1FC7A

Photosystem ii d1 c-terminal processing protease
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
386
structure length
386
Chain Sequence
VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II D1 PROTEASE
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
total genus 119
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc7A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc7A03
2M0ZA 4UU5A 2G5MB 2K1ZA 2KG2A 4NNLA 3HVQC 5FHTA 3Q0GA 5DUFA 4Z0MA 2AWXA 1UYRA 3GMAA 3ZW8A 4IC6A 1XNVA 4OAJA 2KBSA 3QJMA 4PQWA 1N99A 1I92A 3CH8A 4ZU2A 2AINA 2JIKA 2L4TA 3GDSA 3PE8A 4U0GA 3ZWAA 4U0HA 4HNKA 3QGLA 2VSVA 2F9IA 1WI2A 3K50A 3N6RB 5HJ1A 2Q9VA 1XZ9A 5HFBA 3PEAA 1TP3A 5DU4A 3H0SA 4YDPA 1OBZA 4NMVA 1ZOKA 2JILA 4JL7A 3I4WA 5E11A 2ZPLA 4JORA 5HFFA 3FDUA 3L3SA 3U9RB 3MH6A 1HNOA 1UM1A 2HE2A 2VPHA 3OU0A 1RJNA 1Q51A 3WKLA 2H3MA 5JXBA 3TVWA 3KZDA 4JWVA 4QIIA 4B3IA 5I7ZA 2UZCA 2EGNA 3GCNA 4E3BA 5C90A 2KPLA 4NXRA 4RYFH 3DJ3A 1VRGA 1GQ5A 3ZRTA 2VX2A 2WL7A 3QYRA 3SOEA 5DTHA 1N7EA 3R9QA 2FN5A 4KFVA 4NMSA 4REYA 5DUCA 2HGAA 1UJVA 2NP9A 5CTBA 3PV5A 3KTGA 4G69A 2EDPA 4QFEA 4U0GH 2KRGA 4JYJA 3GF7A 1TG6A 4P0CA 5IKLB 5FUSA 3KZEA 2Z9IA 1WHDA 1N7TA 2EGOA 3QK8A 2PDZA 3WKMA 3PV2A 4EDJA 2ZL2A 3FF6A 1V1TA 1VJ6A 4ZDFA 3ID2A 4UU6A 4ZDCA 3HINA 3BPPA 2IWNA 1WF7A 1DUBA 4OG1A 4JCRA 3ID1A 1V62A 2A7SA 2DAZA 2I1NA 4JCQA 3VQFA 1TYFA 1N6FA 3H0QA 5GLJA 1UHPA 4L6WA 2QBWA 3RL7A 4EMLA 2X58A 2KOJA 1U3BA 2OGPA 2EJYA 2ZPMA 1VAEA 2VSPA 4F8KA 2JOAA 4FNBA 2D8IA 5DZKH 3RSIA 1BFEA 2M3MA 2F9YB 3DIWA 4NMTA 3BEZA 3TLFA 4Q2OA 1UYSA 1WG6A 1UEPA 2QKTA 1N6EA 4NMPA 2KOMA 2PKTA 1W2XA 1Q3PA 4K6YA 1T2MA 2IWPA 1G9OA 3SLLA 2EDVA 2KJKA 3TZ3A 2DLUA 4GVCA 5DL1A 5HFDA 2L97A 2VSSF 2VSSE 3QIKA 3V5EA 2Q3GA 2KV8A 1U37A 1FC7A 4L8KA 2KYLA 4E34A 2IWQA 3I18A 4WYUA 4KWBA 5JBWA 1J7XA 1NZYB 2YUBA 1UEWA 5HFEA 4FZWC 2C8TA 3HP0A 2EEIA 1TP5A 3R9SA 3RL8A 2D3TA 2IEXA 1UEZA 2EAQA 3RSTA 3SFJA 3STAA 1O8UA 1FC9A 2H2BA 2Z17A 2YT7A 2G2LA 5EZ0A 4Z33A 3MYBA 1Q3OA 2JWEA 4EMPA 2KQFA 4JOEA 2OPGA 5G1DA 3PGQA 2YTWA 3PV4A 3K82A 1B8QA 5JBXA 1SZOA 2DC2A 3MFMA 2GZVA 2ZL3A 1X0UA 4JOKA 3B76A 3HPMA 3E17A 2F6QA 4AMHA 4RCNA 2DLSA 1MC7A 4I4ZA 1WIFA 3O46A 2MHOA 2PG8A 5E21A 3U9SB 2ZL4A 3QO6A 4E35A 2A7KA 1UJDA 2M0UA 1HNUA 3O5NA 1WZ8A 2Q34A 3IBBA 2VSSA 2J5II 4H11A 2YUYA 3CBXA 2EHRA 2I4SA 4K72A 3EGGC 4YLHA 1MFLA 2OCSA 5DU6A 3R0OA 2JREA 4YYXA 2J5IB 4FN8A 1RJMA 2LA8A 2QQ3A 1NF3C 3OMEA 4O06A 5HF4A 5E1YA 1ZUBA 3STJA 4OEOA 2EDZA 3HLN1 1UYTA 3TSWA 1WJLA 2QT5A 1PIXA 2F9YA 3ISAA 4U18A 4B3HA 5A2PA 3G64A 2BYGA 2EEHA 3CC0A 5KJPA 1UM7A 1Q7XA 1QLCA 4NMOA 1XX4A 3H02A 3R9TA 2OQSA 3QREA 5E0NX 2OSGA 4NXQA 1XNYA 1XNWA 3QXZA 2VSUC 4Q6SA 3P2LA 5FIFA 1OZIA 3TRRA 4JOFA 5D13A 3M6NA 2MX6A 3P85A 1NZYA 2VREA 1QAVB 3BPUA 3T8BA 4JOTA 2VZ5A 5DTWA 1YG8A 1WI4A 1X5QA 1Z87A 4MPAA 3QDOA 3GKBA 3Q7HA 3QXIA 2X24A 1WFVA 5INFA 4Q6HA 4JOPA 3PDVA 5GNDA 1Y7NA 1X8SA 3Q1TA 3R6HA 4OMRA 3P5MA 3TDCA 3TMHA 3T3WA 2PPYA 2ZQQA 1U39A 1VCWA 4JSBA 2PZDA 1LCYA 2M0TA 1WF8A 2F0AA 2V90A 1XO6A 5B6LA 1WHAA 3LNXA 3PS4A 4QIJA 4ELSA 3KTKA 1N6DA 2F6IA 3VIVA 3MT6A 4B3JA 3SHWA 2F5YA 4RI0A 5HEYA 5DKPA 2WTBA 1UEQA 2Q2XA 1OBYA 4P2AB 3HE2A 5CTCA 1HZDA 3TVUA 2JXOA 2EV8A 2J5GD 3DORA 5INIA 1QAUA 3VQGA 3R68A 1Y8TA 3JXTA 4K29A 2OMJA 3GGEA 4Q1IA 4JCSA 2PNTA 3H81A 2V1WA 1RZXA 4WCZA 2KAWA 4Q2NA 3CBZA 2LUIA 4GM2A 5G1EA 2ENOA 1KWAA 1X45A 1P1EA 2E7KA 2I0IA 2J5IA 4Q2PA 1IU0A 3RRVA 3CYYA 3KHFA 4GVDA 1SOZA 2DM8A 3KTJA 5HEDA 3AXAA 3NGHA 2M0VA 2QKUA 5EYZA 4JJTA 2QG1A 4Q3HA 4N6XA 1IU2A 4LK5A 3FY5A 3ZW9A 1D5GA 2A81A 3GJ9A 2FCFA 4DI1A 4K76A 4WZ8B 4LMMA 5MGBA 3GDUA 3OTPA 3IAVA 4K78A 1WDKA 2KOHA 1DCIA 4K75A 2DEOA 4HC8A 1PJHA 4JYLA 2VRFA 5HDYA 4F47A 4Q2QA 4JOHA 1K32A 2FNEA 1FC6A 2LC7A 3ID3A 3LNYA 2W7RA 3R69A 3BF0A 2W3PA 3GSLA 4WYOB 3SUZA 3EGHC 2P3WA 5DU8A 2I6VA 5F3XA 5G1QA 2HE4A 4MI2A 1QAVA 3QJNA 4I42A 3MH7A 1EY3A 3HPKA 1UFXA 1SG4A 2DMZA 1UF1A 2FZSA 4ELXA 3TT6A 4L8NA 3TV5A 3WG5A 2M10A 1UIYA 3GF3A 3LAOA 1ON3A 4Q0GA 2BZRA 2DKRA 5E6PB 2REYA 2FW2A 5E0SA 3H0UA 4ZDBA 4HOPB 3NJBA 2AWUA 1VB7A 3QE1A 3QKAA 2VSUF 2VSUE 5C9GA 2D92A 2KJPA 4KNPA 2KL1A 4FNDA 1RGRA 3GDVA 1X5RA 2EEGA 3ID4A 5H3JA 3SWXA 5E22A 3LKEA 2R4HA 5KDRB 4OLQA 2EJ5A 3ZWBA 3Q0JA 3QMJA 4OEPA 5HEBA 5G1RA 1V5QA 5INGA 5FB8C 1GQ4A 2HW5A 1OD4A 2QKVA 1JXZA 3MOYA 4FJWD 4IZCA 4I52A 2PKUA 1OD2A 1VA8A 4U19A 1PDRA 3TSZA 2RCZA 4JCTA 3T89A 1Y7OA 3DJAA 4WYTA 4K2NA 4FB8A 3CS0A 2FBMA 2CBYA 2R3YA 2ZQRA 1GM1A 2EGKA 3ST9A 3IB9A 3CBYA 1Q52A 4KFWA 2CE3A 2DB5A 3GLMA 3KQFA 2D90A 1K39A 2KJDA 3JU1A 3NFKA 2PA1A 2I0LA 1TQ3A 4XHVA 2VSUA 4K3WA 5DZKA 4NEKA 1SOTA 1I16A 1OBXA 5G1SA 3I47A 4EMMA 4IZBA 1Z86A 3SHUA 2KPKA 3H0JA 5E0SH 3HRXA 2H2CA 1WFGA 4U1AA 4KPKA 1W9OA 5HFCA 4ZDEA 2VWRA 1MFGA 2IWOA 3K1RA 1UITA 4JOJA 4KD6A 2JINA 3RLEA 2GTRA 2KA9A 3L4FD 3K8XA 1RY4A 3I1EA 1BE9A 1W9EA 3M6MA 1WDLA 3DJ1A 2H3LA 1M5ZA 2RRMA 2EEJA 2LOBA 4NMQA 4NXPA 2F9IB 3QWDA 1NTEA 1V5LA 2O2TA 4R2ZA 5DTPA 4Z8JA 2YT8A 4FN7A 3R0HA 4HOPA 2J5GA 3U9TB 3T8AA 3T88A 2Q35A 1FCFA 4ELWA 4JFCA 1KY9A 2CSJA 2J5SA 3PDZA 1P1DA 3OC7A 3TT7A 3TSVA 5KDRA 2PBPA 1IHJA 1W9QA 2EXGA 1UYVA 2CS5A 4GHNA 4G2RA 1X5NA 3NFLA 3KTHA 1MJ3A 1YBOA 1EF9A 3PZKA 5F67A 1R6JA 1RGWA 3GCOA 2W4FA 1UJUA 4NMRA 2DJTA 2DUBA 4NNQA 2I04A 1EF8A 1WDMA 1YG6A 1X6DA 1V6BA 4JOGA 5HF1A 2L4SA 4ASIA 3MH4A 4JVTA 3V5IA 2LC6A 4NNMA 4FZWA 4ZDDA 1TE0A 2OZFA 3KTIA 1N7FA 3NJDA 2X7ZA 4MOUA 2AWWA 2ZL0A 3OT6A 1U38A 4FGMA 3ZWCA 1ON9A 2UZFA 4MXIA 2FE5A 4RYFA 1WH1A 2OS6A 2CSSA 4IZDA 1KEFA 5HETA 1L6OA 2K20A
