1FC7A

Photosystem ii d1 c-terminal processing protease
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
386
structure length
386
Chain Sequence
b'VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II D1 PROTEASE
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
total genus 119
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc7A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc7A03
1WDMA 1TE0A 4WCZA 3TDCA 4P0CA 4Q0GA 3B76A 3M6NA 4JOPA 1YG6A 1ZOKA 2KJKA 1WFGA 3ZRTA 4QIJA 3DORA 2ZL0A 5G1DA 1OD2A 3T8BA 2VSUC 2ENOA 3L4FD 3VQFA 4FZWC 2DAZA 1UM7A 5CTBA 2VSVA 5H3JA 2ZQRA 4QIIA 3R9QA 3ID1A 1WF7A 4FNDA 1G9OA 3TVUA 4ZDFA 1SG4A 2DB5A 1KWAA 2VZ5A 1N6DA 3GLMA 5DTPA 1NF3C 3R6HA 1SOTA 1WFVA 4XHVA 3ZWBA 2EV8A 5B6LA 4K6YA 3LAOA 5G1EA 1K32A 1UM1A 4Q2PA 3KHFA 4JOJA 2I4SA 2VSUF 3KQFA 4NXPA 5HEBA 1V5QA 1Q7XA 4NMVA 1UITA 1Y8TA 2PZDA 1HNUA 1MJ3A 4Q1IA 1UHPA 2ZPMA 4JOFA 4U19A 3FF6A 1MFLA 1N99A 1P1DA 3GCNA 1XNYA 1X5NA 4OEPA 3K1RA 5FUSA 2AWXA 4N6XA 5FB8C 4ZDEA 1KEFA 4MPAA 3PGQA 3KZDA 4I4ZA 2DM8A 4FGMA 3H81A 3R0HA 2M0UA 1NZYB 3HE2A 2DJTA 3MYBA 5DUFA 3GGEA 5DUCA 2J5II 2FN5A 3DJAA 2VSSE 1OBXA 3DJ3A 5DL1A 2WTBA 2OCSA 1Q3PA 2K20A 4RI0A 4YDPA 1Y7OA 5G1RA 3STJA 3GDUA 2P3WA 3TZ3A 3ZWAA 3GMAA 3GKBA 1WZ8A 4I52A 1N7EA 2F9IB 1PJHA 4U0HA 4FN7A 4I42A 4NMOA 3K50A 3GDSA 2KOHA 1W9QA 2F9YA 2JIKA 4JFCA 2D8IA 1EF8A 3TVWA 2V90A 1XNVA 2OS6A 2VSUA 5INGA 3GDVA 4JCTA 3FY5A 1W2XA 1WHDA 2M0ZA 2V1WA 4RCNA 5E22A 4LMMA 3SFJA 1OBZA 2QT5A 3SLLA 3BPUA 3P5MA 1WF8A 2D90A 2Q2XA 3ID4A 4NMQA 3O5NA 4F47A 2DKRA 2IWQA 4NNQA 3P2LA 1Q51A 1X0UA 4JWVA 1LCYA 4HC8A 1EF9A 3QXIA 5HDYA 2VREA 4U0GA 2VSPA 3CC0A 4NMPA 2EEIA 1UEPA 3HPKA 4IZDA 5IKLB 5HFDA 1UJUA 2OQSA 3N6RB 2PKUA 5E0NX 2E7KA 2EAQA 2G5MB 2WL7A 2H2CA 2J5IB 4K29A 1UYSA 2JOAA 2Q9VA 4MOUA 2UZFA 4WYUA 4JOKA 4NXQA 3PDZA 2BZRA 3RL8A 3QK8A 5A2PA 1TP5A 4Q6HA 3HLN1 2JREA 2PG8A 2VSSA 2W3PA 1FC7A 1DCIA 3OT6A 1W9OA 5MGBA 3OTPA 2JWEA 4ZDBA 1Z87A 2QKVA 3WKLA 3ID3A 3NFKA 3IB9A 2CBYA 5FHTA 3NGHA 2FZSA 1IHJA 3GJ9A 3U9TB 2DLUA 4U0GH 2X7ZA 1K39A 2DUBA 4QFEA 4IC6A 2KQFA 2KAWA 4KNPA 3H0SA 2QBWA 1YBOA 2RCZA 1QAVB 2X58A 2KJPA 3QREA 3HINA 2AINA 3KTIA 2PBPA 4L8NA 2IWNA 1VJ6A 3G64A 2H3LA 2KV8A 3VQGA 3SWXA 5HF4A 2F0AA 4JJTA 5F3XA 1I92A 1M5ZA 3R68A 4KWBA 1V5LA 4JCQA 5FIFA 5HEDA 3PEAA 3V5IA 5E21A 4ELSA 4K3WA 3WG5A 3H0JA 4RYFA 4FN8A 2EGOA 1OD4A 4JOGA 3RSIA 1N7FA 2KJDA 3PV4A 3SHUA 4Q2QA 1X45A 5HETA 2X24A 4P2AB 4NEKA 2JILA 2DMZA 2EHRA 3QIKA 3RL7A 1WJLA 4JSBA 2CSJA 1QAUA 4KD6A 3TT7A 5DKPA 4ZU2A 2GZVA 3QGLA 1U3BA 4KFWA 4ZDDA 2LC7A 3KTHA 2I0LA 2KOMA 2LOBA 3HPMA 5HJ1A 5DU8A 3ZW9A 4WYTA 2VRFA 1Q52A 1RJNA 4B3HA 4HOPB 1OBYA 1MC7A 2A7SA 4HNKA 2F9IA 4RYFH 1V62A 3U9SB 1TQ3A 5G1QA 2QKTA 4U18A 1GQ4A 4K75A 3RLEA 4U1AA 2FNEA 3QJNA 4FJWD 4Z33A 3PV5A 1UJDA 2CS5A 2PDZA 4Q2OA 3SOEA 4OLQA 2JINA 2ZQQA 1RGWA 3H02A 5HFBA 1UEQA 3GCOA 4NMSA 3V5EA 1WDLA 1VB7A 2CE3A 2QKUA 3ST9A 2OSGA 2D3TA 4JL7A 4R2ZA 4YLHA 2KOJA 2VSSF 2I0IA 4GVDA 2D92A 1X5QA 1EY3A 4FB8A 2A7KA 3MH7A 3QJMA 3BF0A 4JCRA 4NNMA 1VA8A 1RZXA 4Q6SA 2NP9A 2HGAA 3K8XA 4ASIA 5EZ0A 2KA9A 2VWRA 2Q34A 2MX6A 3TLFA 1DUBA 1UYRA 1UEZA 4OAJA 2PPYA 4ZDCA 3K82A 3PV2A 2J5IA 3NJBA 5DU6A 2IEXA 3NFLA 3KTKA 1X5RA 2DLSA 4JCSA 1YG8A 4PQWA 3I18A 3FDUA 3PZKA 2LC6A 4F8KA 3OU0A 3GF7A 2F5YA 2EDVA 3IAVA 3Q1TA 4ELWA 3R9TA 1IU0A 1Y7NA 2L4TA 1IU2A 3JU1A 3QYRA 1D5GA 2IWPA 1FC9A 3LNYA 2Q35A 1O8UA 4GHNA 2KBSA 5E0SA 2RRMA 2F9YB 5KDRA 4IZCA 2OMJA 3I4WA 2EJ5A 5DTHA 3M6MA 5G1SA 3T88A 3TSWA 3DJ1A 4OG1A 1V6BA 2HE4A 1QAVA 4JVTA 3Q7HA 3RRVA 2L4SA 2KPKA 3PDVA 3CBYA 3STAA 2BYGA 1RGRA 3O46A 3MT6A 5F67A 2H2BA 2M0VA 3QKAA 5I7ZA 3U9RB 3I1EA 3EGHC 1UJVA 3HRXA 2JXOA 3TT6A 4G69A 4OMRA 4L8KA 1OZIA 1U39A 2PKTA 1VRGA 2M10A 5INIA 4DI1A 2YTWA 3HP0A 2OZFA 4NXRA 3ZWCA 5C90A 4B3JA 1FC6A 2KYLA 3T3WA 5E0SH 1ZUBA 1UYTA 2PA1A 5JBXA 2F6IA 3MFMA 1X6DA 2OGPA 1XX4A 3QE1A 2DC2A 2EXGA 3CBZA 4GVCA 3ID2A 3R0OA 2W4FA 3LNXA 1ON9A 5HEYA 2Q3GA 3EGGC 1WHAA 4K2NA 3PS4A 3GF3A 4Q3HA 1UYVA 2REYA 4EMMA 5E6PB 5DZKA 4E3BA 3SUZA 1HNOA 2AWWA 1HZDA 4L6WA 1TG6A 2J5GD 4JORA 1GM1A 1WIFA 4JOTA 3QMJA 4B3IA 3CH8A 1UEWA 3PE8A 3TV5A 4HOPA 1I16A 2KL1A 5C9GA 1NZYA 1WI4A 2EJYA 2VSUE 2EDPA 2LUIA 5D13A 5JBWA 3LKEA 3TMHA 1RJMA 4NMTA 3QO6A 2MHOA 3CYYA 2FBMA 4MI2A 3QXZA 2OPGA 1WDKA 5JXBA 5INFA 2Z9IA 5HFCA 2VX2A 4Z0MA 3NJDA 1BFEA 4MXIA 3QWDA 5DZKH 3CS0A 1VCWA 3QDOA 2HW5A 5GNDA 2ZL2A 3R9SA 1Z86A 3RSTA 1N6EA 4Q2NA 3TSZA 2YUBA 3WKMA 2EDZA 4E34A 2R3YA 1UF1A 2IWOA 4K72A 3KTJA 2FE5A 2I04A 5GLJA 5DTWA 1V1TA 1X8SA 2ZL3A 4OEOA 4WZ8B 1NTEA 2HE2A 1T2MA 4GM2A 4WYOB 4UU5A 5DU4A 5HFEA 2J5GA 3SHWA 2DEOA 4JOHA 2EGKA 1XNWA 3ZW8A 3KZEA 1UFXA 2O2TA 4E35A 4O06A 2YT7A 4EMLA 5KJPA 3E17A 2QQ3A 2FCFA 1SZOA 1R6JA 2C8TA 3MH6A 2GTRA 4H11A 1XO6A 3I47A 2ZL4A 2KRGA 1TYFA 3R69A 2EEHA 2YT8A 1TP3A 3IBBA 3ISAA 3MOYA 4FZWA 3H0UA 4K78A 1L6OA 2W7RA 4AMHA 3Q0GA 3GSLA 4NNLA 1JXZA 3Q0JA 4IZBA 4G2RA 1QLCA 1Q3OA 2M0TA 1U38A 3MH4A 3T89A 2EEJA 2G2LA 2EEGA 2R4HA 1WG6A 4FNBA 5CTCA 4ELXA 3BPPA 2F6QA 3HVQC 2I6VA 1SOZA 1B8QA 1GQ5A 1PIXA 4KPKA 5E11A 3JXTA 1BE9A 1KY9A 1PDRA 2EGNA 2H3MA 2KPLA 1UIYA 3TRRA 3OMEA 5EYZA 2J5SA 5E1YA 1N6FA 4Z8JA 3DIWA 1WH1A 1U37A 2AWUA 1VAEA 3BEZA 1FCFA 4K76A 4LK5A 4UU6A 3OC7A 2M3MA 1XZ9A 3TSVA 3T8AA 4YYXA 2A81A 2I1NA 4JOEA 2KG2A 4JYJA 2VPHA 2UZCA 4JYLA 1MFGA 2QG1A 1RY4A 4REYA 2YUYA 1N7TA 4NMRA 5HF1A 3L3SA 3CBXA 4EMPA 2ZPLA 1P1EA 2CSSA 5KDRB 5HFFA 2K1ZA 2FW2A 2PNTA 2L97A 1WI2A 4EDJA 1ON3A 3H0QA 3KTGA 4KFVA 2LA8A 1J7XA 3VIVA 2Z17A 3P85A 1W9EA 3AXAA
