1FC6A

Photosystem ii d1 c-terminal processing protease
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
386
structure length
386
Chain Sequence
VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II D1 PROTEASE
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
total genus 115
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc6A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc6A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc6A03
4JVTA 4NXQA 4JOPA 1P1DA 4AMHA 2QKTA 1YG8A 5HJ1A 4Q1IA 3TRRA 1JXZA 2KOJA 4U0HA 4HOPA 1MJ3A 3AXAA 5E11A 4E34A 1XO6A 4JORA 3STJA 2I1NA 2KOMA 4UU6A 3FY5A 2ZL3A 1N6EA 2PDZA 1Y7OA 3R9QA 3HINA 2D8IA 2EEIA 4DI1A 2M0VA 3P85A 1UFXA 2Z17A 5HDYA 4OMRA 4K72A 4YLHA 2FCFA 4GHNA 3IAVA 3NFLA 4K6YA 4Q2PA 3CYYA 3TT6A 5F3XA 3NFKA 4NMVA 3ZWAA 1N7EA 5G1EA 1FC6A 2ZPLA 3TSWA 1G9OA 5HFDA 3PGQA 3OC7A 3PE8A 1N6FA 3O5NA 2C8TA 2E7KA 2M3MA 2KQFA 5C9GA 3RRVA 5GLJA 2LUIA 2Q9VA 3K50A 2EGNA 2K1ZA 4Q0GA 3TT7A 2VSSF 1U3BA 5HF1A 3ID1A 5E21A 2D92A 4NMQA 2LA8A 5F67A 2F9YA 1UJDA 4EMPA 1FC7A 1OD4A 2X7ZA 5E22A 2M0UA 1K32A 3QGLA 3T3WA 1UF1A 2KPKA 4K76A 5IKLB 1Y8TA 3H81A 3WKLA 1N99A 2Q3GA 3WKMA 3KZEA 3I47A 3QWDA 3GCNA 1UIYA 4IZDA 2OCSA 2IWOA 1M5ZA 2EEHA 4KPKA 2PG8A 1QAVA 2MHOA 4QFEA 1TP3A 4GVCA 4ELXA 1I92A 4IZCA 4ZDDA 5JXBA 4FJWD 5DTPA 1OZIA 2X24A 3L3SA 1OBYA 3VIVA 4U0GH 3SFJA 2YT8A 2PKTA 3I4WA 1UM7A 1N7TA 1X0UA 5FUSA 4ELWA 1EF9A 4HNKA 2I6VA 4U19A 1TG6A 3KTJA 4U18A 3PV2A 2F6IA 5B6LA 1VCWA 4NMRA 4K2NA 1LCYA 3QMJA 4ZDEA 2JINA 3OU0A 3KQFA 1WJLA 2LC7A 1KEFA 2V90A 3ZW8A 4JOHA 3SUZA 1V5QA 1BE9A 3HE2A 4MPAA 3GF3A 2I0IA 4QIIA 2J5GA 3KHFA 3LNXA 3H02A 4REYA 2L4TA 3SWXA 3QYRA 4K29A 4OAJA 3DJ1A 3H0SA 2OGPA 2A7KA 2ZQRA 5DU6A 3E17A 4EDJA 4JYLA 4Q3HA 3HPMA 3GCOA 1WF7A 3T89A 1NF3C 5INFA 4JOEA 4FN8A 3ZWBA 1NZYA 3QE1A 2VSSA 2Q35A 4WCZA 4K78A 4YDPA 1DCIA 3H0QA 2UZFA 2QG1A 1Q7XA 2KA9A 1WDKA 1PDRA 5E6PB 3BPPA 2VSUF 4IZBA 5DU4A 3PV4A 2CBYA 4B3IA 3CBXA 5HEBA 1WFVA 4NXPA 1SOTA 1SZOA 2YT7A 4ELSA 3HPKA 3MOYA 3R6HA 4KD6A 3R68A 2EEJA 4U0GA 4WZ8B 3RL7A 1UYRA 3N6RB 3TDCA 1VRGA 5C90A 5GNDA 4WYTA 4UU5A 3H0UA 1ZUBA 2AWXA 3TLFA 1HZDA 2A81A 5HF4A 2ZQQA 2FE5A 1Q52A 3KTKA 2H2CA 1MFLA 4JOGA 4Q6HA 1XNWA 4WYOB 1L6OA 2OSGA 2F9IB 2KL1A 4NMTA 3M6NA 2JXOA 2YUBA 4LK5A 1X5NA 3V5EA 5I7ZA 2J5IB 5DKPA 4EMMA 2DUBA 4L6WA 1IU0A 5G1RA 3B76A 3QO6A 5INGA 5E0SH 2EGKA 3R69A 4FNDA 1RJMA 2CSSA 1UEQA 5HFBA 2OQSA 2RRMA 3QXZA 1RY4A 3ID2A 3GMAA 1VB7A 3DORA 5DZKA 4O06A 4OEPA 3KTHA 2EV8A 4Z8JA 1V6BA 4IC6A 2AWUA 2QT5A 2KOHA 3T8AA 2VREA 2Q2XA 2PZDA 1UM1A 3P2LA 4Z0MA 3DJAA 3Q0GA 5G1QA 2FZSA 2GTRA 4PQWA 3GGEA 1RGWA 2VSSE 1TE0A 2WTBA 2ZL4A 4JOTA 2KV8A 4FNBA 3DIWA 1VA8A 5G1DA 2A7SA 4NNLA 4JL7A 1HNUA 4JCTA 3HVQC 2F0AA 2Z9IA 4R2ZA 1N7FA 3QXIA 2CS5A 2G2LA 3TMHA 2EDPA 3K8XA 2VSUA 2FW2A 2DC2A 5DTHA 1W9EA 1U38A 4G2RA 3JXTA 4WYUA 1UYTA 1Q3OA 1RZXA 4E3BA 3U9SB 3TVWA 2YTWA 1SG4A 4NXRA 3ZWCA 1XNYA 4JYJA 3MH4A 5HEYA 3M6MA 5HETA 5E0SA 5H3JA 2FNEA 2MX6A 1V62A 2Q34A 4P2AB 5KDRB 3EGHC 3KTGA 3LNYA 4XHVA 4NEKA 1YBOA 1TYFA 1Y7NA 1IU2A 4EMLA 2QBWA 1UJVA 3GSLA 5E1YA 3PDVA 3BF0A 3PS4A 5INIA 5D13A 2OS6A 4NNMA 2OPGA 1WH1A 1WDLA 2H3MA 2UZCA 4MOUA 3I1EA 3MYBA 4K75A 3ZRTA 1P1EA 5A2PA 4JOKA 4F8KA 1X8SA 2R3YA 4H11A 1UITA 4KNPA 2K20A 3DJ3A 2VSVA 3SOEA 4B3HA 1N6DA 3MH6A 1XX4A 2HGAA 3L4FD 4E35A 3HLN1 3MT6A 3T8BA 2EGOA 2IWQA 2F6QA 3QDOA 1Z86A 2GZVA 5FIFA 4JOFA 3K82A 3NJBA 5DZKH 3CC0A 1GM1A 4FN7A 4U1AA 3U9TB 1KY9A 2FBMA 4FZWA 2W4FA 3PV5A 1VAEA 3NGHA 4OLQA 2VSUE 3HRXA 3HP0A 4NNQA 2NP9A 2M10A 1MFGA 3GDVA 1EY3A 1ON3A 2IWNA 4L8KA 3MFMA 1Q3PA 2BYGA 3MH7A 4I42A 1GQ5A 1OD2A 2KJKA 4KWBA 5JBXA 2KPLA 1FC9A 2PNTA 3CS0A 3IBBA 2EXGA 2PKUA 4JSBA 3SHUA 1BFEA 1B8QA 3CBYA 2LC6A 4G69A 4ZDBA 1UYSA 3QJMA 2D3TA 2KAWA 1FCFA 1K39A 3RSIA 2PBPA 5KJPA 5FB8C 2F9IA 2JOAA 4Q2NA 2ENOA 2I0LA 2J5IA 2QKUA 4MXIA 2VWRA 1WIFA 3GDUA 3JU1A 1W9QA 2H2BA 2IWPA 4JCSA 4ZDCA 2P3WA 2HE2A 4GVDA 4B3JA 2G5MB 4HOPB 5DL1A 3WG5A 4F47A 1ZOKA 1IHJA 1WF8A 1PIXA 2CE3A 3SHWA 3GLMA 1W9OA 2VX2A 3Q7HA 1XZ9A 2L97A 3PDZA 1UEWA 3QJNA 2HW5A 2IEXA 1Q51A 2AWWA 4FGMA 1D5GA 2EJ5A 2M0TA 4NMPA 1I16A 3TVUA 3BEZA 3QIKA 3CH8A 2EDZA 2V1WA 4NMSA 3ST9A 1RJNA 3U9RB 3KTIA 5MGBA 2KRGA 4KFVA 4RI0A 2RCZA 2VZ5A 2H3LA 1DUBA 4OEOA 3NJDA 1WFGA 3RL8A 1EF8A 4ZDFA 3OT6A 3QKAA 2VRFA 4RYFH 2DEOA 3V5IA 1X45A 3T88A 1GQ4A 3TSZA 2J5II 3RSTA 1KWAA 2CSJA 5CTCA 2HE4A 4Q2OA 2BZRA 5HFCA 3STAA 4N6XA 2DAZA 5DTWA 2X58A 1V5LA 3ID3A 2L4SA 2VSUC 2F9YB 3QK8A 1QAUA 1WI4A 4Z33A 4HC8A 2EHRA 2F5YA 4GM2A 2JREA 5JBWA 1OBZA 4KFWA 1PJHA 3Q1TA 5DU8A 5HFEA 2DM8A 2OMJA 2KYLA 3SLLA 2I04A 2JILA 5DUCA 1SOZA 5KDRA 1WHDA 2ZL0A 2J5GD 5DUFA 4JFCA 3EGGC 1XNVA 4QIJA 3OMEA 1X6DA 2O2TA 1UHPA 4K3WA 2LOBA 1QAVB 1UYVA 1WDMA 1J7XA 2W3PA 3H0JA 1MC7A 4I52A 4L8NA 3FF6A 4YYXA 2EJYA 3CBZA 2ZPMA 5EYZA 1UEZA 1W2XA 3O46A 4LMMA 3PZKA 3LKEA 3R0OA 2KJPA 1O8UA 1WI2A 1U37A 4FB8A 1OBXA 3VQFA 3TSVA 5G1SA 5EZ0A 3KZDA 3ZW9A 2M0ZA 1VJ6A 3GDSA 2DLSA 1WZ8A 4JOJA 1UEPA 4JJTA 5CTBA 4RYFA 2QQ3A 4JCQA 1ON9A 5FHTA 3Q0JA 3R0HA 2JWEA 2QKVA 1TP5A 3LAOA 4NMOA 4ZU2A 2I4SA 2FN5A 2DMZA 3R9SA 1V1TA 3ISAA 2KBSA 1UJUA 4ASIA 4I4ZA 3ID4A 3IB9A 1X5QA 5HFFA 4JCRA 4OG1A 3R9TA 2EEGA 2PA1A 2PPYA 2WL7A 3OTPA 3K1RA 4JWVA 2EDVA 2DKRA 2AINA 2DJTA 2KG2A 3RLEA 4FZWC 1QLCA 1WG6A 3G64A 1YG6A 2ZL2A 3FDUA 1NZYB 1U39A 2D90A 2J5SA 1Z87A 2JIKA 1RGRA 3I18A 2KJDA 2VSPA 3TV5A 3GJ9A 1T2MA 2DLUA 3QREA 3GKBA 1WHAA 4Q6SA 1HNOA 2EAQA 2W7RA 4MI2A 4Q2QA 1R6JA 2YUYA 1X5RA 5E0NX 3TZ3A 4P0CA 2R4HA 2VPHA 3VQGA 3P5MA 1TQ3A 2OZFA 2REYA 5HEDA 3PEAA 1NTEA 3GF7A 4RCNA 3BPUA 2DB5A
