1FC7A

Photosystem ii d1 c-terminal processing protease
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
386
structure length
386
Chain Sequence
VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
molecule keywords PHOTOSYSTEM II D1 PROTEASE
total genus 119
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc7A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc7A03
2DKRA 3GMAA 1U39A 2IWQA 1P1EA 1UEPA 3H0JA 2REYA 4NXRA 4KWBA 5G1RA 4FN7A 1XNVA 2YT7A 3GKBA 2KL1A 3KTHA 1WG6A 3TSVA 4QFEA 2LOBA 4JCRA 2VSUF 1K32A 1UEWA 1UFXA 3E17A 3OU0A 2WTBA 4WCZA 1N7FA 5DZKA 3RL8A 1NZYA 4EMMA 1DCIA 5EYZA 2HW5A 2AWWA 2RRMA 2L97A 2MHOA 2UZCA 5E0SA 3R9TA 4ZDDA 5KJPA 3CC0A 1YBOA 2VWRA 2ZL2A 2D8IA 4N6XA 1UM1A 5I7ZA 3QXIA 4NMVA 1BFEA 5B6LA 3R0HA 3R9QA 5E6PB 2CBYA 2OGPA 4OG1A 3EGHC 2A7KA 4L8KA 2K20A 1FCFA 1K39A 2PKTA 2H2BA 3T8BA 3K82A 3PV4A 2H2CA 4U18A 5KDRB 2PG8A 2VPHA 1Q51A 1NF3C 4FZWC 1Y7NA 3QXZA 2D90A 2IEXA 3CYYA 2YUBA 4GM2A 2IWPA 2LA8A 4Q6SA 3DORA 2PDZA 3WKMA 3H0SA 3MT6A 4MXIA 3T8AA 3HP0A 1X45A 2KQFA 3R9SA 1FC9A 3DJ1A 1OZIA 5F3XA 2VX2A 4JOJA 3N6RB 2W7RA 3TVUA 5INGA 2DB5A 2KRGA 3P5MA 3PV2A 3PZKA 4REYA 5FIFA 1OBZA 3TSZA 2JILA 4WYTA 1Z87A 2ZPMA 5DU4A 2I1NA 4NEKA 2F9IA 3V5IA 3K1RA 4Q2NA 3QKAA 2C8TA 1WJLA 1UJDA 2DJTA 3LNXA 4NMTA 2KBSA 5HEDA 1TP3A 2DM8A 1UJVA 3R0OA 1QLCA 4FNDA 3M6NA 2DLUA 3H81A 2ENOA 5C9GA 3IBBA 1NZYB 3STAA 3SHUA 3KQFA 4OLQA 2DEOA 1O8UA 4I4ZA 4JVTA 2D92A 2QG1A 1WF8A 4K3WA 1WDMA 3M6MA 3ZRTA 2I6VA 4GHNA 2H3LA 3JXTA 2BZRA 2KJPA 4OEOA 5DU8A 4HOPB 4Q3HA 3QJNA 1Q3PA 4P0CA 1WDLA 3KTGA 1WHDA 1YG6A 2YT8A 2EEGA 3NJDA 1X6DA 3ID3A 5CTBA 2ZPLA 2W3PA 4Q6HA 5HFDA 2PNTA 2J5GA 1TP5A 5DUFA 2PBPA 3CH8A 1FC6A 3R69A 3T3WA 1VA8A 4FNBA 3TT7A 5H3JA 1UEQA 1UITA 4GVCA 5E22A 4Z0MA 2HGAA 3BF0A 3CBXA 4EMPA 4ELXA 2UZFA 2QKVA 5HETA 2EGKA 3AXAA 2JOAA 2X7ZA 4MPAA 4I42A 3EGGC 2M3MA 2J5II 1UF1A 3LKEA 1WFVA 2V90A 4ELSA 1HNOA 5G1EA 3OC7A 3QGLA 1V5QA 2EDPA 2AWUA 2M0TA 4B3IA 2YTWA 1P1DA 1QAVB 5GNDA 3ZWAA 4NMSA 1Q7XA 4G2RA 1OBYA 1Y8TA 4DI1A 3RLEA 3GDSA 5INFA 2R3YA 3VQGA 3FY5A 4JOEA 4H11A 1DUBA 1Q52A 3VIVA 2EJYA 3CS0A 1I92A 5FHTA 5DKPA 1V6BA 1X0UA 2VZ5A 1EF9A 3MFMA 3DJ3A 5JBWA 1TG6A 1ZUBA 3GF7A 1W2XA 3O46A 3SOEA 4NNLA 3H0UA 1EF8A 2EGOA 1N6EA 5FUSA 4B3HA 3FF6A 3DIWA 1XNWA 3QE1A 3ZWCA 4QIJA 5JXBA 2I04A 3I1EA 3GGEA 4KNPA 4JYLA 4IZBA 1PDRA 2QBWA 1PJHA 1W9EA 2IWOA 2KOMA 3IB9A 3KTIA 3NFKA 1HNUA 4UU6A 3U9TB 2HE2A 3RL7A 1GM1A 1R6JA 5E1YA 2J5IA 2J5SA 1XNYA 1D5GA 4EDJA 2VSSE 4JFCA 3SFJA 3RSTA 3P2LA 2KOJA 4Q2OA 5E0NX 2F9YA 4RYFH 4JOHA 1VAEA 2DMZA 1RGWA 1W9OA 2HE4A 1VCWA 1U3BA 1MFLA 3I4WA 2DUBA 2EGNA 2W4FA 1MFGA 3JU1A 4MI2A 2J5GD 1WDKA 4AMHA 3HE2A 3R6HA 5INIA 1GQ5A 2PPYA 2R4HA 1X8SA 2AINA 2M10A 1N6DA 4K6YA 4U19A 3SWXA 5HF4A 3QJMA 3Q7HA 2EEJA 1SZOA 5DTHA 2AWXA 3GCNA 1MC7A 4FZWA 3KTJA 3PS4A 4RCNA 4QIIA 5FB8C 4O06A 3FDUA 4JWVA 2PA1A 3NFLA 2X58A 1FC7A 5G1DA 1U37A 2EDZA 2KJKA 3ST9A 2K1ZA 5DZKH 2F9YB 2H3MA 4E3BA 4Q1IA 3T89A 2JREA 1WH1A 1I16A 2F6IA 2CSSA 3Q0JA 2L4TA 1ZOKA 2A7SA 4HC8A 2KJDA 1U38A 4RI0A 3KTKA 4E35A 2EJ5A 4WZ8B 4JOGA 4XHVA 1JXZA 2FZSA 1X5RA 2Z17A 1WFGA 4LMMA 5DL1A 4NMPA 2I4SA 2FW2A 3MOYA 3LAOA 3TLFA 3MYBA 5HFBA 3ID4A 4WYUA 2WL7A 2ZQQA 2EDVA 4U0GH 1TE0A 3B76A 1N6FA 1N7EA 2OMJA 2P3WA 2J5IB 4U0GA 4K2NA 1IHJA 1HZDA 4OEPA 5DTWA 1L6OA 2M0UA 1VJ6A 2OPGA 1SOZA 2I0IA 5EZ0A 4ASIA 2VSUE 1SOTA 3I47A 4LK5A 3PDZA 4OMRA 3HLN1 4L6WA 5G1SA 2Q35A 1N99A 4KD6A 2CS5A 1UHPA 1OD4A 4YLHA 4F8KA 5F67A 1WHAA 1WI4A 1UEZA 4U0HA 3HINA 1KWAA 2G5MB 1WF7A 2FCFA 3Q0GA 3V5EA 4YYXA 5HFCA 5A2PA 2KA9A 2F5YA 3QWDA 3DJAA 1RGRA 2VSVA 2ZL4A 2FNEA 3ZW9A 2EXGA 3SUZA 1ON9A 4Z8JA 3TMHA 2OZFA 2KV8A 3GDVA 2FN5A 5HDYA 2KPLA 3NJBA 2EEHA 3QDOA 1XX4A 3PE8A 1KEFA 3ZWBA 3LNYA 3L3SA 2JIKA 3HPKA 4ZDFA 2OQSA 4JJTA 2I0LA 4JCTA 4IZDA 2Q34A 2LC6A 1T2MA 5HEBA 3TT6A 2Q9VA 2M0ZA 3T88A 1RJMA 2F0AA 2O2TA 3P85A 1PIXA 1KY9A 3QO6A 2VRFA 3G64A 5DU6A 4WYOB 3OTPA 3TDCA 3SLLA 3ID1A 3TRRA 2CSJA 2G2LA 2LC7A 4RYFA 5KDRA 1V62A 1M5ZA 2MX6A 3GJ9A 3MH4A 3STJA 1LCYA 2X24A 1UYVA 4ZDCA 1G9OA 3TV5A 3MH6A 2A81A 2KPKA 3TZ3A 2F9IB 3ID2A 4HOPA 2PZDA 1RZXA 1V1TA 4JORA 1UIYA 2CE3A 3HVQC 1SG4A 1WZ8A 2M0VA 1Q3OA 3R68A 3GF3A 4L8NA 4NXPA 1XO6A 2VSSF 4NMQA 2IWNA 5JBXA 1Z86A 1RJNA 1J7XA 2FBMA 3IAVA 2JWEA 3O5NA 5DTPA 4K76A 2F6QA 3U9SB 2EV8A 4IC6A 5HF1A 4R2ZA 2QT5A 2BYGA 2KYLA 4P2AB 1X5NA 2VSSA 3VQFA 4JYJA 2QKUA 5E0SH 2KG2A 1OD2A 1ON3A 4ELWA 3GSLA 2DLSA 2ZQRA 1IU0A 1BE9A 4Q2PA 2D3TA 4FB8A 1GQ4A 2DC2A 2JINA 4YDPA 4JSBA 2GZVA 4I52A 1B8QA 4G69A 1QAUA 1X5QA 3CBZA 3RRVA 1UYSA 3TVWA 5D13A 4U1AA 3BPUA 4KFWA 2EEIA 4JCSA 3PDVA 3KZEA 3ISAA 2KOHA 5CTCA 5GLJA 3QREA 3GCOA 3HPMA 4E34A 3H02A 2KAWA 2DAZA 1UYRA 1UYTA 3NGHA 2OS6A 5HFEA 4KFVA 4NMRA 1WI2A 2E7KA 3TSWA 3I18A 4K78A 4B3JA 4ZU2A 1WIFA 2QKTA 1MJ3A 4F47A 3K8XA 1Y7OA 5C90A 1RY4A 3PEAA 2EHRA 3MH7A 3RSIA 3U9RB 2LUIA 2OCSA 3KHFA 3QK8A 3QMJA 4NNMA 2VSUC 3Q1TA 3GLMA 4Q0GA 1UJUA 3OMEA 3WG5A 3KZDA 4Z33A 3QIKA 4NXQA 1NTEA 5IKLB 1XZ9A 4JL7A 5E11A 1V5LA 2VREA 4JOFA 2ZL3A 2V1WA 4FJWD 3WKLA 1TYFA 3OT6A 4JCQA 2L4SA 2FE5A 5MGBA 2VSUA 1UM7A 2Z9IA 5DUCA 5HEYA 4JOPA 2YUYA 2VSPA 4K29A 1QAVA 4UU5A 1YG8A 3CBYA 4JOKA 3K50A 1VB7A 3H0QA 2ZL0A 3SHWA 2RCZA 4HNKA 2PKUA 2NP9A 4K75A 1W9QA 2QQ3A 3ZW8A 3BPPA 1OBXA 3BEZA 3L4FD 1EY3A 4GVDA 3PGQA 5E21A 3PV5A 4EMLA 1IU2A 3HRXA 4MOUA 3GDUA 4FGMA 4NMOA 2Q2XA 4ZDBA 4IZCA 4FN8A 5HJ1A 4K72A 3QYRA 5G1QA 1N7TA 4NNQA 2GTRA 2OSGA 1TQ3A 4KPKA 2EAQA 2Q3GA 1VRGA 4Q2QA 4JOTA 4OAJA 4PQWA 4ZDEA 5HFFA 2JXOA