chains in the Genus database with same CATH superfamily
1WDMA 1TE0A 4WCZA 3TDCA 4P0CA 4Q0GA 3B76A 3M6NA 4JOPA 1YG6A 1ZOKA 2KJKA 1WFGA 3ZRTA 4QIJA 3DORA 5EUXA 2ZL0A 5G1DA 1OD2A 3T8BA 2VSUC 2ENOA 3L4FD 3VQFA 4FZWC 2DAZA 1UM7A 5CTBA 2VSVA 5H3JA 2ZQRA 4QIIA 3R9QA 3ID1A 1WF7A 1H4YA 4FNDA 1G9OA 3IH8A 3TVUA 4ZDFA 1SG4A 2DB5A 1KWAA 2VZ5A 1N6DA 3EH7A 3GLMA 5DTPA 3F43A 1NF3C 3R6HA 1SOTA 1WFVA 4XHVA 4FLNA 2EV8A 2JSNA 5B6LA 3ZWBA 4K6YA 3LAOA 5G1EA 1K32A 1UM1A 4Q2PA 3KHFA 4JOJA 2I4SA 2VSUF 3MOGA 3KQFA 4NXPA 5HEBA 1V5QA 1Q7XA 4NMVA 1UITA 1Y8TA 2PZDA 1HNUA 1MJ3A 4Q1IA 1UHPA 2ZPMA 4JOFA 4U19A 3FF6A 1MFLA 1N99A 1P1DA 3GCNA 1XNYA 1X5NA 2GEFA 4OEPA 3K1RA 5FUSA 1H4XA 2AWXA 4N6XA 4J2UA 5FB8C 4ZDEA 1KEFA 4MPAA 3PGQA 3KZDA 3ZXNA 2DM8A 4I4ZA 4FGMA 3H81A 3R0HA 2M0UA 1NZYB 3HE2A 2DJTA 3MYBA 5DUFA 3GGEA 5DUCA 2J5II 2FN5A 3DJAA 2VSSE 1OBXA 3DJ3A 5DL1A 2WTBA 2OCSA 1Q3PA 2K20A 4RI0A 4YDPA 1Y7OA 5G1RA 3STJA 3GDUA 2P3WA 3TZ3A 3ZWAA 3GMAA 3GKBA 1TIDB 1WZ8A 4I52A 1N7EA 2F9IB 1PJHA 4U0HA 4FN7A 4I42A 4NMOA 3K50A 3GDSA 2KOHA 1W9QA 2F9YA 2JIKA 4JFCA 2D8IA 1EF8A 3TVWA 2V90A 1XNVA 2OS6A 2VSUA 5INGA 3GDVA 4JCTA 3FY5A 1W2XA 1WHDA 2M0ZA 2V1WA 4RCNA 5E22A 3GK7A 4LMMA 3SFJA 1OBZA 2QT5A 3SLLA 3BPUA 3P5MA 1WF8A 4XS5A 2D90A 2Q2XA 3ID4A 4NMQA 3O5NA 4F47A 2DKRA 2IWQA 4NNQA 3P2LA 1TH8B 1Q51A 1X0UA 4JWVA 1LCYA 4HC8A 1EF9A 3QXIA 3IHAA 5HDYA 2VREA 2YJGA 4U0GA 2VSPA 3CC0A 4NMPA 2EEIA 1UEPA 3HPKA 4IZDA 5IKLB 5HFDA 4DMGA 1UJUA 2OQSA 3N6RB 2PKUA 5E0NX 2E7KA 2EAQA 2G5MB 2WL7A 2H2CA 2OASA 2J5IB 4K29A 1UYSA 2JOAA 2CWWA 2Q9VA 4MOUA 2UZFA 4WYUA 4JOKA 4NXQA 3PDZA 2BZRA 3RL8A 1V0FA 5A2PA 3QK8A 1TP5A 4Q6HA 3HLN1 2JREA 2PG8A 2VSSA 2W3PA 1FC7A 1DCIA 3OT6A 1W9OA 5MGBA 3OTPA 2JWEA 4ZDBA 1Z87A 2QKVA 3WKLA 3BPTA 3ID3A 3NFKA 3IB9A 2RRLA 2CBYA 5FHTA 3NGHA 2FZSA 3NCVA 1IHJA 3GJ9A 3U9TB 2DLUA 4U0GH 3V97A 2X7ZA 1K39A 2DUBA 4QFEA 4IC6A 2KQFA 2KAWA 4KNPA 3H0SA 2QBWA 1YBOA 2RCZA 1QAVB 2X58A 2KJPA 3QREA 3LLOA 3HINA 2AINA 3KTIA 2PBPA 4L8NA 2IWNA 1VJ6A 3G64A 2H3LA 2KV8A 3VQGA 3SWXA 5HF4A 2F0AA 4JJTA 5F3XA 1I92A 1M5ZA 3R68A 4KWBA 1V5LA 4JCQA 3NY7A 5FIFA 5HEDA 3PEAA 3V5IA 5E21A 4ELSA 4K3WA 3WG5A 3H0JA 4RYFA 4FN8A 2EGOA 1OD4A 2AS0A 4JOGA 2KLNA 3RSIA 1SBOA 1N7FA 2KJDA 3PV4A 3SHUA 4Q2QA 1X45A 5HETA 2X24A 4P2AB 4NEKA 2JILA 2DMZA 2EHRA 3QIKA 2KA5A 3RL7A 1WJLA 4JSBA 2CSJA 1QAUA 4KD6A 5EUWA 3TT7A 5DKPA 4ZU2A 2GZVA 3QGLA 1U3BA 4KFWA 4ZDDA 2LC7A 3KTHA 2I0LA 2KOMA 2LOBA 3HPMA 5HJ1A 5DU8A 3ZW9A 4WYTA 2VRFA 1Q52A 1RJNA 4B3HA 4HOPB 1OBYA 1MC7A 2A7SA 4HNKA 2F9IA 4RYFH 1V62A 3U9SB 3D03A 1TQ3A 5G1QA 2QKTA 4U18A 4QTPA 1GQ4A 4K75A 3RLEA 4U1AA 4DGHA 2FNEA 3QJNA 4FJWD 4Z33A 3KDKA 3PV5A 1T6RA 1UJDA 2CS5A 2PDZA 4Q2OA 3SOEA 4OLQA 2JINA 2ZQQA 1RGWA 3H02A 5HFBA 1UEQA 3LDFA 3GCOA 4NMSA 3V5EA 1WDLA 1VB7A 2CE3A 2QKUA 3ST9A 2OSGA 2D3TA 4JL7A 4R2ZA 4YLHA 2KOJA 2VSSF 2I0IA 4GVDA 2D92A 1X5QA 1EY3A 4FB8A 2A7KA 3MH7A 3QJMA 3BF0A 4JCRA 3IH9A 4NNMA 1VA8A 1RZXA 4Q6SA 2NP9A 2HGAA 3K8XA 4ASIA 5EZ0A 2KA9A 2VWRA 2Q34A 2MX6A 3TLFA 1DUBA 1UYRA 1UEZA 1BPLA 4OAJA 2PPYA 4HYLA 3K82A 4DGFA 3PV2A 4ZDCA 2J5IA 3NJBA 5DU6A 2IEXA 3NFLA 3KTKA 1X5RA 2DLSA 4JCSA 1YG8A 4PQWA 3I18A 3FDUA 3PZKA 5EUSA 2LC6A 4F8KA 5B42A 3OU0A 3GF7A 2F5YA 2EDVA 1H4ZA 3IAVA 3Q1TA 4ELWA 2ZO9B 3R9TA 1IU0A 1Y7NA 2L4TA 1IU2A 3JU1A 3QYRA 1D5GA 2IWPA 1FC9A 3LNYA 2Q35A 1O8UA 4GHNA 2KBSA 5E0SA 1V0EA 2RRMA 2F9YB 5KDRA 4IZCA 2OMJA 3I4WA 2EJ5A 5DTHA 3M6MA 5G1SA 3T88A 3TSWA 3DJ1A 4OG1A 1V6BA 2HE4A 1QAVA 3KDGA 3Q7HA 4JVTA 3RRVA 3AGDA 2L4SA 2KPKA 3PDVA 3CBYA 2ZOAA 3STAA 2BYGA 1RGRA 3LKLA 3O46A 3MT6A 5F67A 2H2BA 2M0VA 3QKAA 5I7ZA 3GMFA 3I1EA 3U9RB 3QDQA 3EGHC 1UJVA 3HRXA 2JXOA 3TT6A 3V8VA 4G69A 4OMRA 4L8KA 3ZTBA 1OZIA 1U39A 2PKTA 3GABA 1VRGA 2M10A 5INIA 4DI1A 2YTWA 3HP0A 2OZFA 4NXRA 1WXXA 3ZWCA 5C90A 4B3JA 1FC6A 2KYLA 3T3WA 5E0SH 1ZUBA 1UYTA 2PA1A 1BUZA 5JBXA 2F6IA 4JC0A 1X6DA 2OGPA 3MFMA 3IHBA 1XX4A 1THNB 3QE1A 2DC2A 2EXGA 3CBZA 4GVCA 3ID2A 3R0OA 5EZBA 2W4FA 3LNXA 1ON9A 5HEYA 2Q3GA 3EGGC 1WHAA 4K2NA 3PS4A 3GF3A 4Q3HA 1UYVA 2REYA 3D3UA 4EMMA 3GHFA 5E6PB 5IL9A 4E3BA 3SUZA 3GVJA 1HNOA 5DZKA 2AWWA 1HZDA 4L6WA 1TG6A 2J5GD 4JORA 1GM1A 1WIFA 4JOTA 3T6OA 3QMJA 3CH8A 4B3IA 1UEWA 3PE8A 3TV5A 4HOPA 1I16A 2KL1A 3GVLA 5C9GA 1NZYA 5HUQA 1WI4A 2EJYA 2VSUE 4AEJA 2EDPA 2LUIA 5D13A 5JBWA 3LKEA 3TMHA 1RJMA 4NMTA 3QO6A 2MHOA 3CYYA 2FBMA 4MI2A 3QXZA 2OPGA 1WDKA 4HIZA 5JXBA 5INFA 4JJ3A 2Z9IA 1TILB 5HFCA 2VX2A 4Z0MA 3NJDA 1BFEA 4MXIA 3QWDA 5DZKH 3CS0A 1VCWA 3QDOA 5EUUA 2HW5A 5GNDA 2ZL2A 3R9SA 1HF2A 5EUZA 1Z86A 3RSTA 1N6EA 4Q2NA 4HDTA 3TSZA 2YUBA 3WKMA 2EDZA 4E34A 2R3YA 1UF1A 2IWOA 4K72A 3KTJA 2FE5A 2I04A 5GLJA 5DTWA 1V1TA 1X8SA 3AGEA 4OEOA 2ZL3A 2VY9A 1NTEA 4WZ8B 2HE2A 1T2MA 1VC1A 4GM2A 4WYOB 4UU5A 5DU4A 5HFEA 2J5GA 