chains in the Genus database with same CATH superfamily
4JVTA 4NXQA 4JOPA 1P1DA 4AMHA 2QKTA 1YG8A 5HJ1A 4Q1IA 3TRRA 1JXZA 2KOJA 4U0HA 4HOPA 1MJ3A 3AXAA 5E11A 4E34A 1XO6A 4JORA 3STJA 2I1NA 2KOMA 4UU6A 3FY5A 2ZL3A 1N6EA 2PDZA 1Y7OA 3R9QA 3OIRA 3HINA 2D8IA 2EEIA 4DI1A 2VY9A 2M0VA 5ILBA 3P85A 1UFXA 2Z17A 5HDYA 4OMRA 4K72A 4YLHA 2FCFA 4GHNA 3IAVA 3NFLA 4K6YA 4Q2PA 3CYYA 3TT6A 5F3XA 3DUPA 3NFKA 4NMVA 3ZWAA 1N7EA 5G1EA 3AGEA 1FC6A 2ZPLA 3TSWA 1G9OA 5HFDA 3PGQA 3OC7A 3PE8A 1N6FA 3O5NA 2C8TA 2E7KA 2M3MA 2KQFA 5C9GA 3RRVA 5GLJA 2LUIA 2Q9VA 3K50A 2EGNA 2K1ZA 4Q0GA 3TT7A 2VSSF 1U3BA 5HF1A 3ID1A 5E21A 2D92A 4NMQA 2LA8A 5F67A 2F9YA 1UJDA 4EMPA 1FC7A 1OD4A 2X7ZA 5E22A 2M0UA 1K32A 3QGLA 3T3WA 1UF1A 2KPKA 4K76A 5HUQA 5IKLB 1Y8TA 5EUWA 3H81A 3WKLA 1N99A 2Q3GA 3WKMA 3KZEA 3I47A 3QWDA 3GCNA 1UIYA 4IZDA 2OCSA 2IWOA 1M5ZA 2EEHA 4KPKA 2PG8A 1QAVA 2MHOA 3D3UA 4QFEA 1TP3A 4GVCA 4ELXA 3D03A 1SBOA 1I92A 4IZCA 4ZDDA 2AS0A 5JXBA 4FJWD 5EUXA 5DTPA 1OZIA 2X24A 3L3SA 3EH7A 1OBYA 3VIVA 2OASA 4U0GH 3SFJA 2YT8A 2PKTA 3I4WA 1UM7A 1N7TA 1X0UA 5FUSA 4ELWA 1EF9A 4HNKA 2I6VA 4U19A 1WXWA 1TG6A 3KTJA 1AUZA 4U18A 3PV2A 2F6IA 5B6LA 1VCWA 4NMRA 4K2NA 1LCYA 3QMJA 4ZDEA 2JINA 3OU0A 3KQFA 1WJLA 2LC7A 1KEFA 2V90A 3ZW8A 4JOHA 3SUZA 1V5QA 1BE9A 3HE2A 4MPAA 3GF3A 2I0IA 4QIIA 2J5GA 3KHFA 3LNXA 3H02A 4REYA 2L4TA 2DXLA 3SWXA 3QYRA 3ZXNA 4K29A 4OAJA 3MGLA 3DJ1A 3H0SA 2OGPA 2A7KA 2ZQRA 5DU6A 1WXXA 4L1CA 3E17A 2ZOAA 4EDJA 4HIZA 1TH8B 4JYLA 4Q3HA 3HPMA 3GCOA 1WF7A 3GMFA 1NF3C 3VSEA 3T89A 5INFA 4JOEA 4FN8A 3ZWBA 1NZYA 3QE1A 2VSSA 2Q35A 4WCZA 4K78A 4YDPA 3BPTA 1DCIA 3H0QA 2UZFA 2QG1A 1Q7XA 2KA9A 1WDKA 1PDRA 3T6OA 1H4ZA 5E6PB 3IH8A 3BPPA 3NY7A 2VSUF 4IZBA 5DU4A 3PV4A 2CBYA 4B3IA 3CBXA 5HEBA 1WFVA 4NXPA 1SOTA 1SZOA 2YT7A 4ELSA 3HPKA 3MOYA 3QDQA 3R6HA 4KD6A 3R68A 2EEJA 4U0GA 4WZ8B 3RL7A 1UYRA 3N6RB 3TDCA 1VRGA 5C90A 5GNDA 4WYTA 2GEFA 4UU5A 3H0UA 1ZUBA 2AWXA 3TLFA 3JU4A 1HZDA 2A81A 5HF4A 1V0FA 2FE5A 2ZQQA 1BPLA 1Q52A 3GABA 3KTKA 2H2CA 1MFLA 4JOGA 4Q6HA 4FLNA 4JC0A 1XNWA 1L6OA 2OSGA 4WYOB 2F9IB 2KL1A 4NMTA 3M6NA 2JXOA 2YUBA 4LK5A 1X5NA 3V5EA 5I7ZA 2J5IB 5DKPA 4EMMA 2DUBA 4L6WA 3GVKA 1IU0A 5G1RA 3B76A 3QO6A 5INGA 5E0SH 2EGKA 3R69A 4FNDA 1RJMA 2CSSA 1UEQA 5HFBA 2OQSA 2RRMA 3QXZA 1RY4A 3ID2A 3KDGA 3GMAA 4XS5A 1VB7A 3DORA 5DZKA 4O06A 4OEPA 2KA5A 3KTHA 2EV8A 4Z8JA 1V6BA 4IC6A 2AWUA 2QT5A 2KOHA 3T8AA 2VREA 1THNB 2Q2XA 2PZDA 1UM1A 3P2LA 4Z0MA 3DJAA 3Q0GA 5G1QA 2FZSA 2GTRA 4PQWA 3GGEA 1RGWA 2VSSE 1TE0A 2WTBA 2ZL4A 4JOTA 2KV8A 4FNBA 3DIWA 1VA8A 1X9ZA 5G1DA 2A7SA 4NNLA 4JL7A 1HNUA 4JCTA 3HVQC 2F0AA 2Z9IA 4R2ZA 1N7FA 3QXIA 2CS5A 1BUZA 2G2LA 3TMHA 2EDPA 3K8XA 2VSUA 2FW2A 2DC2A 5DTHA 3MOGA 1W9EA 1U38A 4G2RA 3JXTA 4WYUA 1UYTA 1Q3OA 1RZXA 4E3BA 3U9SB 3TVWA 2YTWA 1SG4A 4NXRA 3ZWCA 1XNYA 4QTPA 4JYJA 3MH4A 3F43A 5HEYA 3M6MA 5HETA 5E0SA 5H3JA 2FNEA 2MX6A 1V62A 2Q34A 4P2AB 5KDRB 3EGHC 3KTGA 3LNYA 4XHVA 4NEKA 1YBOA 5B42A 1TYFA 1Y7NA 1IU2A 5EUUA 2QBWA 4EMLA 1UJVA 3GSLA 5E1YA 3PDVA 1VC1A 3PS4A 3BF0A 5D13A 5INIA 3C0KA 2OS6A 4NNMA 2OPGA 1WH1A 1WDLA 2H3MA 2KLNA 2UZCA 2JSNA 4MOUA 3I1EA 3MYBA 4K75A 3ZRTA 1P1EA 5A2PA 4JOKA 4F8KA 1X8SA 4AEJA 2R3YA 4H11A 1UITA 2DXNA 4KNPA 2K20A 3DJ3A 2VSVA 3SOEA 4B3HA 1N6DA 3MH6A 1XX4A 2HGAA 4J2UA 5EUSA 3L4FD 4E35A 3HLN1 3MT6A 3T8BA 2EGOA 2IWQA 2F6QA 3QDOA 1Z86A 3GVJA 2GZVA 5EUZA 5FIFA 4JOFA 3K82A 3NJBA 5DZKH 3CC0A 1GM1A 4FN7A 4U1AA 3U9TB 1KY9A 2FBMA 4FZWA 2W4FA 3PV5A 1VAEA 3NGHA 4OLQA 2VSUE 3HRXA 3HP0A 4NNQA 2NP9A 2M10A 1MFGA 3GDVA 1EY3A 1ON3A 2IWNA 4L8KA 3MFMA 1Q3PA 2BYGA 3MH7A 4I42A 1GQ5A 1OD2A 2KJKA 4KWBA 5JBXA 2KPLA 1FC9A 2PNTA 3CS0A 4HYLA 3IBBA 2EXGA 2PKUA 4JSBA 3SHUA 4NARA 3GK7A 1BFEA 1B8QA 3CBYA 2LC6A 4G69A 4ZDBA 1UYSA 3IHAA 3IHBA 3QJMA 3V97A 4DMGA 2KAWA 2D3TA 1FCFA 1K39A 3RSIA 2PBPA 5KJPA 5FB8C 3GHFA 2JOAA 3IH9A 2F9IA 4AE2A 2YJGA 4Q2NA 2ENOA 2I0LA 3KDKA 2J5IA 2QKUA 4MXIA 2VWRA 4JJ0A 1WIFA 3GDUA 3JU1A 1W9QA 2H2BA 2IWPA 4JCSA 4ZDCA 2P3WA 2HE2A 4GVDA 4B3JA 2G5MB 4HOPB 5DL1A 3WG5A 4F47A 1ZOKA 1IHJA 1WF8A 1PIXA 2CE3A 3SHWA 3GLMA 1W9OA 2RRLA 2VX2A 3Q7HA 1XZ9A 2L97A 5EZBA 3PDZA 1UEWA 3QJNA 3V8VA 2HW5A 2IEXA 1Q51A 2AWWA 3GVLA 4FGMA 1D5GA 2EJ5A 2M0TA 4NMPA 1I16A 3TVUA 3BEZA 3QIKA 3CH8A 2EDZA 2V1WA 4NMSA 3ST9A 1RJNA 3U9RB 3KTIA 5MGBA 2KRGA 4KFVA 4RI0A 2RCZA 2VZ5A 2H3LA 1DUBA 4OEOA 3NJDA 1WFGA 3RL8A 4JJ3A 1EF8A 4ZDFA 3OT6A 3QKAA 2VRFA 3OIZA 2DEOA 4RYFH 3V5IA 2CWWA 1X45A 3T88A 1GQ4A 3TSZA 2J5II 3RSTA 1KWAA 2CSJA 5CTCA 2HE4A 4Q2OA 2BZRA 5HFCA 3STAA 4N6XA 2DAZA 5DTWA 2X58A 1V5LA 3ID3A 2L4SA 1T6RA 2VSUC 2F9YB 3QK8A 1QAUA 1WI4A 4Z33A 1H4XA 2EHRA 2F5YA 4GM2A 2JREA 4HC8A 5JBWA 1OBZA 4KFWA 1PJHA 3Q1TA 5DU8A 3NCVA 5HFEA 2DM8A 2OMJA 2KYLA 3SLLA 2I04A 