1FC7A

Photosystem ii d1 c-terminal processing protease
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
386
structure length
386
Chain Sequence
VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
molecule keywords PHOTOSYSTEM II D1 PROTEASE
total genus 119
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc7A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc7A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc7A03
2HW5A 1Q7XA 3E17A 3GMAA 2GZVA 4B3HA 3STJA 1Q52A 1UYTA 4QIIA 2PZDA 2F6QA 1RJNA 3PZKA 3CYYA 3KTIA 2F9IA 2M0UA 2J5IB 3TRRA 1TE0A 5HFCA 1QAVB 3PEAA 2VREA 3QXIA 4NMPA 4KFVA 2JREA 3LKEA 1RGRA 4O06A 1UM1A 4NEKA 2L4TA 1LCYA 3KTHA 3HPKA 1BE9A 4QFEA 2KPLA 2OPGA 3DIWA 1V1TA 1XNYA 2OMJA 2VRFA 1DCIA 4JCSA 5E21A 5G1EA 3EGHC 3ID2A 4YLHA 4ASIA 1HNUA 2D92A 1WH1A 3R68A 2FZSA 1FC9A 1GQ4A 5CTBA 2LC7A 1WIFA 2AWUA 4PQWA 3U9SB 1WDLA 4K75A 4JFCA 4JWVA 3KTGA 3PV5A 3ZRTA 2YT7A 3R69A 4EMPA 2EV8A 4JOHA 2YT8A 3WKMA 4FN7A 2WTBA 3T3WA 4K76A 2VSVA 2CSSA 3QO6A 2DM8A 4JYJA 3TLFA 2M0ZA 4HOPB 4IZDA 5JBXA 2PA1A 4ZU2A 1QAVA 1WFVA 2YUBA 1WHAA 2EGKA 3LNXA 2QT5A 4NMQA 3T89A 3P2LA 3ID4A 2K20A 2FCFA 5B6LA 3NGHA 3H02A 5HFEA 3H81A 2LOBA 1YG8A 3I1EA 3MH6A 5HFDA 1UITA 2OCSA 4WYTA 5E0SA 4NXPA 2I0IA 3BEZA 4OEPA 3H0QA 3IBBA 3RL7A 2A81A 3I47A 3R0OA 4I52A 4JOPA 3KZEA 4REYA 4OEOA 4NNQA 3MOYA 2J5IA 5G1DA 4F8KA 1NZYB 1OBYA 2M0VA 2EDVA 3MH7A 3QJNA 5I7ZA 2EEJA 4Q1IA 2PPYA 2ZPLA 1OD2A 1N6FA 3QDOA 3PS4A 1W2XA 4WYOB 2EDPA 3SFJA 2CSJA 2WL7A 1P1DA 2O2TA 4EDJA 4GVDA 1P1EA 4YDPA 1EY3A 2REYA 3PGQA 2VSUF 1YG6A 4G69A 3OC7A 3GDVA 3CBYA 2A7KA 1QLCA 2VSSE 3NJDA 2IWPA 3ISAA 1SOZA 5FB8C 2ZL3A 1ZOKA 4IZCA 2EHRA 4LK5A 5DL1A 4U19A 1I16A 5CTCA 3HLN1 2QKTA 5HFBA 3Q7HA 2VSUA 1DUBA 2DMZA 4RCNA 5DTHA 1XZ9A 4NNLA 3GCNA 1W9EA 2DLSA 3QREA 4I42A 1N99A 3QJMA 2F9YB 4K2NA 4E35A 5A2PA 4FN8A 4Z0MA 4UU5A 2JXOA 3QMJA 4ZDDA 2Z9IA 4FGMA 2OS6A 5F67A 2KYLA 1HNOA 4OAJA 2YTWA 