3SHWA 2DEOA 4JOHA 2EGKA 1WXWA 1XNWA 3ZW8A 3KZEA 1UFXA 2O2TA 1X9ZA 4E35A 4O06A 2YT7A 4EMLA 5KJPA 3MGLA 3E17A 3GVKA 2QQ3A 2FCFA 1SZOA 1R6JA 2C8TA 3MH6A 2GTRA 4H11A 1XO6A 3I47A 2ZL4A 2KRGA 1TYFA 3R69A 2EEHA 2YT8A 1TP3A 3IBBA 3ISAA 3MOYA 4FZWA 3H0UA 4K78A 1L6OA 2W7RA 4AMHA 4L1CA 3Q0GA 3GSLA 4NNLA 1JXZA 3Q0JA 4IZBA 2DXNA 4G2RA 1QLCA 1Q3OA 2M0TA 1U38A 3MH4A 3T89A 2EEJA 2G2LA 2EEGA 3OIRA 2R4HA 1WG6A 4FNBA 5CTCA 5ILBA 3BPPA 4ELXA 2F6QA 3HVQC 2I6VA 1SOZA 1B8QA 1GQ5A 1PIXA 4KPKA 5E11A 3JXTA 1BE9A 2DXLA 1KY9A 1PDRA 2EGNA 2H3MA 2KPLA 3JU4A 1UIYA 3TRRA 3OMEA 5EYZA 2J5SA 5E1YA 1N6FA 4Z8JA 3DIWA 4JJ0A 1WH1A 1U37A 2AWUA 3IF5A 1VAEA 3BEZA 1FCFA 4K76A 4LK5A 4UU6A 3OC7A 2M3MA 1XZ9A 3TSVA 3T8AA 4YYXA 2A81A 2I1NA 4JOEA 2KG2A 4JYJA 1AUZA 2VPHA 2UZCA 4JYLA 1MFGA 4AE2A 2QG1A 1RY4A 4REYA 2YUYA 1N7TA 4NMRA 5HF1A 3L3SA 3CBXA 4NARA 4EMPA 2ZPLA 1P1EA 2CSSA 5KDRB 5HFFA 2K1ZA 3VSEA 2FW2A 2PNTA 2L97A 1WI2A 4EDJA 3C0KA 1ON3A 3H0QA 3DUPA 3KTGA 3OIZA 2B78A 4KFVA 2LA8A 1J7XA 3VIVA 2Z17A 3P85A 1W9EA 3AXAA
chains in the Genus database with same CATH topology
1WDMA 1TE0A 4WCZA 3TDCA 4P0CA 4Q0GA 3B76A 3M6NA 4JOPA 1YG6A 1ZOKA 2KJKA 1WFGA 3ZRTA 4QIJA 3DORA 2ZL0A 5G1DA 1OD2A 3T8BA 2VSUC 2ENOA 3L4FD 3VQFA 4FZWC 2DAZA 1UM7A 5CTBA 2VSVA 5H3JA 2ZQRA 4QIIA 3R9QA 3ID1A 1WF7A 4FNDA 1G9OA 3TVUA 4ZDFA 1SG4A 2DB5A 1KWAA 2VZ5A 1N6DA 3GLMA 5DTPA 1NF3C 3R6HA 1SOTA 1WFVA 4XHVA 4FLNA 2EV8A 2JSNA 5B6LA 3ZWBA 4K6YA 3LAOA 5G1EA 1K32A 1UM1A 4Q2PA 3KHFA 4JOJA 2I4SA 2VSUF 3MOGA 3KQFA 4NXPA 5HEBA 1V5QA 1Q7XA 4NMVA 1UITA 1Y8TA 2PZDA 1HNUA 1MJ3A 4Q1IA 1UHPA 2ZPMA 4JOFA 4U19A 3FF6A 1MFLA 1N99A 1P1DA 3GCNA 1XNYA 1X5NA 2GEFA 4OEPA 3K1RA 5FUSA 4J2UA 2AWXA 4N6XA 5FB8C 4ZDEA 1KEFA 4MPAA 3PGQA 3KZDA 4I4ZA 2DM8A 4FGMA 3H81A 3R0HA 2M0UA 1NZYB 3HE2A 2DJTA 3MYBA 5DUFA 3GGEA 5DUCA 2J5II 2FN5A 3DJAA 2VSSE 1OBXA 3DJ3A 5DL1A 2WTBA 2OCSA 1Q3PA 2K20A 4RI0A 4YDPA 1Y7OA 5G1RA 3STJA 3GDUA 2P3WA 3TZ3A 3ZWAA 3GMAA 3GKBA 1WZ8A 4I52A 1N7EA 2F9IB 1PJHA 4U0HA 4FN7A 4I42A 4NMOA 3K50A 3GDSA 2KOHA 1W9QA 2F9YA 2JIKA 4JFCA 2D8IA 1EF8A 3TVWA 2V90A 1XNVA 2OS6A 2VSUA 5INGA 3GDVA 4JCTA 3FY5A 1W2XA 1WHDA 2M0ZA 2V1WA 4RCNA 5E22A 4LMMA 3SFJA 1OBZA 2QT5A 3SLLA 3BPUA 3P5MA 1WF8A 2D90A 2Q2XA 3ID4A 4NMQA 3O5NA 4F47A 2DKRA 2IWQA 4NNQA 3P2LA 1Q51A 1X0UA 4JWVA 1LCYA 4HC8A 1EF9A 3QXIA 5HDYA 2VREA 2YJGA 4U0GA 2VSPA 3CC0A 4NMPA 2EEIA 1UEPA 3HPKA 4IZDA 5IKLB 5HFDA 1UJUA 2OQSA 3N6RB 2PKUA 5E0NX 2E7KA 2EAQA 2G5MB 2WL7A 2H2CA 2J5IB 4K29A 1UYSA 2JOAA 2Q9VA 4MOUA 2UZFA 4WYUA 4JOKA 4NXQA 3PDZA 2BZRA 3RL8A 3QK8A 5A2PA 1TP5A 4Q6HA 3HLN1 2JREA 2PG8A 2VSSA 2W3PA 1FC7A 1DCIA 3OT6A 1W9OA 5MGBA 3OTPA 2JWEA 4ZDBA 1Z87A 2QKVA 3WKLA 3BPTA 3ID3A 3NFKA 3IB9A 2RRLA 2CBYA 5FHTA 3NGHA 2FZSA 3NCVA 1IHJA 3GJ9A 3U9TB 2DLUA 4U0GH 2X7ZA 1K39A 2DUBA 4QFEA 4IC6A 2KQFA 2KAWA 4KNPA 3H0SA 2QBWA 1YBOA 2RCZA 1QAVB 2X58A 2KJPA 3QREA 3HINA 2AINA 3KTIA 2PBPA 4L8NA 2IWNA 1VJ6A 3G64A 2H3LA 2KV8A 3VQGA 3SWXA 5HF4A 2F0AA 4JJTA 5F3XA 1I92A 1M5ZA 3R68A 4KWBA 1V5LA 4JCQA 5FIFA 5HEDA 3PEAA 3V5IA 5E21A 4ELSA 4K3WA 3WG5A 3H0JA 4RYFA 4FN8A 2EGOA 1OD4A 4JOGA 3RSIA 1N7FA 2KJDA 3PV4A 3SHUA 4Q2QA 1X45A 5HETA 2X24A 4P2AB 4NEKA 2JILA 2DMZA 2EHRA 3QIKA 3RL7A 1WJLA 4JSBA 2CSJA 1QAUA 4KD6A 3TT7A 5DKPA 4ZU2A 2GZVA 3QGLA 1U3BA 4KFWA 4ZDDA 2LC7A 3KTHA 2I0LA 2KOMA 2LOBA 3HPMA 5HJ1A 5DU8A 3ZW9A 4WYTA 2VRFA 1Q52A 1RJNA 4B3HA 4HOPB 1OBYA 1MC7A 2A7SA 4HNKA 2F9IA 4RYFH 1V62A 3U9SB 3D03A 1TQ3A 5G1QA 2QKTA 4U18A 1GQ4A 4K75A 3RLEA 4U1AA 2FNEA 3QJNA 4FJWD 4Z33A 3KDKA 3PV5A 1UJDA 2CS5A 2PDZA 4Q2OA 3SOEA 4OLQA 2JINA 2ZQQA 1RGWA 3H02A 5HFBA 1UEQA 3GCOA 4NMSA 3V5EA 1WDLA 1VB7A 2CE3A 2QKUA 3ST9A 2OSGA 2D3TA 4JL7A 4R2ZA 4YLHA 2KOJA 2VSSF 2I0IA 4GVDA 2D92A 1X5QA 1EY3A 4FB8A 2A7KA 3MH7A 3QJMA 3BF0A 4JCRA 4NNMA 1VA8A 1RZXA 4Q6SA 2NP9A 2HGAA 3K8XA 4ASIA 5EZ0A 2KA9A 2VWRA 2Q34A 2MX6A 3TLFA 1DUBA 1UYRA 1UEZA 1BPLA 4OAJA 2PPYA 4ZDCA 3K82A 3PV2A 2J5IA 3NJBA 5DU6A 2IEXA 3NFLA 3KTKA 1X5RA 2DLSA 4JCSA 1YG8A 4PQWA 3I18A 3FDUA 3PZKA 2LC6A 4F8KA 5B42A 3OU0A 3GF7A 2F5YA 2EDVA 3IAVA 3Q1TA 4ELWA 2ZO9B 3R9TA 1IU0A 1Y7NA 2L4TA 1IU2A 3JU1A 3QYRA 1D5GA 2IWPA 1FC9A 3LNYA 2Q35A 1O8UA 4GHNA 2KBSA 5E0SA 2RRMA 2F9YB 5KDRA 4IZCA 2OMJA 3I4WA 2EJ5A 5DTHA 3M6MA 5G1SA 3T88A 3TSWA 3DJ1A 4OG1A 1V6BA 2HE4A 1QAVA 3KDGA 3Q7HA 4JVTA 3RRVA 2L4SA 2KPKA 3PDVA 3CBYA 2ZOAA 3STAA 2BYGA 1RGRA 3O46A 3MT6A 5F67A 2H2BA 2M0VA 3QKAA 5I7ZA 3GMFA 3I1EA 3U9RB 3EGHC 1UJVA 3HRXA 2JXOA 3TT6A 4G69A 4OMRA 4L8KA 1OZIA 1U39A 2PKTA 3GABA 1VRGA 2M10A 5INIA 4DI1A 2YTWA 3HP0A 2OZFA 4NXRA 3ZWCA 5C90A 4B3JA 1FC6A 2KYLA 3T3WA 5E0SH 1ZUBA 1UYTA 2PA1A 5JBXA 2F6IA 4JC0A 1X6DA 2OGPA 3MFMA 1XX4A 3QE1A 2DC2A 2EXGA 3CBZA 4GVCA 3ID2A 3R0OA 2W4FA 3LNXA 1ON9A 5HEYA 2Q3GA 3EGGC 1WHAA 4K2NA 3PS4A 3GF3A 4Q3HA 1UYVA 2REYA 4EMMA 3GHFA 5E6PB 5IL9A 4E3BA 3SUZA 1HNOA 5DZKA 2AWWA 1HZDA 4L6WA 1TG6A 2J5GD 4JORA 1GM1A 1WIFA 4JOTA 3QMJA 4B3IA 3CH8A 1UEWA 3PE8A 3TV5A 4HOPA 1I16A 2KL1A 5C9GA 1NZYA 5HUQA 1WI4A 2EJYA 2VSUE 4AEJA 2EDPA 2LUIA 5D13A 5JBWA 3LKEA 3TMHA 1RJMA 4NMTA 3QO6A 2MHOA 3CYYA 2FBMA 4MI2A 3QXZA 2OPGA 1WDKA 5JXBA 5INFA 4JJ3A 2Z9IA 5HFCA 