2JILA 5DUCA 1SOZA 5KDRA 1WHDA 2ZL0A 2J5GD 5DUFA 4JFCA 3EGGC 1XNVA 4QIJA 3OMEA 1X6DA 4DGHA 2O2TA 1UHPA 4K3WA 2LOBA 1QAVB 3LDFA 1UYVA 1WDMA 1J7XA 2W3PA 3H0JA 1MC7A 4I52A 4L8NA 3FF6A 4YYXA 2EJYA 3CBZA 2ZPMA 5EYZA 1UEZA 1W2XA 3O46A 2B78A 4LMMA 3PZKA 3LKEA 3R0OA 2KJPA 1HF2A 1O8UA 1WI2A 1U37A 4FB8A 1OBXA 3VQFA 3TSVA 5IL9A 5G1SA 5EZ0A 3KZDA 3ZTBA 3ZW9A 2M0ZA 1VJ6A 3GDSA 2DLSA 1TIDB 4JOJA 1UEPA 1WZ8A 4JJTA 4RYFA 2QQ3A 5CTBA 1TILB 4JCQA 1ON9A 5FHTA 1H4YA 3Q0JA 3R0HA 2JWEA 2QKVA 1TP5A 3LAOA 4NMOA 4ZU2A 2I4SA 2FN5A 2DMZA 3R9SA 1V1TA 3ISAA 2KBSA 1UJUA 4ASIA 4I4ZA 3ID4A 3IB9A 1X5QA 5HFFA 4JCRA 4OG1A 3R9TA 2EEGA 2PA1A 2ZO9B 2PPYA 2WL7A 3OTPA 3K1RA 4JWVA 2EDVA 2DKRA 2AINA 3IF5A 2DJTA 2KG2A 3RLEA 4FZWC 1QLCA 1WG6A 3G64A 1YG6A 2ZL2A 3FDUA 1NZYB 1U39A 1V0EA 2D90A 2J5SA 1Z87A 2JIKA 1RGRA 3LLOA 3I18A 2KJDA 2VSPA 3TV5A 3GJ9A 1T2MA 2DLUA 3AGDA 3QREA 3GKBA 3LKLA 1WHAA 4Q6SA 4DGFA 1HNOA 2EAQA 2W7RA 4MI2A 4Q2QA 1R6JA 4HDTA 2YUYA 1X5RA 5E0NX 3TZ3A 4P0CA 2R4HA 2VPHA 3VQGA 3P5MA 1TQ3A 2OZFA 2REYA 5HEDA 3PEAA 1NTEA 3GF7A 4RCNA 3BPUA 2DB5A
chains in the Genus database with same CATH topology
4JVTA 4NXQA 4JOPA 1P1DA 4AMHA 2QKTA 1YG8A 5HJ1A 4Q1IA 3TRRA 1JXZA 2KOJA 4U0HA 4HOPA 1MJ3A 3AXAA 5E11A 4E34A 1XO6A 4JORA 3STJA 2I1NA 2KOMA 4UU6A 3FY5A 2ZL3A 1N6EA 2PDZA 1Y7OA 3R9QA 3HINA 2D8IA 2EEIA 4DI1A 2M0VA 5ILBA 3P85A 1UFXA 2Z17A 5HDYA 4OMRA 4K72A 4YLHA 2FCFA 4GHNA 3IAVA 3NFLA 4K6YA 4Q2PA 3CYYA 3TT6A 5F3XA 3DUPA 3NFKA 4NMVA 3ZWAA 1N7EA 5G1EA 1FC6A 2ZPLA 3TSWA 1G9OA 5HFDA 3PGQA 3OC7A 3PE8A 1N6FA 3O5NA 2C8TA 2E7KA 2M3MA 2KQFA 5C9GA 3RRVA 5GLJA 2LUIA 2Q9VA 3K50A 2EGNA 2K1ZA 4Q0GA 3TT7A 2VSSF 1U3BA 5HF1A 3ID1A 5E21A 2D92A 4NMQA 2LA8A 5F67A 2F9YA 1UJDA 4EMPA 1FC7A 1OD4A 2X7ZA 5E22A 2M0UA 1K32A 3QGLA 3T3WA 1UF1A 2KPKA 4K76A 5HUQA 5IKLB 1Y8TA 3H81A 3WKLA 1N99A 2Q3GA 3WKMA 3KZEA 3I47A 3QWDA 3GCNA 1UIYA 4IZDA 2OCSA 2IWOA 1M5ZA 2EEHA 4KPKA 2PG8A 1QAVA 2MHOA 4QFEA 1TP3A 4GVCA 4ELXA 3D03A 1I92A 4IZCA 4ZDDA 5JXBA 4FJWD 5DTPA 1OZIA 2X24A 3L3SA 1OBYA 3VIVA 4U0GH 3SFJA 2YT8A 2PKTA 3I4WA 1UM7A 1N7TA 1X0UA 5FUSA 4ELWA 1EF9A 4HNKA 2I6VA 4U19A 1TG6A 3KTJA 4U18A 3PV2A 2F6IA 5B6LA 1VCWA 4NMRA 4K2NA 1LCYA 3QMJA 4ZDEA 2JINA 3OU0A 3KQFA 1WJLA 2LC7A 1KEFA 2V90A 3ZW8A 4JOHA 3SUZA 1V5QA 1BE9A 3HE2A 4MPAA 3GF3A 2I0IA 4QIIA 2J5GA 3KHFA 3LNXA 3H02A 4REYA 2L4TA 2DXLA 3SWXA 3QYRA 4K29A 4OAJA 3DJ1A 3H0SA 2OGPA 2A7KA 2ZQRA 5DU6A 4L1CA 3E17A 2ZOAA 4EDJA 4JYLA 4Q3HA 3HPMA 3GCOA 1WF7A 3GMFA 1NF3C 3T89A 5INFA 4JOEA 4FN8A 3ZWBA 1NZYA 3QE1A 2VSSA 2Q35A 4WCZA 4K78A 4YDPA 3BPTA 1DCIA 3H0QA 2UZFA 2QG1A 1Q7XA 2KA9A 1WDKA 1PDRA 5E6PB 3BPPA 2VSUF 4IZBA 5DU4A 3PV4A 2CBYA 4B3IA 3CBXA 5HEBA 1WFVA 4NXPA 1SOTA 1SZOA 2YT7A 4ELSA 3HPKA 3MOYA 3R6HA 4KD6A 3R68A 2EEJA 4U0GA 4WZ8B 3RL7A 1UYRA 3N6RB 3TDCA 1VRGA 5C90A 5GNDA 4WYTA 2GEFA 4UU5A 3H0UA 1ZUBA 2AWXA 3TLFA 1HZDA 2A81A 5HF4A 2ZQQA 2FE5A 1BPLA 1Q52A 3GABA 3KTKA 2H2CA 1MFLA 4JOGA 4Q6HA 4FLNA 4JC0A 1XNWA 1L6OA 2OSGA 4WYOB 2F9IB 2KL1A 4NMTA 3M6NA 2JXOA 2YUBA 4LK5A 1X5NA 3V5EA 5I7ZA 2J5IB 5DKPA 4EMMA 2DUBA 4L6WA 1IU0A 5G1RA 3B76A 3QO6A 5INGA 5E0SH 2EGKA 3R69A 4FNDA 1RJMA 2CSSA 1UEQA 5HFBA 2OQSA 2RRMA 3QXZA 1RY4A 3ID2A 3KDGA 3GMAA 1VB7A 3DORA 5DZKA 4O06A 4OEPA 3KTHA 2EV8A 4Z8JA 1V6BA 4IC6A 2AWUA 2QT5A 2KOHA 3T8AA 2VREA 2Q2XA 2PZDA 1UM1A 3P2LA 4Z0MA 3DJAA 3Q0GA 5G1QA 2FZSA 2GTRA 4PQWA 3GGEA 1RGWA 2VSSE 1TE0A 2WTBA 2ZL4A 4JOTA 2KV8A 4FNBA 3DIWA 1VA8A 1X9ZA 5G1DA 2A7SA 4NNLA 4JL7A 1HNUA 4JCTA 3HVQC 2F0AA 2Z9IA 4R2ZA 1N7FA 3QXIA 2CS5A 2G2LA 3TMHA 2EDPA 3K8XA 2VSUA 2FW2A 2DC2A 5DTHA 3MOGA 1W9EA 1U38A 4G2RA 3JXTA 4WYUA 1UYTA 1Q3OA 1RZXA 4E3BA 3U9SB 3TVWA 2YTWA 1SG4A 4NXRA 3ZWCA 1XNYA 4JYJA 3MH4A 5HEYA 3M6MA 5HETA 5E0SA 5H3JA 2FNEA 2MX6A 1V62A 2Q34A 4P2AB 5KDRB 3EGHC 3KTGA 3LNYA 4XHVA 4NEKA 1YBOA 5B42A 1TYFA 1Y7NA 1IU2A 4EMLA 2QBWA 1UJVA 3GSLA 5E1YA 3PDVA 3BF0A 3PS4A 5INIA 5D13A 2OS6A 4NNMA 2OPGA 1WH1A 1WDLA 2H3MA 2UZCA 2JSNA 4MOUA 3I1EA 3MYBA 4K75A 3ZRTA 1P1EA 5A2PA 4JOKA 4F8KA 1X8SA 4AEJA 2R3YA 4H11A 1UITA 2DXNA 4KNPA 2K20A 3DJ3A 2VSVA 3SOEA 4B3HA 1N6DA 3MH6A 1XX4A 2HGAA 4J2UA 3L4FD 4E35A 3HLN1 3MT6A 3T8BA 2EGOA 2IWQA 2F6QA 3QDOA 1Z86A 2GZVA 5FIFA 4JOFA 3K82A 3NJBA 5DZKH 3CC0A 1GM1A 4FN7A 4U1AA 3U9TB 1KY9A 2FBMA 4FZWA 2W4FA 3PV5A 1VAEA 3NGHA 4OLQA 2VSUE 3HRXA 3HP0A 4NNQA 2NP9A 2M10A 1MFGA 3GDVA 1EY3A 1ON3A 2IWNA 4L8KA 3MFMA 1Q3PA 2BYGA 3MH7A 4I42A 1GQ5A 1OD2A 2KJKA 4KWBA 5JBXA 2KPLA 1FC9A 2PNTA 3CS0A 3IBBA 2EXGA 2PKUA 4JSBA 3SHUA 4NARA 1BFEA 1B8QA 3CBYA 2LC6A 4G69A 4ZDBA 1UYSA 3QJMA 2D3TA 2KAWA 1FCFA 1K39A 3RSIA 2PBPA 5KJPA 5FB8C 3GHFA 2JOAA 2F9IA 4AE2A 2YJGA 4Q2NA 2ENOA 2I0LA 3KDKA 2J5IA 2QKUA 4MXIA 2VWRA 4JJ0A 1WIFA 3GDUA 3JU1A 1W9QA 2H2BA 2IWPA 4JCSA 4ZDCA 2P3WA 2HE2A 4GVDA 4B3JA 2G5MB 4HOPB 5DL1A 3WG5A 4F47A 1ZOKA 1IHJA 1WF8A 1PIXA 2CE3A 3SHWA 3GLMA 1W9OA 2RRLA 2VX2A 3Q7HA 1XZ9A 2L97A 3PDZA 1UEWA 3QJNA 2HW5A 2IEXA 1Q51A 2AWWA 4FGMA 1D5GA 2EJ5A 2M0TA 4NMPA 1I16A 3TVUA 3BEZA 3QIKA 3CH8A 2EDZA 2V1WA 4NMSA 3ST9A 1RJNA 3U9RB 3KTIA 5MGBA 2KRGA 4KFVA 4RI0A 2RCZA 2VZ5A 2H3LA 1DUBA 4OEOA 3NJDA 1WFGA 3RL8A 4JJ3A 1EF8A 4ZDFA 3OT6A 3QKAA 2VRFA 