chains in the Genus database with same CATH superfamily
2M0ZA 5EUUA 4UU5A 2G5MB 2K1ZA 2KG2A 4NNLA 3HVQC 5FHTA 3Q0GA 5DUFA 4Z0MA 2AWXA 1UYRA 2KLNA 3GMAA 3ZW8A 4IC6A 1XNVA 4OAJA 2KBSA 3QJMA 4PQWA 1N99A 1I92A 3CH8A 4ZU2A 2AINA 2JIKA 2L4TA 3GDSA 3PE8A 4U0GA 3ZWAA 4U0HA 1BUZA 3QDQA 4HNKA 3QGLA 2VSVA 2F9IA 1WI2A 1TILB 3JU4A 3K50A 3N6RB 5HJ1A 2Q9VA 1XZ9A 5HFBA 5EUSA 1TP3A 3PEAA 5DU4A 1T6RA 3H0SA 4YDPA 1OBZA 4NMVA 1ZOKA 2JILA 4JL7A 3I4WA 5E11A 2ZPLA 4JORA 5HFFA 3FDUA 3L3SA 3U9RB 3MH6A 1HNOA 1UM1A 2HE2A 2VPHA 3OU0A 4DGFA 1RJNA 1Q51A 3WKLA 2H3MA 5JXBA 3TVWA 3KZDA 4JWVA 4QIIA 4B3IA 5I7ZA 2UZCA 2DXNA 2EGNA 3GCNA 1WXXA 4E3BA 5C90A 5HUQA 2KPLA 4NXRA 4RYFH 3DJ3A 1VRGA 1GQ5A 3ZRTA 2VX2A 2WL7A 1HF2A 3QYRA 3SOEA 5DTHA 1N7EA 3R9QA 2FN5A 4KFVA 3KDGA 4NMSA 4REYA 3GVJA 5DUCA 2HGAA 3R9SA 1UJVA 2NP9A 5CTBA 3PV5A 3KTGA 4G69A 2EDPA 4QFEA 4U0GH 2KRGA 5B42A 4JYJA 3GF7A 1TG6A 4P0CA 5IKLB 5FUSA 3KZEA 3IHAA 2Z9IA 1WHDA 5EUWA 1N7TA 2EGOA 3QK8A 2PDZA 3WKMA 3PV2A 4EDJA 2ZL2A 3FF6A 1V1TA 1VJ6A 4ZDFA 3BPTA 2ZOAA 3ID2A 4UU6A 4ZDCA 3V97A 3HINA 3BPPA 2IWNA 1WF7A 1DUBA 4OG1A 4JCRA 3ID1A 1V62A 2A7SA 2DAZA 2I1NA 4JCQA 3VQFA 1TYFA 1N6FA 3H0QA 5GLJA 1SBOA 4DGHA 1UHPA 4L6WA 2QBWA 3RL7A 4EMLA 2X58A 2KOJA 1U3BA 2OGPA 2EJYA 2ZPMA 1VAEA 2VSPA 4F8KA 2JOAA 4FNBA 2D8IA 5DZKH 3RSIA 1BFEA 2M3MA 2F9YB 3DIWA 4NMTA 3BEZA 3TLFA 4Q2OA 1H4ZA 1UYSA 1WG6A 1UEPA 2QKTA 1N6EA 4NMPA 2KOMA 2PKTA 1W2XA 1Q3PA 4K6YA 1T2MA 2IWPA 1V0FA 1G9OA 3SLLA 2EDVA 2KJKA 3TZ3A 2DLUA 4GVCA 5DL1A 5HFDA 2L97A 2VSSF 2VSSE 3QIKA 3V5EA 2Q3GA 1TH8B 2KV8A 1U37A 1FC7A 4JC0A 4L8KA 3OIRA 2KYLA 4E34A 2IWQA 3I18A 4WYUA 4KWBA 5JBWA 1J7XA 1NZYB 2YUBA 1UEWA 5HFEA 4FZWC 2C8TA 3HP0A 2EEIA 1AUZA 1TP5A 3IH8A 3RL8A 3GVLA 3IH9A 3MGLA 2D3TA 2IEXA 1UEZA 2EAQA 3RSTA 3SFJA 3STAA 1O8UA 4HYLA 1FC9A 2H2BA 2Z17A 2YT7A 2G2LA 5EZ0A 4Z33A 5IL9A 3MOGA 3MYBA 1Q3OA 3NCVA 2JWEA 4EMPA 5EZBA 2KQFA 4JOEA 2OPGA 5G1DA 3PGQA 2YTWA 3PV4A 3K82A 1B8QA 3ZTBA 5JBXA 1SZOA 2KA5A 1WXWA 2DC2A 1BPLA 3MFMA 2GZVA 2ZL3A 1X0UA 4JOKA 3B76A 3HPMA 3E17A 2F6QA 4AMHA 4RCNA 2DLSA 4AEJA 1MC7A 4I4ZA 1WIFA 3O46A 2MHOA 2PG8A 5E21A 3U9SB 2ZL4A 3QO6A 4E35A 2A7KA 1UJDA 2M0UA 1HNUA 3O5NA 1WZ8A 2Q34A 3IBBA 2VSSA 4DMGA 2J5II 4H11A 2YUYA 3CBXA 2EHRA 2I4SA 4K72A 3EGGC 4YLHA 1MFLA 2OCSA 5DU6A 3R0OA 2JREA 4YYXA 2J5IB 4FN8A 1RJMA 2LA8A 2QQ3A 1NF3C 3OMEA 4O06A 5HF4A 5E1YA 1ZUBA 3STJA 4OEOA 2EDZA 3HLN1 1UYTA 3NY7A 3TSWA 1WJLA 2QT5A 1PIXA 2F9YA 3ISAA 4U18A 4B3HA 5A2PA 3G64A 2BYGA 2EEHA 3CC0A 5KJPA 1UM7A 1Q7XA 1QLCA 4NMOA 1XX4A 3H02A 3R9TA 2OQSA 3QREA 5E0NX 2OSGA 4NXQA 3AGEA 1XNWA 1XNYA 3QXZA 2VSUC 4Q6SA 3P2LA 5FIFA 1OZIA 1TIDB 3TRRA 4JOFA 5D13A 3M6NA 2MX6A 3P85A 1NZYA 2VREA 1QAVB 3BPUA 3T8BA 4JOTA 2VZ5A 5DTWA 1YG8A 1WI4A 1X5QA 1Z87A 4MPAA 2B78A 3QDOA 3GKBA 3Q7HA 3QXIA 3KDKA 1WFVA 2X24A 4J2UA 5INFA 4Q6HA 1H4YA 4JOPA 3PDVA 5GNDA 1Y7NA 1X8SA 3Q1TA 3R6HA 4OMRA 3P5MA 3TDCA 3TMHA 3T3WA 2PPYA 2ZQQA 1U39A 1VCWA 4JSBA 2PZDA 1LCYA 2M0TA 1WF8A 2F0AA 3LLOA 2V90A 1XO6A 5B6LA 1WHAA 3LNXA 3PS4A 4QIJA 3OIZA 4ELSA 3KTKA 1N6DA 2F6IA 3VIVA 3MT6A 4B3JA 3SHWA 2F5YA 4RI0A 5HEYA 1VC1A 3D3UA 2WTBA 5DKPA 1UEQA 4AE2A 2Q2XA 1OBYA 4P2AB 3HE2A 3GABA 1HZDA 5CTCA 2JXOA 2EV8A 2J5GD 3DORA 3TVUA 5INIA 1QAUA 2VY9A 3VQGA 3R68A 1Y8TA 3JXTA 4K29A 4FLNA 2OMJA 3GGEA 4Q1IA 4JCSA 2PNTA 3H81A 2V1WA 1RZXA 4WCZA 2KAWA 4Q2NA 3CBZA 2LUIA 3V8VA 3GK7A 5G1EA 4GM2A 2ENOA 1KWAA 1X45A 1P1EA 2E7KA 2I0IA 2J5IA 4Q2PA 3ZXNA 1IU0A 3RRVA 3CYYA 3KHFA 4GVDA 1SOZA 2DM8A 3KTJA 5HEDA 3AXAA 3NGHA 2M0VA 2QKUA 5EYZA 4JJTA 2QG1A 4Q3HA 4N6XA 1IU2A 4LK5A 3FY5A 3C0KA 1D5GA 3ZW9A 5ILBA 1V0EA 2A81A 3GJ9A 2FCFA 3D03A 4DI1A 4K76A 1H4XA 5EUXA 4WZ8B 4LMMA 5MGBA 3GDUA 3OTPA 1THNB 3IAVA 4K78A 3IF5A 1WDKA 2KOHA 1DCIA 4K75A 2OASA 2DEOA 1PJHA 4HC8A 4JYLA 2VRFA 5HDYA 4F47A 4Q2QA 4JOHA 1K32A 2FNEA 1FC6A 2LC7A 3ID3A 3LNYA 2W7RA 4L1CA 3IHBA 3R69A 3BF0A 2W3PA 3GSLA 4WYOB 3SUZA 3EGHC 2P3WA 5DU8A 2I6VA 5F3XA 5G1QA 2HE4A 4MI2A 1QAVA 3QJNA 4I42A 3MH7A 1EY3A 3HPKA 1UFXA 1SG4A 2DMZA 1UF1A 2FZSA 4ELXA 3TT6A 4L8NA 3TV5A 3WG5A 2M10A 1UIYA 3GF3A 3LAOA 1ON3A 4Q0GA 2BZRA 2DKRA 5E6PB 2REYA 3LDFA 2FW2A 5E0SA 3H0UA 4ZDBA 4HOPB 3NJBA 2AWUA 1VB7A 3QE1A 3QKAA 2VSUF 2VSUE 3T6OA 5C9GA 2D92A 2KJPA 4KNPA 2KL1A 4FNDA 1RGRA 3GDVA 1X5RA 2EEGA 3ID4A 5H3JA 3SWXA 5E22A 3LKEA 4JJ0A 2R4HA 5KDRB 5EUZA 4OLQA 2EJ5A 3ZWBA 3AGDA 2YJGA 3Q0JA 3QMJA 2JSNA 4OEPA 5HEBA 5G1RA 1V5QA 5INGA 5FB8C 1GQ4A 2HW5A 1OD4A 2QKVA 1JXZA 3MOYA 4FJWD 4IZCA 4I52A 2PKUA 3EH7A 1OD2A 1VA8A 4U19A 4JJ3A 1PDRA 3GMFA 3TSZA 4HDTA 2RCZA 4JCTA 3T89A 1Y7OA 3DJAA 4WYTA 4K2NA 4FB8A 3CS0A 2FBMA 2CBYA 2R3YA 2ZQRA 1GM1A 2EGKA 3ST9A 3IB9A 3CBYA 1Q52A 4KFWA 2CE3A 2DB5A 3GLMA 2AS0A 3KQFA 2D90A 1K39A 2KJDA 4NARA 3JU1A 3NFKA 2PA1A 2I0LA 1TQ3A 