chains in the Genus database with same CATH superfamily
2DKRA 3GMAA 1U39A 4FB8A 2IWQA 1P1EA 1UEPA 3H0JA 2REYA 4NXRA 4KWBA 5G1RA 4FN7A 1TIDB 1XNVA 2YT7A 3GKBA 2KL1A 3KTHA 2KLNA 1WG6A 3TSVA 4QFEA 2LOBA 4JCRA 2VSUF 1K32A 1UEWA 1UFXA 3E17A 3OU0A 2WTBA 4WCZA 3MOGA 1N7FA 5DZKA 3RL8A 1NZYA 4EMMA 2ZOAA 1DCIA 5EYZA 3MGLA 2AWWA 2RRMA 3IHBA 2HW5A 2L97A 2MHOA 2UZCA 5E0SA 3R9TA 4ZDDA 5KJPA 3CC0A 1YBOA 2VWRA 2ZL2A 2D8IA 4N6XA 1UM1A 5I7ZA 3QXIA 4NMVA 1BFEA 5B6LA 3R0HA 3R9QA 5E6PB 2CBYA 2OGPA 4OG1A 3EGHC 2A7KA 4L8KA 2K20A 1FCFA 1K39A 2PKTA 2H2BA 3T8BA 3K82A 3PV4A 5EUXA 2H2CA 4U18A 5KDRB 1V0EA 2PG8A 2VPHA 1Q51A 1NF3C 4FZWC 1Y7NA 3QXZA 2D90A 2IEXA 3CYYA 2YUBA 4GM2A 2IWPA 2LA8A 4Q6SA 3DORA 2PDZA 3WKMA 3H0SA 3MT6A 4MXIA 3T8AA 3HP0A 1X45A 3F43A 2KQFA 3R9SA 1FC9A 3DJ1A 1OZIA 5F3XA 2VX2A 4JOJA 3N6RB 2W7RA 3TVUA 5INGA 2DB5A 2KRGA 3P5MA 3PV2A 3PZKA 1THNB 4REYA 5FIFA 1OBZA 3TSZA 2JILA 4WYTA 1Z87A 2ZPMA 5DU4A 2I1NA 4NEKA 2F9IA 3V5IA 3K1RA 4Q2NA 3V97A 2C8TA 3QKAA 1WJLA 1UJDA 2DJTA 3LNXA 4NMTA 2KBSA 5HEDA 1TP3A 2DM8A 1UJVA 3R0OA 1QLCA 4FNDA 3M6NA 2DLUA 3H81A 2ENOA 5C9GA 3IBBA 1NZYB 3STAA 3SHUA 3KQFA 4OLQA 2DEOA 1O8UA 4I4ZA 4JVTA 2D92A 2QG1A 1WF8A 4K3WA 1WDMA 4JC0A 4DGHA 2JSNA 2I6VA 3ZRTA 3M6MA 4GHNA 2H3LA 3JXTA 2BZRA 2KJPA 4OEOA 5DU8A 4HOPB 4Q3HA 3QJNA 1Q3PA 4P0CA 1WDLA 4JJ0A 1WHDA 3KTGA 1YG6A 2YT8A 2EEGA 3NJDA 2GEFA 1X6DA 3ID3A 5CTBA 2ZPLA 2W3PA 4Q6HA 5HFDA 2PNTA 2J5GA 1TP5A 4XS5A 5DUFA 2PBPA 3CH8A 1FC6A 3R69A 3T3WA 1VA8A 4FNBA 3TT7A 5H3JA 1UEQA 1UITA 4GVCA 5E22A 4Z0MA 3NY7A 2HGAA 3BF0A 3CBXA 4EMPA 4QTPA 2UZFA 4ELXA 2QKVA 2DXNA 5HETA 2EGKA 3AXAA 2JOAA 2X7ZA 4MPAA 4I42A 3EGGC 2M3MA 2J5II 1UF1A 3NCVA 3LKEA 1WFVA 2V90A 4ELSA 2VY9A 1HNOA 3ZXNA 5G1EA 3OC7A 3QGLA 3AGEA 1V5QA 2EDPA 2AWUA 3IHAA 2M0TA 4L1CA 2YTWA 1P1DA 4B3IA 1QAVB 5GNDA 3ZWAA 4NMSA 1Q7XA 4G2RA 1OBYA 1TILB 4HYLA 1Y8TA 4DI1A 3RLEA 3GDSA 5INFA 2R3YA 3VQGA 3FY5A 4JOEA 4H11A 1DUBA 3BPTA 1Q52A 2CWWA 3VIVA 2EJYA 3CS0A 1I92A 5FHTA 3ZTBA 5DKPA 3AGDA 1V6BA 1X0UA 2VZ5A 1EF9A 3MFMA 3DJ3A 5JBWA 1TG6A 1ZUBA 3GF7A 1W2XA 3O46A 3SOEA 4NNLA 3VSEA 3H0UA 1EF8A 2EGOA 1N6EA 5FUSA 4B3HA 3FF6A 3DIWA 3LDFA 1XNWA 3QE1A 3ZWCA 4QIJA 5JXBA 2YJGA 2I04A 3I1EA 3GGEA 4KNPA 4JYLA 4IZBA 1PDRA 2QBWA 1PJHA 1W9EA 2IWOA 2KOMA 3IB9A 3KTIA 3NFKA 1HNUA 4UU6A 3U9TB 2HE2A 3RL7A 1GM1A 1R6JA 5E1YA 5ILBA 2J5IA 2J5SA 1XNYA 1D5GA 4EDJA 2VSSE 4JFCA 3SFJA 3RSTA 3P2LA 2KOJA 4Q2OA 5E0NX 2F9YA 1HF2A 4RYFH 4JOHA 1VAEA 2DMZA 1RGWA 1W9OA 2HE4A 1VCWA 1U3BA 1MFLA 3I4WA 2DUBA 2EGNA 2W4FA 1MFGA 3JU1A 2AS0A 2J5GD 1WDKA 4MI2A 4AMHA 3HE2A 3R6HA 5INIA 1GQ5A 4DGFA 2PPYA 2R4HA 1X8SA 2AINA 2M10A 1N6DA 4K6YA 4U19A 3SWXA 5HF4A 3QJMA 3Q7HA 1TH8B 2EEJA 1SZOA 5DTHA 2AWXA 3GCNA 1MC7A 4FZWA 3KTJA 3PS4A 4RCNA 3GMFA 4QIIA 5FB8C 4O06A 3FDUA 4JWVA 2PA1A 3NFLA 3EH7A 2X58A 1FC7A 5G1DA 1U37A 2EDZA 2KJKA 3ST9A 2K1ZA 5HUQA 5DZKH 2F9YB 2H3MA 4E3BA 4Q1IA 3T89A 3GVLA 2JREA 1WH1A 1I16A 2F6IA 2CSSA 3Q0JA 2L4TA 1ZOKA 2A7SA 4HC8A 2KJDA 1U38A 4RI0A 3KTKA 4E35A 4HDTA 2EJ5A 4WZ8B 4AEJA 4JOGA 4XHVA 1JXZA 2FZSA 3T6OA 1X5RA 2Z17A 1WFGA 4LMMA 5DL1A 4NMPA 2I4SA 3IF5A 2FW2A 3MOYA 3LAOA 3TLFA 3MYBA 5HFBA 3ID4A 4WYUA 2WL7A 2ZQQA 2EDVA 1H4ZA 4U0GH 1TE0A 3B76A 1N6FA 1N7EA 2OMJA 2P3WA 2J5IB 4U0GA 4K2NA 1IHJA 1VC1A 1HZDA 4OEPA 2ZO9B 1L6OA 2M0UA 3JU4A 5DTWA 4DMGA 1VJ6A 2OPGA 1SOZA 2I0IA 5EZ0A 4ASIA 2VSUE 1SOTA 2RRLA 3I47A 4LK5A 3PDZA 4OMRA 3HLN1 4L6WA 5G1SA 2Q35A 5IL9A 1N99A 4KD6A 2CS5A 1UHPA 1OD4A 4YLHA 4F8KA 5F67A 1WHAA 5EUUA 1WI4A 1UEZA 4U0HA 3HINA 1KWAA 2G5MB 1WF7A 2FCFA 5B42A 3Q0GA 3V5EA 4YYXA 5HFCA 5A2PA 2KA9A 2F5YA 3QWDA 3DJAA 1RGRA 2VSVA 2ZL4A 2FNEA 3ZW9A 2EXGA 3SUZA 1ON9A 4Z8JA 3TMHA 2OASA 2OZFA 2KV8A 3GDVA 2FN5A 5HDYA 2KPLA 3NJBA 2EEHA 3QDOA 1XX4A 3PE8A 1KEFA 3ZWBA 3LNYA 3L3SA 2JIKA 3HPKA 4ZDFA 2OQSA 4JJTA 2I0LA 1BPLA 1AUZA 4JCTA 4IZDA 2Q34A 2DXLA 2LC6A 1T2MA 5HEBA 3TT6A 2Q9VA 2M0ZA 3T88A 1RJMA 2F0AA 3GVKA 2O2TA 5EUSA 3GABA 3P85A 1PIXA 1H4YA 1KY9A 2VRFA 3QO6A 3G64A 5DU6A 4WYOB 3OTPA 4AE2A 3SLLA 3TDCA 3ID1A 3TRRA 2CSJA 2G2LA 2LC7A 4RYFA 5KDRA 1V62A 1M5ZA 2MX6A 3GJ9A 3MH4A 3STJA 1LCYA 2X24A 1UYVA 4ZDCA 1G9OA 3TV5A 3KDGA 3MH6A 3IH8A 2KPKA 2A81A 3TZ3A 3QDQA 3ID2A 4HOPA 2PZDA 2F9IB 1RZXA 1V1TA 4JORA 1UIYA 2CE3A 3HVQC 1SG4A 1WZ8A 5EZBA 3LKLA 2M0VA 1Q3OA 3R68A 3GF3A 3OIRA 4L8NA 4NXPA 1XO6A 2VSSF 4NMQA 2IWNA 5JBXA 1Z86A 1RJNA 1J7XA 2FBMA 3IAVA 2JWEA 3O5NA 5DTPA 4K76A 2F6QA 3LLOA 3U9SB 3OIZA 2EV8A 4IC6A 5HF1A 4R2ZA 2QT5A 2BYGA 2KYLA 4P2AB 1X5NA 2VSSA 3VQFA 4JYJA 2QKUA 5E0SH 2KG2A 3KDKA 1OD2A 3D03A 1ON3A 4ELWA 3GSLA 2DLSA 2ZQRA 1IU0A 1BE9A 4Q2PA 1T6RA 3IH9A 1GQ4A 2DC2A 2JINA 2D3TA 4YDPA 4JSBA 2GZVA 4I52A 1B8QA 4G69A 1QAUA 1X5QA 3CBZA 3RRVA 1UYSA 3TVWA 5D13A 4U1AA 3BPUA 4KFWA 2EEIA 3DUPA 4JCSA 3PDVA 3KZEA 3ISAA 