4RYFH 2DEOA 3V5IA 1X45A 3T88A 1GQ4A 3TSZA 2J5II 3RSTA 1KWAA 2CSJA 5CTCA 2HE4A 4Q2OA 2BZRA 5HFCA 3STAA 4N6XA 2DAZA 5DTWA 2X58A 1V5LA 3ID3A 2L4SA 2VSUC 2F9YB 3QK8A 1QAUA 1WI4A 4Z33A 4HC8A 2EHRA 2F5YA 4GM2A 2JREA 5JBWA 1OBZA 4KFWA 1PJHA 3Q1TA 5DU8A 3NCVA 5HFEA 2DM8A 2OMJA 2KYLA 3SLLA 2I04A 2JILA 5DUCA 1SOZA 5KDRA 1WHDA 2ZL0A 2J5GD 5DUFA 4JFCA 3EGGC 1XNVA 4QIJA 3OMEA 1X6DA 2O2TA 1UHPA 4K3WA 2LOBA 1QAVB 1UYVA 1WDMA 1J7XA 2W3PA 3H0JA 1MC7A 4I52A 4L8NA 3FF6A 4YYXA 2EJYA 3CBZA 2ZPMA 5EYZA 1UEZA 1W2XA 3O46A 4LMMA 3PZKA 3LKEA 3R0OA 2KJPA 1O8UA 1WI2A 1U37A 4FB8A 1OBXA 3VQFA 3TSVA 5IL9A 5G1SA 5EZ0A 3KZDA 3ZW9A 2M0ZA 1VJ6A 3GDSA 2DLSA 1WZ8A 4JOJA 1UEPA 4JJTA 5CTBA 4RYFA 2QQ3A 4JCQA 1ON9A 5FHTA 3Q0JA 3R0HA 2JWEA 2QKVA 1TP5A 3LAOA 4NMOA 4ZU2A 2I4SA 2FN5A 2DMZA 3R9SA 1V1TA 3ISAA 2KBSA 1UJUA 4ASIA 4I4ZA 3ID4A 3IB9A 1X5QA 5HFFA 4JCRA 4OG1A 3R9TA 2EEGA 2PA1A 2ZO9B 2PPYA 2WL7A 3OTPA 3K1RA 4JWVA 2EDVA 2DKRA 2AINA 2DJTA 2KG2A 3RLEA 4FZWC 1QLCA 1WG6A 3G64A 1YG6A 2ZL2A 3FDUA 1NZYB 1U39A 2D90A 2J5SA 1Z87A 2JIKA 1RGRA 3I18A 2KJDA 2VSPA 3TV5A 3GJ9A 1T2MA 2DLUA 3QREA 3GKBA 1WHAA 4Q6SA 1HNOA 2EAQA 2W7RA 4MI2A 4Q2QA 1R6JA 4HDTA 2YUYA 1X5RA 5E0NX 3TZ3A 4P0CA 2R4HA 2VPHA 3VQGA 3P5MA 1TQ3A 2OZFA 2REYA 5HEDA 3PEAA 1NTEA 3GF7A 4RCNA 3BPUA 2DB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVT A;  4NXQ A;  4JOP A;  1P1D A;  4AMH A;  2QKT A;  1YG8 A;  5HJ1 A;  4Q1I A;  3TRR A;  1JXZ A;  2KOJ A;  4U0H A;  4HOP A;  1MJ3 A;  3AXA A;  5E11 A;  4E34 A;  1XO6 A;  4JOR A;  3STJ A;  2I1N A;  2KOM A;  4UU6 A;  3FY5 A;  2ZL3 A;  1N6E A;  2PDZ A;  1Y7O A;  3R9Q A;  3HIN A;  2D8I A;  2EEI A;  4DI1 A;  2M0V A;  3P85 A;  1UFX A;  2Z17 A;  5HDY A;  4OMR A;  4K72 A;  4YLH A;  2FCF A;  4GHN A;  3IAV A;  3NFL A;  4K6Y A;  4Q2P A;  3CYY A;  3TT6 A;  5F3X A;  3NFK A;  4NMV A;  3ZWA A;  1N7E A;  5G1E A;  1FC6 A;  2ZPL A;  3TSW A;  1G9O A;  5HFD A;  3PGQ A;  3OC7 A;  3PE8 A;  1N6F A;  3O5N A;  2C8T A;  2E7K A;  2M3M A;  2KQF A;  5C9G A;  3RRV A;  5GLJ A;  2LUI A;  2Q9V A;  3K50 A;  2EGN A;  2K1Z A;  4Q0G A;  3TT7 A;  2VSS F;  1U3B A;  5HF1 A;  3ID1 A;  5E21 A;  2D92 A;  4NMQ A;  2LA8 A;  5F67 A;  2F9Y A;  1UJD A;  4EMP A;  1FC7 A;  1OD4 A;  2X7Z A;  5E22 A;  2M0U A;  1K32 A;  3QGL A;  3T3W A;  1UF1 A;  2KPK A;  4K76 A;  5IKL B;  1Y8T A;  3H81 A;  3WKL A;  1N99 A;  2Q3G A;  3WKM A;  3KZE A;  3I47 A;  3QWD A;  3GCN A;  1UIY A;  4IZD A;  2OCS A;  2IWO A;  1M5Z A;  2EEH A;  4KPK A;  2PG8 A;  1QAV A;  2MHO A;  4QFE A;  1TP3 A;  4GVC A;  4ELX A;  1I92 A;  4IZC A;  4ZDD A;  5JXB A;  4FJW D;  5DTP A;  1OZI A;  2X24 A;  3L3S A;  1OBY A;  3VIV A;  4U0G H;  3SFJ A;  2YT8 A;  2PKT A;  3I4W A;  1UM7 A;  1N7T A;  1X0U A;  5FUS A;  4ELW A;  1EF9 A;  4HNK A;  2I6V A;  4U19 A;  1TG6 A;  3KTJ A;  4U18 A;  3PV2 A;  2F6I A;  5B6L A;  1VCW A;  4NMR A;  4K2N A;  1LCY A;  3QMJ A;  4ZDE A;  2JIN A;  3OU0 A;  3KQF A;  1WJL A;  2LC7 A;  1KEF A;  2V90 A;  3ZW8 A;  4JOH A;  3SUZ A;  1V5Q A;  1BE9 A;  3HE2 A;  4MPA A;  3GF3 A;  2I0I A;  4QII A;  2J5G A;  3KHF A;  3LNX A;  3H02 A;  4REY A;  2L4T A;  3SWX A;  3QYR A;  4K29 A;  4OAJ A;  3DJ1 A;  3H0S A;  2OGP A;  2A7K A;  2ZQR A;  5DU6 A;  3E17 A;  4EDJ A;  4JYL A;  4Q3H A;  3HPM A;  3GCO A;  1WF7 A;  3T89 A;  1NF3 C;  5INF A;  4JOE A;  4FN8 A;  3ZWB A;  1NZY A;  3QE1 A;  2VSS A;  2Q35 A;  4WCZ A;  4K78 A;  4YDP A;  1DCI A;  3H0Q A;  2UZF A;  2QG1 A;  1Q7X A;  2KA9 A;  1WDK A;  1PDR A;  5E6P B;  3BPP A;  2VSU F;  4IZB A;  5DU4 A;  3PV4 A;  2CBY A;  4B3I A;  3CBX A;  5HEB A;  1WFV A;  4NXP A;  1SOT A;  1SZO A;  2YT7 A;  4ELS A;  3HPK A;  3MOY A;  3R6H A;  4KD6 A;  3R68 A;  2EEJ A;  4U0G A;  4WZ8 B;  3RL7 A;  1UYR A;  3N6R B;  3TDC A;  1VRG A;  5C90 A;  5GND A;  4WYT A;  4UU5 A;  3H0U A;  1ZUB A;  2AWX A;  3TLF A;  1HZD A;  2A81 A;  5HF4 A;  2ZQQ A;  2FE5 A;  1Q52 A;  3KTK A;  2H2C A;  1MFL A;  4JOG A;  4Q6H A;  1XNW A;  4WYO B;  1L6O A;  2OSG A;  2F9I B;  2KL1 A;  4NMT A;  3M6N A;  2JXO A;  2YUB A;  4LK5 A;  1X5N A;  3V5E A;  5I7Z A;  2J5I B;  5DKP A;  4EMM A;  2DUB A;  4L6W A;  1IU0 A;  5G1R A;  3B76 A;  3QO6 A;  5ING A;  5E0S H;  2EGK A;  3R69 A;  4FND A;  1RJM A;  2CSS A;  1UEQ A;  5HFB A;  2OQS A;  2RRM A;  3QXZ A;  1RY4 A;  3ID2 A;  3GMA A;  1VB7 A;  3DOR A;  5DZK A;  4O06 A;  4OEP A;  3KTH A;  2EV8 A;  4Z8J A;  1V6B A;  4IC6 A;  2AWU A;  2QT5 A;  2KOH A;  3T8A A;  2VRE A;  2Q2X A;  2PZD A;  1UM1 A;  3P2L A;  4Z0M A;  3DJA A;  3Q0G A;  5G1Q A;  2FZS A;  2GTR A;  4PQW A;  3GGE A;  1RGW A;  2VSS E;  1TE0 A;  2WTB A;  2ZL4 A;  4JOT A;  2KV8 A;  4FNB A;  3DIW A;  1VA8 A;  5G1D A;  2A7S A;  4NNL A;  4JL7 A;  1HNU A;  4JCT A;  3HVQ C;  2F0A A;  2Z9I A;  4R2Z A;  1N7F A;  3QXI A;  2CS5 A;  2G2L A;  3TMH A;  2EDP A;  3K8X A;  2VSU A;  2FW2 A;  2DC2 A;  5DTH A;  1W9E A;  1U38 A;  4G2R A;  3JXT A;  4WYU A;  1UYT A;  1Q3O A;  1RZX A;  4E3B A;  3U9S B;  3TVW A;  2YTW A;  1SG4 A;  4NXR A;  3ZWC A;  1XNY A;  4JYJ A;  3MH4 A;  5HEY A;  3M6M A;  5HET A;  5E0S A;  5H3J A;  2FNE A;  2MX6 A;  1V62 A;  2Q34 A;  4P2A B;  5KDR B;  