4XHVA 2VSUA 4K3WA 5DZKA 4NEKA 1SOTA 1I16A 1OBXA 5G1SA 3I47A 4EMMA 4IZBA 1Z86A 3SHUA 2KPKA 3H0JA 5E0SH 3HRXA 2H2CA 1WFGA 4U1AA 4KPKA 1W9OA 5HFCA 4ZDEA 2VWRA 1MFGA 2IWOA 3K1RA 2ZO9B 2GEFA 1UITA 4JOJA 4KD6A 2JINA 3RLEA 2GTRA 2KA9A 3L4FD 3K8XA 1RY4A 3I1EA 1BE9A 1W9EA 3M6MA 3GVKA 1WDLA 3DJ1A 2H3LA 2DXLA 1M5ZA 2RRMA 4XS5A 2EEJA 2LOBA 4NMQA 4NXPA 3GHFA 2F9IB 3QWDA 1NTEA 1V5LA 2O2TA 4R2ZA 5DTPA 4Z8JA 2YT8A 4FN7A 3R0HA 4HOPA 2J5GA 3U9TB 3T8AA 3T88A 2Q35A 1FCFA 4ELWA 3VSEA 4HIZA 4JFCA 1KY9A 2CSJA 2J5SA 3PDZA 1P1DA 3OC7A 3TT7A 3TSVA 1X9ZA 5KDRA 2PBPA 3LKLA 1IHJA 1W9QA 2EXGA 1UYVA 2CS5A 4GHNA 4G2RA 1X5NA 3NFLA 3KTHA 1MJ3A 1YBOA 1EF9A 3PZKA 5F67A 1R6JA 1RGWA 3GCOA 2W4FA 1UJUA 4NMRA 2DJTA 2DUBA 4NNQA 2I04A 1EF8A 1WDMA 1YG6A 1X6DA 1V6BA 4JOGA 5HF1A 2L4SA 4ASIA 3MH4A 4JVTA 3V5IA 2LC6A 4NNMA 4FZWA 4ZDDA 1TE0A 2OZFA 3KTIA 1N7FA 3NJDA 2X7ZA 4MOUA 2AWWA 3DUPA 4QTPA 2ZL0A 1U38A 3OT6A 4FGMA 3ZWCA 1ON9A 2UZFA 2RRLA 4MXIA 2FE5A 2CWWA 4RYFA 1WH1A 2OS6A 2CSSA 3F43A 4IZDA 1KEFA 5HETA 1L6OA 2K20A
chains in the Genus database with same CATH topology
2M0ZA 4UU5A 2G5MB 2K1ZA 2KG2A 4NNLA 3HVQC 5FHTA 3Q0GA 5DUFA 4Z0MA 2AWXA 1UYRA 3GMAA 3ZW8A 4IC6A 1XNVA 4OAJA 2KBSA 3QJMA 4PQWA 1N99A 1I92A 3CH8A 4ZU2A 2AINA 2JIKA 2L4TA 3GDSA 3PE8A 4U0GA 3ZWAA 4U0HA 4HNKA 3QGLA 2VSVA 2F9IA 1WI2A 3K50A 3N6RB 5HJ1A 2Q9VA 1XZ9A 5HFBA 3PEAA 1TP3A 5DU4A 3H0SA 4YDPA 1OBZA 4NMVA 1ZOKA 2JILA 4JL7A 3I4WA 5E11A 2ZPLA 4JORA 5HFFA 3FDUA 3L3SA 3U9RB 3MH6A 1HNOA 1UM1A 2HE2A 2VPHA 3OU0A 1RJNA 1Q51A 3WKLA 2H3MA 5JXBA 3TVWA 3KZDA 4JWVA 4QIIA 4B3IA 5I7ZA 2UZCA 2DXNA 2EGNA 3GCNA 4E3BA 5C90A 5HUQA 2KPLA 4NXRA 4RYFH 3DJ3A 1VRGA 1GQ5A 3ZRTA 2VX2A 2WL7A 3QYRA 3SOEA 5DTHA 1N7EA 3R9QA 2FN5A 4KFVA 3KDGA 4NMSA 4REYA 5DUCA 2HGAA 1UJVA 2NP9A 5CTBA 3PV5A 3KTGA 4G69A 2EDPA 4QFEA 4U0GH 2KRGA 5B42A 4JYJA 3GF7A 1TG6A 4P0CA 5IKLB 5FUSA 3KZEA 2Z9IA 1WHDA 1N7TA 2EGOA 3QK8A 2PDZA 3WKMA 3PV2A 4EDJA 2ZL2A 3FF6A 1V1TA 1VJ6A 4ZDFA 3BPTA 2ZOAA 3ID2A 4UU6A 4ZDCA 3HINA 3BPPA 2IWNA 1WF7A 1DUBA 4OG1A 4JCRA 3ID1A 1V62A 2A7SA 2DAZA 2I1NA 4JCQA 3VQFA 1TYFA 1N6FA 3H0QA 5GLJA 1UHPA 4L6WA 2QBWA 3RL7A 4EMLA 2X58A 2KOJA 1U3BA 2OGPA 2EJYA 2ZPMA 1VAEA 2VSPA 4F8KA 2JOAA 4FNBA 2D8IA 5DZKH 3RSIA 1BFEA 2M3MA 2F9YB 3DIWA 4NMTA 3BEZA 3TLFA 4Q2OA 1UYSA 1WG6A 1UEPA 2QKTA 1N6EA 4NMPA 2KOMA 2PKTA 1W2XA 1Q3PA 4K6YA 1T2MA 2IWPA 1G9OA 3SLLA 2EDVA 2KJKA 3TZ3A 2DLUA 4GVCA 5DL1A 5HFDA 2L97A 2VSSF 2VSSE 3QIKA 3V5EA 2Q3GA 2KV8A 1U37A 1FC7A 4JC0A 4L8KA 2KYLA 4E34A 2IWQA 3I18A 4WYUA 4KWBA 5JBWA 1J7XA 1NZYB 2YUBA 1UEWA 5HFEA 4FZWC 2C8TA 3HP0A 2EEIA 1TP5A 3R9SA 3RL8A 2D3TA 2IEXA 1UEZA 2EAQA 3RSTA 3SFJA 3STAA 1O8UA 1FC9A 2H2BA 2Z17A 2YT7A 2G2LA 5EZ0A 4Z33A 5IL9A 3MOGA 3MYBA 1Q3OA 3NCVA 2JWEA 4EMPA 2KQFA 4JOEA 2OPGA 5G1DA 3PGQA 2YTWA 3PV4A 3K82A 1B8QA 5JBXA 1SZOA 2DC2A 1BPLA 3MFMA 2GZVA 2ZL3A 1X0UA 4JOKA 3B76A 3HPMA 3E17A 2F6QA 4AMHA 4RCNA 2DLSA 4AEJA 1MC7A 4I4ZA 1WIFA 3O46A 2MHOA 2PG8A 5E21A 3U9SB 2ZL4A 3QO6A 4E35A 2A7KA 1UJDA 2M0UA 1HNUA 3O5NA 1WZ8A 2Q34A 3IBBA 2VSSA 2J5II 4H11A 2YUYA 3CBXA 2EHRA 2I4SA 4K72A 3EGGC 4YLHA 1MFLA 2OCSA 5DU6A 3R0OA 2JREA 4YYXA 2J5IB 4FN8A 1RJMA 2LA8A 2QQ3A 1NF3C 3OMEA 4O06A 5HF4A 5E1YA 1ZUBA 3STJA 4OEOA 2EDZA 3HLN1 1UYTA 3TSWA 1WJLA 2QT5A 1PIXA 2F9YA 3ISAA 4U18A 4B3HA 5A2PA 3G64A 2BYGA 2EEHA 3CC0A 5KJPA 1UM7A 1Q7XA 1QLCA 4NMOA 1XX4A 3H02A 3R9TA 2OQSA 3QREA 5E0NX 2OSGA 4NXQA 1XNYA 1XNWA 3QXZA 2VSUC 4Q6SA 3P2LA 5FIFA 1OZIA 3TRRA 4JOFA 5D13A 3M6NA 2MX6A 3P85A 1NZYA 2VREA 1QAVB 3BPUA 3T8BA 4JOTA 2VZ5A 5DTWA 1YG8A 1WI4A 1X5QA 1Z87A 4MPAA 3QDOA 3GKBA 3Q7HA 3QXIA 3KDKA 1WFVA 2X24A 4J2UA 5INFA 4Q6HA 4JOPA 3PDVA 5GNDA 1Y7NA 1X8SA 3Q1TA 3R6HA 4OMRA 3P5MA 3TDCA 3TMHA 3T3WA 2PPYA 2ZQQA 1U39A 1VCWA 4JSBA 2PZDA 1LCYA 2M0TA 1WF8A 2F0AA 2V90A 1XO6A 5B6LA 1WHAA 3LNXA 3PS4A 4QIJA 4ELSA 3KTKA 1N6DA 2F6IA 3VIVA 3MT6A 4B3JA 3SHWA 2F5YA 4RI0A 5HEYA 5DKPA 2WTBA 1UEQA 4AE2A 2Q2XA 1OBYA 4P2AB 3HE2A 3GABA 1HZDA 5CTCA 2JXOA 2EV8A 2J5GD 3DORA 3TVUA 5INIA 1QAUA 3VQGA 3R68A 1Y8TA 3JXTA 4K29A 4FLNA 2OMJA 3GGEA 4Q1IA 4JCSA 2PNTA 3H81A 2V1WA 1RZXA 4WCZA 2KAWA 4Q2NA 3CBZA 2LUIA 4GM2A 5G1EA 2ENOA 1KWAA 1X45A 1P1EA 2E7KA 2I0IA 2J5IA 4Q2PA 1IU0A 3RRVA 3CYYA 3KHFA 4GVDA 1SOZA 2DM8A 3KTJA 5HEDA 3AXAA 3NGHA 2M0VA 2QKUA 5EYZA 4JJTA 2QG1A 4Q3HA 4N6XA 1IU2A 4LK5A 3FY5A 3ZW9A 1D5GA 5ILBA 2A81A 3GJ9A 2FCFA 3D03A 4DI1A 4K76A 4WZ8B 4LMMA 5MGBA 3GDUA 3OTPA 3IAVA 4K78A 1WDKA 2KOHA 1DCIA 4K75A 2DEOA 4HC8A 1PJHA 4JYLA 2VRFA 5HDYA 4F47A 4Q2QA 4JOHA 1K32A 2FNEA 1FC6A 2LC7A 3ID3A 3LNYA 2W7RA 4L1CA 3R69A 3BF0A 2W3PA 3GSLA 4WYOB 3SUZA 3EGHC 2P3WA 5DU8A 2I6VA 5F3XA 5G1QA 2HE4A 4MI2A 1QAVA 3QJNA 4I42A 3MH7A 1EY3A 3HPKA 1UFXA 1SG4A 2DMZA 1UF1A 2FZSA 4ELXA 3TT6A 4L8NA 3TV5A 3WG5A 2M10A 1UIYA 3GF3A 3LAOA 1ON3A 4Q0GA 2BZRA 2DKRA 5E6PB 2REYA 2FW2A 5E0SA 3H0UA 4ZDBA 4HOPB 3NJBA 2AWUA 1VB7A 3QE1A 3QKAA 2VSUF 2VSUE 5C9GA 2D92A 2KJPA 4KNPA 2KL1A 4FNDA 1RGRA 3GDVA 1X5RA 2EEGA 3ID4A 5H3JA 3SWXA 5E22A 3LKEA 4JJ0A 2R4HA 5KDRB 4OLQA 2EJ5A 3ZWBA 2YJGA 3Q0JA 3QMJA 2JSNA 4OEPA 5HEBA 5G1RA 1V5QA 5INGA 5FB8C 1GQ4A 2HW5A 1OD4A 2QKVA 1JXZA 3MOYA 4FJWD 