4JOKA 5GLJA 3T8BA 5INGA 3H0SA 3FY5A 2F5YA 3ID1A 2H2BA 2PG8A 3MT6A 4KD6A 2FW2A 4Q2QA 3GSLA 1WF7A 1U37A 3OT6A 2OZFA 2LUIA 4G2RA 2MHOA 1L6OA 2BZRA 2PBPA 2R3YA 1PIXA 2MX6A 1V5QA 2ZL2A 1X8SA 4Q6SA 1K32A 1J7XA 5KJPA 3VQGA 2DB5A 4NMOA 5FIFA 1X5NA 5IKLB 2RCZA 4FZWC 5DU4A 1XNVA 2J5II 2PKTA 1FC7A 2QG1A 2W3PA 3SLLA 3DJ1A 5E6PB 1BFEA 4FNDA 1OBXA 2DJTA 5EZ0A 1WZ8A 3TV5A 1K39A 2EGNA 1WG6A 3CH8A 4Q2PA 3GCOA 2W4FA 5KDRB 2KOHA 2JIKA 1VCWA 3MFMA 3QXZA 3NJBA 3G64A 3GKBA 4U0HA 1V62A 1ON9A 2QKVA 4KFWA 3R6HA 4QIJA 2J5GD 4EMLA 5HJ1A 1V6BA 3JXTA 1MJ3A 1I92A 1UJUA 1IU0A 1UYRA 4IZBA 3PDVA 1Z86A 3DJ3A 3ID3A 3RL8A 3QIKA 4HNKA 1Q3PA 3AXAA 2QBWA 1MFGA 5INFA 4MOUA 3CC0A 4OMRA 2I04A 4ZDFA 3QGLA 2ZQRA 4OG1A 4P0CA 2VSUE 1Y7OA 3TVWA 2J5GA 2KV8A 1N7FA 3ZWCA 4IC6A 3VIVA 5E22A 3ZWAA 4JOJA 3PE8A 4NMSA 3CBZA 1N6EA 1G9OA 3QKAA 3OMEA 3GDSA 3I4WA 5E0SH 1UJDA 4ZDCA 3K50A 5DUCA 3PV2A 1X5RA 2KJPA 4Q2NA 1WDMA 1WI2A 4NMTA 4P2AB 1ZUBA 4WCZA 3HINA 1WFGA 4NXQA 2JOAA 3FF6A 1TG6A 3RSIA 1SZOA 2KOJA 3R9QA 3GF3A 2ENOA 3TVUA 3ZWBA 4DI1A 3ZW9A 4F47A 3GDUA 3TMHA 4I4ZA 5INIA 1TP5A 2HE2A 3QWDA 5HDYA 1Y8TA 2CE3A 4MI2A 3K1RA 4JORA 5G1SA 3HRXA 3R9SA 2RRMA 4NXRA 2JILA 3DJAA 1OD4A 4FNBA 1RZXA 1UM7A 2EGOA 4JOFA 2KA9A 2X7ZA 3OTPA 2OQSA 2VSPA 2QQ3A 3P85A 5DUFA 4E3BA 1HZDA 1KWAA 1VJ6A 4K72A 1EF9A 1N7TA 3R0HA 3ST9A 1RY4A 2PDZA 2JWEA 1UEQA 5C9GA 3STAA 3QE1A 3R9TA 2F9IB 1UF1A 2KG2A 2W7RA 4Q2OA 3NFLA 2LA8A 1X0UA 3O46A 2J5SA 1W9QA 4U18A 4JJTA 2Q34A 4JSBA 2KRGA 3RSTA 1NZYA 2ZL4A 2JINA 4JVTA 5HEDA 1U3BA 2BYGA 3CS0A 4JCRA 4WZ8B 2KPKA 5DU6A 4FB8A 2YUYA 3TZ3A 3IB9A 3WG5A 2VPHA 2D90A 1UEWA 1V5LA 3PV4A 2DAZA 4YYXA 1XO6A 1U38A 4OLQA 2UZFA 3FDUA 1O8UA 2K1ZA 2FE5A 5E11A 4Z8JA 4XHVA 2EEGA 5KDRA 1UJVA 3GGEA 4U0GA 2KJDA 3RLEA 5DTWA 3O5NA 1IU2A 1FC6A 2CS5A 1JXZA 3OU0A 2KBSA 3WKLA 2GTRA 1OZIA 1TP3A 4Q6HA 3HE2A 3V5IA 1Z87A 2VSSA 2Q9VA 1VAEA 5JBWA 2G2LA 4H11A 4KNPA 2Q3GA 1VB7A 1VRGA 2KOMA 2P3WA 4L6WA 3BPUA 3U9TB 3LNYA 2AINA 2DLUA 2I0LA 3DORA 2EJYA 1UIYA 4JYLA 4ZDBA 2OSGA 3ZW8A 4MXIA 5EYZA 4FZWA 2VWRA 2VSSF 3K82A 4NMVA 2FN5A 1OBZA 2M0TA 2LC6A 4JL7A 2F6IA 4JCQA 3TSWA 2I1NA 1UEZA 1QAUA 2NP9A 2X24A 2EEHA 3P5MA 2D3TA 4NMRA 3HVQC 2FBMA 3CBXA 4K3WA 3LAOA 1MC7A 1WJLA 1RJMA 4KPKA 5FHTA 5FUSA 2HGAA 2OGPA 2VX2A 1Q3OA 4RYFH 5F3XA 2DUBA 4K6YA 1PJHA 3NFKA 5H3JA 5HEYA 4UU6A 5HETA 2X58A 2L4SA 2KL1A 1M5ZA 5MGBA 3Q0JA 2IWNA 3L3SA 1KEFA 1NF3C 1Y7NA 2IWOA 3SWXA 1X6DA 5C90A 1VA8A 4AMHA 4ELXA 3EGGC 3KZDA 5D13A 5DZKA 4MPAA 4WYUA 3I18A 1UFXA 2D8IA 3N6RB 3T88A 1GQ5A 1SOTA 2Q2XA 3B76A 5DKPA 2ZL0A 3KTJA 4ELSA 1ON3A 3HP0A 2I6VA 1YBOA 4U0GH 3TT7A 5G1QA 2KAWA 4B3JA 1WF8A 4K78A 5DU8A 2EJ5A 2KQFA 2M10A 2Z17A 5JXBA 2KJKA 1IHJA 3H0UA 4R2ZA 3SHUA 2AWWA 4HC8A 2A7SA 2EXGA 2V90A 1D5GA 1GM1A 4NNMA 2EAQA 3JU1A 1XX4A 2IEXA 3GF7A 4RI0A 2PNTA 1U39A 3TT6A 4LMMA 3KTKA 2PKUA 3MH4A 3TSZA 2VSUC 4B3IA 1RGWA 1NTEA 5GNDA 1TYFA 1W9OA 2H3MA 2ZQQA 1N7EA 3Q1TA 3HPMA 2Q35A 2G5MB 1WDKA 1X5QA 1XNWA 2H2CA 3TDCA 4EMMA 3SOEA 4HOPA 1WI4A 4N6XA 1UEPA 4E34A 5HF4A 1TQ3A 3MYBA 4JOGA 2QKUA 2V1WA 2VZ5A 5E0NX 1MFLA 4JOEA 2IWQA 3H0JA 4L8KA 4GHNA 1UYVA 5G1RA 3IAVA 2ZPMA 1UYSA 2C8TA 3GJ9A 3VQFA 3KHFA 3U9RB 1SG4A 3SUZA 1B8QA 2M3MA 3QK8A 4RYFA 1UHPA 1Q51A 1WHDA 2DKRA 5HF1A 2H3LA 3M6NA 2I4SA 3BPPA 5E1YA 2HE4A 4ELWA 2R4HA 3TSVA 4Q0GA 5DZKH 5HFFA 5DTPA 2AWXA 3T8AA 2F0AA 4K29A 3BF0A 4U1AA 4L8NA 3Q0GA 1X45A 3PDZA 3M6MA 3QYRA 4FJWD 3V5EA 4Q3HA 2EEIA 4GM2A 4JCTA 5HEBA 3KQFA 2UZCA 4GVCA 2DC2A 2L97A 4JOTA 2DEOA 1EF8A 2CBYA 4Z33A 1FCFA 1KY9A 4KWBA 2EDZA 1N6DA 3L4FD 2F9YA 4ZDEA 1R6JA 3GLMA 3SHWA 1PDRA 3K8XA 1T2MA 3RRVA 2FNEA 2E7KA
chains in the Genus database with same CATH superfamily