2VX2A 4Z0MA 3NJDA 1BFEA 4MXIA 3QWDA 5DZKH 3CS0A 1VCWA 3QDOA 2HW5A 5GNDA 2ZL2A 3R9SA 1Z86A 3RSTA 1N6EA 4Q2NA 4HDTA 3TSZA 2YUBA 3WKMA 2EDZA 4E34A 2R3YA 1UF1A 2IWOA 4K72A 3KTJA 2FE5A 2I04A 5GLJA 5DTWA 1V1TA 1X8SA 2ZL3A 4OEOA 4WZ8B 1NTEA 2HE2A 1T2MA 4GM2A 4WYOB 4UU5A 5DU4A 5HFEA 2J5GA 3SHWA 2DEOA 4JOHA 2EGKA 1XNWA 3ZW8A 3KZEA 1UFXA 2O2TA 1X9ZA 4E35A 4O06A 2YT7A 4EMLA 5KJPA 3E17A 2QQ3A 2FCFA 1SZOA 1R6JA 2C8TA 3MH6A 2GTRA 4H11A 1XO6A 3I47A 2ZL4A 2KRGA 1TYFA 3R69A 2EEHA 2YT8A 1TP3A 3IBBA 3ISAA 3MOYA 4FZWA 3H0UA 4K78A 1L6OA 2W7RA 4AMHA 4L1CA 3Q0GA 3GSLA 4NNLA 1JXZA 3Q0JA 4IZBA 2DXNA 4G2RA 1QLCA 1Q3OA 2M0TA 1U38A 3MH4A 3T89A 2EEJA 2G2LA 2EEGA 2R4HA 1WG6A 4FNBA 5CTCA 5ILBA 3BPPA 4ELXA 2F6QA 3HVQC 2I6VA 1SOZA 1B8QA 1GQ5A 1PIXA 4KPKA 5E11A 3JXTA 1BE9A 2DXLA 1KY9A 1PDRA 2EGNA 2H3MA 2KPLA 1UIYA 3TRRA 3OMEA 5EYZA 2J5SA 5E1YA 1N6FA 4Z8JA 3DIWA 4JJ0A 1WH1A 1U37A 2AWUA 1VAEA 3BEZA 1FCFA 4K76A 4LK5A 4UU6A 3OC7A 2M3MA 1XZ9A 3TSVA 3T8AA 4YYXA 2A81A 2I1NA 4JOEA 2KG2A 4JYJA 2VPHA 2UZCA 4JYLA 1MFGA 4AE2A 2QG1A 1RY4A 4REYA 2YUYA 1N7TA 4NMRA 5HF1A 3L3SA 3CBXA 4NARA 4EMPA 2ZPLA 1P1EA 2CSSA 5KDRB 5HFFA 2K1ZA 2FW2A 2PNTA 2L97A 1WI2A 4EDJA 1ON3A 3H0QA 3DUPA 3KTGA 4KFVA 2LA8A 1J7XA 3VIVA 2Z17A 3P85A 1W9EA 3AXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDM A;  1TE0 A;  4WCZ A;  3TDC A;  4P0C A;  4Q0G A;  3B76 A;  3M6N A;  4JOP A;  1YG6 A;  1ZOK A;  2KJK A;  1WFG A;  3ZRT A;  4QIJ A;  3DOR A;  2ZL0 A;  5G1D A;  1OD2 A;  3T8B A;  2VSU C;  2ENO A;  3L4F D;  3VQF A;  4FZW C;  2DAZ A;  1UM7 A;  5CTB A;  2VSV A;  5H3J A;  2ZQR A;  4QII A;  3R9Q A;  3ID1 A;  1WF7 A;  4FND A;  1G9O A;  3TVU A;  4ZDF A;  1SG4 A;  2DB5 A;  1KWA A;  2VZ5 A;  1N6D A;  3GLM A;  5DTP A;  1NF3 C;  3R6H A;  1SOT A;  1WFV A;  4XHV A;  3ZWB A;  2EV8 A;  5B6L A;  4K6Y A;  3LAO A;  5G1E A;  1K32 A;  1UM1 A;  4Q2P A;  3KHF A;  4JOJ A;  2I4S A;  2VSU F;  3KQF A;  4NXP A;  5HEB A;  1V5Q A;  1Q7X A;  4NMV A;  1UIT A;  1Y8T A;  2PZD A;  1HNU A;  1MJ3 A;  4Q1I A;  1UHP A;  2ZPM A;  4JOF A;  4U19 A;  3FF6 A;  1MFL A;  1N99 A;  1P1D A;  3GCN A;  1XNY A;  1X5N A;  4OEP A;  3K1R A;  5FUS A;  2AWX A;  4N6X A;  5FB8 C;  4ZDE A;  1KEF A;  4MPA A;  3PGQ A;  3KZD A;  4I4Z A;  2DM8 A;  4FGM A;  3H81 A;  3R0H A;  2M0U A;  1NZY B;  3HE2 A;  2DJT A;  3MYB A;  5DUF A;  3GGE A;  5DUC A;  2J5I I;  2FN5 A;  3DJA A;  2VSS E;  1OBX A;  3DJ3 A;  5DL1 A;  2WTB A;  2OCS A;  1Q3P A;  2K20 A;  4RI0 A;  4YDP A;  1Y7O A;  5G1R A;  3STJ A;  3GDU A;  2P3W A;  3TZ3 A;  3ZWA A;  3GMA A;  3GKB A;  1WZ8 A;  4I52 A;  1N7E A;  2F9I B;  1PJH A;  4U0H A;  4FN7 A;  4I42 A;  4NMO A;  3K50 A;  3GDS A;  2KOH A;  1W9Q A;  2F9Y A;  2JIK A;  4JFC A;  2D8I A;  1EF8 A;  3TVW A;  2V90 A;  1XNV A;  2OS6 A;  2VSU A;  5ING A;  3GDV A;  4JCT A;  3FY5 A;  1W2X A;  1WHD A;  2M0Z A;  2V1W A;  4RCN A;  5E22 A;  4LMM A;  3SFJ A;  1OBZ A;  2QT5 A;  3SLL A;  3BPU A;  3P5M A;  1WF8 A;  2D90 A;  2Q2X A;  3ID4 A;  4NMQ A;  3O5N A;  4F47 A;  2DKR A;  2IWQ A;  4NNQ A;  3P2L A;  1Q51 A;  1X0U A;  4JWV A;  1LCY A;  4HC8 A;  1EF9 A;  3QXI A;  5HDY A;  2VRE A;  4U0G A;  2VSP A;  3CC0 A;  4NMP A;  2EEI A;  1UEP A;  3HPK A;  4IZD A;  5IKL B;  5HFD A;  1UJU A;  2OQS A;  3N6R B;  2PKU A;  5E0N X;  2E7K A;  2EAQ A;  2G5M B;  2WL7 A;  2H2C A;  2J5I B;  4K29 A;  1UYS A;  2JOA A;  2Q9V A;  4MOU A;  2UZF A;  4WYU A;  4JOK A;  4NXQ A;  3PDZ A;  2BZR A;  3RL8 A;  3QK8 A;  5A2P A;  1TP5 A;  4Q6H A;  3HLN 1;  2JRE A;  2PG8 A;  2VSS A;  2W3P A;  1FC7 A;  1DCI A;  3OT6 A;  1W9O A;  5MGB A;  3OTP A;  2JWE A;  4ZDB A;  1Z87 A;  2QKV A;  3WKL A;  3ID3 A;  3NFK A;  3IB9 A;  2CBY A;  5FHT A;  3NGH A;  2FZS A;  1IHJ A;  3GJ9 A;  3U9T B;  2DLU A;  4U0G H;  2X7Z A;  1K39 A;  2DUB A;  4QFE A;  4IC6 A;  2KQF A;  2KAW A;  4KNP A;  3H0S A;  2QBW A;  1YBO A;  2RCZ A;  1QAV B;  2X58 A;  2KJP A;  3QRE A;  3HIN A;  2AIN A;  3KTI A;  2PBP A;  4L8N A;  2IWN A;  1VJ6 A;  3G64 A;  2H3L A;  2KV8 A;  3VQG A;  3SWX A;  5HF4 A;  2F0A A;  4JJT A;  5F3X A;  1I92 A;  1M5Z A;  3R68 A;  4KWB A;  1V5L A;  4JCQ A;  5FIF A;  5HED A;  3PEA A;  3V5I A;  5E21 A;  4ELS A;  4K3W A;  3WG5 A;  3H0J A;  4RYF A;  4FN8 A;  2EGO A;  1OD4 A;  4JOG A;  3RSI A;  1N7F A;  2KJD A;  3PV4 A;  3SHU A;  4Q2Q A;  1X45 A;  5HET A;  2X24 A;  4P2A B;  4NEK A;  2JIL A;  2DMZ A;  2EHR A;  3QIK A;  3RL7 A;  1WJL A;  4JSB A;  2CSJ A;  1QAU A;  4KD6 A;  3TT7 A;  5DKP A;  4ZU2 A;  2GZV A;  3QGL A;  1U3B A;  4KFW A;  4ZDD A;  2LC7 A;  3KTH A;  2I0L A;  2KOM A;  2LOB A;  3HPM A;  5HJ1 A;  5DU8 A;  3ZW9 A;  4WYT A;  2VRF A;  1Q52 A;  1RJN A;  4B3H A;  4HOP B;  1OBY A;  1MC7 A;  2A7S A;  4HNK A;  2F9I A;  4RYF H;  1V62 A;  3U9S B;  1TQ3 A;  5G1Q A;  2QKT A;  4U18 A;  1GQ4 A;  4K75 A;  3RLE A;  4U1A A;  2FNE A;  3QJN A;  4FJW D;  4Z33 A;  3PV5 A;  1UJD A;  2CS5 A;  2PDZ A;  4Q2O A;  3SOE A;  4OLQ A;  2JIN A;  2ZQQ A;  1RGW A;  3H02 A;  5HFB A;  1UEQ A;  3GCO A;  4NMS A;  3V5E A;  1WDL A;  1VB7 A;  2CE3 A;  2QKU A;  3ST9 A;  2OSG A;  2D3T A;  4JL7 A;  4R2Z A;  4YLH A;  2KOJ A;  2VSS F;  