4IZCA 4I52A 2PKUA 1OD2A 1VA8A 4U19A 4JJ3A 1PDRA 3GMFA 3TSZA 4HDTA 2RCZA 4JCTA 3T89A 1Y7OA 3DJAA 4WYTA 4K2NA 4FB8A 3CS0A 2FBMA 2CBYA 2R3YA 2ZQRA 1GM1A 2EGKA 3ST9A 3IB9A 3CBYA 1Q52A 4KFWA 2CE3A 2DB5A 3GLMA 3KQFA 2D90A 1K39A 2KJDA 4NARA 3JU1A 3NFKA 2PA1A 2I0LA 1TQ3A 4XHVA 2VSUA 4K3WA 5DZKA 4NEKA 1SOTA 1I16A 1OBXA 5G1SA 3I47A 4EMMA 4IZBA 1Z86A 3SHUA 2KPKA 3H0JA 5E0SH 3HRXA 2H2CA 1WFGA 4U1AA 4KPKA 1W9OA 5HFCA 4ZDEA 2VWRA 1MFGA 2IWOA 3K1RA 2ZO9B 2GEFA 1UITA 4JOJA 4KD6A 2JINA 3RLEA 2GTRA 2KA9A 3L4FD 3K8XA 1RY4A 3I1EA 1BE9A 1W9EA 3M6MA 1WDLA 3DJ1A 2H3LA 2DXLA 1M5ZA 2RRMA 2EEJA 2LOBA 4NMQA 4NXPA 3GHFA 2F9IB 3QWDA 1NTEA 1V5LA 2O2TA 4R2ZA 5DTPA 4Z8JA 2YT8A 4FN7A 3R0HA 4HOPA 2J5GA 3U9TB 3T8AA 3T88A 2Q35A 1FCFA 4ELWA 4JFCA 1KY9A 2CSJA 2J5SA 3PDZA 1P1DA 3OC7A 3TT7A 3TSVA 1X9ZA 5KDRA 2PBPA 1IHJA 1W9QA 2EXGA 1UYVA 2CS5A 4GHNA 4G2RA 1X5NA 3NFLA 3KTHA 1MJ3A 1YBOA 1EF9A 3PZKA 5F67A 1R6JA 1RGWA 3GCOA 2W4FA 1UJUA 4NMRA 2DJTA 2DUBA 4NNQA 2I04A 1EF8A 1WDMA 1YG6A 1X6DA 1V6BA 4JOGA 5HF1A 2L4SA 4ASIA 3MH4A 4JVTA 3V5IA 2LC6A 4NNMA 4FZWA 4ZDDA 1TE0A 2OZFA 3KTIA 1N7FA 3NJDA 2X7ZA 4MOUA 2AWWA 3DUPA 2ZL0A 3OT6A 1U38A 4FGMA 3ZWCA 1ON9A 2UZFA 2RRLA 4MXIA 2FE5A 4RYFA 1WH1A 2OS6A 2CSSA 4IZDA 1KEFA 5HETA 1L6OA 2K20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0Z A;  4UU5 A;  2G5M B;  2K1Z A;  2KG2 A;  4NNL A;  3HVQ C;  5FHT A;  3Q0G A;  5DUF A;  4Z0M A;  2AWX A;  1UYR A;  3GMA A;  3ZW8 A;  4IC6 A;  1XNV A;  4OAJ A;  2KBS A;  3QJM A;  4PQW A;  1N99 A;  1I92 A;  3CH8 A;  4ZU2 A;  2AIN A;  2JIK A;  2L4T A;  3GDS A;  3PE8 A;  4U0G A;  3ZWA A;  4U0H A;  4HNK A;  3QGL A;  2VSV A;  2F9I A;  1WI2 A;  3K50 A;  3N6R B;  5HJ1 A;  2Q9V A;  1XZ9 A;  5HFB A;  3PEA A;  1TP3 A;  5DU4 A;  3H0S A;  4YDP A;  1OBZ A;  4NMV A;  1ZOK A;  2JIL A;  4JL7 A;  3I4W A;  5E11 A;  2ZPL A;  4JOR A;  5HFF A;  3FDU A;  3L3S A;  3U9R B;  3MH6 A;  1HNO A;  1UM1 A;  2HE2 A;  2VPH A;  3OU0 A;  1RJN A;  1Q51 A;  3WKL A;  2H3M A;  5JXB A;  3TVW A;  3KZD A;  4JWV A;  4QII A;  4B3I A;  5I7Z A;  2UZC A;  2EGN A;  3GCN A;  4E3B A;  5C90 A;  2KPL A;  4NXR A;  4RYF H;  3DJ3 A;  1VRG A;  1GQ5 A;  3ZRT A;  2VX2 A;  2WL7 A;  3QYR A;  3SOE A;  5DTH A;  1N7E A;  3R9Q A;  2FN5 A;  4KFV A;  4NMS A;  4REY A;  5DUC A;  2HGA A;  1UJV A;  2NP9 A;  5CTB A;  3PV5 A;  3KTG A;  4G69 A;  2EDP A;  4QFE A;  4U0G H;  2KRG A;  4JYJ A;  3GF7 A;  1TG6 A;  4P0C A;  5IKL B;  5FUS A;  3KZE A;  2Z9I A;  1WHD A;  1N7T A;  2EGO A;  3QK8 A;  2PDZ A;  3WKM A;  3PV2 A;  4EDJ A;  2ZL2 A;  3FF6 A;  1V1T A;  1VJ6 A;  4ZDF A;  3ID2 A;  4UU6 A;  4ZDC A;  3HIN A;  3BPP A;  2IWN A;  1WF7 A;  1DUB A;  4OG1 A;  4JCR A;  3ID1 A;  1V62 A;  2A7S A;  2DAZ A;  2I1N A;  4JCQ A;  3VQF A;  1TYF A;  1N6F A;  3H0Q A;  5GLJ A;  1UHP A;  4L6W A;  2QBW A;  3RL7 A;  4EML A;  2X58 A;  2KOJ A;  1U3B A;  2OGP A;  2EJY A;  2ZPM A;  1VAE A;  2VSP A;  4F8K A;  2JOA A;  4FNB A;  2D8I A;  5DZK H;  3RSI A;  1BFE A;  2M3M A;  2F9Y B;  3DIW A;  4NMT A;  3BEZ A;  3TLF A;  4Q2O A;  1UYS A;  1WG6 A;  1UEP A;  2QKT A;  1N6E A;  4NMP A;  2KOM A;  2PKT A;  1W2X A;  1Q3P A;  4K6Y A;  1T2M A;  2IWP A;  1G9O A;  3SLL A;  2EDV A;  2KJK A;  3TZ3 A;  2DLU A;  4GVC A;  5DL1 A;  5HFD A;  2L97 A;  2VSS F;  2VSS E;  3QIK A;  3V5E A;  2Q3G A;  2KV8 A;  1U37 A;  1FC7 A;  4L8K A;  2KYL A;  4E34 A;  2IWQ A;  3I18 A;  4WYU A;  4KWB A;  5JBW A;  1J7X A;  1NZY B;  2YUB A;  1UEW A;  5HFE A;  4FZW C;  2C8T A;  3HP0 A;  2EEI A;  1TP5 A;  3R9S A;  3RL8 A;  2D3T A;  2IEX A;  1UEZ A;  2EAQ A;  3RST A;  3SFJ A;  3STA A;  1O8U A;  1FC9 A;  2H2B A;  2Z17 A;  2YT7 A;  2G2L A;  5EZ0 A;  4Z33 A;  3MYB A;  1Q3O A;  2JWE A;  4EMP A;  2KQF A;  4JOE A;  2OPG A;  5G1D A;  3PGQ A;  2YTW A;  3PV4 A;  3K82 A;  1B8Q A;  5JBX A;  1SZO A;  2DC2 A;  3MFM A;  2GZV A;  2ZL3 A;  1X0U A;  4JOK A;  3B76 A;  3HPM A;  3E17 A;  2F6Q A;  4AMH A;  4RCN A;  2DLS A;  1MC7 A;  4I4Z A;  1WIF A;  3O46 A;  2MHO A;  2PG8 A;  5E21 A;  3U9S B;  2ZL4 A;  3QO6 A;  4E35 A;  2A7K A;  1UJD A;  2M0U A;  1HNU A;  3O5N A;  1WZ8 A;  2Q34 A;  3IBB A;  2VSS A;  2J5I I;  4H11 A;  2YUY A;  3CBX A;  2EHR A;  2I4S A;  4K72 A;  3EGG C;  4YLH A;  1MFL A;  2OCS A;  5DU6 A;  3R0O A;  2JRE A;  4YYX A;  2J5I B;  4FN8 A;  1RJM A;  2LA8 A;  2QQ3 A;  1NF3 C;  3OME A;  4O06 A;  5HF4 A;  5E1Y A;  1ZUB A;  3STJ A;  4OEO A;  2EDZ A;  3HLN 1;  1UYT A;  3TSW A;  1WJL A;  2QT5 A;  1PIX A;  2F9Y A;  3ISA A;  4U18 A;  4B3H A;  5A2P A;  3G64 A;  2BYG A;  2EEH A;  3CC0 A;  5KJP A;  1UM7 A;  1Q7X A;  1QLC A;  4NMO A;  1XX4 A;  3H02 A;  3R9T A;  2OQS A;  3QRE A;  5E0N X;  2OSG A;  4NXQ A;  1XNY A;  1XNW A;  3QXZ A;  2VSU C;  4Q6S A;  3P2L A;  5FIF A;  1OZI A;  3TRR A;  4JOF A;  5D13 A;  3M6N A;  2MX6 A;  3P85 A;  1NZY A;  2VRE A;  1QAV B;  3BPU A;  3T8B A;  4JOT A;  2VZ5 A;  5DTW A;  1YG8 A;  1WI4 A;  1X5Q A;  1Z87 A;  4MPA A;  3QDO A;  3GKB A;  3Q7H A;  3QXI A;  2X24 A;  1WFV A;  5INF A;  4Q6H A;  4JOP A;  3PDV A;  5GND A;  1Y7N A;  1X8S A;  3Q1T A;  3R6H A;  4OMR A;  3P5M A;  3TDC A;  3TMH A;  3T3W A;  2PPY A;  