2KOHA 5CTCA 5GLJA 1V0FA 3QREA 4FLNA 3GCOA 3HPMA 4E34A 3H02A 2KAWA 2DAZA 1UYRA 1UYTA 3NGHA 2OS6A 5HFEA 4KFVA 4NMRA 1WI2A 2KA5A 2E7KA 3TSWA 3I18A 4K78A 4B3JA 4ZU2A 1WIFA 2QKTA 1MJ3A 4F47A 3K8XA 1Y7OA 5C90A 1WXXA 1RY4A 3PEAA 2EHRA 3MH7A 3RSIA 2B78A 3U9RB 2LUIA 2OCSA 3KHFA 3QK8A 1WXWA 3QMJA 4NNMA 5EUZA 2VSUC 3GLMA 3Q1TA 1UJUA 3OMEA 4Q0GA 3WG5A 3KZDA 4Z33A 3QIKA 3GHFA 4NXQA 1NTEA 5IKLB 1X9ZA 1XZ9A 4JL7A 5E11A 1V5LA 2VREA 4JOFA 2ZL3A 2V1WA 4FJWD 3WKLA 1TYFA 3OT6A 4JCQA 2L4SA 2FE5A 1SBOA 5MGBA 2VSUA 1UM7A 2Z9IA 5DUCA 5HEYA 3V8VA 4JOPA 2YUYA 2VSPA 4K29A 1QAVA 4UU5A 1YG8A 3CBYA 4JOKA 4J2UA 3K50A 1VB7A 3H0QA 2ZL0A 3SHWA 1H4XA 2RCZA 4HNKA 2PKUA 2NP9A 4K75A 1W9QA 4JJ3A 2QQ3A 4NARA 3ZW8A 3BPPA 1OBXA 3BEZA 1BUZA 3L4FD 3GK7A 1EY3A 4GVDA 3C0KA 3PGQA 5E21A 3PV5A 5EUWA 4EMLA 1IU2A 3HRXA 4MOUA 3GDUA 4FGMA 4NMOA 2Q2XA 4ZDBA 4IZCA 4FN8A 5HJ1A 4K72A 3QYRA 5G1QA 1N7TA 4HIZA 4NNQA 3D3UA 2GTRA 2OSGA 3GVJA 1TQ3A 4KPKA 2EAQA 2Q3GA 1VRGA 4Q2QA 4JOTA 4OAJA 4PQWA 4ZDEA 5HFFA 2JXOA
chains in the Genus database with same CATH topology
2DKRA 3GMAA 1U39A 2IWQA 1P1EA 1UEPA 3H0JA 2REYA 4NXRA 4KWBA 5G1RA 4FN7A 1XNVA 2YT7A 3GKBA 2KL1A 3KTHA 1WG6A 3TSVA 4QFEA 2LOBA 4JCRA 2VSUF 1K32A 1UEWA 1UFXA 3E17A 3OU0A 2WTBA 4WCZA 3MOGA 1N7FA 5DZKA 3RL8A 1NZYA 4EMMA 2ZOAA 1DCIA 5EYZA 2HW5A 2AWWA 2RRMA 2L97A 2MHOA 2UZCA 5E0SA 3R9TA 4ZDDA 5KJPA 3CC0A 1YBOA 2VWRA 2ZL2A 2D8IA 4N6XA 1UM1A 5I7ZA 3QXIA 4NMVA 1BFEA 5B6LA 3R0HA 3R9QA 5E6PB 2CBYA 2OGPA 4OG1A 3EGHC 2A7KA 4L8KA 2K20A 1FCFA 1K39A 2PKTA 2H2BA 3T8BA 3K82A 3PV4A 2H2CA 4U18A 5KDRB 2PG8A 2VPHA 1Q51A 1NF3C 4FZWC 1Y7NA 3QXZA 2D90A 2IEXA 3CYYA 2YUBA 4GM2A 2IWPA 2LA8A 4Q6SA 3DORA 2PDZA 3WKMA 3H0SA 3MT6A 4MXIA 3T8AA 3HP0A 1X45A 2KQFA 3R9SA 1FC9A 3DJ1A 1OZIA 5F3XA 2VX2A 4JOJA 3N6RB 2W7RA 3TVUA 5INGA 2DB5A 2KRGA 3P5MA 3PV2A 3PZKA 4REYA 5FIFA 1OBZA 3TSZA 2JILA 4WYTA 1Z87A 2ZPMA 5DU4A 2I1NA 4NEKA 2F9IA 3V5IA 3K1RA 4Q2NA 3QKAA 2C8TA 1WJLA 1UJDA 2DJTA 3LNXA 4NMTA 2KBSA 5HEDA 1TP3A 2DM8A 1UJVA 3R0OA 1QLCA 4FNDA 3M6NA 2DLUA 3H81A 2ENOA 5C9GA 3IBBA 1NZYB 3STAA 3SHUA 3KQFA 4OLQA 2DEOA 1O8UA 4I4ZA 4JVTA 2D92A 2QG1A 1WF8A 4K3WA 1WDMA 4JC0A 3M6MA 2JSNA 2I6VA 3ZRTA 4GHNA 2H3LA 3JXTA 2BZRA 2KJPA 4OEOA 5DU8A 4HOPB 4Q3HA 3QJNA 1Q3PA 4P0CA 1WDLA 4JJ0A 1WHDA 3KTGA 1YG6A 2YT8A 2EEGA 3NJDA 2GEFA 1X6DA 3ID3A 5CTBA 2ZPLA 2W3PA 4Q6HA 5HFDA 2PNTA 2J5GA 1TP5A 5DUFA 2PBPA 3CH8A 1FC6A 3R69A 3T3WA 1VA8A 4FNBA 3TT7A 5H3JA 1UEQA 1UITA 4GVCA 5E22A 4Z0MA 2HGAA 3BF0A 3CBXA 4EMPA 4ELXA 2UZFA 2QKVA 2DXNA 5HETA 2EGKA 3AXAA 2JOAA 2X7ZA 4MPAA 4I42A 3EGGC 2M3MA 2J5II 1UF1A 3NCVA 3LKEA 1WFVA 2V90A 4ELSA 1HNOA 5G1EA 3OC7A 3QGLA 1V5QA 2EDPA 2AWUA 2M0TA 4L1CA 2YTWA 1P1DA 4B3IA 1QAVB 5GNDA 3ZWAA 4NMSA 1Q7XA 4G2RA 1OBYA 1Y8TA 4DI1A 3RLEA 3GDSA 5INFA 2R3YA 3VQGA 3FY5A 4JOEA 4H11A 1DUBA 3BPTA 1Q52A 3VIVA 2EJYA 3CS0A 1I92A 5FHTA 5DKPA 1V6BA 1X0UA 2VZ5A 1EF9A 3MFMA 3DJ3A 5JBWA 1TG6A 1ZUBA 3GF7A 1W2XA 3O46A 3SOEA 4NNLA 3H0UA 1EF8A 2EGOA 1N6EA 5FUSA 4B3HA 3FF6A 3DIWA 1XNWA 3QE1A 3ZWCA 4QIJA 5JXBA 2YJGA 2I04A 3I1EA 3GGEA 4KNPA 4JYLA 4IZBA 1PDRA 2QBWA 1PJHA 1W9EA 2IWOA 2KOMA 3IB9A 3KTIA 3NFKA 1HNUA 4UU6A 3U9TB 2HE2A 3RL7A 1GM1A 1R6JA 5E1YA 5ILBA 2J5IA 2J5SA 1XNYA 1D5GA 4EDJA 2VSSE 4JFCA 3SFJA 3RSTA 3P2LA 2KOJA 4Q2OA 5E0NX 2F9YA 4RYFH 4JOHA 1VAEA 2DMZA 1RGWA 1W9OA 2HE4A 1VCWA 1U3BA 1MFLA 3I4WA 2DUBA 2EGNA 2W4FA 1MFGA 3JU1A 4MI2A 2J5GD 1WDKA 4AMHA 3HE2A 3R6HA 5INIA 1GQ5A 2PPYA 2R4HA 1X8SA 2AINA 2M10A 1N6DA 4K6YA 4U19A 3SWXA 5HF4A 3QJMA 3Q7HA 2EEJA 1SZOA 5DTHA 2AWXA 3GCNA 1MC7A 4FZWA 3KTJA 3PS4A 4RCNA 3GMFA 4QIIA 5FB8C 4O06A 3FDUA 4JWVA 2PA1A 3NFLA 2X58A 1FC7A 5G1DA 1U37A 2EDZA 2KJKA 3ST9A 2K1ZA 5HUQA 5DZKH 2F9YB 2H3MA 4E3BA 4Q1IA 3T89A 2JREA 1WH1A 1I16A 2F6IA 2CSSA 3Q0JA 2L4TA 1ZOKA 2A7SA 4HC8A 2KJDA 1U38A 4RI0A 3KTKA 4E35A 4HDTA 2EJ5A 4WZ8B 4AEJA 4JOGA 4XHVA 1JXZA 2FZSA 1X5RA 2Z17A 1WFGA 4LMMA 5DL1A 4NMPA 2I4SA 2FW2A 3MOYA 3LAOA 3TLFA 3MYBA 5HFBA 3ID4A 4WYUA 2WL7A 2ZQQA 2EDVA 4U0GH 1TE0A 3B76A 1N6FA 1N7EA 2OMJA 2P3WA 2J5IB 4U0GA 4K2NA 1IHJA 1HZDA 4OEPA 2ZO9B 1L6OA 2M0UA 5DTWA 1VJ6A 2OPGA 1SOZA 2I0IA 5EZ0A 4ASIA 2VSUE 1SOTA 2RRLA 3I47A 4LK5A 3PDZA 4OMRA 3HLN1 4L6WA 5G1SA 2Q35A 5IL9A 1N99A 4KD6A 2CS5A 1UHPA 1OD4A 4YLHA 4F8KA 5F67A 1WHAA 1WI4A 1UEZA 4U0HA 3HINA 1KWAA 2G5MB 1WF7A 2FCFA 5B42A 3Q0GA 3V5EA 4YYXA 5HFCA 5A2PA 2KA9A 2F5YA 3QWDA 3DJAA 1RGRA 2VSVA 2ZL4A 2FNEA 3ZW9A 2EXGA 3SUZA 1ON9A 4Z8JA 3TMHA 2OZFA 2KV8A 3GDVA 2FN5A 5HDYA 2KPLA 3NJBA 2EEHA 3QDOA 1XX4A 3PE8A 1KEFA 3ZWBA 3LNYA 3L3SA 2JIKA 3HPKA 4ZDFA 2OQSA 4JJTA 2I0LA 1BPLA 4JCTA 4IZDA 2Q34A 2DXLA 2LC6A 1T2MA 5HEBA 3TT6A 2Q9VA 2M0ZA 3T88A 1RJMA 2F0AA 2O2TA 3GABA 3P85A 1PIXA 1KY9A 2VRFA 3QO6A 3G64A 5DU6A 4WYOB 3OTPA 4AE2A 3SLLA 3TDCA 3ID1A 3TRRA 2CSJA 2G2LA 2LC7A 4RYFA 5KDRA 1V62A 1M5ZA 2MX6A 3GJ9A 3MH4A 3STJA 1LCYA 2X24A 1UYVA 4ZDCA 1G9OA 3TV5A 3KDGA 3MH6A 2A81A 2KPKA 3TZ3A 2F9IB 3ID2A 4HOPA 2PZDA 1RZXA 1V1TA 4JORA 1UIYA 2CE3A 3HVQC 1SG4A 1WZ8A 2M0VA 1Q3OA 3R68A 3GF3A 4L8NA 4NXPA 1XO6A 2VSSF 4NMQA 2IWNA 5JBXA 1Z86A 1RJNA 1J7XA 2FBMA 3IAVA 2JWEA 3O5NA 5DTPA 4K76A 2F6QA 3U9SB 2EV8A 