2I0I A;  4GVD A;  2D92 A;  1X5Q A;  1EY3 A;  4FB8 A;  2A7K A;  3MH7 A;  3QJM A;  3BF0 A;  4JCR A;  4NNM A;  1VA8 A;  1RZX A;  4Q6S A;  2NP9 A;  2HGA A;  3K8X A;  4ASI A;  5EZ0 A;  2KA9 A;  2VWR A;  2Q34 A;  2MX6 A;  3TLF A;  1DUB A;  1UYR A;  1UEZ A;  4OAJ A;  2PPY A;  4ZDC A;  3K82 A;  3PV2 A;  2J5I A;  3NJB A;  5DU6 A;  2IEX A;  3NFL A;  3KTK A;  1X5R A;  2DLS A;  4JCS A;  1YG8 A;  4PQW A;  3I18 A;  3FDU A;  3PZK A;  2LC6 A;  4F8K A;  3OU0 A;  3GF7 A;  2F5Y A;  2EDV A;  3IAV A;  3Q1T A;  4ELW A;  3R9T A;  1IU0 A;  1Y7N A;  2L4T A;  1IU2 A;  3JU1 A;  3QYR A;  1D5G A;  2IWP A;  1FC9 A;  3LNY A;  2Q35 A;  1O8U A;  4GHN A;  2KBS A;  5E0S A;  2RRM A;  2F9Y B;  5KDR A;  4IZC A;  2OMJ A;  3I4W A;  2EJ5 A;  5DTH A;  3M6M A;  5G1S A;  3T88 A;  3TSW A;  3DJ1 A;  4OG1 A;  1V6B A;  2HE4 A;  1QAV A;  4JVT A;  3Q7H A;  3RRV A;  2L4S A;  2KPK A;  3PDV A;  3CBY A;  3STA A;  2BYG A;  1RGR A;  3O46 A;  3MT6 A;  5F67 A;  2H2B A;  2M0V A;  3QKA A;  5I7Z A;  3U9R B;  3I1E A;  3EGH C;  1UJV A;  3HRX A;  2JXO A;  3TT6 A;  4G69 A;  4OMR A;  4L8K A;  1OZI A;  1U39 A;  2PKT A;  1VRG A;  2M10 A;  5INI A;  4DI1 A;  2YTW A;  3HP0 A;  2OZF A;  4NXR A;  3ZWC A;  5C90 A;  4B3J A;  1FC6 A;  2KYL A;  3T3W A;  5E0S H;  1ZUB A;  1UYT A;  2PA1 A;  5JBX A;  2F6I A;  3MFM A;  1X6D A;  2OGP A;  1XX4 A;  3QE1 A;  2DC2 A;  2EXG A;  3CBZ A;  4GVC A;  3ID2 A;  3R0O A;  2W4F A;  3LNX A;  1ON9 A;  5HEY A;  2Q3G A;  3EGG C;  1WHA A;  4K2N A;  3PS4 A;  3GF3 A;  4Q3H A;  1UYV A;  2REY A;  4EMM A;  5E6P B;  5DZK A;  4E3B A;  3SUZ A;  1HNO A;  2AWW A;  1HZD A;  4L6W A;  1TG6 A;  2J5G D;  4JOR A;  1GM1 A;  1WIF A;  4JOT A;  3QMJ A;  4B3I A;  3CH8 A;  1UEW A;  3PE8 A;  3TV5 A;  4HOP A;  1I16 A;  2KL1 A;  5C9G A;  1NZY A;  1WI4 A;  2EJY A;  2VSU E;  2EDP A;  2LUI A;  5D13 A;  5JBW A;  3LKE A;  3TMH A;  1RJM A;  4NMT A;  3QO6 A;  2MHO A;  3CYY A;  2FBM A;  4MI2 A;  3QXZ A;  2OPG A;  1WDK A;  5JXB A;  5INF A;  2Z9I A;  5HFC A;  2VX2 A;  4Z0M A;  3NJD A;  1BFE A;  4MXI A;  3QWD A;  5DZK H;  3CS0 A;  1VCW A;  3QDO A;  2HW5 A;  5GND A;  2ZL2 A;  3R9S A;  1Z86 A;  3RST A;  1N6E A;  4Q2N A;  3TSZ A;  2YUB A;  3WKM A;  2EDZ A;  4E34 A;  2R3Y A;  1UF1 A;  2IWO A;  4K72 A;  3KTJ A;  2FE5 A;  2I04 A;  5GLJ A;  5DTW A;  1V1T A;  1X8S A;  2ZL3 A;  4OEO A;  4WZ8 B;  1NTE A;  2HE2 A;  1T2M A;  4GM2 A;  4WYO B;  4UU5 A;  5DU4 A;  5HFE A;  2J5G A;  3SHW A;  2DEO A;  4JOH A;  2EGK A;  1XNW A;  3ZW8 A;  3KZE A;  1UFX A;  2O2T A;  4E35 A;  4O06 A;  2YT7 A;  4EML A;  5KJP A;  3E17 A;  2QQ3 A;  2FCF A;  1SZO A;  1R6J A;  2C8T A;  3MH6 A;  2GTR A;  4H11 A;  1XO6 A;  3I47 A;  2ZL4 A;  2KRG A;  1TYF A;  3R69 A;  2EEH A;  2YT8 A;  1TP3 A;  3IBB A;  3ISA A;  3MOY A;  4FZW A;  3H0U A;  4K78 A;  1L6O A;  2W7R A;  4AMH A;  3Q0G A;  3GSL A;  4NNL A;  1JXZ A;  3Q0J A;  4IZB A;  4G2R A;  1QLC A;  1Q3O A;  2M0T A;  1U38 A;  3MH4 A;  3T89 A;  2EEJ A;  2G2L A;  2EEG A;  2R4H A;  1WG6 A;  4FNB A;  5CTC A;  4ELX A;  3BPP A;  2F6Q A;  3HVQ C;  2I6V A;  1SOZ A;  1B8Q A;  1GQ5 A;  1PIX A;  4KPK A;  5E11 A;  3JXT A;  1BE9 A;  1KY9 A;  1PDR A;  2EGN A;  2H3M A;  2KPL A;  1UIY A;  3TRR A;  3OME A;  5EYZ A;  2J5S A;  5E1Y A;  1N6F A;  4Z8J A;  3DIW A;  1WH1 A;  1U37 A;  2AWU A;  1VAE A;  3BEZ A;  1FCF A;  4K76 A;  4LK5 A;  4UU6 A;  3OC7 A;  2M3M A;  1XZ9 A;  3TSV A;  3T8A A;  4YYX A;  2A81 A;  2I1N A;  4JOE A;  2KG2 A;  4JYJ A;  2VPH A;  2UZC A;  4JYL A;  1MFG A;  2QG1 A;  1RY4 A;  4REY A;  2YUY A;  1N7T A;  4NMR A;  5HF1 A;  3L3S A;  3CBX A;  4EMP A;  2ZPL A;  1P1E A;  2CSS A;  5KDR B;  5HFF A;  2K1Z A;  2FW2 A;  2PNT A;  2L97 A;  1WI2 A;  4EDJ A;  1ON3 A;  3H0Q A;  3KTG A;  4KFV A;  2LA8 A;  1J7X A;  3VIV A;  2Z17 A;  3P85 A;  1W9E A;  3AXA A; 
#chains in the Genus database with same CATH topology
 1WDM A;  1TE0 A;  4WCZ A;  3TDC A;  4P0C A;  4Q0G A;  3B76 A;  3M6N A;  4JOP A;  1YG6 A;  1ZOK A;  2KJK A;  1WFG A;  3ZRT A;  4QIJ A;  3DOR A;  5EUX A;  2ZL0 A;  5G1D A;  1OD2 A;  3T8B A;  2VSU C;  2ENO A;  3L4F D;  3VQF A;  4FZW C;  2DAZ A;  1UM7 A;  5CTB A;  2VSV A;  5H3J A;  2ZQR A;  4QII A;  3R9Q A;  3ID1 A;  1WF7 A;  1H4Y A;  4FND A;  1G9O A;  3IH8 A;  3TVU A;  4ZDF A;  1SG4 A;  2DB5 A;  1KWA A;  2VZ5 A;  1N6D A;  3EH7 A;  3GLM A;  5DTP A;  3F43 A;  1NF3 C;  3R6H A;  1SOT A;  1WFV A;  4XHV A;  4FLN A;  2EV8 A;  2JSN A;  5B6L A;  3ZWB A;  4K6Y A;  3LAO A;  5G1E A;  1K32 A;  1UM1 A;  4Q2P A;  3KHF A;  4JOJ A;  2I4S A;  2VSU F;  3MOG A;  3KQF A;  4NXP A;  5HEB A;  1V5Q A;  1Q7X A;  4NMV A;  1UIT A;  1Y8T A;  2PZD A;  1HNU A;  1MJ3 A;  4Q1I A;  1UHP A;  2ZPM A;  4JOF A;  4U19 A;  3FF6 A;  1MFL A;  1N99 A;  1P1D A;  3GCN A;  1XNY A;  1X5N A;  2GEF A;  4OEP A;  3K1R A;  5FUS A;  1H4X A;  2AWX A;  4N6X A;  4J2U A;  5FB8 C;  4ZDE A;  1KEF A;  4MPA A;  3PGQ A;  3KZD A;  3ZXN A;  2DM8 A;  4I4Z A;  4FGM A;  3H81 A;  3R0H A;  2M0U A;  1NZY B;  3HE2 A;  2DJT A;  3MYB A;  5DUF A;  3GGE A;  5DUC A;  2J5I I;  2FN5 A;  3DJA A;  2VSS E;  1OBX A;  3DJ3 A;  5DL1 A;  2WTB A;  2OCS A;  1Q3P