2HW5A 1Q7XA 3E17A 2ZOAA 3GMAA 2GZVA 4B3HA 3STJA 1Q52A 1UYTA 4QIIA 2PZDA 2F6QA 1RJNA 3PZKA 3CYYA 3KTIA 2F9IA 2M0UA 2J5IB 3TRRA 1TE0A 5HFCA 1QAVB 3PEAA 3LDFA 2VREA 3QXIA 4NMPA 3D03A 3F43A 4KFVA 2JREA 3LKEA 1RGRA 4O06A 1UM1A 4NEKA 2L4TA 1LCYA 3KTHA 4AEJA 3ZTBA 3HPKA 1BE9A 4QFEA 2KPLA 2OPGA 3DIWA 1V1TA 3V8VA 1XNYA 2OMJA 2VRFA 1DCIA 4JCSA 5E21A 5G1EA 1THNB 3EGHC 3ID2A 4YLHA 4ASIA 4QTPA 1HNUA 2D92A 1WH1A 3R68A 2FZSA 1FC9A 1GQ4A 5CTBA 2LC7A 1WIFA 2AWUA 4PQWA 3U9SB 1WDLA 4K75A 4JFCA 4JWVA 3KTGA 3PV5A 3ZRTA 2YT7A 3R69A 4EMPA 2EV8A 1WXWA 4JOHA 2YT8A 3WKMA 4FN7A 2WTBA 3T3WA 4K76A 2VSVA 2CSSA 3QO6A 2DM8A 4JYJA 1V0FA 3TLFA 2M0ZA 4HOPB 4IZDA 5JBXA 2PA1A 4ZU2A 1QAVA 3GVLA 1WFVA 2YUBA 1WHAA 2EGKA 3LNXA 2QT5A 4NMQA 3T89A 3P2LA 5EZBA 3ID4A 3AGEA 2K20A 2FCFA 5B6LA 3NGHA 3H02A 5HFEA 3H81A 2LOBA 1YG8A 3I1EA 3MH6A 5HFDA 1UITA 2DXLA 2OCSA 4WYTA 5EUSA 5E0SA 4NXPA 2I0IA 3BEZA 4OEPA 3H0QA 3IBBA 3RL7A 2A81A 3I47A 5IL9A 3R0OA 4I52A 4JOPA 3KZEA 4REYA 4OEOA 4NNQA 3IF5A 2CWWA 3MOYA 3ZXNA 2J5IA 5G1DA 4F8KA 1NZYB 1OBYA 2M0VA 2EDVA 3MH7A 3QJNA 4DGHA 5I7ZA 2EEJA 1SBOA 4Q1IA 2PPYA 2ZPLA 1OD2A 1N6FA 5B42A 3QDOA 3IHAA 3PS4A 1W2XA 4WYOB 1V0EA 2EDPA 3SFJA 2CSJA 2WL7A 1P1DA 2O2TA 4EDJA 4GVDA 1P1EA 4YDPA 1EY3A 2REYA 3PGQA 2VSUF 1YG6A 4G69A 3OC7A 3GDVA 3CBYA 2A7KA 1QLCA 2VSSE 3NJDA 2IWPA 5EUUA 3ISAA 1SOZA 5FB8C 2ZL3A 1ZOKA 4IZCA 2EHRA 1T6RA 4LK5A 5DL1A 4U19A 1I16A 5CTCA 3HLN1 2QKTA 5HFBA 3Q7HA 4FLNA 2VSUA 1DUBA 2DMZA 1AUZA 4RCNA 5DTHA 1XZ9A 4NNLA 2VY9A 3GCNA 1W9EA 2DLSA 3QREA 4I42A 1N99A 4DMGA 3QJMA 2F9YB 4K2NA 4E35A 5A2PA 3GHFA 4L1CA 4FN8A 2OASA 4UU5A 2JXOA 4Z0MA 3QMJA 4ZDDA 2Z9IA 4FGMA 4JJ3A 2OS6A 5F67A 2KYLA 3D3UA 1HNOA 4OAJA 2YTWA 4JOKA 5GLJA 3T8BA 5INGA 3H0SA 3FY5A 2F5YA 3KDGA 3ID1A 2H2BA 2PG8A 3MT6A 4KD6A 2FW2A 4Q2QA 3GSLA 1H4ZA 1WF7A 1U37A 3OT6A 2OZFA 2LUIA 4G2RA 2MHOA 1L6OA 2BZRA 2PBPA 2R3YA 1PIXA 2MX6A 1V5QA 2ZL2A 1X8SA 4Q6SA 1K32A 1J7XA 5KJPA 3VQGA 2DB5A 4NMOA 5FIFA 1X5NA 5IKLB 2RCZA 4FZWC 5DU4A 1XNVA 2J5II 2PKTA 1FC7A 2QG1A 2W3PA 3SLLA 3DJ1A 2GEFA 1BFEA 5E6PB 4FNDA 1OBXA 2DJTA 5EZ0A 1WZ8A 3TV5A 1K39A 2EGNA 1WG6A 3CH8A 4Q2PA 3GCOA 2W4FA 5KDRB 3GVJA 