4IC6A 5HF1A 4R2ZA 2QT5A 2BYGA 2KYLA 4P2AB 1X5NA 2VSSA 3VQFA 4JYJA 2QKUA 5E0SH 2KG2A 3KDKA 1OD2A 3D03A 1ON3A 4ELWA 3GSLA 2DLSA 2ZQRA 1IU0A 1BE9A 4Q2PA 2D3TA 4FB8A 1GQ4A 2DC2A 2JINA 4YDPA 4JSBA 2GZVA 4I52A 1B8QA 4G69A 1QAUA 1X5QA 3CBZA 3RRVA 1UYSA 3TVWA 5D13A 4U1AA 3BPUA 4KFWA 2EEIA 3DUPA 4JCSA 3PDVA 3KZEA 3ISAA 2KOHA 5CTCA 5GLJA 3QREA 4FLNA 3GCOA 3HPMA 4E34A 3H02A 2KAWA 2DAZA 1UYRA 1UYTA 3NGHA 2OS6A 5HFEA 4KFVA 4NMRA 1WI2A 2E7KA 3TSWA 3I18A 4K78A 4B3JA 4ZU2A 1WIFA 2QKTA 1MJ3A 4F47A 3K8XA 1Y7OA 5C90A 1RY4A 3PEAA 2EHRA 3MH7A 3RSIA 3U9RB 2LUIA 2OCSA 3KHFA 3QK8A 3QMJA 4NNMA 2VSUC 3Q1TA 3GLMA 4Q0GA 1UJUA 3OMEA 3WG5A 3KZDA 4Z33A 3QIKA 3GHFA 4NXQA 1NTEA 5IKLB 1X9ZA 1XZ9A 4JL7A 5E11A 1V5LA 2VREA 4JOFA 2ZL3A 2V1WA 4FJWD 3WKLA 1TYFA 3OT6A 4JCQA 2L4SA 2FE5A 5MGBA 2VSUA 1UM7A 2Z9IA 5DUCA 5HEYA 4JOPA 2YUYA 2VSPA 4K29A 1QAVA 4UU5A 1YG8A 3CBYA 4JOKA 4J2UA 3K50A 1VB7A 3H0QA 2ZL0A 3SHWA 2RCZA 4HNKA 2PKUA 2NP9A 4K75A 1W9QA 4JJ3A 2QQ3A 4NARA 3ZW8A 3BPPA 1OBXA 3BEZA 3L4FD 1EY3A 4GVDA 3PGQA 5E21A 3PV5A 4EMLA 1IU2A 3HRXA 4MOUA 3GDUA 4FGMA 4NMOA 2Q2XA 4ZDBA 4IZCA 4FN8A 5HJ1A 4K72A 3QYRA 5G1QA 1N7TA 4NNQA 2GTRA 2OSGA 1TQ3A 4KPKA 2EAQA 2Q3GA 1VRGA 4Q2QA 4JOTA 4OAJA 4PQWA 4ZDEA 5HFFA 2JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKR A;  3GMA A;  1U39 A;  2IWQ A;  1P1E A;  1UEP A;  3H0J A;  2REY A;  4NXR A;  4KWB A;  5G1R A;  4FN7 A;  1XNV A;  2YT7 A;  3GKB A;  2KL1 A;  3KTH A;  1WG6 A;  3TSV A;  4QFE A;  2LOB A;  4JCR A;  2VSU F;  1K32 A;  1UEW A;  1UFX A;  3E17 A;  3OU0 A;  2WTB A;  4WCZ A;  1N7F A;  5DZK A;  3RL8 A;  1NZY A;  4EMM A;  1DCI A;  5EYZ A;  2HW5 A;  2AWW A;  2RRM A;  2L97 A;  2MHO A;  2UZC A;  5E0S A;  3R9T A;  4ZDD A;  5KJP A;  3CC0 A;  1YBO A;  2VWR A;  2ZL2 A;  2D8I A;  4N6X A;  1UM1 A;  5I7Z A;  3QXI A;  4NMV A;  1BFE A;  5B6L A;  3R0H A;  3R9Q A;  5E6P B;  2CBY A;  2OGP A;  4OG1 A;  3EGH C;  2A7K A;  4L8K A;  2K20 A;  1FCF A;  1K39 A;  2PKT A;  2H2B A;  3T8B A;  3K82 A;  3PV4 A;  2H2C A;  4U18 A;  5KDR B;  2PG8 A;  2VPH A;  1Q51 A;  1NF3 C;  4FZW C;  1Y7N A;  3QXZ A;  2D90 A;  2IEX A;  3CYY A;  2YUB A;  4GM2 A;  2IWP A;  2LA8 A;  4Q6S A;  3DOR A;  2PDZ A;  3WKM A;  3H0S A;  3MT6 A;  4MXI A;  3T8A A;  3HP0 A;  1X45 A;  2KQF A;  3R9S A;  1FC9 A;  3DJ1 A;  1OZI A;  5F3X A;  2VX2 A;  4JOJ A;  3N6R B;  2W7R A;  3TVU A;  5ING A;  2DB5 A;  2KRG A;  3P5M A;  3PV2 A;  3PZK A;  4REY A;  5FIF A;  1OBZ A;  3TSZ A;  2JIL A;  4WYT A;  1Z87 A;  2ZPM A;  5DU4 A;  2I1N A;  4NEK A;  2F9I A;  3V5I A;  3K1R A;  4Q2N A;  3QKA A;  2C8T A;  1WJL A;  1UJD A;  2DJT A;  3LNX A;  4NMT A;  2KBS A;  5HED A;  1TP3 A;  2DM8 A;  1UJV A;  3R0O A;  1QLC A;  4FND A;  3M6N A;  2DLU A;  3H81 A;  2ENO A;  5C9G A;  3IBB A;  1NZY B;  3STA A;  3SHU A;  3KQF A;  4OLQ A;  2DEO A;  1O8U A;  4I4Z A;  4JVT A;  2D92 A;  2QG1 A;  1WF8 A;  4K3W A;  1WDM A;  3M6M A;  3ZRT A;  2I6V A;  4GHN A;  2H3L A;  3JXT A;  2BZR A;  2KJP A;  4OEO A;  5DU8 A;  4HOP B;  4Q3H A;  3QJN A;  1Q3P A;  4P0C A;  1WDL A;  3KTG A;  1WHD A;  1YG6 A;  2YT8 A;  2EEG A;  3NJD A;  1X6D A;  3ID3 A;  5CTB A;  2ZPL A;  2W3P A;  4Q6H A;  5HFD A;  2PNT A;  2J5G A;  1TP5 A;  5DUF A;  2PBP A;  3CH8 A;  1FC6 A;  3R69 A;  3T3W A;  1VA8 A;  4FNB A;  3TT7 A;  5H3J A;  1UEQ A;  1UIT A;  4GVC A;  5E22 A;  4Z0M A;  2HGA A;  3BF0 A;  3CBX A;  4EMP A;  4ELX A;  2UZF A;  2QKV A;  5HET A;  2EGK A;  3AXA A;  2JOA A;  2X7Z A;  4MPA A;  4I42 A;  3EGG C;  2M3M A;  2J5I I;  1UF1 A;  3LKE A;  1WFV A;  2V90 A;  4ELS A;  1HNO A;  5G1E A;  3OC7 A;  3QGL A;  1V5Q A;  2EDP A;  2AWU A;  2M0T A;  4B3I A;  2YTW A;  1P1D A;  1QAV B;  5GND A;  3ZWA A;  4NMS A;  1Q7X A;  4G2R A;  1OBY A;  1Y8T A;  4DI1 A;  3RLE A;  3GDS A;  5INF A;  2R3Y A;  3VQG A;  3FY5 A;  4JOE A;  4H11 A;  1DUB A;  1Q52 A;  3VIV A;  2EJY A;  3CS0 A;  1I92 A;  5FHT A;  5DKP A;  1V6B A;  1X0U A;  2VZ5 A;  1EF9 A;  3MFM A;  3DJ3 A;  5JBW A;  1TG6 A;  1ZUB A;  3GF7 A;  1W2X A;  3O46 A;  3SOE A;  4NNL A;  3H0U A;  1EF8 A;  2EGO A;  1N6E A;  5FUS A;  4B3H A;  3FF6 A;  3DIW A;  1XNW A;  3QE1 A;  3ZWC A;  4QIJ A;  5JXB A;  2I04 A;  3I1E A;  3GGE A;  4KNP A;  4JYL A;  4IZB A;  1PDR A;  2QBW A;  1PJH A;  1W9E A;  2IWO A;  2KOM A;  3IB9 A;  3KTI A;  3NFK A;  1HNU A;  4UU6 A;  3U9T B;  2HE2 A;  3RL7 A;  1GM1 A;  1R6J A;  5E1Y A;  2J5I A;  2J5S A;  1XNY A;  1D5G A;  4EDJ A;  2VSS E;  4JFC A;  3SFJ A;  3RST A;  3P2L A;  2KOJ A;  4Q2O A;  5E0N X;  2F9Y A;  4RYF H;  4JOH A;  1VAE A;  2DMZ A;  1RGW A;  1W9O A;  2HE4 A;  1VCW A;  1U3B A;  1MFL A;  3I4W A;  2DUB A;  2EGN A;  2W4F A;  1MFG A;  3JU1 A;  4MI2 A;  2J5G D;  1WDK A;  4AMH A;  3HE2 A;  3R6H A;  5INI A;  1GQ5 A;  2PPY A;  2R4H A;  1X8S A;  2AIN A;  2M10 A;  1N6D A;  4K6Y A;  4U19 A;  3SWX A;  5HF4 A;  3QJM A;  3Q7H A;  2EEJ A;  1SZO A;  5DTH A;  2AWX A;  3GCN A;  1MC7 A;  4FZW A;  3KTJ A;  3PS4 A;  4RCN A;  4QII A;  5FB8 C;  4O06 A;  3FDU A;  4JWV A;  2PA1 A;  3NFL A;  2X58 A;  1FC7 A;  5G1D A;  1U37 A;  2EDZ A;  2KJK A;  3ST9 A;  2K1Z A;  5DZK H;  2F9Y B;  2H3M A;  4E3B