A;  2K20 A;  4RI0 A;  4YDP A;  1Y7O A;  5G1R A;  3STJ A;  3GDU A;  2P3W A;  3TZ3 A;  3ZWA A;  3GMA A;  3GKB A;  1TID B;  1WZ8 A;  4I52 A;  1N7E A;  2F9I B;  1PJH A;  4U0H A;  4FN7 A;  4I42 A;  4NMO A;  3K50 A;  3GDS A;  2KOH A;  1W9Q A;  2F9Y A;  2JIK A;  4JFC A;  2D8I A;  1EF8 A;  3TVW A;  2V90 A;  1XNV A;  2OS6 A;  2VSU A;  5ING A;  3GDV A;  4JCT A;  3FY5 A;  1W2X A;  1WHD A;  2M0Z A;  2V1W A;  4RCN A;  5E22 A;  3GK7 A;  4LMM A;  3SFJ A;  1OBZ A;  2QT5 A;  3SLL A;  3BPU A;  3P5M A;  1WF8 A;  4XS5 A;  2D90 A;  2Q2X A;  3ID4 A;  4NMQ A;  3O5N A;  4F47 A;  2DKR A;  2IWQ A;  4NNQ A;  3P2L A;  1TH8 B;  1Q51 A;  1X0U A;  4JWV A;  1LCY A;  4HC8 A;  1EF9 A;  3QXI A;  3IHA A;  5HDY A;  2VRE A;  2YJG A;  4U0G A;  2VSP A;  3CC0 A;  4NMP A;  2EEI A;  1UEP A;  3HPK A;  4IZD A;  5IKL B;  5HFD A;  4DMG A;  1UJU A;  2OQS A;  3N6R B;  2PKU A;  5E0N X;  2E7K A;  2EAQ A;  2G5M B;  2WL7 A;  2H2C A;  2OAS A;  2J5I B;  4K29 A;  1UYS A;  2JOA A;  2CWW A;  2Q9V A;  4MOU A;  2UZF A;  4WYU A;  4JOK A;  4NXQ A;  3PDZ A;  2BZR A;  3RL8 A;  1V0F A;  5A2P A;  3QK8 A;  1TP5 A;  4Q6H A;  3HLN 1;  2JRE A;  2PG8 A;  2VSS A;  2W3P A;  1FC7 A;  1DCI A;  3OT6 A;  1W9O A;  5MGB A;  3OTP A;  2JWE A;  4ZDB A;  1Z87 A;  2QKV A;  3WKL A;  3BPT A;  3ID3 A;  3NFK A;  3IB9 A;  2RRL A;  2CBY A;  5FHT A;  3NGH A;  2FZS A;  3NCV A;  1IHJ A;  3GJ9 A;  3U9T B;  2DLU A;  4U0G H;  3V97 A;  2X7Z A;  1K39 A;  2DUB A;  4QFE A;  4IC6 A;  2KQF A;  2KAW A;  4KNP A;  3H0S A;  2QBW A;  1YBO A;  2RCZ A;  1QAV B;  2X58 A;  2KJP A;  3QRE A;  3LLO A;  3HIN A;  2AIN A;  3KTI A;  2PBP A;  4L8N A;  2IWN A;  1VJ6 A;  3G64 A;  2H3L A;  2KV8 A;  3VQG A;  3SWX A;  5HF4 A;  2F0A A;  4JJT A;  5F3X A;  1I92 A;  1M5Z A;  3R68 A;  4KWB A;  1V5L A;  4JCQ A;  3NY7 A;  5FIF A;  5HED A;  3PEA A;  3V5I A;  5E21 A;  4ELS A;  4K3W A;  3WG5 A;  3H0J A;  4RYF A;  4FN8 A;  2EGO A;  1OD4 A;  2AS0 A;  4JOG A;  2KLN A;  3RSI A;  1SBO A;  1N7F A;  2KJD A;  3PV4 A;  3SHU A;  4Q2Q A;  1X45 A;  5HET A;  2X24 A;  4P2A B;  4NEK A;  2JIL A;  2DMZ A;  2EHR A;  3QIK A;  2KA5 A;  3RL7 A;  1WJL A;  4JSB A;  2CSJ A;  1QAU A;  4KD6 A;  5EUW A;  3TT7 A;  5DKP A;  4ZU2 A;  2GZV A;  3QGL A;  1U3B A;  4KFW A;  4ZDD A;  2LC7 A;  3KTH A;  2I0L A;  2KOM A;  2LOB A;  3HPM A;  5HJ1 A;  5DU8 A;  3ZW9 A;  4WYT A;  2VRF A;  1Q52 A;  1RJN A;  4B3H A;  4HOP B;  1OBY A;  1MC7 A;  2A7S A;  4HNK A;  2F9I A;  4RYF H;  1V62 A;  3U9S B;  3D03 A;  1TQ3 A;  5G1Q A;  2QKT A;  4U18 A;  4QTP A;  1GQ4 A;  4K75 A;  3RLE A;  4U1A A;  4DGH A;  2FNE A;  3QJN A;  4FJW D;  4Z33 A;  3KDK A;  3PV5 A;  1T6R A;  1UJD A;  2CS5 A;  2PDZ A;  4Q2O A;  3SOE A;  4OLQ A;  2JIN A;  2ZQQ A;  1RGW A;  3H02 A;  5HFB A;  1UEQ A;  3LDF A;  3GCO A;  4NMS A;  3V5E A;  1WDL A;  1VB7 A;  2CE3 A;  2QKU A;  3ST9 A;  2OSG A;  2D3T A;  4JL7 A;  4R2Z A;  4YLH A;  2KOJ A;  2VSS F;  2I0I A;  4GVD A;  2D92 A;  1X5Q A;  1EY3 A;  4FB8 A;  2A7K A;  3MH7 A;  3QJM A;  3BF0 A;  4JCR A;  3IH9 A;  4NNM A;  1VA8 A;  1RZX A;  4Q6S A;  2NP9 A;  2HGA A;  3K8X A;  4ASI A;  5EZ0 A;  2KA9 A;  2VWR A;  2Q34 A;  2MX6 A;  3TLF A;  1DUB A;  1UYR A;  1UEZ A;  1BPL A;  4OAJ A;  2PPY A;  4HYL A;  3K82 A;  4DGF A;  3PV2 A;  4ZDC A;  2J5I A;  3NJB A;  5DU6 A;  2IEX A;  3NFL A;  3KTK A;  1X5R A;  2DLS A;  4JCS A;  1YG8 A;  4PQW A;  3I18 A;  3FDU A;  3PZK A;  5EUS A;  2LC6 A;  4F8K A;  5B42 A;  3OU0 A;  3GF7 A;  2F5Y A;  2EDV A;  1H4Z A;  3IAV A;  3Q1T A;  4ELW A;  2ZO9 B;  3R9T A;  1IU0 A;  1Y7N A;  2L4T A;  1IU2 A;  3JU1 A;  3QYR A;  1D5G A;  2IWP A;  1FC9 A;  3LNY A;  2Q35 A;  1O8U A;  4GHN A;  2KBS A;  5E0S A;  1V0E A;  2RRM A;  2F9Y B;  5KDR A;  4IZC A;  2OMJ A;  3I4W A;  2EJ5 A;  5DTH A;  3M6M A;  5G1S A;  3T88 A;  3TSW A;  3DJ1 A;  4OG1 A;  1V6B A;  2HE4 A;  1QAV A;  3KDG A;  3Q7H A;  4JVT A;  3RRV A;  3AGD A;  2L4S A;  2KPK A;  3PDV A;  3CBY A;  2ZOA A;  3STA A;  2BYG A;  1RGR A;  3LKL A;  3O46 A;  3MT6 A;  5F67 A;  2H2B A;  2M0V A;  3QKA A;  5I7Z A;  3GMF A;  3I1E A;  3U9R B;  3QDQ A;  3EGH C;  1UJV A;  3HRX A;  2JXO A;  3TT6 A;  3V8V A;  4G69 A;  4OMR A;  4L8K A;  3ZTB A;  1OZI A;  1U39 A;  2PKT A;  3GAB A;  1VRG A;  2M10 A;  5INI A;  4DI1 A;  2YTW A;  3HP0 A;  2OZF A;  4NXR A;  1WXX A;  3ZWC A;  5C90 A;  4B3J A;  1FC6 A;  2KYL A;  3T3W A;  5E0S H;  1ZUB A;  1UYT A;  2PA1 A;  1BUZ A;  5JBX A;  2F6I A;  4JC0 A;  1X6D A;  2OGP A;  3MFM A;  3IHB A;  1XX4 A;  1THN B;  3QE1 A;  2DC2 A;  2EXG A;  3CBZ A;  4GVC A;  3ID2 A;  3R0O A;  5EZB A;  2W4F A;  3LNX A;  1ON9 A;  5HEY A;  2Q3G A;  3EGG C;  1WHA A;  4K2N A;  3PS4 A;  3GF3 A;  4Q3H A;  1UYV A;  2REY A;  3D3U A;  4EMM A;  3GHF A;  5E6P B;  5IL9 A;  4E3B A;  3SUZ A;  3GVJ A;  1HNO A;  5DZK A;  2AWW A;  1HZD A;  4L6W A;  1TG6 A;  2J5G D;  4JOR A;  1GM1 A;  1WIF A;  4JOT A;  3T6O A;  3QMJ A;  3CH8 A;  4B3I A;  1UEW A;  3PE8 A;  3TV5 A;  4HOP A;  1I16 A;  2KL1 A;  3GVL A;  5C9G A;  1NZY A;  5HUQ A;  1WI4 A;  2EJY A;  2VSU E;  4AEJ A;  2EDP A;  2LUI A;  5D13 A;  5JBW A;  3LKE A;  3TMH A;  1RJM A;  4NMT A;  3QO6 