3LA 4JCRA 2PA1A 1L6OA 1V0EA 4ZDDA 1G9OA 2R3YA 5HDYA 3TVWA 5MGBA 2PPYA 3GVJA 3BPUA 2JREA 1UYRA 1W2XA 3V5EA 4B3JA 2J5GA 5E0SA 5E1YA 5HEBA 2PKUA 2W7RA 2DEOA 3JXTA 2ZPMA 4NXPA 2F6IA 1IU0A 4QIIA 2PDZA 2YUBA 1KEFA 2KOMA 1WZ8A 3HINA 3Q7HA 3ZWAA 4FB8A 1KY9A 1N6FA 1X45A 3QDQA 5INFA 2I04A 5G1EA 4DI1A 4G69A 1TIDB 4FZWA 4FN8A 1ZOKA 5DUFA 4YLHA 2IWPA 2BZRA 3MYBA 2D92A 1V5QA 2WL7A 2V90A 3ZW8A
chains in the Genus database with same CATH topology
1T2MA 1FC9A 2JWEA 4Q2OA 2ZL3A 2FCFA 2PZDA 1QAVB 1V62A 3K82A 3MH7A 3R0HA 3D03A 1NF3C 2D3TA 3GCOA 2KOHA 3QK8A 2YT7A 1X9ZA 4KFVA 4E3BA 3KTGA 2AINA 3PS4A 3FF6A 3PE8A 4GVCA 3P2LA 4KFWA 1NZYB 4I42A 4P0CA 3CYYA 4NMSA 2H2CA 3O5NA 2RRMA 1X0UA 2A7SA 4JYJA 3FY5A 2EEJA 2KPKA 5HFDA 2X7ZA 4E34A 1UEZA 1SZOA 1RY4A 1TYFA 1GQ4A 4JYLA 4IZCA 3TVUA 2CS5A 2J5II 2D90A 1UYSA 2DLUA 4Q2NA 2ZQRA 5G1RA 3ST9A 1V1TA 4JL7A 4AEJA 3GDSA 4IZBA 3PDVA 1W9OA 3TT7A 5HF4A 1DCIA 1WH1A 1MFLA 1OZIA 1WG6A 4B3HA 4NMQA 5INGA 1WDLA 4K2NA 4U0GH 3GDVA 3ID1A 4Q6SA 2A7KA 3Q1TA 3ID2A 3NGHA 4JFCA 4EMMA 2JSNA 3K8XA 2I1NA 2FW2A 4NMRA 5HFBA 5IKLB 1QAVA 1UF1A 3OT6A 1U3BA 1Q52A 3NJBA 5DTWA 3DORA 1WF8A 4K6YA 5HETA 3KTKA 3Q0JA 2O2TA 1VB7A 4I4ZA 2VSPA 1V6BA 3RSIA 4MOUA 2H3MA 2EEIA 2JILA 2DKRA 3CBZA 5E22A 3WKMA 2ZO9B 1GQ5A 1NZYA 3N6RB 1YG6A 3PV2A 5G1QA 3NJDA 3HLN1 3T8BA 1RZXA 4L8KA 2EJYA 2D8IA 3EGGC 5HFEA 5DTHA 4JOEA 3E17A 3U9RB 3ZWCA 2DM8A 3OU0A 3SWXA 4F47A 2LOBA 3OC7A 3PDZA 1XO6A 2OGPA 4WZ8B 3R9TA 2L4TA 1BFEA 2UZCA 2E7KA 4OEPA 4K29A 3MFMA 3PEAA 1VA8A 1XZ9A 2P3WA 2KL1A 4JVTA 3RSTA 3I47A 4QIJA 4R2ZA 1N7TA 1FC6A 2BYGA 2Q2XA 4NXQA 3PV5A 2PBPA 4JJTA 2M0TA 5DUCA 1UYTA 1SG4A 2PG8A 2Q34A 2M0VA 1UITA 2W3PA 2QKUA 3HPKA 3H81A 2L97A 2X24A 2ZL4A 2OPGA 3MH4A 2OCSA 1WFGA 2Z17A 5DKPA 4U0HA 3R0OA 5DTPA 2HE2A 5JBWA 2Q35A 3QJNA 2VWRA 3BF0A 3H0UA 1TG6A 4GHNA 3DJ3A 2J5IA 1OD4A 4KNPA 4JC0A 1TE0A 5CTBA 1UM7A 2J5GD 2EGKA 2PNTA 1B8QA 5INIA 4E35A 1EY3A 3MH6A 3H02A 2Q3GA 3CBYA 2FBMA 2VSUE 3H0JA 2Q9VA 5FHTA 1YBOA 4UU6A 3KHFA 1MFGA 3DJAA 3R69A 1SOTA 1UFXA 4KWBA 4NARA 4EMPA 3M6MA 2JIKA 2EV8A 3I1EA 1X6DA 4NNMA 4ELWA 4RCNA 3KTHA 3L3SA 3LNXA 5HFCA 1WHDA 2C8TA 2GTRA 1HZDA 4ZDBA 4ZU2A 3BPPA 4FNDA 2I0LA 3DUPA 5DZKA 3TZ3A 5GNDA 2KRGA 2LC7A 2HW5A 4JOTA 4QFEA 3ZRTA 3PZKA 4AE2A 4FZWC 2QKVA 3QYRA 4NXRA 5E0SH 3Q0GA 4YYXA 2K20A 1LCYA 2J5SA 3BPTA 1X5RA 3B76A 4PQWA 2EDPA 1UIYA 4ZDFA 2VRFA 1DUBA 2R4HA 4EDJA 4K72A 2EEHA 4FN7A 3DJ1A 4NNLA 3GF7A 3R68A 1D5GA 3EGHC 4K76A 2DXLA 2QQ3A 1KWAA 3QXZA 3R6HA 3QGLA 5IL9A 1IHJA 2RRLA 5HFFA 1OD2A 4HNKA 4JCQA 1QAUA 3AXAA 5HEYA 3KTIA 4JOJA 4JWVA 4FJWD 3TV5A 1Q3PA 5DU8A 1PJHA 4I52A 2ZL2A 2FE5A 2GEFA 3QMJA 1Y7NA 2KAWA 5DZKH 4MI2A 4WCZA 4ELSA 3GJ9A 1WFVA 4Z0MA 1VCWA 2KQFA 3LNYA 2AWUA 4OAJA 1WIFA 3PV4A 4HOPB 3TRRA 4OEOA 4F8KA 4ZDEA 2LC6A 2VSSE 5JXBA 2EGNA 3WKLA 5ILBA 2KYLA 2DMZA 4WYTA 2QKTA 3NFLA 3KZEA 3CBXA 3CC0A 2CE3A 2IEXA 2EGOA 4Q0GA 5DU4A 4ELXA 2OSGA 2ZQQA 5B6LA 2ENOA 2OMJA 2OZFA 3GABA 3K1RA 4KD6A 3STAA 1N7EA 1UEWA 2V1WA 2AWWA 3TLFA 4Q2QA 4EMLA 4NEKA 2DXNA 3GKBA 3PGQA 4FNBA 2VSUA 4K78A 1BPLA 2UZFA 3LKEA 3I18A 3GDUA 2KJKA 4RYFA 3TDCA 3DIWA 3U9SB 1RJNA 1M5ZA 4KPKA 4FGMA 4L8NA 5EYZA 3ISAA 3RLEA 5KDRB 2L4SA 1FC7A 3OMEA 2F0AA 2CSSA 2F9IA 2VSUF 3NCVA 1HNOA 1VRGA 2KPLA 2FZSA 3TSVA 4MPAA 4WYUA 3IB9A 1HNUA 1OBZA 4K75A 4RI0A 3JU1A 3R9QA 2EDVA 1Y7OA 4AMHA 1GM1A 1UJUA 3SLLA 1TP5A 2VREA 5HUQA 3VQGA 1RGRA 3NFKA 3OTPA 5C90A 1X8SA 4IC6A 4OG1A 1I16A 3ZW9A 1RGWA 4HOPA 4UU5A 2DJTA 2DUBA 5HF1A 2CBYA 2EAQA 2J5IB 3GMFA 1WI4A 3SOEA 2NP9A 3IAVA 1MC7A 1ON3A 1UEPA 5E21A 1W9QA 4Q3HA 4REYA 3RL8A 4RYFH 5C9GA 5E6PB 3R9SA 2IWOA 3G64A 1OBXA 1TP3A 5GLJA 5G1SA 1UJDA 3RRVA 1FCFA 1QLCA 5EZ0A 3KDGA 1Z86A 3MOGA 4JOPA 4JOGA 4O06A 1N7FA 5B42A 5JBXA 5DU6A 2DLSA 4OMRA 2YTWA 1PDRA 3TMHA 1MJ3A 