2ZQQ A;  1U39 A;  1VCW A;  4JSB A;  2PZD A;  1LCY A;  2M0T A;  1WF8 A;  2F0A A;  2V90 A;  1XO6 A;  5B6L A;  1WHA A;  3LNX A;  3PS4 A;  4QIJ A;  4ELS A;  3KTK A;  1N6D A;  2F6I A;  3VIV A;  3MT6 A;  4B3J A;  3SHW A;  2F5Y A;  4RI0 A;  5HEY A;  5DKP A;  2WTB A;  1UEQ A;  2Q2X A;  1OBY A;  4P2A B;  3HE2 A;  5CTC A;  1HZD A;  3TVU A;  2JXO A;  2EV8 A;  2J5G D;  3DOR A;  5INI A;  1QAU A;  3VQG A;  3R68 A;  1Y8T A;  3JXT A;  4K29 A;  2OMJ A;  3GGE A;  4Q1I A;  4JCS A;  2PNT A;  3H81 A;  2V1W A;  1RZX A;  4WCZ A;  2KAW A;  4Q2N A;  3CBZ A;  2LUI A;  4GM2 A;  5G1E A;  2ENO A;  1KWA A;  1X45 A;  1P1E A;  2E7K A;  2I0I A;  2J5I A;  4Q2P A;  1IU0 A;  3RRV A;  3CYY A;  3KHF A;  4GVD A;  1SOZ A;  2DM8 A;  3KTJ A;  5HED A;  3AXA A;  3NGH A;  2M0V A;  2QKU A;  5EYZ A;  4JJT A;  2QG1 A;  4Q3H A;  4N6X A;  1IU2 A;  4LK5 A;  3FY5 A;  3ZW9 A;  1D5G A;  2A81 A;  3GJ9 A;  2FCF A;  4DI1 A;  4K76 A;  4WZ8 B;  4LMM A;  5MGB A;  3GDU A;  3OTP A;  3IAV A;  4K78 A;  1WDK A;  2KOH A;  1DCI A;  4K75 A;  2DEO A;  4HC8 A;  1PJH A;  4JYL A;  2VRF A;  5HDY A;  4F47 A;  4Q2Q A;  4JOH A;  1K32 A;  2FNE A;  1FC6 A;  2LC7 A;  3ID3 A;  3LNY A;  2W7R A;  3R69 A;  3BF0 A;  2W3P A;  3GSL A;  4WYO B;  3SUZ A;  3EGH C;  2P3W A;  5DU8 A;  2I6V A;  5F3X A;  5G1Q A;  2HE4 A;  4MI2 A;  1QAV A;  3QJN A;  4I42 A;  3MH7 A;  1EY3 A;  3HPK A;  1UFX A;  1SG4 A;  2DMZ A;  1UF1 A;  2FZS A;  4ELX A;  3TT6 A;  4L8N A;  3TV5 A;  3WG5 A;  2M10 A;  1UIY A;  3GF3 A;  3LAO A;  1ON3 A;  4Q0G A;  2BZR A;  2DKR A;  5E6P B;  2REY A;  2FW2 A;  5E0S A;  3H0U A;  4ZDB A;  4HOP B;  3NJB A;  2AWU A;  1VB7 A;  3QE1 A;  3QKA A;  2VSU F;  2VSU E;  5C9G A;  2D92 A;  2KJP A;  4KNP A;  2KL1 A;  4FND A;  1RGR A;  3GDV A;  1X5R A;  2EEG A;  3ID4 A;  5H3J A;  3SWX A;  5E22 A;  3LKE A;  2R4H A;  5KDR B;  4OLQ A;  2EJ5 A;  3ZWB A;  3Q0J A;  3QMJ A;  4OEP A;  5HEB A;  5G1R A;  1V5Q A;  5ING A;  5FB8 C;  1GQ4 A;  2HW5 A;  1OD4 A;  2QKV A;  1JXZ A;  3MOY A;  4FJW D;  4IZC A;  4I52 A;  2PKU A;  1OD2 A;  1VA8 A;  4U19 A;  1PDR A;  3TSZ A;  2RCZ A;  4JCT A;  3T89 A;  1Y7O A;  3DJA A;  4WYT A;  4K2N A;  4FB8 A;  3CS0 A;  2FBM A;  2CBY A;  2R3Y A;  2ZQR A;  1GM1 A;  2EGK A;  3ST9 A;  3IB9 A;  3CBY A;  1Q52 A;  4KFW A;  2CE3 A;  2DB5 A;  3GLM A;  3KQF A;  2D90 A;  1K39 A;  2KJD A;  3JU1 A;  3NFK A;  2PA1 A;  2I0L A;  1TQ3 A;  4XHV A;  2VSU A;  4K3W A;  5DZK A;  4NEK A;  1SOT A;  1I16 A;  1OBX A;  5G1S A;  3I47 A;  4EMM A;  4IZB A;  1Z86 A;  3SHU A;  2KPK A;  3H0J A;  5E0S H;  3HRX A;  2H2C A;  1WFG A;  4U1A A;  4KPK A;  1W9O A;  5HFC A;  4ZDE A;  2VWR A;  1MFG A;  2IWO A;  3K1R A;  1UIT A;  4JOJ A;  4KD6 A;  2JIN A;  3RLE A;  2GTR A;  2KA9 A;  3L4F D;  3K8X A;  1RY4 A;  3I1E A;  1BE9 A;  1W9E A;  3M6M A;  1WDL A;  3DJ1 A;  2H3L A;  1M5Z A;  2RRM A;  2EEJ A;  2LOB A;  4NMQ A;  4NXP A;  2F9I B;  3QWD A;  1NTE A;  1V5L A;  2O2T A;  4R2Z A;  5DTP A;  4Z8J A;  2YT8 A;  4FN7 A;  3R0H A;  4HOP A;  2J5G A;  3U9T B;  3T8A A;  3T88 A;  2Q35 A;  1FCF A;  4ELW A;  4JFC A;  1KY9 A;  2CSJ A;  2J5S A;  3PDZ A;  1P1D A;  3OC7 A;  3TT7 A;  3TSV A;  5KDR A;  2PBP A;  1IHJ A;  1W9Q A;  2EXG A;  1UYV A;  2CS5 A;  4GHN A;  4G2R A;  1X5N A;  3NFL A;  3KTH A;  1MJ3 A;  1YBO A;  1EF9 A;  3PZK A;  5F67 A;  1R6J A;  1RGW A;  3GCO A;  2W4F A;  1UJU A;  4NMR A;  2DJT A;  2DUB A;  4NNQ A;  2I04 A;  1EF8 A;  1WDM A;  1YG6 A;  1X6D A;  1V6B A;  4JOG A;  5HF1 A;  2L4S A;  4ASI A;  3MH4 A;  4JVT A;  3V5I A;  2LC6 A;  4NNM A;  4FZW A;  4ZDD A;  1TE0 A;  2OZF A;  3KTI A;  1N7F A;  3NJD A;  2X7Z A;  4MOU A;  2AWW A;  2ZL0 A;  3OT6 A;  1U38 A;  4FGM A;  3ZWC A;  1ON9 A;  2UZF A;  4MXI A;  2FE5 A;  4RYF A;  1WH1 A;  2OS6 A;  2CSS A;  4IZD A;  1KEF A;  5HET A;  1L6O A;  2K20 A; 
#chains in the Genus database with same CATH topology
 2M0Z A;  5EUU A;  4UU5 A;  2G5M B;  2K1Z A;  2KG2 A;  4NNL A;  3HVQ C;  5FHT A;  3Q0G A;  5DUF A;  4Z0M A;  2AWX A;  1UYR A;  2KLN A;  3GMA A;  3ZW8 A;  4IC6 A;  1XNV A;  4OAJ A;  2KBS A;  3QJM A;  4PQW A;  1N99 A;  1I92 A;  3CH8 A;  4ZU2 A;  2AIN A;  2JIK A;  2L4T A;  3GDS A;  3PE8 A;  4U0G A;  3ZWA A;  4U0H A;  1BUZ A;  3QDQ A;  4HNK A;  3QGL A;  2VSV A;  2F9I A;  1WI2 A;  1TIL B;  3JU4 A;  3K50 A;  3N6R B;  5HJ1 A;  2Q9V A;  1XZ9 A;  5HFB A;  5EUS A;  1TP3 A;  3PEA A;  5DU4 A;  1T6R A;  3H0S A;  4YDP A;  1OBZ A;  4NMV A;  1ZOK A;  2JIL A;  4JL7 A;  3I4W A;  5E11 A;  2ZPL A;  4JOR A;  5HFF A;  3FDU A;  3L3S A;  3U9R B;  3MH6 A;  1HNO A;  1UM1 A;  2HE2 A;  2VPH A;  3OU0 A;  4DGF A;  1RJN A;  1Q51 A;  3WKL A;  2H3M A;  5JXB A;  3TVW A;  3KZD A;  4JWV A;  4QII A;  4B3I A;  5I7Z A;  2UZC A;  2DXN A;  2EGN A;  3GCN A;  1WXX A;  4E3B A;  5C90 A;  5HUQ A;  2KPL A;  4NXR A;  4RYF H;  3DJ3 A;  1VRG A;  1GQ5 A;  3ZRT A;  2VX2 A;  2WL7 A;  1HF2 A;  3QYR A;  3SOE A;  5DTH A;  1N7E A;  3R9Q A;  2FN5 A;  4KFV A;  3KDG A;  4NMS A;  4REY A;  3GVJ A;  5DUC A;  2HGA A;  3R9S A;  1UJV A;  2NP9 A;  5CTB A;  3PV5 A;  3KTG A;  4G69 A;  2EDP A;  4QFE A;  4U0G H;  2KRG A;  5B42 A;  4JYJ A;  3GF7 