A;  2MHO A;  3CYY A;  2FBM A;  4MI2 A;  3QXZ A;  2OPG A;  1WDK A;  4HIZ A;  5JXB A;  5INF A;  4JJ3 A;  2Z9I A;  1TIL B;  5HFC A;  2VX2 A;  4Z0M A;  3NJD A;  1BFE A;  4MXI A;  3QWD A;  5DZK H;  3CS0 A;  1VCW A;  3QDO A;  5EUU A;  2HW5 A;  5GND A;  2ZL2 A;  3R9S A;  1HF2 A;  5EUZ A;  1Z86 A;  3RST A;  1N6E A;  4Q2N A;  4HDT A;  3TSZ A;  2YUB A;  3WKM A;  2EDZ A;  4E34 A;  2R3Y A;  1UF1 A;  2IWO A;  4K72 A;  3KTJ A;  2FE5 A;  2I04 A;  5GLJ A;  5DTW A;  1V1T A;  1X8S A;  3AGE A;  4OEO A;  2ZL3 A;  2VY9 A;  1NTE A;  4WZ8 B;  2HE2 A;  1T2M A;  1VC1 A;  4GM2 A;  4WYO B;  4UU5 A;  5DU4 A;  5HFE A;  2J5G A;  3SHW A;  2DEO A;  4JOH A;  2EGK A;  1WXW A;  1XNW A;  3ZW8 A;  3KZE A;  1UFX A;  2O2T A;  1X9Z A;  4E35 A;  4O06 A;  2YT7 A;  4EML A;  5KJP A;  3MGL A;  3E17 A;  3GVK A;  2QQ3 A;  2FCF A;  1SZO A;  1R6J A;  2C8T A;  3MH6 A;  2GTR A;  4H11 A;  1XO6 A;  3I47 A;  2ZL4 A;  2KRG A;  1TYF A;  3R69 A;  2EEH A;  2YT8 A;  1TP3 A;  3IBB A;  3ISA A;  3MOY A;  4FZW A;  3H0U A;  4K78 A;  1L6O A;  2W7R A;  4AMH A;  4L1C A;  3Q0G A;  3GSL A;  4NNL A;  1JXZ A;  3Q0J A;  4IZB A;  2DXN A;  4G2R A;  1QLC A;  1Q3O A;  2M0T A;  1U38 A;  3MH4 A;  3T89 A;  2EEJ A;  2G2L A;  2EEG A;  3OIR A;  2R4H A;  1WG6 A;  4FNB A;  5CTC A;  5ILB A;  3BPP A;  4ELX A;  2F6Q A;  3HVQ C;  2I6V A;  1SOZ A;  1B8Q A;  1GQ5 A;  1PIX A;  4KPK A;  5E11 A;  3JXT A;  1BE9 A;  2DXL A;  1KY9 A;  1PDR A;  2EGN A;  2H3M A;  2KPL A;  3JU4 A;  1UIY A;  3TRR A;  3OME A;  5EYZ A;  2J5S A;  5E1Y A;  1N6F A;  4Z8J A;  3DIW A;  4JJ0 A;  1WH1 A;  1U37 A;  2AWU A;  3IF5 A;  1VAE A;  3BEZ A;  1FCF A;  4K76 A;  4LK5 A;  4UU6 A;  3OC7 A;  2M3M A;  1XZ9 A;  3TSV A;  3T8A A;  4YYX A;  2A81 A;  2I1N A;  4JOE A;  2KG2 A;  4JYJ A;  1AUZ A;  2VPH A;  2UZC A;  4JYL A;  1MFG A;  4AE2 A;  2QG1 A;  1RY4 A;  4REY A;  2YUY A;  1N7T A;  4NMR A;  5HF1 A;  3L3S A;  3CBX A;  4NAR A;  4EMP A;  2ZPL A;  1P1E A;  2CSS A;  5KDR B;  5HFF A;  2K1Z A;  3VSE A;  2FW2 A;  2PNT A;  2L97 A;  1WI2 A;  4EDJ A;  3C0K A;  1ON3 A;  3H0Q A;  3DUP A;  3KTG A;  3OIZ A;  2B78 A;  4KFV A;  2LA8 A;  1J7X A;  3VIV A;  2Z17 A;  3P85 A;  1W9E A;  3AXA A; 
#chains in the Genus database with same CATH homology
 1WDM A;  1TE0 A;  4WCZ A;  3TDC A;  4P0C A;  4Q0G A;  3B76 A;  3M6N A;  4JOP A;  1YG6 A;  1ZOK A;  2KJK A;  1WFG A;  3ZRT A;  4QIJ A;  3DOR A;  2ZL0 A;  5G1D A;  1OD2 A;  3T8B A;  2VSU C;  2ENO A;  3L4F D;  3VQF A;  4FZW C;  2DAZ A;  1UM7 A;  5CTB A;  2VSV A;  5H3J A;  2ZQR A;  4QII A;  3R9Q A;  3ID1 A;  1WF7 A;  4FND A;  1G9O A;  3TVU A;  4ZDF A;  1SG4 A;  2DB5 A;  1KWA A;  2VZ5 A;  1N6D A;  3GLM A;  5DTP A;  1NF3 C;  3R6H A;  1SOT A;  1WFV A;  4XHV A;  4FLN A;  2EV8 A;  2JSN A;  5B6L A;  3ZWB A;  4K6Y A;  3LAO A;  5G1E A;  1K32 A;  1UM1 A;  4Q2P A;  3KHF A;  4JOJ A;  2I4S A;  2VSU F;  3MOG A;  3KQF A;  4NXP A;  5HEB A;  1V5Q A;  1Q7X A;  4NMV A;  1UIT A;  1Y8T A;  2PZD A;  1HNU A;  1MJ3 A;  4Q1I A;  1UHP A;  2ZPM A;  4JOF A;  4U19 A;  3FF6 A;  1MFL A;  1N99 A;  1P1D A;  3GCN A;  1XNY A;  1X5N A;  2GEF A;  4OEP A;  3K1R A;  5FUS A;  4J2U A;  2AWX A;  4N6X A;  5FB8 C;  4ZDE A;  1KEF A;  4MPA A;  3PGQ A;  3KZD A;  4I4Z A;  2DM8 A;  4FGM A;  3H81 A;  3R0H A;  2M0U A;  1NZY B;  3HE2 A;  2DJT A;  3MYB A;  5DUF A;  3GGE A;  5DUC A;  2J5I I;  2FN5 A;  3DJA A;  2VSS E;  1OBX A;  3DJ3 A;  5DL1 A;  2WTB A;  2OCS A;  1Q3P A;  2K20 A;  4RI0 A;  4YDP A;  1Y7O A;  5G1R A;  3STJ A;  3GDU A;  2P3W A;  3TZ3 A;  3ZWA A;  3GMA A;  3GKB A;  1WZ8 A;  4I52 A;  1N7E A;  2F9I B;  1PJH A;  4U0H A;  4FN7 A;  4I42 A;  4NMO A;  3K50 A;  3GDS A;  2KOH A;  1W9Q A;  2F9Y A;  2JIK A;  4JFC A;  2D8I A;  1EF8 A;  3TVW A;  2V90 A;  1XNV A;  2OS6 A;  2VSU A;  5ING A;  3GDV A;  4JCT A;  3FY5 A;  1W2X A;  1WHD A;  2M0Z A;  2V1W A;  4RCN A;  5E22 A;  4LMM A;  3SFJ A;  1OBZ A;  2QT5 A;  3SLL A;  3BPU A;  3P5M A;  1WF8 A;  2D90 A;  2Q2X A;  3ID4 A;  4NMQ A;  3O5N A;  4F47 A;  2DKR A;  2IWQ A;  4NNQ A;  3P2L A;  1Q51 A;  1X0U A;  4JWV A;  1LCY A;  4HC8 A;  1EF9 A;  3QXI A;  5HDY A;  2VRE A;  2YJG A;  4U0G A;  2VSP A;  3CC0 A;  4NMP A;  2EEI A;  1UEP A;  3HPK A;  4IZD A;  5IKL B;  5HFD A;  1UJU A;  2OQS A;  3N6R B;  2PKU A;  5E0N X;  2E7K A;  2EAQ A;  2G5M B;  2WL7 A;  2H2C A;  2J5I B;  4K29 A;  1UYS A;  2JOA A;  2Q9V A;  4MOU A;  2UZF A;  4WYU A;  4JOK A;  4NXQ A;  3PDZ A;  2BZR A;  3RL8 A;  3QK8 A;  5A2P A;  1TP5 A;  4Q6H A;  3HLN 1;  2JRE A;  2PG8 A;  2VSS A;  2W3P A;  1FC7 A;  1DCI A;  3OT6 A;  1W9O A;  5MGB A;  3OTP A;  2JWE A;  4ZDB A;  1Z87 A;  2QKV A;  3WKL A;  3BPT A;  3ID3 A;  3NFK A;  3IB9 A;  2RRL A;  2CBY A;  5FHT A;  3NGH A;  2FZS A;  3NCV A;  1IHJ A;  3GJ9 A;  3U9T B;  2DLU A;  4U0G H;  2X7Z A;  1K39 A;  2DUB A;  4QFE A;  4IC6 A;  2KQF A;  2KAW A;  4KNP A;  3H0S A;  2QBW A;  1YBO A;  2RCZ A;  1QAV B;  2X58 A;  2KJP A;  3QRE A;  3HIN A;  2AIN A;  3KTI A;  2PBP A;  4L8N A;  2IWN A;  1VJ6 A;  3G64 A;  2H3L A;  2KV8 A;  3VQG A;  3SWX A;  5HF4 A;  2F0A A;  4JJT A;  5F3X A;  1I92 A;  1M5Z A;  3R68 A;  4KWB A;  