3EGH C;  3KTG A;  3LNY A;  4XHV A;  4NEK A;  1YBO A;  1TYF A;  1Y7N A;  1IU2 A;  4EML A;  2QBW A;  1UJV A;  3GSL A;  5E1Y A;  3PDV A;  3BF0 A;  3PS4 A;  5INI A;  5D13 A;  2OS6 A;  4NNM A;  2OPG A;  1WH1 A;  1WDL A;  2H3M A;  2UZC A;  4MOU A;  3I1E A;  3MYB A;  4K75 A;  3ZRT A;  1P1E A;  5A2P A;  4JOK A;  4F8K A;  1X8S A;  2R3Y A;  4H11 A;  1UIT A;  4KNP A;  2K20 A;  3DJ3 A;  2VSV A;  3SOE A;  4B3H A;  1N6D A;  3MH6 A;  1XX4 A;  2HGA A;  3L4F D;  4E35 A;  3HLN 1;  3MT6 A;  3T8B A;  2EGO A;  2IWQ A;  2F6Q A;  3QDO A;  1Z86 A;  2GZV A;  5FIF A;  4JOF A;  3K82 A;  3NJB A;  5DZK H;  3CC0 A;  1GM1 A;  4FN7 A;  4U1A A;  3U9T B;  1KY9 A;  2FBM A;  4FZW A;  2W4F A;  3PV5 A;  1VAE A;  3NGH A;  4OLQ A;  2VSU E;  3HRX A;  3HP0 A;  4NNQ A;  2NP9 A;  2M10 A;  1MFG A;  3GDV A;  1EY3 A;  1ON3 A;  2IWN A;  4L8K A;  3MFM A;  1Q3P A;  2BYG A;  3MH7 A;  4I42 A;  1GQ5 A;  1OD2 A;  2KJK A;  4KWB A;  5JBX A;  2KPL A;  1FC9 A;  2PNT A;  3CS0 A;  3IBB A;  2EXG A;  2PKU A;  4JSB A;  3SHU A;  1BFE A;  1B8Q A;  3CBY A;  2LC6 A;  4G69 A;  4ZDB A;  1UYS A;  3QJM A;  2D3T A;  2KAW A;  1FCF A;  1K39 A;  3RSI A;  2PBP A;  5KJP A;  5FB8 C;  2F9I A;  2JOA A;  4Q2N A;  2ENO A;  2I0L A;  2J5I A;  2QKU A;  4MXI A;  2VWR A;  1WIF A;  3GDU A;  3JU1 A;  1W9Q A;  2H2B A;  2IWP A;  4JCS A;  4ZDC A;  2P3W A;  2HE2 A;  4GVD A;  4B3J A;  2G5M B;  4HOP B;  5DL1 A;  3WG5 A;  4F47 A;  1ZOK A;  1IHJ A;  1WF8 A;  1PIX A;  2CE3 A;  3SHW A;  3GLM A;  1W9O A;  2VX2 A;  3Q7H A;  1XZ9 A;  2L97 A;  3PDZ A;  1UEW A;  3QJN A;  2HW5 A;  2IEX A;  1Q51 A;  2AWW A;  4FGM A;  1D5G A;  2EJ5 A;  2M0T A;  4NMP A;  1I16 A;  3TVU A;  3BEZ A;  3QIK A;  3CH8 A;  2EDZ A;  2V1W A;  4NMS A;  3ST9 A;  1RJN A;  3U9R B;  3KTI A;  5MGB A;  2KRG A;  4KFV A;  4RI0 A;  2RCZ A;  2VZ5 A;  2H3L A;  1DUB A;  4OEO A;  3NJD A;  1WFG A;  3RL8 A;  1EF8 A;  4ZDF A;  3OT6 A;  3QKA A;  2VRF A;  4RYF H;  2DEO A;  3V5I A;  1X45 A;  3T88 A;  1GQ4 A;  3TSZ A;  2J5I I;  3RST A;  1KWA A;  2CSJ A;  5CTC A;  2HE4 A;  4Q2O A;  2BZR A;  5HFC A;  3STA A;  4N6X A;  2DAZ A;  5DTW A;  2X58 A;  1V5L A;  3ID3 A;  2L4S A;  2VSU C;  2F9Y B;  3QK8 A;  1QAU A;  1WI4 A;  4Z33 A;  4HC8 A;  2EHR A;  2F5Y A;  4GM2 A;  2JRE A;  5JBW A;  1OBZ A;  4KFW A;  1PJH A;  3Q1T A;  5DU8 A;  5HFE A;  2DM8 A;  2OMJ A;  2KYL A;  3SLL A;  2I04 A;  2JIL A;  5DUC A;  1SOZ A;  5KDR A;  1WHD A;  2ZL0 A;  2J5G D;  5DUF A;  4JFC A;  3EGG C;  1XNV A;  4QIJ A;  3OME A;  1X6D A;  2O2T A;  1UHP A;  4K3W A;  2LOB A;  1QAV B;  1UYV A;  1WDM A;  1J7X A;  2W3P A;  3H0J A;  1MC7 A;  4I52 A;  4L8N A;  3FF6 A;  4YYX A;  2EJY A;  3CBZ A;  2ZPM A;  5EYZ A;  1UEZ A;  1W2X A;  3O46 A;  4LMM A;  3PZK A;  3LKE A;  3R0O A;  2KJP A;  1O8U A;  1WI2 A;  1U37 A;  4FB8 A;  1OBX A;  3VQF A;  3TSV A;  5G1S A;  5EZ0 A;  3KZD A;  3ZW9 A;  2M0Z A;  1VJ6 A;  3GDS A;  2DLS A;  1WZ8 A;  4JOJ A;  1UEP A;  4JJT A;  5CTB A;  4RYF A;  2QQ3 A;  4JCQ A;  1ON9 A;  5FHT A;  3Q0J A;  3R0H A;  2JWE A;  2QKV A;  1TP5 A;  3LAO A;  4NMO A;  4ZU2 A;  2I4S A;  2FN5 A;  2DMZ A;  3R9S A;  1V1T A;  3ISA A;  2KBS A;  1UJU A;  4ASI A;  4I4Z A;  3ID4 A;  3IB9 A;  1X5Q A;  5HFF A;  4JCR A;  4OG1 A;  3R9T A;  2EEG A;  2PA1 A;  2PPY A;  2WL7 A;  3OTP A;  3K1R A;  4JWV A;  2EDV A;  2DKR A;  2AIN A;  2DJT A;  2KG2 A;  3RLE A;  4FZW C;  1QLC A;  1WG6 A;  3G64 A;  1YG6 A;  2ZL2 A;  3FDU A;  1NZY B;  1U39 A;  2D90 A;  2J5S A;  1Z87 A;  2JIK A;  1RGR A;  3I18 A;  2KJD A;  2VSP A;  3TV5 A;  3GJ9 A;  1T2M A;  2DLU A;  3QRE A;  3GKB A;  1WHA A;  4Q6S A;  1HNO A;  2EAQ A;  2W7R A;  4MI2 A;  4Q2Q A;  1R6J A;  2YUY A;  1X5R A;  5E0N X;  3TZ3 A;  4P0C A;  2R4H A;  2VPH A;  3VQG A;  3P5M A;  1TQ3 A;  2OZF A;  2REY A;  5HED A;  3PEA A;  1NTE A;  3GF7 A;  4RCN A;  3BPU A;  2DB5 A; 
#chains in the Genus database with same CATH topology
 4JVT A;  4NXQ A;  4JOP A;  1P1D A;  4AMH A;  2QKT A;  1YG8 A;  5HJ1 A;  4Q1I A;  3TRR A;  1JXZ A;  2KOJ A;  4U0H A;  4HOP A;  1MJ3 A;  3AXA A;  5E11 A;  4E34 A;  1XO6 A;  4JOR A;  3STJ A;  2I1N A;  2KOM A;  4UU6 A;  3FY5 A;  2ZL3 A;  1N6E A;  2PDZ A;  1Y7O A;  3R9Q A;  3OIR A;  3HIN A;  2D8I A;  2EEI A;  4DI1 A;  2VY9 A;  2M0V A;  5ILB A;  3P85 A;  1UFX A;  2Z17 A;  5HDY A;  4OMR A;  4K72 A;  4YLH A;  2FCF A;  4GHN A;  3IAV A;  3NFL A;  4K6Y A;  4Q2P A;  3CYY A;  3TT6 A;  5F3X A;  3DUP A;  3NFK A;  4NMV A;  3ZWA A;  1N7E A;  5G1E A;  3AGE A;  1FC6 A;  2ZPL A;  3TSW A;  1G9O A;  5HFD A;  3PGQ A;  3OC7 A;  3PE8 A;  1N6F A;  3O5N A;  2C8T A;  2E7K A;  2M3M A;  2KQF A;  5C9G A;  3RRV A;  5GLJ A;  2LUI A;  2Q9V A;  3K50 A;  2EGN A;  2K1Z A;  4Q0G A;  3TT7 A;  2VSS F;  1U3B A;  5HF1 A;  3ID1 A;  5E21 A;  2D92 A;  4NMQ A;  2LA8 A;  5F67 A;  2F9Y A;  1UJD A;  4EMP A;  1FC7 A;  1OD4 A;  2X7Z A;  5E22 A;  2M0U A;  1K32 A;  3QGL A;  3T3W A;  1UF1 A;  2KPK A;  4K76 A;  5HUQ A;  5IKL B;  1Y8T A;  5EUW A;  3H81 A;  3WKL A;  1N99 A;  2Q3G A;  3WKM A;  3KZE A;  3I47 A;  3QWD A;  3GCN A;  1UIY A;  4IZD A;  2OCS A;  2IWO A;  1M5Z A;  2EEH A;  4KPK A;  2PG8 A;  1QAV A;  2MHO