4P2AB 4Q2PA 2IWNA 3RL7A 3WG5A 1UHPA 2HGAA 3GHFA 1XNWA 2ZOAA 2KV8A 5KJPA 3KZDA 1I92A 4JOKA 4B3IA 5FIFA 3GSLA 5E0NX 1ZUBA 5KDRA 4JCSA 1K32A 2VSSA 3LAOA 3T89A 5A2PA 1N6EA 4H11A 3KDKA 3TSWA 2JOAA 1V5LA 4JOFA 2F9YA 4MXIA 3QJMA 4U19A 1UEQA 2X58A 3KTJA 4G2RA 2Z9IA 1EF8A 1U38A 2MHOA 2OQSA 3QDOA 2VSSF 2GZVA 5CTCA 4J2UA 2EJ5A 2M3MA 2KBSA 2M0ZA 1NTEA 1VAEA 3GLMA 1WJLA 2H2BA 4U0GA 2KG2A 1N6DA 4JCTA 3H0SA 2CSJA 3STJA 5FUSA 2EDZA 2EEGA 3HP0A 2F9IB 2F5YA 1TQ3A 1U39A 4Z33A 1PIXA 4OLQA 2W4FA 3T3WA 2VPHA 1Q7XA 1WI2A 4GM2A 4YDPA 2HE4A 1P1EA 5H3JA 3BEZA 4LK5A 3V5IA 5F3XA 3GCNA 4ASIA 2DC2A 4JORA 1IU2A 1YG8A 4NMTA 2LA8A 3TT6A 1SOZA 2KOJA 4Z8JA 3CS0A 5D13A 2DAZA 4U18A 1WF7A 3FDUA 3QKAA 2ZPLA 3H0QA 4NMVA 2IWQA 2DB5A 3MOYA 1UM1A 2FN5A 4U1AA 1X5QA 1P1DA 4NNQA 3L4FD 3QXIA 3VQFA 1ON9A 1XNYA 4K3WA 4N6XA 3QE1A 5DL1A 2OS6A 3GMAA 3HE2A 2I0IA 4Q1IA 3TSZA 2KA9A 1R6JA 3I4WA 1Q3OA 3ID3A 2VX2A 1W9EA 1XX4A 4L6WA 3MT6A 5HEDA 2I4SA 2YUYA 2JINA 2QBWA 3T8AA 2FNEA 1XNVA 2KJDA 2VZ5A 2AWXA 3QIKA 2EHRA 3VIVA 3SFJA 1VJ6A 3O46A 4JJ0A 2JXOA 3T88A 1X5NA 4JOHA 3HVQC 3CH8A 3GGEA 4HC8A 2YT8A 1Z87A 2REYA 3SHUA 2G5MB 1O8UA 4L1CA 4HDTA 1U37A 2LUIA 4GVDA 3IBBA 3KQFA 4ZDCA 3HRXA 3P5MA 2F6QA 2F9YB 5FB8C 2ZL0A 2VSUC 3P85A 2PKTA 3QWDA 4NMPA 5F67A 5G1DA 2M10A 5I7ZA 2M0UA 1RJMA 4JSBA 2RCZA 2KJPA 1WHAA 1JXZA 2MX6A 1K39A 3ZWBA 4Q6HA 1WDMA 3SHWA 1N99A 2EXGA 3M6NA 1EF9A 3GF3A 2K1ZA 2I6VA 1J7XA 2A81A 1UYVA 5HJ1A 2QG1A 4XHVA 1OBYA 5E11A 3ID4A 4FLNA 3QO6A 3K50A 1UJVA 1WDKA 1Y8TA 1Q51A 3HPMA 4NMOA 3SUZA 3QREA 2G2LA 2YJGA 2QT5A 4JJ3A 2WTBA 1BE9A 3U9TB 4IZDA 4LMMA 4WYOB 2VSVA 2H3LA 4JCRA 2PA1A 1L6OA 4ZDDA 1G9OA 2R3YA 5HDYA 3TVWA 5MGBA 2PPYA 3BPUA 2JREA 1UYRA 1W2XA 3V5EA 4B3JA 2J5GA 5E0SA 5E1YA 5HEBA 2PKUA 2W7RA 2DEOA 3JXTA 2ZPMA 4NXPA 2F6IA 1IU0A 4QIIA 2PDZA 2YUBA 1KEFA 2KOMA 1WZ8A 3HINA 3Q7HA 3ZWAA 4FB8A 1KY9A 1N6FA 1X45A 5INFA 2I04A 5G1EA 4DI1A 4G69A 4FZWA 4FN8A 1ZOKA 5DUFA 4YLHA 2IWPA 2BZRA 3MYBA 2D92A 1V5QA 2WL7A 2V90A 3ZW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2M A;  1FC9 A;  2JWE A;  4Q2O A;  2ZL3 A;  2FCF A;  2PZD A;  1QAV B;  1V62 A;  3K82 A;  3MH7 A;  3R0H A;  1NF3 C;  2D3T A;  3GCO A;  2KOH A;  3QK8 A;  2YT7 A;  4KFV A;  4E3B A;  3KTG A;  2AIN A;  3PS4 A;  3FF6 A;  3PE8 A;  4GVC A;  3P2L A;  4KFW A;  1NZY B;  4I42 A;  4P0C A;  3CYY A;  4NMS A;  2H2C A;  3O5N A;  2RRM A;  1X0U A;  2A7S A;  4JYJ A;  3FY5 A;  2EEJ A;  2KPK A;  5HFD A;  2X7Z A;  4E34 A;  1UEZ A;  1SZO A;  1RY4 A;  1TYF A;  1GQ4 A;  4JYL A;  4IZC A;  3TVU A;  2CS5 A;  2J5I I;  2D90 A;  1UYS A;  2DLU A;  4Q2N A;  2ZQR A;  5G1R A;  3ST9 A;  1V1T A;  4JL7 A;  3GDS A;  4IZB A;  3PDV A;  1W9O A;  3TT7 A;  5HF4 A;  1DCI A;  1WH1 A;  1MFL A;  1OZI A;  1WG6 A;  4B3H A;  4NMQ A;  5ING A;  1WDL A;  4K2N A;  4U0G H;  3GDV A;  3ID1 A;  4Q6S A;  2A7K A;  3Q1T A;  3ID2 A;  3NGH A;  4JFC A;  4EMM A;  3K8X A;  2I1N A;  2FW2 A;  4NMR A;  5HFB A;  5IKL B;  1QAV A;  1UF1 A;  3OT6 A;  1U3B A;  1Q52 A;  3NJB A;  5DTW A;  3DOR A;  1WF8 A;  4K6Y A;  5HET A;  3KTK A;  3Q0J A;  2O2T A;  1VB7 A;  4I4Z A;  2VSP A;  1V6B A;  3RSI A;  4MOU A;  2H3M A;  2EEI A;  2JIL A;  2DKR A;  3CBZ A;  5E22 A;  3WKM A;  1GQ5 A;  1NZY A;  3N6R B;  1YG6 A;  3PV2 A;  5G1Q A;  3NJD A;  3HLN 1;  3T8B A;  1RZX A;  4L8K A;  2EJY A;  2D8I A;  3EGG C;  5HFE A;  5DTH A;  4JOE A;  3E17 A;  3U9R B;  3ZWC A;  2DM8 A;  3OU0 A;  3SWX A;  4F47 A;  2LOB A;  3OC7 A;  3PDZ A;  1XO6 A;  2OGP A;  4WZ8 B;  3R9T A;  2L4T A;  1BFE A;  2UZC A;  2E7K A;  4OEP A;  4K29 A;  3MFM A;  3PEA A;  1VA8 A;  1XZ9 A;  2P3W A;  2KL1 A;  4JVT A;  3RST A;  3I47 A;  4QIJ A;  4R2Z A;  1N7T A;  1FC6 A;  2BYG A;  2Q2X A;  4NXQ A;  3PV5 A;  2PBP A;  4JJT A;  2M0T A;  5DUC A;  1UYT A;  1SG4 A;  2PG8 A;  2Q34 A;  2M0V A;  1UIT A;  2W3P A;  2QKU A;  3HPK A;  3H81 A;  2L97 A;  2X24 A;  2ZL4 A;  2OPG A;  3MH4 A;  2OCS A;  1WFG A;  2Z17 A;  5DKP A;  4U0H A;  3R0O A;  5DTP A;  2HE2 A;  5JBW A;  2Q35 A;  3QJN A;  2VWR A;  3BF0 A;  3H0U A;  1TG6 A;  4GHN A;  3DJ3 A;  2J5I A;  1OD4 A;  4KNP A;  1TE0 A;  5CTB A;  1UM7 A;  2J5G D;  2EGK A;  2PNT A;  1B8Q A;  5INI A;  4E35 A;  1EY3 A;  3MH6 A;  3H02 A;  2Q3G A;  3CBY A;  2FBM A;  2VSU E;  3H0J A;  2Q9V A;  5FHT A;  1YBO A;  4UU6 A;  3KHF A;  1MFG A;  3DJA A;  3R69 A;  1SOT A;  1UFX A;  4KWB A;  4EMP A;  3M6M A;  2JIK A;  2EV8 A;  3I1E A;  1X6D A;  4NNM A;  4ELW A;  4RCN A;  3KTH A;  3L3S A;  3LNX A;  5HFC A;  1WHD A;  2C8T A;  2GTR A;  1HZD A;  4ZDB A;  4ZU2 A;  3BPP A;  4FND A;  2I0L A;  5DZK A;  3TZ3 A;  5GND A;  2KRG A;  2LC7 A;  2HW5 A;  4JOT A;  4QFE A;  3ZRT A;  3PZK A;  4FZW C;  2QKV A;  3QYR A;  4NXR A;  5E0S H;  3Q0G A;  4YYX A;  2K20 A;  1LCY A;  2J5S A;  1X5R A;  3B76 A;  4PQW A;  2EDP A;  1UIY A;  4ZDF A;  2VRF A;  1DUB A;  2R4H A;  4EDJ A;  4K72 A;  2EEH A;  4FN7 A;  3DJ1 A;  4NNL A;  3GF7 A;  3R68 A;  1D5G A;  3EGH C;  4K76 A;  2QQ3 A;  1KWA A;  3QXZ A;  3R6H A;  3QGL A;  1IHJ A;  5HFF A;  1OD2 A;  4HNK A;  4JCQ A;  1QAU A;  3AXA A;  5HEY A;  3KTI A;  4JOJ A;  4JWV A;  4FJW D;  3TV5 A;  1Q3P A;  5DU8 A;  1PJH A;  4I52 A;  2ZL2 A;  2FE5 A;  3QMJ A;  5DZK H;  1Y7N A;  2KAW A;  4MI2 A;  4WCZ A;  4ELS A;  3GJ9 A;  1WFV A;  4Z0M A;  1VCW A;  2KQF A;  3LNY A;  2AWU A;  4OAJ A;  1WIF A;  3PV4 A;  4HOP B;  3TRR A;  4OEO A;  4F8K A;  4ZDE A;  2LC6 A;  2VSS E;  5JXB A;  2EGN A;  3WKL A;  2KYL A;  2DMZ A;  4WYT A;  2QKT A;  3NFL A;  3KZE A;  3CBX A;  3CC0 A;  2CE3 A;  2IEX A;  2EGO A;  4Q0G A;  5DU4 A;  4ELX A;  2OSG A;  2ZQQ A;  5B6L A;  2ENO A;  2OMJ A;  2OZF A;  3K1R A;  4KD6 A;  3STA A;  1N7E A;  1UEW A;  2V1W A;  2AWW A;  3TLF A;  4Q2Q A;  4EML A;  4NEK A;  3GKB A;  3PGQ A;  4FNB A;  2VSU A;  4K78 A;  2UZF A;  3LKE A;  3I18 A;  3GDU A;  2KJK A;  4RYF A;  3TDC A;  3DIW A;  3U9S B;  1RJN A;  1M5Z A;  4KPK A;  4FGM A;  4L8N A;  5EYZ A;  3ISA A;  3RLE A;  5KDR B;  2L4S A;  1FC7 A;  3OME A;  2F0A A;  2CSS A;  2F9I A;  2VSU F;  1HNO A;  1VRG A;  2KPL A;  2FZS A;  3TSV A;  4MPA A;  4WYU A;  3IB9 A;  1HNU A;  1OBZ A;  4K75 A;  4RI0 A;  3JU1 A;  3R9Q A;  2EDV A;  1Y7O A;  4AMH A;  1GM1 A;  1UJU A;  3SLL A;  1TP5 A;  2VRE A;  3VQG A;  1RGR A;  3NFK A;  3OTP A;  5C90 A;  1X8S A;  4IC6 A;  4OG1 A;  1I16 A;  3ZW9 A;  1RGW A;  4HOP A;  4UU5 A;  2DJT A;  2DUB A;  5HF1 A;  2CBY A;  2EAQ A;  2J5I B;  1WI4 A;  3SOE A;  2NP9 A;  3IAV A;  1MC7 A;  1ON3 A;  1UEP A;  5E21 A;  1W9Q A;  4Q3H A;  4REY A;  3RL8 A;  4RYF H;  5C9G A;  5E6P B;  3R9S A;  2IWO A;  3G64 A;  1OBX A;  1TP3 A;  5GLJ A;  5G1S A;  1UJD A;  3RRV A;  1FCF A;  1QLC A;  5EZ0 A;  1Z86 A;  4JOP A;  4JOG A;  4O06 A;  1N7F A;  5JBX A;  5DU6 A;  2DLS A;  4OMR A;  2YTW A;  1PDR A;  3TMH A;  1MJ3 A;  4P2A B;  4Q2P A;  2IWN A;  3RL7 A;  3WG5 A;  1UHP A;  2HGA A;  1XNW A;  2KV8 A;  5KJP A;  3KZD A;  1I92 A;  4JOK A;  4B3I A;  5FIF A;  3GSL A;  5E0N X;  1ZUB A;  5KDR A;  4JCS A;  1K32 A;  2VSS A;  3LAO A;  3T89 A;  5A2P A;  1N6E A;  4H11 A;  3TSW A;  2JOA A;  1V5L A;  4JOF A;  2F9Y A;  4MXI A;  3QJM A;  4U19 A;  1UEQ A;  2X58 A;  3KTJ A;  4G2R A;  2Z9I A;  1EF8 A;  1U38 A;  2MHO A;  2OQS A;  3QDO A;  2VSS F;  2GZV A;  5CTC A;  2EJ5 A;  2M3M A;  2KBS A;  2M0Z A;  1NTE A;  1VAE A;  3GLM A;  1WJL A;  2H2B A;  4U0G A;  2KG2 A;  1N6D A;  4JCT A;  3H0S A;  2CSJ A;  3STJ A;  5FUS A;  2EDZ A;  2EEG A;  3HP0 A;  2F9I B;  2F5Y A;  1TQ3 A;  1U39 A;  4Z33 A;  1PIX A;  4OLQ A;  2W4F A;  3T3W A;  2VPH A;  1Q7X A;  1WI2 A;  