2KOHA 2KLNA 1BPLA 2JIKA 1VCWA 3IH9A 3MFMA 3QXZA 3NJBA 5HUQA 3G64A 3GKBA 4U0HA 1V62A 1ON9A 2QKVA 4KFWA 3R6HA 4QIJA 2J5GD 4EMLA 5HJ1A 1V6BA 3JXTA 1MJ3A 1I92A 5EUXA 1UJUA 1IU0A 1UYRA 4IZBA 3PDVA 1Z86A 3DJ3A 3ID3A 3RL8A 3QIKA 4HNKA 1Q3PA 3AXAA 2QBWA 1MFGA 5INFA 2ZO9B 4MOUA 3CC0A 4OMRA 2I04A 4ZDFA 3QGLA 2ZQRA 4OG1A 4P0CA 2VSUE 1Y7OA 3TVWA 2J5GA 2KV8A 1N7FA 3ZWCA 4IC6A 3VIVA 5E22A 3ZWAA 4JOJA 3PE8A 4NMSA 5EUWA 3CBZA 1N6EA 1G9OA 3QKAA 3OMEA 3GDSA 3I4WA 5E0SH 1UJDA 4ZDCA 3K50A 4DGFA 5DUCA 3GVKA 3PV2A 1X5RA 4NARA 2KJPA 4Q2NA 1WXXA 1WDMA 1WI2A 4NMTA 4P2AB 1ZUBA 2JSNA 4WCZA 3HINA 1WFGA 4NXQA 3GK7A 2JOAA 3FF6A 1TG6A 3RSIA 1SZOA 2KOJA 3R9QA 1X9ZA 1BUZA 3QDQA 3GF3A 2ENOA 3TVUA 3ZWBA 4DI1A 3ZW9A 4F47A 3GDUA 3TMHA 4I4ZA 5INIA 1TP5A 2HE2A 3QWDA 5HDYA 1Y8TA 2CE3A 4MI2A 3K1RA 4JORA 5G1SA 1VC1A 3HRXA 3R9SA 2RRMA 4NXRA 2JILA 3DJAA 3LKLA 1OD4A 4FNBA 1RZXA 1UM7A 2EGOA 4JOFA 2KA9A 2X7ZA 3OTPA 2OQSA 2VSPA 2QQ3A 3P85A 5DUFA 4E3BA 1HZDA 1KWAA 4HIZA 1VJ6A 4K72A 1EF9A 1N7TA 3R0HA 3ST9A 1RY4A 2PDZA 2JWEA 1UEQA 3IHBA 5C9GA 3STAA 3QE1A 3R9TA 2F9IB 1UF1A 2KG2A 2W7RA 4Q2OA 3IH8A 3NFLA 2LA8A 1X0UA 3O46A 2J5SA 1W9QA 4U18A 4JJTA 2Q34A 4JSBA 2KRGA 3RSTA 1NZYA 2ZL4A 2JINA 4JVTA 5HEDA 4HYLA 1U3BA 1TIDB 2BYGA 3CS0A 4JCRA 4WZ8B 3V97A 2KPKA 5DU6A 4FB8A 2YUYA 3OIZA 3TZ3A 3IB9A 3WG5A 2VPHA 2D90A 1UEWA 1V5LA 3PV4A 2DAZA 4YYXA 1XO6A 1U38A 4OLQA 2UZFA 3FDUA 1O8UA 1TILB 2K1ZA 3MOGA 2FE5A 5E11A 4Z8JA 4XHVA 2EEGA 3JU4A 1UJVA 3GGEA 5KDRA 4U0GA 2KJDA 3RLEA 5DTWA 3O5NA 1IU2A 3AGDA 1FC6A 2CS5A 1JXZA 3OU0A 5ILBA 2KBSA 3WKLA 2GTRA 1OZIA 1TP3A 4Q6HA 3HE2A 3V5IA 3BPTA 1Z87A 2VSSA 2Q9VA 1VAEA 5JBWA 2G2LA 4H11A 4KNPA 1H4YA 2Q3GA 1VB7A 2KA5A 1VRGA 2KOMA 2DXNA 2P3WA 4L6WA 3BPUA 3U9TB 3LNYA 2AINA 2DLUA 2I0LA 3DORA 2EJYA 1UIYA 4JYLA 4ZDBA 2OSGA 3ZW8A 3T6OA 4MXIA 5EYZA 4FZWA 2VWRA 2VSSF 3K82A 4NMVA 2FN5A 1OBZA 2M0TA 3GABA 2LC6A 4JL7A 2F6IA 4JCQA 3TSWA 2I1NA 1UEZA 1QAUA 2NP9A 2X24A 