A;  1TG6 A;  4P0C A;  5IKL B;  5FUS A;  3KZE A;  3IHA A;  2Z9I A;  1WHD A;  5EUW A;  1N7T A;  2EGO A;  3QK8 A;  2PDZ A;  3WKM A;  3PV2 A;  4EDJ A;  2ZL2 A;  3FF6 A;  1V1T A;  1VJ6 A;  4ZDF A;  3BPT A;  2ZOA A;  3ID2 A;  4UU6 A;  4ZDC A;  3V97 A;  3HIN A;  3BPP A;  2IWN A;  1WF7 A;  1DUB A;  4OG1 A;  4JCR A;  3ID1 A;  1V62 A;  2A7S A;  2DAZ A;  2I1N A;  4JCQ A;  3VQF A;  1TYF A;  1N6F A;  3H0Q A;  5GLJ A;  1SBO A;  4DGH A;  1UHP A;  4L6W A;  2QBW A;  3RL7 A;  4EML A;  2X58 A;  2KOJ A;  1U3B A;  2OGP A;  2EJY A;  2ZPM A;  1VAE A;  2VSP A;  4F8K A;  2JOA A;  4FNB A;  2D8I A;  5DZK H;  3RSI A;  1BFE A;  2M3M A;  2F9Y B;  3DIW A;  4NMT A;  3BEZ A;  3TLF A;  4Q2O A;  1H4Z A;  1UYS A;  1WG6 A;  1UEP A;  2QKT A;  1N6E A;  4NMP A;  2KOM A;  2PKT A;  1W2X A;  1Q3P A;  4K6Y A;  1T2M A;  2IWP A;  1V0F A;  1G9O A;  3SLL A;  2EDV A;  2KJK A;  3TZ3 A;  2DLU A;  4GVC A;  5DL1 A;  5HFD A;  2L97 A;  2VSS F;  2VSS E;  3QIK A;  3V5E A;  2Q3G A;  1TH8 B;  2KV8 A;  1U37 A;  1FC7 A;  4JC0 A;  4L8K A;  3OIR A;  2KYL A;  4E34 A;  2IWQ A;  3I18 A;  4WYU A;  4KWB A;  5JBW A;  1J7X A;  1NZY B;  2YUB A;  1UEW A;  5HFE A;  4FZW C;  2C8T A;  3HP0 A;  2EEI A;  1AUZ A;  1TP5 A;  3IH8 A;  3RL8 A;  3GVL A;  3IH9 A;  3MGL A;  2D3T A;  2IEX A;  1UEZ A;  2EAQ A;  3RST A;  3SFJ A;  3STA A;  1O8U A;  4HYL A;  1FC9 A;  2H2B A;  2Z17 A;  2YT7 A;  2G2L A;  5EZ0 A;  4Z33 A;  5IL9 A;  3MOG A;  3MYB A;  1Q3O A;  3NCV A;  2JWE A;  4EMP A;  5EZB A;  2KQF A;  4JOE A;  2OPG A;  5G1D A;  3PGQ A;  2YTW A;  3PV4 A;  3K82 A;  1B8Q A;  3ZTB A;  5JBX A;  1SZO A;  2KA5 A;  1WXW A;  2DC2 A;  1BPL A;  3MFM A;  2GZV A;  2ZL3 A;  1X0U A;  4JOK A;  3B76 A;  3HPM A;  3E17 A;  2F6Q A;  4AMH A;  4RCN A;  2DLS A;  4AEJ A;  1MC7 A;  4I4Z A;  1WIF A;  3O46 A;  2MHO A;  2PG8 A;  5E21 A;  3U9S B;  2ZL4 A;  3QO6 A;  4E35 A;  2A7K A;  1UJD A;  2M0U A;  1HNU A;  3O5N A;  1WZ8 A;  2Q34 A;  3IBB A;  2VSS A;  4DMG A;  2J5I I;  4H11 A;  2YUY A;  3CBX A;  2EHR A;  2I4S A;  4K72 A;  3EGG C;  4YLH A;  1MFL A;  2OCS A;  5DU6 A;  3R0O A;  2JRE A;  4YYX A;  2J5I B;  4FN8 A;  1RJM A;  2LA8 A;  2QQ3 A;  1NF3 C;  3OME A;  4O06 A;  5HF4 A;  5E1Y A;  1ZUB A;  3STJ A;  4OEO A;  2EDZ A;  3HLN 1;  1UYT A;  3NY7 A;  3TSW A;  1WJL A;  2QT5 A;  1PIX A;  2F9Y A;  3ISA A;  4U18 A;  4B3H A;  5A2P A;  3G64 A;  2BYG A;  2EEH A;  3CC0 A;  5KJP A;  1UM7 A;  1Q7X A;  1QLC A;  4NMO A;  1XX4 A;  3H02 A;  3R9T A;  2OQS A;  3QRE A;  5E0N X;  2OSG A;  4NXQ A;  3AGE A;  1XNW A;  1XNY A;  3QXZ A;  2VSU C;  4Q6S A;  3P2L A;  5FIF A;  1OZI A;  1TID B;  3TRR A;  4JOF A;  5D13 A;  3M6N A;  2MX6 A;  3P85 A;  1NZY A;  2VRE A;  1QAV B;  3BPU A;  3T8B A;  4JOT A;  2VZ5 A;  5DTW A;  1YG8 A;  1WI4 A;  1X5Q A;  1Z87 A;  4MPA A;  2B78 A;  3QDO A;  3GKB A;  3Q7H A;  3QXI A;  3KDK A;  1WFV A;  2X24 A;  4J2U A;  5INF A;  4Q6H A;  1H4Y A;  4JOP A;  3PDV A;  5GND A;  1Y7N A;  1X8S A;  3Q1T A;  3R6H A;  4OMR A;  3P5M A;  3TDC A;  3TMH A;  3T3W A;  2PPY A;  2ZQQ A;  1U39 A;  1VCW A;  4JSB A;  2PZD A;  1LCY A;  2M0T A;  1WF8 A;  2F0A A;  3LLO A;  2V90 A;  1XO6 A;  5B6L A;  1WHA A;  3LNX A;  3PS4 A;  4QIJ A;  3OIZ A;  4ELS A;  3KTK A;  1N6D A;  2F6I A;  3VIV A;  3MT6 A;  4B3J A;  3SHW A;  2F5Y A;  4RI0 A;  5HEY A;  1VC1 A;  3D3U A;  2WTB A;  5DKP A;  1UEQ A;  4AE2 A;  2Q2X A;  1OBY A;  4P2A B;  3HE2 A;  3GAB A;  1HZD A;  5CTC A;  2JXO A;  2EV8 A;  2J5G D;  3DOR A;  3TVU A;  5INI A;  1QAU A;  2VY9 A;  3VQG A;  3R68 A;  1Y8T A;  3JXT A;  4K29 A;  4FLN A;  2OMJ A;  3GGE A;  4Q1I A;  4JCS A;  2PNT A;  3H81 A;  2V1W A;  1RZX A;  4WCZ A;  2KAW A;  4Q2N A;  3CBZ A;  2LUI A;  3V8V A;  3GK7 A;  5G1E A;  4GM2 A;  2ENO A;  1KWA A;  1X45 A;  1P1E A;  2E7K A;  2I0I A;  2J5I A;  4Q2P A;  3ZXN A;  1IU0 A;  3RRV A;  3CYY A;  3KHF A;  4GVD A;  1SOZ A;  2DM8 A;  3KTJ A;  5HED A;  3AXA A;  3NGH A;  2M0V A;  2QKU A;  5EYZ A;  4JJT A;  2QG1 A;  4Q3H A;  4N6X A;  1IU2 A;  4LK5 A;  3FY5 A;  3C0K A;  1D5G A;  3ZW9 A;  5ILB A;  1V0E A;  2A81 A;  3GJ9 A;  2FCF A;  3D03 A;  4DI1 A;  4K76 A;  1H4X A;  5EUX A;  4WZ8 B;  4LMM A;  5MGB A;  3GDU A;  3OTP A;  1THN B;  3IAV A;  4K78 A;  3IF5 A;  1WDK A;  2KOH A;  1DCI A;  4K75 A;  2OAS A;  2DEO A;  1PJH A;  4HC8 A;  4JYL A;  2VRF A;  5HDY A;  4F47 A;  4Q2Q A;  4JOH A;  1K32 A;  2FNE A;  1FC6 A;  2LC7 A;  3ID3 A;  3LNY A;  2W7R A;  4L1C A;  3IHB A;  3R69 A;  3BF0 A;  2W3P A;  3GSL A;  4WYO B;  3SUZ A;  3EGH C;  2P3W A;  5DU8 A;  2I6V A;  5F3X A;  5G1Q A;  2HE4 A;  4MI2 A;  1QAV A;  3QJN A;  4I42 A;  3MH7 A;  1EY3 A;  3HPK A;  1UFX A;  1SG4 A;  2DMZ A;  1UF1 A;  2FZS A;  4ELX A;  3TT6 A;  4L8N A;  3TV5 A;  3WG5 A;  2M10 A;  1UIY A;  3GF3 A;  3LAO A;  1ON3 A;  4Q0G A;  2BZR A;  2DKR A;  5E6P B;  2REY A;  3LDF A;  2FW2 A;  5E0S A;  3H0U A;  4ZDB A;  4HOP B;  3NJB A;  2AWU A;  1VB7 A;  3QE1 A;  3QKA A;  2VSU F;  2VSU E;  3T6O A;  5C9G A;  2D92 A;  2KJP A;  4KNP A;  2KL1 A;  4FND A;  1RGR A;  3GDV A;  1X5R A;  2EEG A;  3ID4 A;  5H3J A;  3SWX A;  5E22 A;  3LKE A;  4JJ0 A;  2R4H A;  5KDR B;  5EUZ A;  4OLQ A;  2EJ5 A;  3ZWB A;  3AGD A;  2YJG A;  3Q0J A;  3QMJ A;  2JSN A;  4OEP A;  5HEB A;  5G1R A;  1V5Q A;  5ING A;  5FB8 C;  1GQ4 A;  2HW5 A;  1OD4 A;  2QKV A;  1JXZ A;  3MOY A;  4FJW D;  4IZC A;  4I52 A;  2PKU A;  3EH7 A;  1OD2 A;  1VA8 A;  4U19 A;  4JJ3 A;  1PDR A;  3GMF A;  3TSZ A;  4HDT A;  2RCZ A;  4JCT A;  3T89 A;  1Y7O A;  3DJA A;  4WYT A;  4K2N A;  4FB8 A;  3CS0 A;  2FBM A;  2CBY A;  2R3Y A;  2ZQR A;  1GM1 A;  2EGK A;  3ST9 A;  3IB9 A;  3CBY A;  1Q52 A;  4KFW A;  2CE3 A;  2DB5 A;  3GLM A;  2AS0 A;  3KQF A;  2D90 A;  1K39 A;  2KJD A;  4NAR A;  3JU1 A;  3NFK A;  2PA1 A;  2I0L A;  1TQ3 A;  4XHV A;  2VSU A;  4K3W A;  5DZK A;  4NEK A;  1SOT A;  1I16 A;  1OBX A;  5G1S A;  3I47 A;  4EMM A;  4IZB A;  1Z86 A;  3SHU A;  2KPK A;  3H0J A;  5E0S H;  3HRX A;  2H2C A;  1WFG A;  4U1A A;  4KPK A;  1W9O A;  5HFC A;  4ZDE A;  2VWR A;  1MFG A;  2IWO A;  3K1R A;  2ZO9 B;  2GEF A;  1UIT A;  4JOJ A;  4KD6 A;  2JIN A;  3RLE A;  2GTR A;  2KA9 A;  3L4F D;  3K8X A;  1RY4 A;  3I1E A;  1BE9 A;  1W9E A;  3M6M A;  3GVK A;  1WDL A;  3DJ1 A;  2H3L A;  2DXL A;  1M5Z A;  2RRM A;  4XS5 A;  2EEJ A;  2LOB A;  4NMQ A;  4NXP A;  3GHF A;  2F9I B;  3QWD A;  1NTE A;  1V5L A;  2O2T A;  4R2Z A;  5DTP A;  4Z8J A;  2YT8 A;  4FN7 A;  3R0H A;  4HOP A;  2J5G A;  3U9T B;  3T8A A;  3T88 A;  2Q35 A;  1FCF A;  4ELW A;  3VSE A;  4HIZ A;  4JFC A;  1KY9 A;  2CSJ A;  2J5S A;  3PDZ A;  1P1D A;  3OC7 A;  3TT7 A;  3TSV A;  1X9Z A;  5KDR A;  2PBP A;  3LKL A;  1IHJ A;  1W9Q A;  2EXG A;  1UYV A;  2CS5 A;  4GHN A;  4G2R A;  1X5N A;  3NFL A;  3KTH A;  1MJ3 A;  1YBO A;  1EF9 A;  3PZK A;  5F67 A;  1R6J A;  1RGW A;  3GCO A;  2W4F A;  1UJU A;  4NMR A;  2DJT A;  2DUB A;  4NNQ A;  2I04 A;  1EF8 A;  1WDM A;  1YG6 A;  1X6D A;  1V6B A;  4JOG A;  5HF1 A;  2L4S A;  4ASI A;  3MH4 A;  4JVT A;  3V5I A;  2LC6 A;  4NNM A;  4FZW A;  4ZDD A;  1TE0 A;  2OZF A;  3KTI A;  1N7F A;  3NJD A;  2X7Z A;  4MOU A;  2AWW A;  3DUP A;  4QTP A;  2ZL0 A;  1U38 A;  3OT6 A;  4FGM A;  3ZWC A;  1ON9 A;  2UZF A;  2RRL A;  4MXI A;  2FE5 A;  2CWW A;  4RYF A;  1WH1 A;  2OS6 A;  2CSS A;  3F43 A;  4IZD A;  1KEF A;  5HET A;  1L6O A;  2K20 A; 
#chains in the Genus database with same CATH homology
 2M0Z A;  4UU5 A;  2G5M B;  2K1Z A;  2KG2 A;  4NNL A;  3HVQ C;  5FHT A;  3Q0G A;  5DUF A;  4Z0M A;  2AWX A;  1UYR A;  3GMA A;  3ZW8 A;  4IC6 A;  1XNV A;  4OAJ A;  2KBS A;  3QJM A;  4PQW A;  1N99 A;  1I92 A;  3CH8 A;  4ZU2 A;  2AIN A;  2JIK A;  2L4T A;  3GDS A;  3PE8 A;  4U0G A;  3ZWA A;  4U0H A;  4HNK A;  3QGL A;  2VSV A;  2F9I A;  1WI2 A;  3K50 A;  3N6R B;  5HJ1 A;  2Q9V A;  1XZ9 A;  5HFB A;  3PEA A;  1TP3 A;  5DU4 A;  3H0S A;  4YDP A;  1OBZ A;  4NMV A;  1ZOK A;  2JIL A;  4JL7 A;  3I4W A;  5E11 A;  2ZPL A;  4JOR A;  5HFF A;  3FDU A;  3L3S A;  3U9R B;  3MH6 A;  1HNO A;  1UM1 A;  2HE2 A;  2VPH A;  3OU0 A;  1RJN A;  1Q51 A;  3WKL A;  2H3M A;  5JXB A;  3TVW A;  3KZD A;  4JWV A;  4QII A;  4B3I A;  5I7Z A;  2UZC A;  2DXN A;  2EGN A;  3GCN A;  4E3B A;  5C90 A;  5HUQ A;  2KPL A;  4NXR A;  4RYF H;  3DJ3 A;  1VRG A;  1GQ5 A;  3ZRT A;  2VX2 A;  2WL7 A;  3QYR A;  3SOE A;  5DTH A;  1N7E A;  3R9Q A;  2FN5 A;  4KFV A;  3KDG A;  4NMS A;  4REY A;  5DUC A;  2HGA A;  1UJV A;  2NP9 A;  5CTB A;  3PV5 A;  3KTG A;  4G69 A;  2EDP A;  4QFE A;  4U0G H;  2KRG A;  5B42 A;  4JYJ A;  3GF7 A;  1TG6 A;  4P0C A;  5IKL B;  5FUS A;  3KZE A;  2Z9I A;  1WHD A;  1N7T A;  2EGO A;  3QK8 A;  2PDZ A;  3WKM A;  3PV2 A;  4EDJ A;  2ZL2 A;  3FF6 A;  1V1T A;  1VJ6 A;  4ZDF A;  3BPT A;  2ZOA A;  3ID2 A;  4UU6 A;  4ZDC A;  3HIN A;  3BPP A;  2IWN A;  1WF7 A;  1DUB A;  4OG1 A;  4JCR A;  3ID1 A;  1V62 A;  2A7S A;  2DAZ A;  2I1N A;  4JCQ A;  3VQF A;  1TYF A;  1N6F A;  3H0Q A;  5GLJ A;  1UHP A;  4L6W A;  2QBW A;  3RL7 A;  4EML A;  2X58 A;  2KOJ A;  1U3B A;  2OGP A;  2EJY A;  2ZPM A;  1VAE A;  2VSP A;  4F8K A;  2JOA A;  4FNB A;  2D8I A;  5DZK H;  3RSI A;  1BFE A;  2M3M A;  2F9Y B;  3DIW A;  4NMT A;  3BEZ A;  3TLF A;  4Q2O A;  1UYS A;  1WG6 A;  1UEP A;  2QKT A;  1N6E A;  4NMP A;  2KOM A;  2PKT A;  1W2X A;  1Q3P A;  4K6Y A;  1T2M A;  2IWP A;  1G9O A;  3SLL A;  2EDV A;  2KJK A;  3TZ3 A;  2DLU A;  4GVC A;  5DL1 A;  5HFD A;  2L97 A;  2VSS F;  2VSS E;  3QIK A;  3V5E A;  2Q3G A;  2KV8 A;  1U37 A;  1FC7 A;  4JC0 A;  4L8K A;  2KYL A;  4E34 A;  2IWQ A;  3I18 A;  4WYU A;  4KWB A;  5JBW A;  1J7X A;  1NZY B;  2YUB A;  1UEW A;  5HFE A;  4FZW C;  2C8T A;  3HP0 A;  2EEI A;  1TP5 A;  3R9S A;  3RL8 A;  2D3T A;  2IEX A;  1UEZ A;  2EAQ A;  3RST A;  3SFJ A;  3STA A;  1O8U A;  1FC9 A;  2H2B A;  2Z17 A;  2YT7 A;  2G2L A;  5EZ0 A;  4Z33 A;  5IL9 A;  3MOG A;  3MYB A;  1Q3O A;  3NCV A;  2JWE A;  4EMP A;  2KQF A;  4JOE A;  2OPG A;  5G1D A;  3PGQ A;  2YTW A;  3PV4 A;  3K82 A;  1B8Q A;  5JBX A;  1SZO A;  2DC2 A;  1BPL A;  3MFM A;  2GZV A;  2ZL3 A;  1X0U A;  4JOK A;  3B76 A;  3HPM A;  3E17 A;  2F6Q A;  4AMH A;  4RCN A;  2DLS A;  4AEJ A;  1MC7 A;  4I4Z A;  1WIF A;  3O46 A;  2MHO A;  2PG8 A;  5E21 A;  3U9S B;  2ZL4 A;  3QO6 A;  4E35 A;  2A7K A;  1UJD A;  2M0U A;  