4GM2 A;  4YDP A;  2HE4 A;  1P1E A;  5H3J A;  3BEZ A;  4LK5 A;  3V5I A;  5F3X A;  3GCN A;  4ASI A;  2DC2 A;  4JOR A;  1IU2 A;  1YG8 A;  4NMT A;  2LA8 A;  3TT6 A;  1SOZ A;  2KOJ A;  4Z8J A;  3CS0 A;  5D13 A;  2DAZ A;  4U18 A;  1WF7 A;  3FDU A;  3QKA A;  2ZPL A;  3H0Q A;  4NMV A;  2IWQ A;  2DB5 A;  3MOY A;  1UM1 A;  2FN5 A;  4U1A A;  1X5Q A;  1P1D A;  4NNQ A;  3L4F D;  3QXI A;  3VQF A;  1ON9 A;  1XNY A;  4K3W A;  4N6X A;  3QE1 A;  5DL1 A;  2OS6 A;  3GMA A;  3HE2 A;  2I0I A;  4Q1I A;  3TSZ A;  2KA9 A;  1R6J A;  3I4W A;  1Q3O A;  3ID3 A;  2VX2 A;  1W9E A;  1XX4 A;  4L6W A;  3MT6 A;  5HED A;  2I4S A;  2YUY A;  2JIN A;  2QBW A;  3T8A A;  2FNE A;  1XNV A;  2KJD A;  2VZ5 A;  2AWX A;  3QIK A;  2EHR A;  3VIV A;  3SFJ A;  1VJ6 A;  3O46 A;  2JXO A;  3T88 A;  1X5N A;  4JOH A;  3HVQ C;  3CH8 A;  3GGE A;  4HC8 A;  2YT8 A;  1Z87 A;  2REY A;  3SHU A;  2G5M B;  1O8U A;  1U37 A;  2LUI A;  4GVD A;  3IBB A;  3KQF A;  4ZDC A;  3HRX A;  3P5M A;  2F6Q A;  2F9Y B;  5FB8 C;  2ZL0 A;  2VSU C;  3P85 A;  2PKT A;  3QWD A;  4NMP A;  5F67 A;  5G1D A;  2M10 A;  5I7Z A;  2M0U A;  1RJM A;  4JSB A;  2RCZ A;  2KJP A;  1WHA A;  1JXZ A;  2MX6 A;  1K39 A;  3ZWB A;  4Q6H A;  1WDM A;  3SHW A;  1N99 A;  2EXG A;  3M6N A;  1EF9 A;  3GF3 A;  2K1Z A;  2I6V A;  1J7X A;  2A81 A;  1UYV A;  5HJ1 A;  2QG1 A;  4XHV A;  1OBY A;  5E11 A;  3ID4 A;  3QO6 A;  3K50 A;  1UJV A;  1WDK A;  1Y8T A;  1Q51 A;  3HPM A;  4NMO A;  3SUZ A;  3QRE A;  2G2L A;  2QT5 A;  2WTB A;  1BE9 A;  3U9T B;  4IZD A;  4LMM A;  4WYO B;  2VSV A;  2H3L A;  4JCR A;  2PA1 A;  1L6O A;  4ZDD A;  1G9O A;  2R3Y A;  5HDY A;  3TVW A;  5MGB A;  2PPY A;  3BPU A;  2JRE A;  1UYR A;  1W2X A;  3V5E A;  4B3J A;  2J5G A;  5E0S A;  5E1Y A;  5HEB A;  2PKU A;  2W7R A;  2DEO A;  3JXT A;  2ZPM A;  4NXP A;  2F6I A;  1IU0 A;  4QII A;  2PDZ A;  2YUB A;  1KEF A;  2KOM A;  1WZ8 A;  3HIN A;  3Q7H A;  3ZWA A;  4FB8 A;  1KY9 A;  1N6F A;  1X45 A;  5INF A;  2I04 A;  5G1E A;  4DI1 A;  4G69 A;  4FZW A;  4FN8 A;  1ZOK A;  5DUF A;  4YLH A;  2IWP A;  2BZR A;  3MYB A;  2D92 A;  1V5Q A;  2WL7 A;  2V90 A;  3ZW8 A; 
#chains in the Genus database with same CATH topology
 1T2M A;  1FC9 A;  2JWE A;  4Q2O A;  2ZL3 A;  2FCF A;  2PZD A;  1QAV B;  1V62 A;  3K82 A;  3MH7 A;  3R0H A;  3D03 A;  1NF3 C;  2D3T A;  3GCO A;  2KOH A;  3QK8 A;  2YT7 A;  1X9Z A;  4KFV A;  3IHB A;  4E3B A;  3KTG A;  2AIN A;  3PS4 A;  3FF6 A;  3PE8 A;  4GVC A;  3P2L A;  4KFW A;  1NZY B;  4I42 A;  4P0C A;  3CYY A;  4NMS A;  4DGF A;  2H2C A;  3O5N A;  2RRM A;  1X0U A;  2A7S A;  4JYJ A;  3FY5 A;  2EEJ A;  2KPK A;  5HFD A;  2X7Z A;  4E34 A;  1UEZ A;  5EUX A;  1RY4 A;  1SZO A;  1TYF A;  1GQ4 A;  4JYL A;  3EH7 A;  4IZC A;  3TVU A;  2CS5 A;  2J5I I;  2D90 A;  3V97 A;  1UYS A;  2DLU A;  4Q2N A;  2ZQR A;  5G1R A;  3ST9 A;  1V1T A;  4JL7 A;  1WXX A;  2B78 A;  4AEJ A;  3GDS A;  4IZB A;  3PDV A;  1W9O A;  3TT7 A;  5HF4 A;  1DCI A;  1WH1 A;  1MFL A;  1OZI A;  1WG6 A;  4B3H A;  4NMQ A;  5ING A;  3OIR A;  1WDL A;  4K2N A;  4U0G H;  3GDV A;  3ID1 A;  4Q6S A;  2A7K A;  3Q1T A;  3ID2 A;  3NGH A;  4JFC A;  4EMM A;  2JSN A;  3K8X A;  2I1N A;  2FW2 A;  4NMR A;  5HFB A;  5IKL B;  3ZXN A;  1QAV A;  1UF1 A;  3OT6 A;  1U3B A;  1Q52 A;  3NJB A;  5DTW A;  3DOR A;  1WF8 A;  4K6Y A;  5HET A;  3KTK A;  3Q0J A;  2O2T A;  1VB7 A;  4I4Z A;  2VSP A;  1V6B A;  3MGL A;  4MOU A;  3RSI A;  2H3M A;  2EEI A;  2JIL A;  2DKR A;  3CBZ A;  5E22 A;  3WKM A;  2ZO9 B;  1GQ5 A;  1NZY A;  3N6R B;  1YG6 A;  3PV2 A;  5G1Q A;  3NJD A;  3HLN 1;  3IF5 A;  3T8B A;  1RZX A;  4L8K A;  2EJY A;  2D8I A;  3EGG C;  5HFE A;  5DTH A;  4JOE A;  3E17 A;  3U9R B;  3ZWC A;  2DM8 A;  3OU0 A;  3SWX A;  4F47 A;  2LOB A;  3OC7 A;  3PDZ A;  