A;  4Q1I A;  3T89 A;  2JRE A;  1WH1 A;  1I16 A;  2F6I A;  2CSS A;  3Q0J A;  2L4T A;  1ZOK A;  2A7S A;  4HC8 A;  2KJD A;  1U38 A;  4RI0 A;  3KTK A;  4E35 A;  2EJ5 A;  4WZ8 B;  4JOG A;  4XHV A;  1JXZ A;  2FZS A;  1X5R A;  2Z17 A;  1WFG A;  4LMM A;  5DL1 A;  4NMP A;  2I4S A;  2FW2 A;  3MOY A;  3LAO A;  3TLF A;  3MYB A;  5HFB A;  3ID4 A;  4WYU A;  2WL7 A;  2ZQQ A;  2EDV A;  4U0G H;  1TE0 A;  3B76 A;  1N6F A;  1N7E A;  2OMJ A;  2P3W A;  2J5I B;  4U0G A;  4K2N A;  1IHJ A;  1HZD A;  4OEP A;  5DTW A;  1L6O A;  2M0U A;  1VJ6 A;  2OPG A;  1SOZ A;  2I0I A;  5EZ0 A;  4ASI A;  2VSU E;  1SOT A;  3I47 A;  4LK5 A;  3PDZ A;  4OMR A;  3HLN 1;  4L6W A;  5G1S A;  2Q35 A;  1N99 A;  4KD6 A;  2CS5 A;  1UHP A;  1OD4 A;  4YLH A;  4F8K A;  5F67 A;  1WHA A;  1WI4 A;  1UEZ A;  4U0H A;  3HIN A;  1KWA A;  2G5M B;  1WF7 A;  2FCF A;  3Q0G A;  3V5E A;  4YYX A;  5HFC A;  5A2P A;  2KA9 A;  2F5Y A;  3QWD A;  3DJA A;  1RGR A;  2VSV A;  2ZL4 A;  2FNE A;  3ZW9 A;  2EXG A;  3SUZ A;  1ON9 A;  4Z8J A;  3TMH A;  2OZF A;  2KV8 A;  3GDV A;  2FN5 A;  5HDY A;  2KPL A;  3NJB A;  2EEH A;  3QDO A;  1XX4 A;  3PE8 A;  1KEF A;  3ZWB A;  3LNY A;  3L3S A;  2JIK A;  3HPK A;  4ZDF A;  2OQS A;  4JJT A;  2I0L A;  4JCT A;  4IZD A;  2Q34 A;  2LC6 A;  1T2M A;  5HEB A;  3TT6 A;  2Q9V A;  2M0Z A;  3T88 A;  1RJM A;  2F0A A;  2O2T A;  3P85 A;  1PIX A;  1KY9 A;  3QO6 A;  2VRF A;  3G64 A;  5DU6 A;  4WYO B;  3OTP A;  3TDC A;  3SLL A;  3ID1 A;  3TRR A;  2CSJ A;  2G2L A;  2LC7 A;  4RYF A;  5KDR A;  1V62 A;  1M5Z A;  2MX6 A;  3GJ9 A;  3MH4 A;  3STJ A;  1LCY A;  2X24 A;  1UYV A;  4ZDC A;  1G9O A;  3TV5 A;  3MH6 A;  2A81 A;  2KPK A;  3TZ3 A;  2F9I B;  3ID2 A;  4HOP A;  2PZD A;  1RZX A;  1V1T A;  4JOR A;  1UIY A;  2CE3 A;  3HVQ C;  1SG4 A;  1WZ8 A;  2M0V A;  1Q3O A;  3R68 A;  3GF3 A;  4L8N A;  4NXP A;  1XO6 A;  2VSS F;  4NMQ A;  2IWN A;  5JBX A;  1Z86 A;  1RJN A;  1J7X A;  2FBM A;  3IAV A;  2JWE A;  3O5N A;  5DTP A;  4K76 A;  2F6Q A;  3U9S B;  2EV8 A;  4IC6 A;  5HF1 A;  4R2Z A;  2QT5 A;  2BYG A;  2KYL A;  4P2A B;  1X5N A;  2VSS A;  3VQF A;  4JYJ A;  2QKU A;  5E0S H;  2KG2 A;  1OD2 A;  1ON3 A;  4ELW A;  3GSL A;  2DLS A;  2ZQR A;  1IU0 A;  1BE9 A;  4Q2P A;  2D3T A;  4FB8 A;  1GQ4 A;  2DC2 A;  2JIN A;  4YDP A;  4JSB A;  2GZV A;  4I52 A;  1B8Q A;  4G69 A;  1QAU A;  1X5Q A;  3CBZ A;  3RRV A;  1UYS A;  3TVW A;  5D13 A;  4U1A A;  3BPU A;  4KFW A;  2EEI A;  4JCS A;  3PDV A;  3KZE A;  3ISA A;  2KOH A;  5CTC A;  5GLJ A;  3QRE A;  3GCO A;  3HPM A;  4E34 A;  3H02 A;  2KAW A;  2DAZ A;  1UYR A;  1UYT A;  3NGH A;  2OS6 A;  5HFE A;  4KFV A;  4NMR A;  1WI2 A;  2E7K A;  3TSW A;  3I18 A;  4K78 A;  4B3J A;  4ZU2 A;  1WIF A;  2QKT A;  1MJ3 A;  4F47 A;  3K8X A;  1Y7O A;  5C90 A;  1RY4 A;  3PEA A;  2EHR A;  3MH7 A;  3RSI A;  3U9R B;  2LUI A;  2OCS A;  3KHF A;  3QK8 A;  3QMJ A;  4NNM A;  2VSU C;  3Q1T A;  3GLM A;  4Q0G A;  1UJU A;  3OME A;  3WG5 A;  3KZD A;  4Z33 A;  3QIK A;  4NXQ A;  1NTE A;  5IKL B;  1XZ9 A;  4JL7 A;  5E11 A;  1V5L A;  2VRE A;  4JOF A;  2ZL3 A;  2V1W A;  4FJW D;  3WKL A;  1TYF A;  3OT6 A;  4JCQ A;  2L4S A;  2FE5 A;  5MGB A;  2VSU A;  1UM7 A;  2Z9I A;  5DUC A;  5HEY A;  4JOP A;  2YUY A;  2VSP A;  4K29 A;  1QAV A;  4UU5 A;  1YG8 A;  3CBY A;  4JOK A;  3K50 A;  1VB7 A;  3H0Q A;  2ZL0 A;  3SHW A;  2RCZ A;  4HNK A;  2PKU A;  2NP9 A;  4K75 A;  1W9Q A;  2QQ3 A;  3ZW8 A;  3BPP A;  1OBX A;  3BEZ A;  3L4F D;  1EY3 A;  4GVD A;  3PGQ A;  5E21 A;  3PV5 A;  4EML A;  1IU2 A;  3HRX A;  4MOU A;  3GDU A;  4FGM A;  4NMO A;  2Q2X A;  4ZDB A;  4IZC A;  4FN8 A;  5HJ1 A;  4K72 A;  3QYR A;  5G1Q A;  1N7T A;  4NNQ A;  2GTR A;  2OSG A;  1TQ3 A;  4KPK A;  2EAQ A;  2Q3G A;  1VRG A;  4Q2Q A;  4JOT A;  4OAJ A;  4PQW A;  4ZDE A;  5HFF A;  2JXO A; 
#chains in the Genus database with same CATH topology
 2DKR A;  3GMA A;  1U39 A;  4FB8 A;  2IWQ A;  1P1E A;  1UEP A;  3H0J A;  2REY A;  4NXR A;  4KWB A;  5G1R A;  4FN7 A;  1TID B;  1XNV A;  2YT7 A;  3GKB A;  2KL1 A;  3KTH A;  2KLN A;  1WG6 A;  3TSV A;  4QFE A;  2LOB A;  4JCR A;  2VSU F;  1K32 A;  1UEW A;  1UFX A;  3E17 A;  3OU0 A;  2WTB A;  4WCZ A;  3MOG A;  1N7F A;  5DZK A;  3RL8 A;  1NZY A;  4EMM A;  2ZOA A;  1DCI A;  5EYZ A;  3MGL A;  2AWW A;  2RRM A;  3IHB A;  2HW5 A;  2L97 A;  2MHO A;  2UZC A;  5E0S A;  3R9T A;  4ZDD A;  5KJP A;  3CC0 A;  1YBO A;  2VWR A;  2ZL2 A;  2D8I A;  4N6X A;  1UM1 A;  5I7Z A;  3QXI A;  4NMV A;  1BFE A;  5B6L A;  3R0H A;  3R9Q A;  5E6P B;  2CBY A;  2OGP A;  4OG1 A;  3EGH C;  2A7K A;  4L8K A;  2K20 A;  1FCF A;  1K39 A;  2PKT A;  2H2B A;  3T8B A;  3K82 A;  3PV4 A;  5EUX A;  2H2C A;  4U18 A;  5KDR B;  1V0E A;  2PG8 A;  2VPH A;  1Q51 A;  1NF3 C;  4FZW C;  1Y7N A;  3QXZ A;  2D90 A;  2IEX A;  3CYY A;  2YUB A;  4GM2 A;  2IWP A;  2LA8 A;  4Q6S A;  3DOR A;  2PDZ A;  3WKM A;  3H0S A;  3MT6 A;  4MXI A;  3T8A A;  3HP0 A;  1X45 A;  3F43 A;  2KQF A;  3R9S A;  1FC9 A;  3DJ1 A;  1OZI A;  5F3X A;  2VX2 A;  4JOJ A;  3N6R B;  2W7R A;  3TVU A;  5ING A;  2DB5 A;  2KRG A;  3P5M A;  3PV2 A;  3PZK A;  1THN B;  4REY A;  5FIF A;  1OBZ A;  3TSZ A;  2JIL A;  4WYT A;  1Z87 A;  2ZPM A;  5DU4 A;  2I1N A;  4NEK A;  2F9I A;  3V5I A;  3K1R A;  4Q2N A;  3V97 A;  2C8T A;  3QKA A;  1WJL A;  1UJD A;  2DJT A;  3LNX A;  4NMT A;  2KBS A;  5HED A;  1TP3 A;  2DM8 A;  1UJV A;  3R0O A;  1QLC A;  4FND A;  3M6N A;  2DLU A;  3H81 A;  2ENO A;  5C9G A;  3IBB A;  1NZY B;  3STA A;  3SHU A;  3KQF A;  4OLQ A;  2DEO A;  1O8U A;  4I4Z A;  4JVT A;  2D92 A;  2QG1 A;  1WF8 A;  4K3W A;  1WDM A;  4JC0 A;  4DGH A;  2JSN A;  2I6V A;  3ZRT A;  3M6M A;  4GHN A;  2H3L A;  3JXT A;  2BZR A;  2KJP A;  4OEO A;  5DU8 A;  4HOP B;  4Q3H A;  3QJN A;  1Q3P A;  4P0C A;  1WDL A;  4JJ0 A;  1WHD A;  3KTG A;  1YG6 A;  2YT8 A;  2EEG A;  3NJD A;  2GEF A;  1X6D A;  3ID3 A;  5CTB A;  2ZPL A;  2W3P A;  4Q6H A;  5HFD A;  2PNT A;  2J5G A;  1TP5 A;  4XS5 A;  5DUF A;  2PBP A;  3CH8 A;  1FC6 A;  3R69 A;  3T3W A;  1VA8 A;  4FNB A;  3TT7 A;  5H3J A;  1UEQ A;  1UIT A;  4GVC A;  5E22 A;  4Z0M A;  3NY7 A;  2HGA A;  3BF0 A;  3CBX A;  4EMP A;  4QTP A;  2UZF A;  4ELX A;  2QKV A;  2DXN A;  5HET A;  2EGK A;  3AXA A;  2JOA A;  2X7Z A;  4MPA A;  4I42 A;  3EGG C;  2M3M A;  2J5I I;  1UF1 A;  3NCV A;  3LKE A;  1WFV A;  2V90 A;  4ELS A;  2VY9 A;  1HNO A;  3ZXN A;  5G1E A;  3OC7 A;  3QGL A;  3AGE A;  1V5Q A;  2EDP A;  2AWU A;  3IHA A;  2M0T A;  4L1C A;  2YTW A;  1P1D A;  4B3I A;  1QAV B;  5GND A;  3ZWA A;  4NMS A;  1Q7X A;  4G2R A;  1OBY A;  1TIL B;  4HYL A;  1Y8T A;  4DI1 A;  3RLE A;  3GDS A;  5INF A;  2R3Y A;  3VQG A;  3FY5 A;  4JOE A;  4H11 A;  1DUB A;  3BPT A;  1Q52 A;  2CWW A;  3VIV A;  2EJY A;  3CS0 A;  1I92 A;  5FHT A;  3ZTB A;  5DKP A;  3AGD A;  1V6B A;  1X0U A;  2VZ5 A;  1EF9 A;  3MFM A;  3DJ3 A;  5JBW A;  1TG6 A;  1ZUB A;  3GF7 A;  1W2X A;  3O46 A;  3SOE A;  4NNL A;  3VSE A;  3H0U A;  1EF8 A;  2EGO A;  1N6E A;  5FUS A;  4B3H A;  3FF6 A;  3DIW A;  3LDF A;  1XNW A;  3QE1 A;  3ZWC A;  4QIJ A;  5JXB A;  2YJG A;  2I04 A;  3I1E A;  3GGE A;  4KNP A;  4JYL A;  4IZB A;  1PDR A;  2QBW A;  1PJH A;  1W9E A;  2IWO A;  2KOM A;  3IB9 A;  3KTI A;  3NFK A;  1HNU A;  4UU6 A;  3U9T B;  2HE2 A;  3RL7 A;  1GM1 A;  1R6J A;  5E1Y A;  5ILB A;  2J5I A;  2J5S A;  1XNY A;  1D5G A;  4EDJ A;  2VSS E;  4JFC A;  3SFJ A;  3RST A;  3P2L A;  2KOJ A;  4Q2O A;  5E0N X;  2F9Y A;  1HF2 A;  4RYF H;  4JOH A;  1VAE A;  2DMZ A;  1RGW A;  1W9O A;  2HE4 A;  1VCW A;  1U3B A;  1MFL A;  3I4W A;  2DUB A;  2EGN A;  2W4F A;  1MFG A;  3JU1 A;  2AS0 A;  2J5G D;  1WDK A;  4MI2 A;  4AMH A;  3HE2 A;  3R6H A;  5INI A;  1GQ5 A;  4DGF A;  2PPY A;  2R4H A;  1X8S A;  2AIN A;  2M10 A;  1N6D A;  4K6Y A;  4U19 A;  3SWX A;  5HF4 A;  3QJM A;  3Q7H A;  1TH8 B;  2EEJ A;  1SZO A;  5DTH A;  2AWX A;  3GCN A;  1MC7 A;  4FZW A;  3KTJ A;  3PS4 A;  4RCN A;  3GMF A;  4QII A;  5FB8 C;  4O06 A;  3FDU A;  4JWV A;  2PA1 A;  3NFL A;  3EH7 A;  2X58 A;  1FC7 A;  5G1D A;  1U37 A;  2EDZ A;  2KJK A;  3ST9 A;  2K1Z A;  5HUQ A;  5DZK H;  2F9Y B;  2H3M A;  4E3B A;  4Q1I A;  3T89 A;  3GVL A;  2JRE A;  1WH1 A;  1I16 A;  2F6I A;  2CSS A;  3Q0J A;  2L4T A;  1ZOK A;  2A7S A;  4HC8 A;  2KJD A;  1U38 A;  4RI0 A;  3KTK A;  4E35 A;  4HDT A;  2EJ5 A;  4WZ8 B;  4AEJ A;  4JOG A;  4XHV A;  1JXZ A;  2FZS A;  3T6O A;  1X5R A;  2Z17 A;  1WFG A;  4LMM A;  5DL1 A;  4NMP A;  2I4S A;  3IF5 A;  2FW2 A;  3MOY A;  3LAO A;  3TLF A;  3MYB A;  5HFB A;  3ID4 A;  4WYU A;  2WL7 A;  2ZQQ A;  2EDV A;  1H4Z A;  4U0G H;  1TE0 A;  3B76 A;  1N6F A;  1N7E A;  2OMJ A;  2P3W A;  2J5I B;  4U0G A;  4K2N A;  1IHJ A;  1VC1 A;  1HZD A;  4OEP A;  2ZO9 B;  1L6O A;  2M0U A;  3JU4 A;  5DTW A;  4DMG A;  1VJ6 A;  2OPG A;  1SOZ A;  2I0I A;  5EZ0 A;  4ASI A;  2VSU E;  1SOT A;  2RRL A;  3I47 A;  4LK5 A;  3PDZ A;  4OMR A;  3HLN 1;  4L6W A;  5G1S A;  2Q35 A;  5IL9 A;  1N99 A;  4KD6 A;  2CS5 A;  1UHP A;  1OD4 A;  4YLH A;  4F8K A;  5F67 A;  1WHA A;  5EUU A;  1WI4 A;  1UEZ A;  4U0H A;  3HIN A;  1KWA A;  2G5M B;  1WF7 A;  2FCF A;  5B42 A;  3Q0G A;  3V5E A;  4YYX A;  5HFC A;  5A2P A;  2KA9 A;  2F5Y A;  3QWD A;  3DJA A;  1RGR A;  2VSV A;  2ZL4 A;  2FNE A;  3ZW9 A;  2EXG A;  3SUZ A;  1ON9 A;  4Z8J A;  3TMH A;  2OAS A;  2OZF A;  2KV8 A;  3GDV A;  2FN5 A;  5HDY A;  2KPL A;  3NJB A;  2EEH A;  3QDO A;  1XX4 A;  3PE8 A;  1KEF A;  3ZWB A;  3LNY A;  3L3S A;  2JIK A;  3HPK A;  4ZDF A;  2OQS A;  4JJT A;  2I0L A;  1BPL A;  1AUZ A;  4JCT A;  4IZD A;  2Q34 A;  2DXL A;  2LC6 A;  1T2M A;  5HEB A;  3TT6 A;  2Q9V A;  2M0Z A;  3T88 A;  1RJM A;  2F0A A;  3GVK A;  2O2T A;  5EUS A;  3GAB A;  3P85 A;  1PIX A;  1H4Y A;  1KY9 A;  2VRF A;  3QO6 A;  3G64 A;  5DU6 A;  4WYO B;  3OTP A;  4AE2 A;  3SLL A;  3TDC A;  3ID1 A;  3TRR A;  2CSJ A;  2G2L A;  2LC7 A;  4RYF A;  5KDR A;  1V62 A;  1M5Z A;  2MX6 A;  3GJ9 A;  3MH4 A;  3STJ A;  1LCY A;  2X24 A;  1UYV A;  4ZDC A;  1G9O A;  3TV5 A;  3KDG A;  3MH6 A;  3IH8 A;  2KPK A;  2A81 A;  3TZ3 A;  3QDQ A;  3ID2 A;  4HOP A;  2PZD A;  2F9I B;  1RZX A;  1V1T A;  4JOR A;  1UIY A;  2CE3 A;  3HVQ C;  1SG4 A;  1WZ8 A;  5EZB A;  3LKL A;  2M0V A;  1Q3O A;  3R68 A;  3GF3 A;  3OIR A;  4L8N A;  4NXP A;  1XO6 A;  2VSS F;  