A;  3D3U A;  4QFE A;  1TP3 A;  4GVC A;  4ELX A;  3D03 A;  1SBO A;  1I92 A;  4IZC A;  4ZDD A;  2AS0 A;  5JXB A;  4FJW D;  5EUX A;  5DTP A;  1OZI A;  2X24 A;  3L3S A;  3EH7 A;  1OBY A;  3VIV A;  2OAS A;  4U0G H;  3SFJ A;  2YT8 A;  2PKT A;  3I4W A;  1UM7 A;  1N7T A;  1X0U A;  5FUS A;  4ELW A;  1EF9 A;  4HNK A;  2I6V A;  4U19 A;  1WXW A;  1TG6 A;  3KTJ A;  1AUZ A;  4U18 A;  3PV2 A;  2F6I A;  5B6L A;  1VCW A;  4NMR A;  4K2N A;  1LCY A;  3QMJ A;  4ZDE A;  2JIN A;  3OU0 A;  3KQF A;  1WJL A;  2LC7 A;  1KEF A;  2V90 A;  3ZW8 A;  4JOH A;  3SUZ A;  1V5Q A;  1BE9 A;  3HE2 A;  4MPA A;  3GF3 A;  2I0I A;  4QII A;  2J5G A;  3KHF A;  3LNX A;  3H02 A;  4REY A;  2L4T A;  2DXL A;  3SWX A;  3QYR A;  3ZXN A;  4K29 A;  4OAJ A;  3MGL A;  3DJ1 A;  3H0S A;  2OGP A;  2A7K A;  2ZQR A;  5DU6 A;  1WXX A;  4L1C A;  3E17 A;  2ZOA A;  4EDJ A;  4HIZ A;  1TH8 B;  4JYL A;  4Q3H A;  3HPM A;  3GCO A;  1WF7 A;  3GMF A;  1NF3 C;  3VSE A;  3T89 A;  5INF A;  4JOE A;  4FN8 A;  3ZWB A;  1NZY A;  3QE1 A;  2VSS A;  2Q35 A;  4WCZ A;  4K78 A;  4YDP A;  3BPT A;  1DCI A;  3H0Q A;  2UZF A;  2QG1 A;  1Q7X A;  2KA9 A;  1WDK A;  1PDR A;  3T6O A;  1H4Z A;  5E6P B;  3IH8 A;  3BPP A;  3NY7 A;  2VSU F;  4IZB A;  5DU4 A;  3PV4 A;  2CBY A;  4B3I A;  3CBX A;  5HEB A;  1WFV A;  4NXP A;  1SOT A;  1SZO A;  2YT7 A;  4ELS A;  3HPK A;  3MOY A;  3QDQ A;  3R6H A;  4KD6 A;  3R68 A;  2EEJ A;  4U0G A;  4WZ8 B;  3RL7 A;  1UYR A;  3N6R B;  3TDC A;  1VRG A;  5C90 A;  5GND A;  4WYT A;  2GEF A;  4UU5 A;  3H0U A;  1ZUB A;  2AWX A;  3TLF A;  3JU4 A;  1HZD A;  2A81 A;  5HF4 A;  1V0F A;  2FE5 A;  2ZQQ A;  1BPL A;  1Q52 A;  3GAB A;  3KTK A;  2H2C A;  1MFL A;  4JOG A;  4Q6H A;  4FLN A;  4JC0 A;  1XNW A;  1L6O A;  2OSG A;  4WYO B;  2F9I B;  2KL1 A;  4NMT A;  3M6N A;  2JXO A;  2YUB A;  4LK5 A;  1X5N A;  3V5E A;  5I7Z A;  2J5I B;  5DKP A;  4EMM A;  2DUB A;  4L6W A;  3GVK A;  1IU0 A;  5G1R A;  3B76 A;  3QO6 A;  5ING A;  5E0S H;  2EGK A;  3R69 A;  4FND A;  1RJM A;  2CSS A;  1UEQ A;  5HFB A;  2OQS A;  2RRM A;  3QXZ A;  1RY4 A;  3ID2 A;  3KDG A;  3GMA A;  4XS5 A;  1VB7 A;  3DOR A;  5DZK A;  4O06 A;  4OEP A;  2KA5 A;  3KTH A;  2EV8 A;  4Z8J A;  1V6B A;  4IC6 A;  2AWU A;  2QT5 A;  2KOH A;  3T8A A;  2VRE A;  1THN B;  2Q2X A;  2PZD A;  1UM1 A;  3P2L A;  4Z0M A;  3DJA A;  3Q0G A;  5G1Q A;  2FZS A;  2GTR A;  4PQW A;  3GGE A;  1RGW A;  2VSS E;  1TE0 A;  2WTB A;  2ZL4 A;  4JOT A;  2KV8 A;  4FNB A;  3DIW A;  1VA8 A;  1X9Z A;  5G1D A;  2A7S A;  4NNL A;  4JL7 A;  1HNU A;  4JCT A;  3HVQ C;  2F0A A;  2Z9I A;  4R2Z A;  1N7F A;  3QXI A;  2CS5 A;  1BUZ A;  2G2L A;  3TMH A;  2EDP A;  3K8X A;  2VSU A;  2FW2 A;  2DC2 A;  5DTH A;  3MOG A;  1W9E A;  1U38 A;  4G2R A;  3JXT A;  4WYU A;  1UYT A;  1Q3O A;  1RZX A;  4E3B A;  3U9S B;  3TVW A;  2YTW A;  1SG4 A;  4NXR A;  3ZWC A;  1XNY A;  4QTP A;  4JYJ A;  3MH4 A;  3F43 A;  5HEY A;  3M6M A;  5HET A;  5E0S A;  5H3J A;  2FNE A;  2MX6 A;  1V62 A;  2Q34 A;  4P2A B;  5KDR B;  3EGH C;  3KTG A;  3LNY A;  4XHV A;  4NEK A;  1YBO A;  5B42 A;  1TYF A;  1Y7N A;  1IU2 A;  5EUU A;  2QBW A;  4EML A;  1UJV A;  3GSL A;  5E1Y A;  3PDV A;  1VC1 A;  3PS4 A;  3BF0 A;  5D13 A;  5INI A;  3C0K A;  2OS6 A;  4NNM A;  2OPG A;  1WH1 A;  1WDL A;  2H3M A;  2KLN A;  2UZC A;  2JSN A;  4MOU A;  3I1E A;  3MYB A;  4K75 A;  3ZRT A;  1P1E A;  5A2P A;  4JOK A;  4F8K A;  1X8S A;  4AEJ A;  2R3Y A;  4H11 A;  1UIT A;  2DXN A;  4KNP A;  2K20 A;  3DJ3 A;  2VSV A;  3SOE A;  4B3H A;  1N6D A;  3MH6 A;  1XX4 A;  2HGA A;  4J2U A;  5EUS A;  3L4F D;  4E35 A;  3HLN 1;  3MT6 A;  3T8B A;  2EGO A;  2IWQ A;  2F6Q A;  3QDO A;  1Z86 A;  3GVJ A;  2GZV A;  5EUZ A;  5FIF A;  4JOF A;  3K82 A;  3NJB A;  5DZK H;  3CC0 A;  1GM1 A;  4FN7 A;  4U1A A;  3U9T B;  1KY9 A;  2FBM A;  4FZW A;  2W4F A;  3PV5 A;  1VAE A;  3NGH A;  4OLQ A;  2VSU E;  3HRX A;  3HP0 A;  4NNQ A;  2NP9 A;  2M10 A;  1MFG A;  3GDV A;  1EY3 A;  1ON3 A;  2IWN A;  4L8K A;  3MFM A;  1Q3P A;  2BYG A;  3MH7 A;  4I42 A;  1GQ5 A;  1OD2 A;  2KJK A;  4KWB A;  5JBX A;  2KPL A;  1FC9 A;  2PNT A;  3CS0 A;  4HYL A;  3IBB A;  2EXG A;  2PKU A;  4JSB A;  3SHU A;  4NAR A;  3GK7 A;  1BFE A;  1B8Q A;  3CBY A;  2LC6 A;  4G69 A;  4ZDB A;  1UYS A;  3IHA A;  3IHB A;  3QJM A;  3V97 A;  4DMG A;  2KAW A;  2D3T A;  1FCF A;  1K39 A;  3RSI A;  2PBP A;  5KJP A;  5FB8 C;  3GHF A;  2JOA A;  3IH9 A;  2F9I A;  4AE2 A;  2YJG A;  4Q2N A;  2ENO A;  2I0L A;  3KDK A;  2J5I A;  2QKU A;  4MXI A;  2VWR A;  4JJ0 A;  1WIF A;  3GDU A;  3JU1 A;  1W9Q A;  2H2B A;  2IWP A;  4JCS A;  4ZDC A;  2P3W A;  2HE2 A;  4GVD A;  4B3J A;  2G5M B;  4HOP B;  5DL1 A;  3WG5 A;  4F47 A;  1ZOK A;  1IHJ A;  1WF8 A;  1PIX A;  2CE3 A;  3SHW A;  3GLM A;  1W9O A;  2RRL A;  2VX2 A;  3Q7H A;  1XZ9 A;  2L97 A;  5EZB A;  3PDZ A;  1UEW A;  3QJN A;  3V8V A;  2HW5 A;  2IEX A;  1Q51 A;  2AWW A;  3GVL A;  4FGM A;  1D5G A;  2EJ5 A;  2M0T A;  4NMP A;  1I16 A;  3TVU A;  3BEZ A;  3QIK A;  3CH8 A;  2EDZ A;  2V1W A;  4NMS A;  3ST9 A;  1RJN A;  3U9R B;  3KTI A;  5MGB A;  2KRG A;  4KFV A;  4RI0 A;  2RCZ A;  2VZ5 A;  2H3L A;  1DUB A;  4OEO A;  3NJD A;  1WFG A;  3RL8 A;  4JJ3 A;  1EF8 A;  4ZDF A;  3OT6 A;  3QKA A;  2VRF A;  3OIZ A;  2DEO A;  4RYF H;  3V5I A;  2CWW A;  1X45 A;  3T88 A;  1GQ4 A;  3TSZ A;  2J5I I;  3RST A;  1KWA A;  2CSJ A;  5CTC A;  2HE4 A;  4Q2O A;  2BZR A;  5HFC A;  3STA A;  4N6X A;  2DAZ A;  5DTW A;  2X58 A;  1V5L A;  3ID3 A;  2L4S A;  1T6R A;  2VSU C;  2F9Y B;  3QK8 A;  1QAU A;  1WI4 A;  4Z33 A;  1H4X A;  2EHR A;  2F5Y A;  4GM2 A;  2JRE A;  4HC8 A;  5JBW A;  1OBZ A;  4KFW A;  1PJH A;  3Q1T A;  5DU8 A;  3NCV A;  5HFE A;  2DM8 A;  2OMJ A;  2KYL A;  3SLL A;  2I04 A;  2JIL A;  5DUC A;  1SOZ A;  5KDR A;  1WHD A;  2ZL0 A;  2J5G D;  5DUF A;  4JFC A;  3EGG C;  1XNV A;  4QIJ A;  3OME A;  1X6D A;  4DGH A;  2O2T A;  1UHP A;  4K3W A;  2LOB A;  1QAV B;  3LDF A;  1UYV A;  1WDM A;  1J7X A;  2W3P A;  3H0J A;  1MC7 A;  4I52 A;  4L8N A;  3FF6 A;  4YYX A;  2EJY A;  3CBZ A;  2ZPM A;  5EYZ A;  1UEZ A;  1W2X A;  3O46 A;  2B78 A;  4LMM A;  3PZK A;  3LKE A;  3R0O A;  2KJP A;  1HF2 A;  1O8U A;  1WI2 A;  1U37 A;  4FB8 A;  1OBX A;  3VQF A;  3TSV A;  5IL9 A;  5G1S A;  5EZ0 A;  3KZD A;  3ZTB A;  3ZW9 A;  2M0Z A;  1VJ6 A;  3GDS A;  2DLS A;  1TID B;  4JOJ A;  1UEP A;  1WZ8 A;  4JJT A;  4RYF A;  2QQ3 A;  5CTB A;  1TIL B;  4JCQ A;  1ON9 A;  5FHT A;  1H4Y A;  3Q0J A;  3R0H A;  2JWE A;  2QKV A;  1TP5 A;  3LAO A;  4NMO A;  4ZU2 A;  2I4S A;  2FN5 A;  2DMZ A;  3R9S A;  1V1T A;  3ISA A;  2KBS A;  1UJU A;  4ASI A;  4I4Z A;  3ID4 A;  3IB9 A;  1X5Q A;  5HFF A;  4JCR A;  4OG1 A;  3R9T A;  2EEG A;  2PA1 A;  2ZO9 B;  2PPY A;  2WL7 A;  3OTP A;  3K1R A;  4JWV A;  2EDV A;  2DKR A;  2AIN A;  3IF5 A;  2DJT A;  2KG2 A;  3RLE A;  4FZW C;  1QLC A;  1WG6 A;  3G64 A;  1YG6 A;  2ZL2 A;  3FDU A;  1NZY B;  1U39 A;  1V0E A;  2D90 A;  2J5S A;  1Z87 A;  2JIK A;  1RGR A;  3LLO A;  3I18 A;  2KJD A;  2VSP A;  3TV5 A;  3GJ9 A;  1T2M A;  2DLU A;  3AGD A;  3QRE A;  3GKB A;  3LKL A;  1WHA A;  4Q6S A;  4DGF A;  1HNO A;  2EAQ A;  2W7R A;  4MI2 A;  4Q2Q A;  1R6J A;  4HDT A;  2YUY A;  1X5R A;  5E0N X;  3TZ3 A;  4P0C A;  2R4H A;  2VPH A;  3VQG A;  3P5M A;  1TQ3 A;  2OZF A;  2REY A;  5HED A;  3PEA A;  1NTE A;  3GF7 A;  4RCN A;  3BPU A;  2DB5 A; 
#chains in the Genus database with same CATH homology
 4JVT A;  4NXQ A;  4JOP A;  1P1D A;  4AMH A;  2QKT A;  1YG8 A;  5HJ1 A;  4Q1I A;  3TRR A;  1JXZ A;  2KOJ A;  4U0H A;  4HOP A;  1MJ3 A;  3AXA A;  5E11 A;  4E34 A;  1XO6 A;  4JOR A;  3STJ A;  2I1N A;  2KOM A;  4UU6 A;  3FY5 A;  2ZL3 A;  1N6E A;  2PDZ A;  1Y7O A;  3R9Q A;  3HIN A;  2D8I A;  2EEI A;  4DI1 A;  2M0V A;  5ILB A;  3P85 A;  1UFX A;  2Z17 A;  5HDY A;  4OMR A;  4K72 A;  4YLH A;  2FCF A;  4GHN A;  3IAV A;  3NFL A;  4K6Y A;  4Q2P A;  3CYY A;  3TT6 A;  5F3X A;  3DUP A;  3NFK A;  4NMV A;  3ZWA A;  1N7E A;  5G1E A;  1FC6 A;  2ZPL A;  3TSW A;  1G9O A;  5HFD A;  3PGQ A;  3OC7 A;  3PE8 A;  1N6F A;  3O5N A;  2C8T A;  2E7K A;  2M3M A;  2KQF A;  5C9G A;  3RRV A;  5GLJ A;  2LUI A;  2Q9V A;  3K50 A;  2EGN A;  2K1Z A;  4Q0G A;  3TT7 A;  2VSS F;  1U3B A;  5HF1 A;  3ID1 A;  5E21 A;  2D92 A;  4NMQ A;  2LA8 A;  5F67 A;  2F9Y A;  1UJD A;  4EMP A;  1FC7 A;  1OD4 A;  2X7Z A;  5E22 A;  2M0U A;  1K32 A;  3QGL A;  3T3W A;  1UF1 A;  2KPK A;  4K76 A;  5HUQ A;  5IKL B;  1Y8T A;  3H81 A;  3WKL A;  1N99 A;  2Q3G A;  3WKM A;  3KZE A;  3I47 A;  3QWD A;  3GCN A;  1UIY A;  4IZD A;  2OCS A;  2IWO A;  1M5Z A;  2EEH A;  4KPK A;  2PG8 A;  1QAV A;  2MHO A;  4QFE A;  1TP3 A;  4GVC A;  4ELX A;  3D03 A;  1I92 A;  4IZC A;  4ZDD A;  5JXB A;  4FJW D;  5DTP A;  1OZI A;  2X24 A;  3L3S A;  1OBY A;  3VIV A;  4U0G H;  3SFJ A;  2YT8 A;  2PKT A;  3I4W A;  1UM7 A;  1N7T A;  1X0U A;  5FUS A;  4ELW A;  1EF9 A;  4HNK A;  2I6V A;  4U19 A;  1TG6 A;  3KTJ A;  4U18 A;  3PV2 A;  2F6I A;  5B6L A;  1VCW A;  4NMR A;  4K2N A;  1LCY A;  3QMJ A;  4ZDE A;  2JIN A;  3OU0 A;  3KQF A;  1WJL A;  2LC7 A;  1KEF A;  2V90 A;  3ZW8 A;  4JOH A;  3SUZ A;  1V5Q A;  1BE9 A;  3HE2 A;  4MPA A;  3GF3 A;  2I0I A;  4QII A;  2J5G A;  3KHF A;  3LNX A;  3H02 A;  4REY A;  2L4T A;  2DXL A;  3SWX A;  3QYR A;  4K29 A;  4OAJ A;  3DJ1 A;  3H0S A;  2OGP A;  2A7K A;  2ZQR A;  5DU6 A;  4L1C A;  3E17 A;  2ZOA A;  4EDJ A;  4JYL A;  4Q3H A;  3HPM A;  3GCO A;  1WF7 A;  3GMF A;  1NF3 C;  3T89 A;  5INF A;  4JOE A;  4FN8 A;  3ZWB A;  1NZY A;  3QE1 A;  2VSS A;  2Q35 A;  4WCZ A;  4K78 A;  4YDP A;  3BPT A;  1DCI A;  3H0Q A;  2UZF A;  2QG1 A;  1Q7X A;  2KA9 A;  1WDK A;  1PDR A;  5E6P B;  3BPP A;  2VSU F;  4IZB A;  5DU4 A;  3PV4 A;  2CBY A;  4B3I A;  3CBX A;  5HEB A;  1WFV A;  4NXP A;  1SOT A;  1SZO A;  2YT7 A;  4ELS A;  3HPK A;  3MOY A;  3R6H A;  4KD6 A;  3R68 A;  2EEJ A;  4U0G A;  4WZ8 B;  3RL7 A;  1UYR A;  3N6R B;  3TDC A;  1VRG A;  5C90 A;  5GND A;  4WYT A;  2GEF A;  4UU5 A;  3H0U A;  1ZUB A;  2AWX A;  3TLF A;  1HZD A;  2A81 A;  5HF4 A;  2ZQQ A;  2FE5 A;  1BPL A;  1Q52 A;  3GAB A;  3KTK A;  2H2C A;  1MFL A;  4JOG A;  4Q6H A;  4FLN A;  4JC0 A;  1XNW A;  1L6O A;  2OSG A;  4WYO B;  2F9I B;  2KL1 A;  4NMT A;  3M6N A;  2JXO A;  2YUB A;  4LK5 A;  1X5N A;  3V5E A;  5I7Z A;  