1XO6 A;  2OGP A;  4WZ8 B;  3R9T A;  2L4T A;  1BFE A;  2UZC A;  2E7K A;  4OEP A;  4K29 A;  3AGD A;  3MFM A;  3PEA A;  1VA8 A;  1XZ9 A;  2P3W A;  2KL1 A;  3AGE A;  4JVT A;  3I47 A;  4QIJ A;  4R2Z A;  3RST A;  1N7T A;  1FC6 A;  2BYG A;  2Q2X A;  4NXQ A;  3PV5 A;  1SBO A;  2PBP A;  2M0T A;  4JJT A;  5DUC A;  1UYT A;  1SG4 A;  2PG8 A;  2Q34 A;  2M0V A;  1UIT A;  2W3P A;  2QKU A;  3OIZ A;  3HPK A;  3H81 A;  2L97 A;  2X24 A;  2ZL4 A;  2OPG A;  3MH4 A;  2OCS A;  1H4X A;  1WFG A;  2Z17 A;  5DKP A;  4U0H A;  3R0O A;  5DTP A;  2HE2 A;  1T6R A;  2Q35 A;  5JBW A;  3QJN A;  2VWR A;  3BF0 A;  5EUS A;  3H0U A;  1TG6 A;  4GHN A;  3DJ3 A;  2J5I A;  1OD4 A;  4KNP A;  4JC0 A;  1TE0 A;  5CTB A;  1UM7 A;  2J5G D;  2EGK A;  2PNT A;  1B8Q A;  5INI A;  4E35 A;  1EY3 A;  3MH6 A;  3H02 A;  2Q3G A;  3CBY A;  2FBM A;  2VSU E;  3H0J A;  2Q9V A;  5FHT A;  1H4Z A;  1YBO A;  4UU6 A;  3LDF A;  3KHF A;  1MFG A;  3DJA A;  4HYL A;  3R69 A;  1SOT A;  1UFX A;  4KWB A;  4NAR A;  4EMP A;  3M6M A;  2JIK A;  2EV8 A;  3I1E A;  1X6D A;  4NNM A;  4ELW A;  4RCN A;  3KTH A;  3L3S A;  3LNX A;  5HFC A;  1WHD A;  2C8T A;  2GTR A;  1HZD A;  4ZDB A;  4ZU2 A;  3BPP A;  4FND A;  2I0L A;  3DUP A;  5DZK A;  3TZ3 A;  5GND A;  2KRG A;  2LC7 A;  2HW5 A;  3GVL A;  4JOT A;  4QFE A;  3ZRT A;  3PZK A;  4AE2 A;  4FZW C;  2QKV A;  3QYR A;  3C0K A;  4NXR A;  5E0S H;  3Q0G A;  4YYX A;  1V0F A;  3LKL A;  2K20 A;  1LCY A;  2J5S A;  3BPT A;  1X5R A;  3B76 A;  4PQW A;  2EDP A;  2OAS A;  1UIY A;  4ZDF A;  2VRF A;  1DUB A;  2R4H A;  4EDJ A;  4K72 A;  2EEH A;  4FN7 A;  3DJ1 A;  4NNL A;  4DGH A;  3GF7 A;  3VSE A;  3R68 A;  1D5G A;  3EGH C;  4K76 A;  2DXL A;  2QQ3 A;  1KWA A;  3QXZ A;  3R6H A;  3QGL A;  5IL9 A;  1IHJ A;  2RRL A;  5HFF A;  1OD2 A;  4HNK A;  4JCQ A;  1QAU A;  3AXA A;  5HEY A;  3KTI A;  4JOJ A;  4JWV A;  4FJW D;  3T6O A;  3TV5 A;  1Q3P A;  5DU8 A;  1PJH A;  4I52 A;  2ZL2 A;  2FE5 A;  2GEF A;  3QMJ A;  1Y7N A;  2KAW A;  5DZK H;  4MI2 A;  4WCZ A;  4ELS A;  3GJ9 A;  1WFV A;  4Z0M A;  1VCW A;  2KQF A;  3LNY A;  2AWU A;  4OAJ A;  1WIF A;  3V8V A;  3PV4 A;  4HOP B;  3TRR A;  4OEO A;  4F8K A;  4ZDE A;  2LC6 A;  2VSS E;  5JXB A;  2EGN A;  3WKL A;  5ILB A;  2KYL A;  2DMZ A;  4WYT A;  2QKT A;  3NFL A;  3KZE A;  3CBX A;  3CC0 A;  2CE3 A;  2IEX A;  2EGO A;  4Q0G A;  5DU4 A;  4ELX A;  2OSG A;  2ZQQ A;  5B6L A;  3IHA A;  2ENO A;  2OMJ A;  2OZF A;  3GAB A;  3K1R A;  4KD6 A;  3STA A;  1N7E A;  1UEW A;  4DMG A;  2V1W A;  2AWW A;  3TLF A;  4Q2Q A;  4EML A;  4NEK A;  2DXN A;  3GKB A;  3PGQ A;  4FNB A;  2VSU A;  4K78 A;  1BPL A;  2UZF A;  3LKE A;  3I18 A;  3GDU A;  2KJK A;  3JU4 A;  4RYF A;  3TDC A;  3DIW A;  3U9S B;  1RJN A;  1M5Z A;  4KPK A;  4FGM A;  3NY7 A;  4L8N A;  5EYZ A;  5EUZ A;  3RLE A;  3ISA A;  5KDR B;  2L4S A;  1FC7 A;  3OME A;  2F0A A;  2CSS A;  2F9I A;  2VSU F;  3NCV A;  1HNO A;  1VRG A;  2KPL A;  2FZS A;  2VY9 A;  3TSV A;  4MPA A;  4WYU A;  3IB9 A;  1HNU A;  1OBZ A;  4K75 A;  4RI0 A;  3JU1 A;  3R9Q A;  2EDV A;  1Y7O A;  4AMH A;  1GM1 A;  1UJU A;  3SLL A;  1TP5 A;  2VRE A;  5HUQ A;  3VQG A;  1RGR A;  3NFK A;  3OTP A;  5C90 A;  1X8S A;  4IC6 A;  4OG1 A;  1I16 A;  3ZW9 A;  1RGW A;  4HOP A;  4UU5 A;  2DJT A;  2DUB A;  5HF1 A;  1VC1 A;  2CBY A;  2EAQ A;  2J5I B;  3GMF A;  1WI4 A;  3SOE A;  2NP9 A;  3IAV A;  1MC7 A;  1ON3 A;  1UEP A;  2KA5 A;  5E21 A;  1W9Q A;  4Q3H A;  4REY A;  3RL8 A;  4RYF H;  5C9G A;  5EUW A;  5E6P B;  3R9S A;  2IWO A;  3G64 A;  1OBX A;  1TP3 A;  5GLJ A;  5G1S A;  1UJD A;  3RRV A;  1FCF A;  1QLC A;  5EZ0 A;  3KDG A;  1Z86 A;  3MOG A;  4JOP A;  4JOG A;  4O06 A;  1N7F A;  5B42 A;  5JBX A;  5DU6 A;  2DLS A;  4OMR A;  2YTW A;  1PDR A;  3TMH A;  1MJ3 A;  4P2A B;  