4NMQ A;  2IWN A;  5JBX A;  1Z86 A;  1RJN A;  1J7X A;  2FBM A;  3IAV A;  2JWE A;  3O5N A;  5DTP A;  4K76 A;  2F6Q A;  3LLO A;  3U9S B;  3OIZ A;  2EV8 A;  4IC6 A;  5HF1 A;  4R2Z A;  2QT5 A;  2BYG A;  2KYL A;  4P2A B;  1X5N A;  2VSS A;  3VQF A;  4JYJ A;  2QKU A;  5E0S H;  2KG2 A;  3KDK A;  1OD2 A;  3D03 A;  1ON3 A;  4ELW A;  3GSL A;  2DLS A;  2ZQR A;  1IU0 A;  1BE9 A;  4Q2P A;  1T6R A;  3IH9 A;  1GQ4 A;  2DC2 A;  2JIN A;  2D3T A;  4YDP A;  4JSB A;  2GZV A;  4I52 A;  1B8Q A;  4G69 A;  1QAU A;  1X5Q A;  3CBZ A;  3RRV A;  1UYS A;  3TVW A;  5D13 A;  4U1A A;  3BPU A;  4KFW A;  2EEI A;  3DUP A;  4JCS A;  3PDV A;  3KZE A;  3ISA A;  2KOH A;  5CTC A;  5GLJ A;  1V0F A;  3QRE A;  4FLN A;  3GCO A;  3HPM A;  4E34 A;  3H02 A;  2KAW A;  2DAZ A;  1UYR A;  1UYT A;  3NGH A;  2OS6 A;  5HFE A;  4KFV A;  4NMR A;  1WI2 A;  2KA5 A;  2E7K A;  3TSW A;  3I18 A;  4K78 A;  4B3J A;  4ZU2 A;  1WIF A;  2QKT A;  1MJ3 A;  4F47 A;  3K8X A;  1Y7O A;  5C90 A;  1WXX A;  1RY4 A;  3PEA A;  2EHR A;  3MH7 A;  3RSI A;  2B78 A;  3U9R B;  2LUI A;  2OCS A;  3KHF A;  3QK8 A;  1WXW A;  3QMJ A;  4NNM A;  5EUZ A;  2VSU C;  3GLM A;  3Q1T A;  1UJU A;  3OME A;  4Q0G A;  3WG5 A;  3KZD A;  4Z33 A;  3QIK A;  3GHF A;  4NXQ A;  1NTE A;  5IKL B;  1X9Z A;  1XZ9 A;  4JL7 A;  5E11 A;  1V5L A;  2VRE A;  4JOF A;  2ZL3 A;  2V1W A;  4FJW D;  3WKL A;  1TYF A;  3OT6 A;  4JCQ A;  2L4S A;  2FE5 A;  1SBO A;  5MGB A;  2VSU A;  1UM7 A;  2Z9I A;  5DUC A;  5HEY A;  3V8V A;  4JOP A;  2YUY A;  2VSP A;  4K29 A;  1QAV A;  4UU5 A;  1YG8 A;  3CBY A;  4JOK A;  4J2U A;  3K50 A;  1VB7 A;  3H0Q A;  2ZL0 A;  3SHW A;  1H4X A;  2RCZ A;  4HNK A;  2PKU A;  2NP9 A;  4K75 A;  1W9Q A;  4JJ3 A;  2QQ3 A;  4NAR A;  3ZW8 A;  3BPP A;  1OBX A;  3BEZ A;  1BUZ A;  3L4F D;  3GK7 A;  1EY3 A;  4GVD A;  3C0K A;  3PGQ A;  5E21 A;  3PV5 A;  5EUW A;  4EML A;  1IU2 A;  3HRX A;  4MOU A;  3GDU A;  4FGM A;  4NMO A;  2Q2X A;  4ZDB A;  4IZC A;  4FN8 A;  5HJ1 A;  4K72 A;  3QYR A;  5G1Q A;  1N7T A;  4HIZ A;  4NNQ A;  3D3U A;  2GTR A;  2OSG A;  3GVJ A;  1TQ3 A;  4KPK A;  2EAQ A;  2Q3G A;  1VRG A;  4Q2Q A;  4JOT A;  4OAJ A;  4PQW A;  4ZDE A;  5HFF A;  2JXO A; 
#chains in the Genus database with same CATH homology
 2DKR A;  3GMA A;  1U39 A;  2IWQ A;  1P1E A;  1UEP A;  3H0J A;  2REY A;  4NXR A;  4KWB A;  5G1R A;  4FN7 A;  1XNV A;  2YT7 A;  3GKB A;  2KL1 A;  3KTH A;  1WG6 A;  3TSV A;  4QFE A;  2LOB A;  4JCR A;  2VSU F;  1K32 A;  1UEW A;  1UFX A;  3E17 A;  3OU0 A;  2WTB A;  4WCZ A;  3MOG A;  1N7F A;  5DZK A;  3RL8 A;  1NZY A;  4EMM A;  2ZOA A;  1DCI A;  5EYZ A;  2HW5 A;  2AWW A;  2RRM A;  2L97 A;  2MHO A;  2UZC A;  5E0S A;  3R9T A;  4ZDD A;  5KJP A;  3CC0 A;  1YBO A;  2VWR A;  2ZL2 A;  2D8I A;  4N6X A;  1UM1 A;  5I7Z A;  3QXI A;  4NMV A;  1BFE A;  5B6L A;  3R0H A;  3R9Q A;  5E6P B;  2CBY A;  2OGP A;  4OG1 A;  3EGH C;  2A7K A;  4L8K A;  2K20 A;  1FCF A;  1K39 A;  2PKT A;  2H2B A;  3T8B A;  3K82 A;  3PV4 A;  2H2C A;  4U18 A;  5KDR B;  2PG8 A;  2VPH A;  1Q51 A;  1NF3 C;  4FZW C;  1Y7N A;  3QXZ A;  2D90 A;  2IEX A;  3CYY A;  2YUB A;  4GM2 A;  2IWP A;  2LA8 A;  4Q6S A;  3DOR A;  2PDZ A;  3WKM A;  3H0S A;  3MT6 A;  4MXI A;  3T8A A;  3HP0 A;  1X45 A;  2KQF A;  3R9S A;  1FC9 A;  3DJ1 A;  1OZI A;  5F3X A;  2VX2 A;  4JOJ A;  3N6R B;  2W7R A;  3TVU A;  5ING A;  2DB5 A;  2KRG A;  3P5M A;  3PV2 A;  3PZK A;  4REY A;  5FIF A;  1OBZ A;  3TSZ A;  2JIL A;  4WYT A;  1Z87 A;  2ZPM A;  5DU4 A;  2I1N A;  4NEK A;  2F9I A;  3V5I A;  3K1R A;  4Q2N A;  3QKA A;  2C8T A;  1WJL A;  1UJD A;  2DJT A;  3LNX A;  4NMT A;  2KBS A;  5HED A;  1TP3 A;  2DM8 A;  1UJV A;  3R0O A;  1QLC A;  4FND A;  3M6N A;  2DLU A;  3H81 A;  2ENO A;  5C9G A;  3IBB A;  1NZY B;  3STA A;  3SHU A;  3KQF A;  4OLQ A;  2DEO A;  1O8U A;  4I4Z A;  4JVT A;  2D92 A;  2QG1 A;  1WF8 A;  4K3W A;  1WDM A;  4JC0 A;  3M6M A;  2JSN A;  2I6V A;  3ZRT A;  4GHN A;  2H3L A;  3JXT A;  2BZR A;  2KJP A;  4OEO A;  5DU8 A;  4HOP B;  4Q3H A;  3QJN A;  1Q3P A;  4P0C A;  1WDL A;  4JJ0 A;  1WHD A;  3KTG A;  1YG6 A;  2YT8 A;  2EEG A;  3NJD A;  2GEF A;  1X6D A;  3ID3 A;  5CTB A;  2ZPL A;  2W3P A;  4Q6H A;  5HFD A;  2PNT A;  2J5G A;  1TP5 A;  5DUF A;  2PBP A;  3CH8 A;  1FC6 A;  3R69 A;  3T3W A;  1VA8 A;  4FNB A;  3TT7 A;  5H3J A;  1UEQ A;  1UIT A;  4GVC A;  5E22 A;  4Z0M A;  2HGA A;  3BF0 A;  3CBX A;  4EMP A;  4ELX A;  2UZF A;  2QKV A;  2DXN A;  5HET A;  2EGK A;  3AXA A;  2JOA A;  2X7Z A;  4MPA A;  4I42 A;  3EGG C;  2M3M A;  2J5I I;  1UF1 A;  3NCV A;  3LKE A;  1WFV A;  2V90 A;  4ELS A;  1HNO A;  5G1E A;  3OC7 A;  3QGL A;  1V5Q A;  2EDP A;  2AWU A;  2M0T A;  4L1C A;  2YTW A;  1P1D A;  4B3I A;  1QAV B;  5GND A;  3ZWA A;  4NMS A;  1Q7X A;  4G2R A;  1OBY A;  1Y8T A;  4DI1 A;  3RLE A;  3GDS A;  5INF A;  2R3Y A;  3VQG A;  3FY5 A;  4JOE A;  4H11 A;  1DUB A;  3BPT A;  1Q52 A;  3VIV A;  2EJY A;  3CS0 A;  1I92 A;  5FHT A;  5DKP A;  1V6B A;  1X0U A;  2VZ5 A;  1EF9 A;  3MFM A;  3DJ3 A;  5JBW A;  1TG6 A;  1ZUB A;  3GF7 A;  1W2X A;  3O46 A;  3SOE A;  4NNL A;  3H0U A;  1EF8 A;  2EGO A;  1N6E A;  