2J5I B;  5DKP A;  4EMM A;  2DUB A;  4L6W A;  1IU0 A;  5G1R A;  3B76 A;  3QO6 A;  5ING A;  5E0S H;  2EGK A;  3R69 A;  4FND A;  1RJM A;  2CSS A;  1UEQ A;  5HFB A;  2OQS A;  2RRM A;  3QXZ A;  1RY4 A;  3ID2 A;  3KDG A;  3GMA A;  1VB7 A;  3DOR A;  5DZK A;  4O06 A;  4OEP A;  3KTH A;  2EV8 A;  4Z8J A;  1V6B A;  4IC6 A;  2AWU A;  2QT5 A;  2KOH A;  3T8A A;  2VRE A;  2Q2X A;  2PZD A;  1UM1 A;  3P2L A;  4Z0M A;  3DJA A;  3Q0G A;  5G1Q A;  2FZS A;  2GTR A;  4PQW A;  3GGE A;  1RGW A;  2VSS E;  1TE0 A;  2WTB A;  2ZL4 A;  4JOT A;  2KV8 A;  4FNB A;  3DIW A;  1VA8 A;  1X9Z A;  5G1D A;  2A7S A;  4NNL A;  4JL7 A;  1HNU A;  4JCT A;  3HVQ C;  2F0A A;  2Z9I A;  4R2Z A;  1N7F A;  3QXI A;  2CS5 A;  2G2L A;  3TMH A;  2EDP A;  3K8X A;  2VSU A;  2FW2 A;  2DC2 A;  5DTH A;  3MOG A;  1W9E A;  1U38 A;  4G2R A;  3JXT A;  4WYU A;  1UYT A;  1Q3O A;  1RZX A;  4E3B A;  3U9S B;  3TVW A;  2YTW A;  1SG4 A;  4NXR A;  3ZWC A;  1XNY A;  4JYJ A;  3MH4 A;  5HEY A;  3M6M A;  5HET A;  5E0S A;  5H3J A;  2FNE A;  2MX6 A;  1V62 A;  2Q34 A;  4P2A B;  5KDR B;  3EGH C;  3KTG A;  3LNY A;  4XHV A;  4NEK A;  1YBO A;  5B42 A;  1TYF A;  1Y7N A;  1IU2 A;  4EML A;  2QBW A;  1UJV A;  3GSL A;  5E1Y A;  3PDV A;  3BF0 A;  3PS4 A;  5INI A;  5D13 A;  2OS6 A;  4NNM A;  2OPG A;  1WH1 A;  1WDL A;  2H3M A;  2UZC A;  2JSN A;  4MOU A;  3I1E A;  3MYB A;  4K75 A;  3ZRT A;  1P1E A;  5A2P A;  4JOK A;  4F8K A;  1X8S A;  4AEJ A;  2R3Y A;  4H11 A;  1UIT A;  2DXN A;  4KNP A;  2K20 A;  3DJ3 A;  2VSV A;  3SOE A;  4B3H A;  1N6D A;  3MH6 A;  1XX4 A;  2HGA A;  4J2U A;  3L4F D;  4E35 A;  3HLN 1;  3MT6 A;  3T8B A;  2EGO A;  2IWQ A;  2F6Q A;  3QDO A;  1Z86 A;  2GZV A;  5FIF A;  4JOF A;  3K82 A;  3NJB A;  5DZK H;  3CC0 A;  1GM1 A;  4FN7 A;  4U1A A;  3U9T B;  1KY9 A;  2FBM A;  4FZW A;  2W4F A;  3PV5 A;  1VAE A;  3NGH A;  4OLQ A;  2VSU E;  3HRX A;  3HP0 A;  4NNQ A;  2NP9 A;  2M10 A;  1MFG A;  3GDV A;  1EY3 A;  1ON3 A;  2IWN A;  4L8K A;  3MFM A;  1Q3P A;  2BYG A;  3MH7 A;  4I42 A;  1GQ5 A;  1OD2 A;  2KJK A;  4KWB A;  5JBX A;  2KPL A;  1FC9 A;  2PNT A;  3CS0 A;  3IBB A;  2EXG A;  2PKU A;  4JSB A;  3SHU A;  4NAR A;  1BFE A;  1B8Q A;  3CBY A;  2LC6 A;  4G69 A;  4ZDB A;  1UYS A;  3QJM A;  2D3T A;  2KAW A;  1FCF A;  1K39 A;  3RSI A;  2PBP A;  5KJP A;  5FB8 C;  3GHF A;  2JOA A;  2F9I A;  4AE2 A;  2YJG A;  4Q2N A;  2ENO A;  2I0L A;  3KDK A;  2J5I A;  2QKU A;  4MXI A;  2VWR A;  4JJ0 A;  1WIF A;  3GDU A;  3JU1 A;  1W9Q A;  2H2B A;  2IWP A;  4JCS A;  4ZDC A;  2P3W A;  2HE2 A;  4GVD A;  4B3J A;  2G5M B;  4HOP B;  5DL1 A;  3WG5 A;  4F47 A;  1ZOK A;  1IHJ A;  1WF8 A;  1PIX A;  2CE3 A;  3SHW A;  3GLM A;  1W9O A;  2RRL A;  2VX2 A;  3Q7H A;  1XZ9 A;  2L97 A;  3PDZ A;  1UEW A;  3QJN A;  2HW5 A;  2IEX A;  1Q51 A;  2AWW A;  4FGM A;  1D5G A;  2EJ5 A;  2M0T A;  4NMP A;  1I16 A;  3TVU A;  3BEZ A;  3QIK A;  3CH8 A;  2EDZ A;  2V1W A;  4NMS A;  3ST9 A;  1RJN A;  3U9R B;  3KTI A;  5MGB A;  2KRG A;  4KFV A;  4RI0 A;  2RCZ A;  2VZ5 A;  2H3L A;  1DUB A;  4OEO A;  3NJD A;  1WFG A;  3RL8 A;  4JJ3 A;  1EF8 A;  4ZDF A;  3OT6 A;  3QKA A;  2VRF A;  4RYF H;  2DEO A;  3V5I A;  1X45 A;  3T88 A;  1GQ4 A;  3TSZ A;  2J5I I;  3RST A;  1KWA A;  2CSJ A;  5CTC A;  2HE4 A;  4Q2O A;  2BZR A;  5HFC A;  3STA A;  4N6X A;  2DAZ A;  5DTW A;  2X58 A;  1V5L A;  3ID3 A;  2L4S A;  2VSU C;  2F9Y B;  3QK8 A;  1QAU A;  1WI4 A;  4Z33 A;  4HC8 A;  2EHR A;  2F5Y A;  4GM2 A;  2JRE A;  5JBW A;  1OBZ A;  4KFW A;  1PJH A;  3Q1T A;  5DU8 A;  3NCV A;  5HFE A;  2DM8 A;  2OMJ A;  2KYL A;  3SLL A;  2I04 A;  2JIL A;  5DUC A;  1SOZ A;  5KDR A;  1WHD A;  2ZL0 A;  2J5G D;  5DUF A;  4JFC A;  3EGG C;  1XNV A;  4QIJ A;  3OME A;  1X6D A;  2O2T A;  1UHP A;  4K3W A;  2LOB A;  1QAV B;  1UYV A;  1WDM A;  1J7X A;  2W3P A;  3H0J A;  1MC7 A;  4I52 A;  4L8N A;  3FF6 A;  4YYX A;  2EJY A;  3CBZ A;  2ZPM A;  5EYZ A;  1UEZ A;  1W2X A;  3O46 A;  4LMM A;  3PZK A;  3LKE A;  3R0O A;  2KJP A;  1O8U A;  1WI2 A;  1U37 A;  4FB8 A;  1OBX A;  3VQF A;  3TSV A;  5IL9 A;  5G1S A;  5EZ0 A;  3KZD A;  3ZW9 A;  2M0Z A;  1VJ6 A;  3GDS A;  2DLS A;  1WZ8 A;  4JOJ A;  1UEP A;  4JJT A;  5CTB A;  4RYF A;  2QQ3 A;  4JCQ A;  1ON9 A;  5FHT A;  3Q0J A;  3R0H A;  2JWE A;  2QKV A;  1TP5 A;  3LAO A;  4NMO A;  4ZU2 A;  2I4S A;  2FN5 A;  2DMZ A;  3R9S A;  1V1T A;  3ISA A;  2KBS A;  1UJU A;  4ASI A;  4I4Z A;  3ID4 A;  3IB9 A;  1X5Q A;  5HFF A;  4JCR A;  4OG1 A;  3R9T A;  2EEG A;  2PA1 A;  2ZO9 B;  2PPY A;  2WL7 A;  3OTP A;  3K1R A;  4JWV A;  2EDV A;  2DKR A;  2AIN A;  2DJT A;  2KG2 A;  3RLE A;  4FZW C;  1QLC A;  1WG6 A;  3G64 A;  1YG6 A;  2ZL2 A;  3FDU A;  1NZY B;  1U39 A;  2D90 A;  2J5S A;  1Z87 A;  2JIK A;  1RGR A;  3I18 A;  2KJD A;  2VSP A;  3TV5 A;  3GJ9 A;  1T2M A;  2DLU A;  3QRE A;  3GKB A;  1WHA A;  4Q6S A;  1HNO A;  2EAQ A;  2W7R A;  4MI2 A;  4Q2Q A;  1R6J A;  4HDT A;  2YUY A;  1X5R A;  5E0N X;  3TZ3 A;  4P0C A;  2R4H A;  2VPH A;  3VQG A;  3P5M A;  1TQ3 A;  2OZF A;  2REY A;  5HED A;  3PEA A;  1NTE A;  3GF7 A;  4RCN A;  3BPU A;  2DB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...