4Q2P A;  2IWN A;  3RL7 A;  3WG5 A;  1UHP A;  4XS5 A;  2HGA A;  3GHF A;  1XNW A;  2ZOA A;  2KV8 A;  3GVK A;  5KJP A;  3KZD A;  1I92 A;  4JOK A;  4B3I A;  5FIF A;  3GSL A;  1BUZ A;  5E0N X;  1ZUB A;  5KDR A;  1H4Y A;  4JCS A;  1K32 A;  2VSS A;  3LAO A;  1TIL B;  3T89 A;  5A2P A;  1N6E A;  4H11 A;  3KDK A;  3TSW A;  2JOA A;  1V5L A;  4JOF A;  2F9Y A;  3GK7 A;  4MXI A;  3QJM A;  4U19 A;  1UEQ A;  2X58 A;  3KTJ A;  4G2R A;  2Z9I A;  1EF8 A;  1U38 A;  2MHO A;  2OQS A;  3QDO A;  2VSS F;  2GZV A;  5CTC A;  4J2U A;  2EJ5 A;  2M3M A;  2KBS A;  2M0Z A;  1NTE A;  1VAE A;  3GLM A;  1WJL A;  2H2B A;  4U0G A;  4HIZ A;  2KG2 A;  1N6D A;  4JCT A;  3H0S A;  2CSJ A;  3STJ A;  5FUS A;  2EDZ A;  2EEG A;  3HP0 A;  2F9I B;  1WXW A;  2F5Y A;  1TQ3 A;  1U39 A;  4Z33 A;  1PIX A;  4OLQ A;  2W4F A;  3T3W A;  2VPH A;  1Q7X A;  1WI2 A;  4GM2 A;  4YDP A;  2HE4 A;  1P1E A;  5H3J A;  3BEZ A;  4LK5 A;  3D3U A;  5F3X A;  3V5I A;  3GCN A;  4ASI A;  2DC2 A;  4JOR A;  1IU2 A;  1YG8 A;  4NMT A;  2LA8 A;  3TT6 A;  1SOZ A;  2KOJ A;  4Z8J A;  3CS0 A;  5D13 A;  2DAZ A;  4U18 A;  1WF7 A;  2CWW A;  3ZTB A;  2AS0 A;  3FDU A;  3QKA A;  2ZPL A;  3H0Q A;  4NMV A;  5EZB A;  2IWQ A;  2DB5 A;  3F43 A;  3MOY A;  1UM1 A;  2FN5 A;  4U1A A;  1X5Q A;  1P1D A;  4NNQ A;  3L4F D;  3QXI A;  3VQF A;  1ON9 A;  1XNY A;  4K3W A;  4N6X A;  3QE1 A;  5DL1 A;  2OS6 A;  3GMA A;  3HE2 A;  2I0I A;  4Q1I A;  3TSZ A;  2KA9 A;  1R6J A;  3I4W A;  1Q3O A;  3ID3 A;  1THN B;  1W9E A;  1XX4 A;  2VX2 A;  4L6W A;  3MT6 A;  5HED A;  2I4S A;  2YUY A;  2JIN A;  2QBW A;  3T8A A;  2FNE A;  1XNV A;  2KJD A;  2VZ5 A;  2AWX A;  3QIK A;  2EHR A;  3VIV A;  3SFJ A;  5EUU A;  1VJ6 A;  3O46 A;  4JJ0 A;  2JXO A;  4QTP A;  3T88 A;  1X5N A;  4JOH A;  3HVQ C;  1AUZ A;  3CH8 A;  3IH9 A;  3GGE A;  4HC8 A;  2YT8 A;  1Z87 A;  2REY A;  3SHU A;  2G5M B;  1O8U A;  4L1C A;  4HDT A;  1U37 A;  2LUI A;  4GVD A;  3IBB A;  3KQF A;  4ZDC A;  3HRX A;  3P5M A;  2F6Q A;  2F9Y B;  5FB8 C;  2ZL0 A;  2VSU C;  3P85 A;  2PKT A;  3QWD A;  4NMP A;  5F67 A;  5G1D A;  3LLO A;  2M10 A;  5I7Z A;  2M0U A;  1RJM A;  4JSB A;  1TH8 B;  2RCZ A;  2KJP A;  1WHA A;  1HF2 A;  1JXZ A;  2MX6 A;  1K39 A;  3ZWB A;  4Q6H A;  1WDM A;  3SHW A;  1N99 A;  2EXG A;  3M6N A;  1EF9 A;  3GF3 A;  2K1Z A;  2I6V A;  1J7X A;  2A81 A;  2KLN A;  5HJ1 A;  2QG1 A;  4XHV A;  1UYV A;  1OBY A;  5E11 A;  3ID4 A;  4FLN A;  3QO6 A;  3K50 A;  1UJV A;  1WDK A;  1Y8T A;  1Q51 A;  3HPM A;  4NMO A;  3SUZ A;  3QRE A;  2G2L A;  2YJG A;  2QT5 A;  4JJ3 A;  2WTB A;  1BE9 A;  3U9T B;  4IZD A;  4LMM A;  3IH8 A;  4WYO B;  2VSV A;  2H3L A;  4JCR A;  2PA1 A;  1L6O A;  1V0E A;  4ZDD A;  1G9O A;  2R3Y A;  5HDY A;  3TVW A;  5MGB A;  2PPY A;  3GVJ A;  3BPU A;  2JRE A;  1UYR A;  1W2X A;  3V5E A;  4B3J A;  2J5G A;  5E0S A;  5E1Y A;  5HEB A;  2PKU A;  2W7R A;  2DEO A;  3JXT A;  2ZPM A;  4NXP A;  2F6I A;  1IU0 A;  4QII A;  2PDZ A;  2YUB A;  1KEF A;  2KOM A;  1WZ8 A;  3HIN A;  3Q7H A;  3ZWA A;  4FB8 A;  1KY9 A;  1N6F A;  1X45 A;  3QDQ A;  5INF A;  2I04 A;  5G1E A;  4DI1 A;  4G69 A;  1TID B;  4FZW A;  4FN8 A;  1ZOK A;  5DUF A;  4YLH A;  2IWP A;  2BZR A;  3MYB A;  2D92 A;  1V5Q A;  2WL7 A;  2V90 A;  3ZW8 A; 
#chains in the Genus database with same CATH homology