1V5L A;  4JCQ A;  5FIF A;  5HED A;  3PEA A;  3V5I A;  5E21 A;  4ELS A;  4K3W A;  3WG5 A;  3H0J A;  4RYF A;  4FN8 A;  2EGO A;  1OD4 A;  4JOG A;  3RSI A;  1N7F A;  2KJD A;  3PV4 A;  3SHU A;  4Q2Q A;  1X45 A;  5HET A;  2X24 A;  4P2A B;  4NEK A;  2JIL A;  2DMZ A;  2EHR A;  3QIK A;  3RL7 A;  1WJL A;  4JSB A;  2CSJ A;  1QAU A;  4KD6 A;  3TT7 A;  5DKP A;  4ZU2 A;  2GZV A;  3QGL A;  1U3B A;  4KFW A;  4ZDD A;  2LC7 A;  3KTH A;  2I0L A;  2KOM A;  2LOB A;  3HPM A;  5HJ1 A;  5DU8 A;  3ZW9 A;  4WYT A;  2VRF A;  1Q52 A;  1RJN A;  4B3H A;  4HOP B;  1OBY A;  1MC7 A;  2A7S A;  4HNK A;  2F9I A;  4RYF H;  1V62 A;  3U9S B;  3D03 A;  1TQ3 A;  5G1Q A;  2QKT A;  4U18 A;  1GQ4 A;  4K75 A;  3RLE A;  4U1A A;  2FNE A;  3QJN A;  4FJW D;  4Z33 A;  3KDK A;  3PV5 A;  1UJD A;  2CS5 A;  2PDZ A;  4Q2O A;  3SOE A;  4OLQ A;  2JIN A;  2ZQQ A;  1RGW A;  3H02 A;  5HFB A;  1UEQ A;  3GCO A;  4NMS A;  3V5E A;  1WDL A;  1VB7 A;  2CE3 A;  2QKU A;  3ST9 A;  2OSG A;  2D3T A;  4JL7 A;  4R2Z A;  4YLH A;  2KOJ A;  2VSS F;  2I0I A;  4GVD A;  2D92 A;  1X5Q A;  1EY3 A;  4FB8 A;  2A7K A;  3MH7 A;  3QJM A;  3BF0 A;  4JCR A;  4NNM A;  1VA8 A;  1RZX A;  4Q6S A;  2NP9 A;  2HGA A;  3K8X A;  4ASI A;  5EZ0 A;  2KA9 A;  2VWR A;  2Q34 A;  2MX6 A;  3TLF A;  1DUB A;  1UYR A;  1UEZ A;  1BPL A;  4OAJ A;  2PPY A;  4ZDC A;  3K82 A;  3PV2 A;  2J5I A;  3NJB A;  5DU6 A;  2IEX A;  3NFL A;  3KTK A;  1X5R A;  2DLS A;  4JCS A;  1YG8 A;  4PQW A;  3I18 A;  3FDU A;  3PZK A;  2LC6 A;  4F8K A;  5B42 A;  3OU0 A;  3GF7 A;  2F5Y A;  2EDV A;  3IAV A;  3Q1T A;  4ELW A;  2ZO9 B;  3R9T A;  1IU0 A;  1Y7N A;  2L4T A;  1IU2 A;  3JU1 A;  3QYR A;  1D5G A;  2IWP A;  1FC9 A;  3LNY A;  2Q35 A;  1O8U A;  4GHN A;  2KBS A;  5E0S A;  2RRM A;  2F9Y B;  5KDR A;  4IZC A;  2OMJ A;  3I4W A;  2EJ5 A;  5DTH A;  3M6M A;  5G1S A;  3T88 A;  3TSW A;  3DJ1 A;  4OG1 A;  1V6B A;  2HE4 A;  1QAV A;  3KDG A;  3Q7H A;  4JVT A;  3RRV A;  2L4S A;  2KPK A;  3PDV A;  3CBY A;  2ZOA A;  3STA A;  2BYG A;  1RGR A;  3O46 A;  3MT6 A;  5F67 A;  2H2B A;  2M0V A;  3QKA A;  5I7Z A;  3GMF A;  3I1E A;  3U9R B;  3EGH C;  1UJV A;  3HRX A;  2JXO A;  3TT6 A;  4G69 A;  4OMR A;  4L8K A;  1OZI A;  1U39 A;  2PKT A;  3GAB A;  1VRG A;  2M10 A;  5INI A;  4DI1 A;  2YTW A;  3HP0 A;  2OZF A;  4NXR A;  3ZWC A;  5C90 A;  4B3J A;  1FC6 A;  2KYL A;  3T3W A;  5E0S H;  1ZUB A;  1UYT A;  2PA1 A;  5JBX A;  2F6I A;  4JC0 A;  1X6D A;  2OGP A;  3MFM A;  1XX4 A;  3QE1 A;  2DC2 A;  2EXG A;  3CBZ A;  4GVC A;  3ID2 A;  3R0O A;  2W4F A;  3LNX A;  1ON9 A;  5HEY A;  2Q3G A;  3EGG C;  1WHA A;  4K2N A;  3PS4 A;  3GF3 A;  4Q3H A;  1UYV A;  2REY A;  4EMM A;  3GHF A;  5E6P B;  5IL9 A;  4E3B A;  3SUZ A;  1HNO A;  5DZK A;  2AWW A;  1HZD A;  4L6W A;  1TG6 A;  2J5G D;  4JOR A;  1GM1 A;  1WIF A;  4JOT A;  3QMJ A;  4B3I A;  3CH8 A;  1UEW A;  3PE8 A;  3TV5 A;  4HOP A;  1I16 A;  2KL1 A;  5C9G A;  1NZY A;  5HUQ A;  1WI4 A;  2EJY A;  2VSU E;  4AEJ A;  2EDP A;  2LUI A;  5D13 A;  5JBW A;  3LKE A;  3TMH A;  1RJM A;  4NMT A;  3QO6 A;  2MHO A;  3CYY A;  2FBM A;  4MI2 A;  3QXZ A;  2OPG A;  1WDK A;  5JXB A;  5INF A;  4JJ3 A;  2Z9I A;  5HFC A;  2VX2 A;  4Z0M A;  3NJD A;  1BFE A;  4MXI A;  3QWD A;  5DZK H;  3CS0 A;  1VCW A;  3QDO A;  2HW5 A;  5GND A;  2ZL2 A;  3R9S A;  1Z86 A;  3RST A;  1N6E A;  4Q2N A;  4HDT A;  3TSZ A;  2YUB A;  3WKM A;  2EDZ A;  4E34 A;  2R3Y A;  1UF1 A;  2IWO A;  4K72 A;  3KTJ A;  2FE5 A;  2I04 A;  5GLJ A;  5DTW A;  1V1T A;  1X8S A;  2ZL3 A;  4OEO A;  4WZ8 B;  1NTE A;  2HE2 A;  1T2M A;  4GM2 A;  4WYO B;  4UU5 A;  5DU4 A;  5HFE A;  2J5G A;  3SHW A;  2DEO A;  4JOH A;  2EGK A;  1XNW A;  3ZW8 A;  3KZE A;  1UFX A;  2O2T A;  1X9Z A;  4E35 A;  4O06 A;  2YT7 A;  4EML A;  5KJP A;  3E17 A;  2QQ3 A;  2FCF A;  1SZO A;  1R6J A;  2C8T A;  3MH6 A;  2GTR A;  4H11 A;  1XO6 A;  3I47 A;  2ZL4 A;  2KRG A;  1TYF A;  3R69 A;  2EEH A;  2YT8 A;  1TP3 A;  3IBB A;  3ISA A;  3MOY A;  4FZW A;  3H0U A;  4K78 A;  1L6O A;  2W7R A;  4AMH A;  4L1C A;  3Q0G A;  3GSL A;  4NNL A;  1JXZ A;  3Q0J A;  4IZB A;  2DXN A;  4G2R A;  1QLC A;  1Q3O A;  2M0T A;  1U38 A;  3MH4 A;  3T89 A;  2EEJ A;  2G2L A;  2EEG A;  2R4H A;  1WG6 A;  4FNB A;  5CTC A;  5ILB A;  3BPP A;  4ELX A;  2F6Q A;  3HVQ C;  2I6V A;  1SOZ A;  1B8Q A;  1GQ5 A;  1PIX A;  4KPK A;  5E11 A;  3JXT A;  1BE9 A;  2DXL A;  1KY9 A;  1PDR A;  2EGN A;  2H3M A;  2KPL A;  1UIY A;  3TRR A;  3OME A;  5EYZ A;  2J5S A;  5E1Y A;  1N6F A;  4Z8J A;  3DIW A;  4JJ0 A;  1WH1 A;  1U37 A;  2AWU A;  1VAE A;  3BEZ A;  1FCF A;  4K76 A;  4LK5 A;  4UU6 A;  3OC7 A;  2M3M A;  1XZ9 A;  3TSV A;  3T8A A;  4YYX A;  2A81 A;  2I1N A;  4JOE A;  2KG2 A;  4JYJ A;  2VPH A;  2UZC A;  4JYL A;  1MFG A;  4AE2 A;  2QG1 A;  1RY4 A;  4REY A;  2YUY A;  1N7T A;  4NMR A;  5HF1 A;  3L3S A;  3CBX A;  4NAR A;  4EMP A;  2ZPL A;  1P1E A;  2CSS A;  5KDR B;  5HFF A;  2K1Z A;  2FW2 A;  2PNT A;  2L97 A;  1WI2 A;  4EDJ A;  1ON3 A;  3H0Q A;  3DUP A;  3KTG A;  4KFV A;  2LA8 A;  1J7X A;  3VIV A;  2Z17 A;  3P85 A;  1W9E A;  3AXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...