5FUS A;  4B3H A;  3FF6 A;  3DIW A;  1XNW A;  3QE1 A;  3ZWC A;  4QIJ A;  5JXB A;  2YJG A;  2I04 A;  3I1E A;  3GGE A;  4KNP A;  4JYL A;  4IZB A;  1PDR A;  2QBW A;  1PJH A;  1W9E A;  2IWO A;  2KOM A;  3IB9 A;  3KTI A;  3NFK A;  1HNU A;  4UU6 A;  3U9T B;  2HE2 A;  3RL7 A;  1GM1 A;  1R6J A;  5E1Y A;  5ILB A;  2J5I A;  2J5S A;  1XNY A;  1D5G A;  4EDJ A;  2VSS E;  4JFC A;  3SFJ A;  3RST A;  3P2L A;  2KOJ A;  4Q2O A;  5E0N X;  2F9Y A;  4RYF H;  4JOH A;  1VAE A;  2DMZ A;  1RGW A;  1W9O A;  2HE4 A;  1VCW A;  1U3B A;  1MFL A;  3I4W A;  2DUB A;  2EGN A;  2W4F A;  1MFG A;  3JU1 A;  4MI2 A;  2J5G D;  1WDK A;  4AMH A;  3HE2 A;  3R6H A;  5INI A;  1GQ5 A;  2PPY A;  2R4H A;  1X8S A;  2AIN A;  2M10 A;  1N6D A;  4K6Y A;  4U19 A;  3SWX A;  5HF4 A;  3QJM A;  3Q7H A;  2EEJ A;  1SZO A;  5DTH A;  2AWX A;  3GCN A;  1MC7 A;  4FZW A;  3KTJ A;  3PS4 A;  4RCN A;  3GMF A;  4QII A;  5FB8 C;  4O06 A;  3FDU A;  4JWV A;  2PA1 A;  3NFL A;  2X58 A;  1FC7 A;  5G1D A;  1U37 A;  2EDZ A;  2KJK A;  3ST9 A;  2K1Z A;  5HUQ A;  5DZK H;  2F9Y B;  2H3M A;  4E3B A;  4Q1I A;  3T89 A;  2JRE A;  1WH1 A;  1I16 A;  2F6I A;  2CSS A;  3Q0J A;  2L4T A;  1ZOK A;  2A7S A;  4HC8 A;  2KJD A;  1U38 A;  4RI0 A;  3KTK A;  4E35 A;  4HDT A;  2EJ5 A;  4WZ8 B;  4AEJ A;  4JOG A;  4XHV A;  1JXZ A;  2FZS A;  1X5R A;  2Z17 A;  1WFG A;  4LMM A;  5DL1 A;  4NMP A;  2I4S A;  2FW2 A;  3MOY A;  3LAO A;  3TLF A;  3MYB A;  5HFB A;  3ID4 A;  4WYU A;  2WL7 A;  2ZQQ A;  2EDV A;  4U0G H;  1TE0 A;  3B76 A;  1N6F A;  1N7E A;  2OMJ A;  2P3W A;  2J5I B;  4U0G A;  4K2N A;  1IHJ A;  1HZD A;  4OEP A;  2ZO9 B;  1L6O A;  2M0U A;  5DTW A;  1VJ6 A;  2OPG A;  1SOZ A;  2I0I A;  5EZ0 A;  4ASI A;  2VSU E;  1SOT A;  2RRL A;  3I47 A;  4LK5 A;  3PDZ A;  4OMR A;  3HLN 1;  4L6W A;  5G1S A;  2Q35 A;  5IL9 A;  1N99 A;  4KD6 A;  2CS5 A;  1UHP A;  1OD4 A;  4YLH A;  4F8K A;  5F67 A;  1WHA A;  1WI4 A;  1UEZ A;  4U0H A;  3HIN A;  1KWA A;  2G5M B;  1WF7 A;  2FCF A;  5B42 A;  3Q0G A;  3V5E A;  4YYX A;  5HFC A;  5A2P A;  2KA9 A;  2F5Y A;  3QWD A;  3DJA A;  1RGR A;  2VSV A;  2ZL4 A;  2FNE A;  3ZW9 A;  2EXG A;  3SUZ A;  1ON9 A;  4Z8J A;  3TMH A;  2OZF A;  2KV8 A;  3GDV A;  2FN5 A;  5HDY A;  2KPL A;  3NJB A;  2EEH A;  3QDO A;  1XX4 A;  3PE8 A;  1KEF A;  3ZWB A;  3LNY A;  3L3S A;  2JIK A;  3HPK A;  4ZDF A;  2OQS A;  4JJT A;  2I0L A;  1BPL A;  4JCT A;  4IZD A;  2Q34 A;  2DXL A;  2LC6 A;  1T2M A;  5HEB A;  3TT6 A;  2Q9V A;  2M0Z A;  3T88 A;  1RJM A;  2F0A A;  2O2T A;  3GAB A;  3P85 A;  1PIX A;  1KY9 A;  2VRF A;  3QO6 A;  3G64 A;  5DU6 A;  4WYO B;  3OTP A;  4AE2 A;  3SLL A;  3TDC A;  3ID1 A;  3TRR A;  2CSJ A;  2G2L A;  2LC7 A;  4RYF A;  5KDR A;  1V62 A;  1M5Z A;  2MX6 A;  3GJ9 A;  3MH4 A;  3STJ A;  1LCY A;  2X24 A;  1UYV A;  4ZDC A;  1G9O A;  3TV5 A;  3KDG A;  3MH6 A;  2A81 A;  2KPK A;  3TZ3 A;  2F9I B;  3ID2 A;  4HOP A;  2PZD A;  1RZX A;  1V1T A;  4JOR A;  1UIY A;  2CE3 A;  3HVQ C;  1SG4 A;  1WZ8 A;  2M0V A;  1Q3O A;  3R68 A;  3GF3 A;  4L8N A;  4NXP A;  1XO6 A;  2VSS F;  4NMQ A;  2IWN A;  5JBX A;  1Z86 A;  1RJN A;  1J7X A;  2FBM A;  3IAV A;  2JWE A;  3O5N A;  5DTP A;  4K76 A;  2F6Q A;  3U9S B;  2EV8 A;  4IC6 A;  5HF1 A;  4R2Z A;  2QT5 A;  2BYG A;  2KYL A;  4P2A B;  1X5N A;  2VSS A;  3VQF A;  4JYJ A;  2QKU A;  5E0S H;  2KG2 A;  3KDK A;  1OD2 A;  3D03 A;  1ON3 A;  4ELW A;  3GSL A;  2DLS A;  2ZQR A;  1IU0 A;  1BE9 A;  4Q2P A;  2D3T A;  4FB8 A;  1GQ4 A;  2DC2 A;  2JIN A;  4YDP A;  4JSB A;  2GZV A;  4I52 A;  1B8Q A;  4G69 A;  1QAU A;  1X5Q A;  3CBZ A;  3RRV A;  1UYS A;  3TVW A;  5D13 A;  4U1A A;  3BPU A;  4KFW A;  2EEI A;  3DUP A;  4JCS A;  3PDV A;  3KZE A;  3ISA A;  2KOH A;  5CTC A;  5GLJ A;  3QRE A;  4FLN A;  3GCO A;  3HPM A;  4E34 A;  3H02 A;  2KAW A;  2DAZ A;  1UYR A;  1UYT A;  3NGH A;  2OS6 A;  5HFE A;  4KFV A;  4NMR A;  1WI2 A;  2E7K A;  3TSW A;  3I18 A;  4K78 A;  4B3J A;  4ZU2 A;  1WIF A;  2QKT A;  1MJ3 A;  4F47 A;  3K8X A;  1Y7O A;  5C90 A;  1RY4 A;  3PEA A;  2EHR A;  3MH7 A;  3RSI A;  3U9R B;  2LUI A;  2OCS A;  3KHF A;  3QK8 A;  3QMJ A;  4NNM A;  2VSU C;  3Q1T A;  3GLM A;  4Q0G A;  1UJU A;  3OME A;  3WG5 A;  3KZD A;  4Z33 A;  3QIK A;  3GHF A;  4NXQ A;  1NTE A;  5IKL B;  1X9Z A;  1XZ9 A;  4JL7 A;  5E11 A;  1V5L A;  2VRE A;  4JOF A;  2ZL3 A;  2V1W A;  4FJW D;  3WKL A;  1TYF A;  3OT6 A;  4JCQ A;  2L4S A;  2FE5 A;  5MGB A;  2VSU A;  1UM7 A;  2Z9I A;  5DUC A;  5HEY A;  4JOP A;  2YUY A;  2VSP A;  4K29 A;  1QAV A;  4UU5 A;  1YG8 A;  3CBY A;  4JOK A;  4J2U A;  3K50 A;  1VB7 A;  3H0Q A;  2ZL0 A;  3SHW A;  2RCZ A;  4HNK A;  2PKU A;  2NP9 A;  4K75 A;  1W9Q A;  4JJ3 A;  2QQ3 A;  4NAR A;  3ZW8 A;  3BPP A;  1OBX A;  3BEZ A;  3L4F D;  1EY3 A;  4GVD A;  3PGQ A;  5E21 A;  3PV5 A;  4EML A;  1IU2 A;  3HRX A;  4MOU A;  3GDU A;  4FGM A;  4NMO A;  2Q2X A;  4ZDB A;  4IZC A;  4FN8 A;  5HJ1 A;  4K72 A;  3QYR A;  5G1Q A;  1N7T A;  4NNQ A;  2GTR A;  2OSG A;  1TQ3 A;  4KPK A;  2EAQ A;  2Q3G A;  1VRG A;  4Q2Q A;  4JOT A;  4OAJ A;  4PQW A;  4ZDE A;  5HFF A;  2JXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...