 1T2M A;  1FC9 A;  2JWE A;  4Q2O A;  2ZL3 A;  2FCF A;  2PZD A;  1QAV B;  1V62 A;  3K82 A;  3MH7 A;  3R0H A;  3D03 A;  1NF3 C;  2D3T A;  3GCO A;  2KOH A;  3QK8 A;  2YT7 A;  1X9Z A;  4KFV A;  4E3B A;  3KTG A;  2AIN A;  3PS4 A;  3FF6 A;  3PE8 A;  4GVC A;  3P2L A;  4KFW A;  1NZY B;  4I42 A;  4P0C A;  3CYY A;  4NMS A;  2H2C A;  3O5N A;  2RRM A;  1X0U A;  2A7S A;  4JYJ A;  3FY5 A;  2EEJ A;  2KPK A;  5HFD A;  2X7Z A;  4E34 A;  1UEZ A;  1SZO A;  1RY4 A;  1TYF A;  1GQ4 A;  4JYL A;  4IZC A;  3TVU A;  2CS5 A;  2J5I I;  2D90 A;  1UYS A;  2DLU A;  4Q2N A;  2ZQR A;  5G1R A;  3ST9 A;  1V1T A;  4JL7 A;  4AEJ A;  3GDS A;  4IZB A;  3PDV A;  1W9O A;  3TT7 A;  5HF4 A;  1DCI A;  1WH1 A;  1MFL A;  1OZI A;  1WG6 A;  4B3H A;  4NMQ A;  5ING A;  1WDL A;  4K2N A;  4U0G H;  3GDV A;  3ID1 A;  4Q6S A;  2A7K A;  3Q1T A;  3ID2 A;  3NGH A;  4JFC A;  4EMM A;  2JSN A;  3K8X A;  2I1N A;  2FW2 A;  4NMR A;  5HFB A;  5IKL B;  1QAV A;  1UF1 A;  3OT6 A;  1U3B A;  1Q52 A;  3NJB A;  5DTW A;  3DOR A;  1WF8 A;  4K6Y A;  5HET A;  3KTK A;  3Q0J A;  2O2T A;  1VB7 A;  4I4Z A;  2VSP A;  1V6B A;  3RSI A;  4MOU A;  2H3M A;  2EEI A;  2JIL A;  2DKR A;  3CBZ A;  5E22 A;  3WKM A;  2ZO9 B;  1GQ5 A;  1NZY A;  3N6R B;  1YG6 A;  3PV2 A;  5G1Q A;  3NJD A;  3HLN 1;  3T8B A;  1RZX A;  4L8K A;  2EJY A;  2D8I A;  3EGG C;  5HFE A;  5DTH A;  4JOE A;  3E17 A;  3U9R B;  3ZWC A;  2DM8 A;  3OU0 A;  3SWX A;  4F47 A;  2LOB A;  3OC7 A;  3PDZ A;  1XO6 A;  2OGP A;  4WZ8 B;  3R9T A;  2L4T A;  1BFE A;  2UZC A;  2E7K A;  4OEP A;  4K29 A;  3MFM A;  3PEA A;  1VA8 A;  1XZ9 A;  2P3W A;  2KL1 A;  4JVT A;  3RST A;  3I47 A;  4QIJ A;  4R2Z A;  1N7T A;  1FC6 A;  2BYG A;  2Q2X A;  4NXQ A;  3PV5 A;  2PBP A;  4JJT A;  2M0T A;  5DUC A;  1UYT A;  1SG4 A;  2PG8 A;  2Q34 A;  2M0V A;  1UIT A;  2W3P A;  2QKU A;  3HPK A;  3H81 A;  2L97 A;  2X24 A;  2ZL4 A;  2OPG A;  3MH4 A;  2OCS A;  1WFG A;  2Z17 A;  5DKP A;  4U0H A;  3R0O A;  5DTP A;  2HE2 A;  5JBW A;  2Q35 A;  3QJN A;  2VWR A;  3BF0 A;  3H0U A;  1TG6 A;  4GHN A;  3DJ3 A;  2J5I A;  1OD4 A;  4KNP A;  4JC0 A;  1TE0 A;  5CTB A;  1UM7 A;  2J5G D;  2EGK A;  2PNT A;  1B8Q A;  5INI A;  4E35 A;  1EY3 A;  3MH6 A;  3H02 A;  2Q3G A;  3CBY A;  2FBM A;  2VSU E;  3H0J A;  2Q9V A;  5FHT A;  1YBO A;  4UU6 A;  3KHF A;  1MFG A;  3DJA A;  3R69 A;  1SOT A;  1UFX A;  4KWB A;  4NAR A;  4EMP A;  3M6M A;  2JIK A;  2EV8 A;  3I1E A;  1X6D A;  4NNM A;  4ELW A;  4RCN A;  3KTH A;  3L3S A;  3LNX A;  5HFC A;  1WHD A;  2C8T A;  2GTR A;  1HZD A;  4ZDB A;  4ZU2 A;  3BPP A;  4FND A;  2I0L A;  3DUP A;  5DZK A;  3TZ3 A;  5GND A;  2KRG A;  2LC7 A;  2HW5 A;  4JOT A;  4QFE A;  3ZRT A;  3PZK A;  4AE2 A;  4FZW C;  2QKV A;  3QYR A;  4NXR A;  5E0S H;  3Q0G A;  4YYX A;  2K20 A;  1LCY A;  2J5S A;  3BPT A;  1X5R A;  3B76 A;  4PQW A;  2EDP A;  1UIY A;  4ZDF A;  2VRF A;  1DUB A;  2R4H A;  4EDJ A;  4K72 A;  2EEH A;  4FN7 A;  3DJ1 A;  4NNL A;  3GF7 A;  3R68 A;  1D5G A;  3EGH C;  4K76 A;  2DXL A;  2QQ3 A;  1KWA A;  3QXZ A;  3R6H A;  3QGL A;  5IL9 A;  1IHJ A;  2RRL A;  5HFF A;  1OD2 A;  4HNK A;  4JCQ A;  1QAU A;  3AXA A;  5HEY A;  3KTI A;  4JOJ A;  4JWV A;  4FJW D;  3TV5 A;  1Q3P A;  5DU8 A;  1PJH A;  4I52 A;  2ZL2 A;  2FE5 A;  2GEF A;  3QMJ A;  1Y7N A;  2KAW A;  5DZK H;  4MI2 A;  4WCZ A;  4ELS A;  3GJ9 A;  1WFV A;  4Z0M A;  1VCW A;  2KQF A;  3LNY A;  2AWU A;  4OAJ A;  1WIF A;  3PV4 A;  4HOP B;  3TRR A;  4OEO A;  4F8K A;  4ZDE A;  2LC6 A;  2VSS E;  5JXB A;  2EGN A;  3WKL A;  5ILB A;  2KYL A;  2DMZ A;  4WYT A;  2QKT A;  3NFL A;  3KZE A;  3CBX A;  3CC0 A;  2CE3 A;  2IEX A;  2EGO A;  4Q0G A;  5DU4 A;  4ELX A;  2OSG A;  2ZQQ A;  5B6L A;  2ENO A;  2OMJ A;  2OZF A;  3GAB A;  3K1R A;  4KD6 A;  3STA A;  1N7E A;  1UEW A;  2V1W A;  2AWW A;  3TLF A;  4Q2Q A;  4EML A;  4NEK A;  2DXN A;  3GKB A;  3PGQ A;  4FNB A;  2VSU A;  4K78 A;  1BPL A;  2UZF A;  3LKE A;  3I18 A;  3GDU A;  2KJK A;  4RYF A;  3TDC A;  3DIW A;  3U9S B;  1RJN A;  1M5Z A;  4KPK A;  4FGM A;  4L8N A;  5EYZ A;  3ISA A;  3RLE A;  5KDR B;  2L4S A;  1FC7 A;  3OME A;  2F0A A;  2CSS A;  2F9I A;  2VSU F;  3NCV A;  1HNO A;  1VRG A;  2KPL A;  2FZS A;  3TSV A;  4MPA A;  4WYU A;  3IB9 A;  1HNU A;  1OBZ A;  4K75 A;  4RI0 A;  3JU1 A;  3R9Q A;  2EDV A;  1Y7O A;  4AMH A;  1GM1 A;  1UJU A;  3SLL A;  1TP5 A;  2VRE A;  5HUQ A;  3VQG A;  1RGR A;  3NFK A;  3OTP A;  5C90 A;  1X8S A;  4IC6 A;  4OG1 A;  1I16 A;  3ZW9 A;  1RGW A;  4HOP A;  4UU5 A;  2DJT A;  2DUB A;  5HF1 A;  2CBY A;  2EAQ A;  2J5I B;  3GMF A;  1WI4 A;  3SOE A;  2NP9 A;  3IAV A;  1MC7 A;  1ON3 A;  1UEP A;  5E21 A;  1W9Q A;  4Q3H A;  4REY A;  3RL8 A;  4RYF H;  5C9G A;  5E6P B;  3R9S A;  2IWO A;  3G64 A;  1OBX A;  1TP3 A;  5GLJ A;  5G1S A;  1UJD A;  3RRV A;  1FCF A;  1QLC A;  5EZ0 A;  3KDG A;  1Z86 A;  3MOG A;  4JOP A;  4JOG A;  4O06 A;  1N7F A;  5B42 A;  5JBX A;  5DU6 A;  2DLS A;  4OMR A;  2YTW A;  1PDR A;  3TMH A;  1MJ3 A;  4P2A B;  4Q2P A;  2IWN A;  3RL7 A;  3WG5 A;  1UHP A;  2HGA A;  3GHF A;  1XNW A;  2ZOA A;  2KV8 A;  5KJP A;  3KZD A;  1I92 A;  4JOK A;  4B3I A;  5FIF A;  3GSL A;  5E0N X;  1ZUB A;  5KDR A;  4JCS A;  1K32 A;  2VSS A;  3LAO A;  3T89 A;  5A2P A;  1N6E A;  4H11 A;  3KDK A;  3TSW A;  2JOA A;  1V5L A;  4JOF A;  2F9Y A;  4MXI A;  3QJM A;  4U19 A;  1UEQ A;  2X58 A;  3KTJ A;  4G2R A;  2Z9I A;  1EF8 A;  1U38 A;  2MHO A;  2OQS A;  3QDO A;  2VSS F;  2GZV A;  5CTC A;  4J2U A;  2EJ5 A;  2M3M A;  2KBS A;  2M0Z A;  1NTE A;  1VAE A;  3GLM A;  1WJL A;  2H2B A;  4U0G A;  2KG2 A;  1N6D A;  4JCT A;  3H0S A;  2CSJ A;  3STJ A;  5FUS A;  2EDZ A;  2EEG A;  3HP0 A;  2F9I B;  2F5Y A;  1TQ3 A;  1U39 A;  4Z33 A;  1PIX A;  4OLQ A;  2W4F A;  3T3W A;  2VPH A;  1Q7X A;  1WI2 A;  4GM2 A;  4YDP A;  2HE4 A;  1P1E A;  5H3J A;  3BEZ A;  4LK5 A;  3V5I A;  5F3X A;  3GCN A;  4ASI A;  2DC2 A;  4JOR A;  1IU2 A;  1YG8 A;  4NMT A;  2LA8 A;  3TT6 A;  1SOZ A;  2KOJ A;  4Z8J A;  3CS0 A;  5D13 A;  2DAZ A;  4U18 A;  1WF7 A;  3FDU A;  3QKA A;  2ZPL A;  3H0Q A;  4NMV A;  2IWQ A;  2DB5 A;  3MOY A;  1UM1 A;  2FN5 A;  4U1A A;  1X5Q A;  1P1D A;  4NNQ A;  3L4F D;  3QXI A;  3VQF A;  1ON9 A;  1XNY A;  4K3W A;  4N6X A;  3QE1 A;  5DL1 A;  2OS6 A;  3GMA A;  3HE2 A;  2I0I A;  4Q1I A;  3TSZ A;  2KA9 A;  1R6J A;  3I4W A;  1Q3O A;  3ID3 A;  2VX2 A;  1W9E A;  1XX4 A;  4L6W A;  3MT6 A;  5HED A;  2I4S A;  2YUY A;  2JIN A;  2QBW A;  3T8A A;  2FNE A;  1XNV A;  2KJD A;  2VZ5 A;  2AWX A;  3QIK A;  2EHR A;  3VIV A;  3SFJ A;  1VJ6 A;  3O46 A;  4JJ0 A;  2JXO A;  3T88 A;  1X5N A;  4JOH A;  3HVQ C;  3CH8 A;  3GGE A;  4HC8 A;  2YT8 A;  1Z87 A;  2REY A;  3SHU A;  2G5M B;  1O8U A;  4L1C A;  4HDT A;  1U37 A;  2LUI A;  4GVD A;  3IBB A;  3KQF A;  4ZDC A;  3HRX A;  3P5M A;  2F6Q A;  2F9Y B;  5FB8 C;  2ZL0 A;  2VSU C;  3P85 A;  2PKT A;  3QWD A;  4NMP A;  5F67 A;  5G1D A;  2M10 A;  5I7Z A;  2M0U A;  1RJM A;  4JSB A;  2RCZ A;  2KJP A;  1WHA A;  1JXZ A;  2MX6 A;  1K39 A;  3ZWB A;  4Q6H A;  1WDM A;  3SHW A;  1N99 A;  2EXG A;  3M6N A;  1EF9 A;  3GF3 A;  2K1Z A;  2I6V A;  1J7X A;  2A81 A;  1UYV A;  5HJ1 A;  2QG1 A;  4XHV A;  1OBY A;  5E11 A;  3ID4 A;  4FLN A;  3QO6 A;  3K50 A;  1UJV A;  1WDK A;  1Y8T A;  1Q51 A;  3HPM A;  4NMO A;  3SUZ A;  3QRE A;  2G2L A;  2YJG A;  2QT5 A;  4JJ3 A;  2WTB A;  1BE9 A;  3U9T B;  4IZD A;  4LMM A;  4WYO B;  2VSV A;  2H3L A;  4JCR A;  2PA1 A;  1L6O A;  4ZDD A;  1G9O A;  2R3Y A;  5HDY A;  3TVW A;  5MGB A;  2PPY A;  3BPU A;  2JRE A;  1UYR A;  1W2X A;  3V5E A;  4B3J A;  2J5G A;  5E0S A;  5E1Y A;  5HEB A;  2PKU A;  2W7R A;  2DEO A;  3JXT A;  2ZPM A;  4NXP A;  2F6I A;  1IU0 A;  4QII A;  2PDZ A;  2YUB A;  1KEF A;  2KOM A;  1WZ8 A;  3HIN A;  3Q7H A;  3ZWA A;  4FB8 A;  1KY9 A;  1N6F A;  1X45 A;  5INF A;  2I04 A;  5G1E A;  4DI1 A;  4G69 A;  4FZW A;  4FN8 A;  1ZOK A;  5DUF A;  4YLH A;  2IWP A;  2BZR A;  3MYB A;  2D92 A;  1V5Q A;  2WL7 A;  2V90 A;  3ZW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...