1HNU A;  3O5N A;  1WZ8 A;  2Q34 A;  3IBB A;  2VSS A;  2J5I I;  4H11 A;  2YUY A;  3CBX A;  2EHR A;  2I4S A;  4K72 A;  3EGG C;  4YLH A;  1MFL A;  2OCS A;  5DU6 A;  3R0O A;  2JRE A;  4YYX A;  2J5I B;  4FN8 A;  1RJM A;  2LA8 A;  2QQ3 A;  1NF3 C;  3OME A;  4O06 A;  5HF4 A;  5E1Y A;  1ZUB A;  3STJ A;  4OEO A;  2EDZ A;  3HLN 1;  1UYT A;  3TSW A;  1WJL A;  2QT5 A;  1PIX A;  2F9Y A;  3ISA A;  4U18 A;  4B3H A;  5A2P A;  3G64 A;  2BYG A;  2EEH A;  3CC0 A;  5KJP A;  1UM7 A;  1Q7X A;  1QLC A;  4NMO A;  1XX4 A;  3H02 A;  3R9T A;  2OQS A;  3QRE A;  5E0N X;  2OSG A;  4NXQ A;  1XNY A;  1XNW A;  3QXZ A;  2VSU C;  4Q6S A;  3P2L A;  5FIF A;  1OZI A;  3TRR A;  4JOF A;  5D13 A;  3M6N A;  2MX6 A;  3P85 A;  1NZY A;  2VRE A;  1QAV B;  3BPU A;  3T8B A;  4JOT A;  2VZ5 A;  5DTW A;  1YG8 A;  1WI4 A;  1X5Q A;  1Z87 A;  4MPA A;  3QDO A;  3GKB A;  3Q7H A;  3QXI A;  3KDK A;  1WFV A;  2X24 A;  4J2U A;  5INF A;  4Q6H A;  4JOP A;  3PDV A;  5GND A;  1Y7N A;  1X8S A;  3Q1T A;  3R6H A;  4OMR A;  3P5M A;  3TDC A;  3TMH A;  3T3W A;  2PPY A;  2ZQQ A;  1U39 A;  1VCW A;  4JSB A;  2PZD A;  1LCY A;  2M0T A;  1WF8 A;  2F0A A;  2V90 A;  1XO6 A;  5B6L A;  1WHA A;  3LNX A;  3PS4 A;  4QIJ A;  4ELS A;  3KTK A;  1N6D A;  2F6I A;  3VIV A;  3MT6 A;  4B3J A;  3SHW A;  2F5Y A;  4RI0 A;  5HEY A;  5DKP A;  2WTB A;  1UEQ A;  4AE2 A;  2Q2X A;  1OBY A;  4P2A B;  3HE2 A;  3GAB A;  1HZD A;  5CTC A;  2JXO A;  2EV8 A;  2J5G D;  3DOR A;  3TVU A;  5INI A;  1QAU A;  3VQG A;  3R68 A;  1Y8T A;  3JXT A;  4K29 A;  4FLN A;  2OMJ A;  3GGE A;  4Q1I A;  4JCS A;  2PNT A;  3H81 A;  2V1W A;  1RZX A;  4WCZ A;  2KAW A;  4Q2N A;  3CBZ A;  2LUI A;  4GM2 A;  5G1E A;  2ENO A;  1KWA A;  1X45 A;  1P1E A;  2E7K A;  2I0I A;  2J5I A;  4Q2P A;  1IU0 A;  3RRV A;  3CYY A;  3KHF A;  4GVD A;  1SOZ A;  2DM8 A;  3KTJ A;  5HED A;  3AXA A;  3NGH A;  2M0V A;  2QKU A;  5EYZ A;  4JJT A;  2QG1 A;  4Q3H A;  4N6X A;  1IU2 A;  4LK5 A;  3FY5 A;  3ZW9 A;  1D5G A;  5ILB A;  2A81 A;  3GJ9 A;  2FCF A;  3D03 A;  4DI1 A;  4K76 A;  4WZ8 B;  4LMM A;  5MGB A;  3GDU A;  3OTP A;  3IAV A;  4K78 A;  1WDK A;  2KOH A;  1DCI A;  4K75 A;  2DEO A;  4HC8 A;  1PJH A;  4JYL A;  2VRF A;  5HDY A;  4F47 A;  4Q2Q A;  4JOH A;  1K32 A;  2FNE A;  1FC6 A;  2LC7 A;  3ID3 A;  3LNY A;  2W7R A;  4L1C A;  3R69 A;  3BF0 A;  2W3P A;  3GSL A;  4WYO B;  3SUZ A;  3EGH C;  2P3W A;  5DU8 A;  2I6V A;  5F3X A;  5G1Q A;  2HE4 A;  4MI2 A;  1QAV A;  3QJN A;  4I42 A;  3MH7 A;  1EY3 A;  3HPK A;  1UFX A;  1SG4 A;  2DMZ A;  1UF1 A;  2FZS A;  4ELX A;  3TT6 A;  4L8N A;  3TV5 A;  3WG5 A;  2M10 A;  1UIY A;  3GF3 A;  3LAO A;  1ON3 A;  4Q0G A;  2BZR A;  2DKR A;  5E6P B;  2REY A;  2FW2 A;  5E0S A;  3H0U A;  4ZDB A;  4HOP B;  3NJB A;  2AWU A;  1VB7 A;  3QE1 A;  3QKA A;  2VSU F;  2VSU E;  5C9G A;  2D92 A;  2KJP A;  4KNP A;  2KL1 A;  4FND A;  1RGR A;  3GDV A;  1X5R A;  2EEG A;  3ID4 A;  5H3J A;  3SWX A;  5E22 A;  3LKE A;  4JJ0 A;  2R4H A;  5KDR B;  4OLQ A;  2EJ5 A;  3ZWB A;  2YJG A;  3Q0J A;  3QMJ A;  2JSN A;  4OEP A;  5HEB A;  5G1R A;  1V5Q A;  5ING A;  5FB8 C;  1GQ4 A;  2HW5 A;  1OD4 A;  2QKV A;  1JXZ A;  3MOY A;  4FJW D;  4IZC A;  4I52 A;  2PKU A;  1OD2 A;  1VA8 A;  4U19 A;  4JJ3 A;  1PDR A;  3GMF A;  3TSZ A;  4HDT A;  2RCZ A;  4JCT A;  3T89 A;  1Y7O A;  3DJA A;  4WYT A;  4K2N A;  4FB8 A;  3CS0 A;  2FBM A;  2CBY A;  2R3Y A;  2ZQR A;  1GM1 A;  2EGK A;  3ST9 A;  3IB9 A;  3CBY A;  1Q52 A;  4KFW A;  2CE3 A;  2DB5 A;  3GLM A;  3KQF A;  2D90 A;  1K39 A;  2KJD A;  4NAR A;  3JU1 A;  3NFK A;  2PA1 A;  2I0L A;  1TQ3 A;  4XHV A;  2VSU A;  4K3W A;  5DZK A;  4NEK A;  1SOT A;  1I16 A;  1OBX A;  5G1S A;  3I47 A;  4EMM A;  4IZB A;  1Z86 A;  3SHU A;  2KPK A;  3H0J A;  5E0S H;  3HRX A;  2H2C A;  1WFG A;  4U1A A;  4KPK A;  1W9O A;  5HFC A;  4ZDE A;  2VWR A;  1MFG A;  2IWO A;  3K1R A;  2ZO9 B;  2GEF A;  1UIT A;  4JOJ A;  4KD6 A;  2JIN A;  3RLE A;  2GTR A;  2KA9 A;  3L4F D;  3K8X A;  1RY4 A;  3I1E A;  1BE9 A;  1W9E A;  3M6M A;  1WDL A;  3DJ1 A;  2H3L A;  2DXL A;  1M5Z A;  2RRM A;  2EEJ A;  2LOB A;  4NMQ A;  4NXP A;  3GHF A;  2F9I B;  3QWD A;  1NTE A;  1V5L A;  2O2T A;  4R2Z A;  5DTP A;  4Z8J A;  2YT8 A;  4FN7 A;  3R0H A;  4HOP A;  2J5G A;  3U9T B;  3T8A A;  3T88 A;  2Q35 A;  1FCF A;  4ELW A;  4JFC A;  1KY9 A;  2CSJ A;  2J5S A;  3PDZ A;  1P1D A;  3OC7 A;  3TT7 A;  3TSV A;  1X9Z A;  5KDR A;  2PBP A;  1IHJ A;  1W9Q A;  2EXG A;  1UYV A;  2CS5 A;  4GHN A;  4G2R A;  1X5N A;  3NFL A;  3KTH A;  1MJ3 A;  1YBO A;  1EF9 A;  3PZK A;  5F67 A;  1R6J A;  1RGW A;  3GCO A;  2W4F A;  1UJU A;  4NMR A;  2DJT A;  2DUB A;  4NNQ A;  2I04 A;  1EF8 A;  1WDM A;  1YG6 A;  1X6D A;  1V6B A;  4JOG A;  5HF1 A;  2L4S A;  4ASI A;  3MH4 A;  4JVT A;  3V5I A;  2LC6 A;  4NNM A;  4FZW A;  4ZDD A;  1TE0 A;  2OZF A;  3KTI A;  1N7F A;  3NJD A;  2X7Z A;  4MOU A;  2AWW A;  3DUP A;  2ZL0 A;  3OT6 A;  1U38 A;  4FGM A;  3ZWC A;  1ON9 A;  2UZF A;  2RRL A;  4MXI A;  2FE5 A;  4RYF A;  1WH1 A;  2OS6 A;  2CSS A;  4IZD A;  1KEF A;  5HET A;  1L6O A;  2K20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...