2EEHA 3P5MA 2D3TA 4NMRA 3HVQC 3MGLA 2FBMA 3CBXA 4K3WA 3LAOA 1MC7A 1WJLA 1RJMA 4KPKA 5FHTA 5FUSA 2HGAA 2OGPA 2VX2A 1Q3OA 4RYFH 3DUPA 3OIRA 5F3XA 2DUBA 4K6YA 1PJHA 3NFKA 5H3JA 3NCVA 4UU6A 5HETA 5HEYA 2X58A 2L4SA 2KL1A 1M5ZA 5MGBA 3Q0JA 2YJGA 2B78A 2IWNA 3L3SA 1KEFA 1NF3C 1Y7NA 2IWOA 3EH7A 3SWXA 1X6DA 5C90A 1VA8A 4AMHA 4ELXA 3EGGC 2RRLA 3KZDA 5D13A 5DZKA 4MPAA 4WYUA 3I18A 1UFXA 2D8IA 3N6RB 3T88A 1GQ5A 1SOTA 2Q2XA 3B76A 5DKPA 2ZL0A 3KTJA 4ELSA 1ON3A 3NY7A 3HP0A 2I6VA 1YBOA 4U0GH 3TT7A 5G1QA 2KAWA 4B3JA 1WF8A 4K78A 5DU8A 2EJ5A 2KQFA 2M10A 2Z17A 5JXBA 2KJKA 1IHJA 3H0UA 4R2ZA 3SHUA 2AWWA 4HC8A 2A7SA 2EXGA 2V90A 1D5GA 1GM1A 4NNMA 2EAQA 3JU1A 1XX4A 2IEXA 3GF7A 4RI0A 2PNTA 1U39A 3TT6A 4LMMA 3KTKA 2PKUA 3MH4A 3TSZA 2VSUC 4B3IA 1RGWA 1NTEA 5GNDA 1TYFA 1W9OA 2H3MA 2ZQQA 1N7EA 5EUZA 3Q1TA 3HPMA 4J2UA 2Q35A 4JC0A 2G5MB 1WDKA 1X5QA 1XNWA 2H2CA 3TDCA 4EMMA 3SOEA 4HOPA 1WI4A 4N6XA 1UEPA 4E34A 5HF4A 1TQ3A 3MYBA 4JOGA 4HDTA 2QKUA 4AE2A 3C0KA 2V1WA 2VZ5A 5E0NX 1MFLA 4JOEA 2IWQA 3H0JA 4L8KA 4GHNA 1UYVA 5G1RA 3IAVA 2ZPMA 1UYSA 2C8TA 3GJ9A 3GMFA 3VQFA 3KHFA 3U9RB 1SG4A 3SUZA 1HF2A 1B8QA 2M3MA 3QK8A 4RYFA 1UHPA 3LLOA 1Q51A 1WHDA 2DKRA 5HF1A 2H3LA 3M6NA 2I4SA 3KDKA 3BPPA 5E1YA 2HE4A 4XS5A 4ELWA 2R4HA 3TSVA 4Q0GA 1TH8B 5DZKH 5HFFA 5DTPA 2AWXA 3T8AA 2F0AA 4JJ0A 4K29A 3VSEA 3BF0A 4U1AA 4L8NA 3Q0GA 1X45A 3PDZA 3M6MA 3QYRA 4FJWD 3V5EA 4Q3HA 2EEIA 4GM2A 4JCTA 5HEBA 3KQFA 2UZCA 4GVCA 2DC2A 2L97A 4JOTA 2DEOA 1EF8A 2CBYA 4Z33A 1FCFA 1KY9A 4KWBA 2EDZA 1N6DA 2AS0A 3L4FD 2F9YA 4ZDEA 1R6JA 3GLMA 1H4XA 3SHWA 1PDRA 3K8XA 1T2MA 3RRVA 2FNEA 2E7KA
chains in the Genus database with same CATH topology
2HW5A 1Q7XA 3E17A 2ZOAA 3GMAA 2GZVA 4B3HA 3STJA 1Q52A 1UYTA 4QIIA 2PZDA 2F6QA 1RJNA 3PZKA 3CYYA 3KTIA 2F9IA 2M0UA 2J5IB 3TRRA 1TE0A 5HFCA 1QAVB 3PEAA 2VREA 3QXIA 4NMPA 3D03A 4KFVA 2JREA 3LKEA 1RGRA 4O06A 1UM1A 4NEKA 2L4TA 1LCYA 3KTHA 4AEJA 3HPKA 1BE9A 4QFEA 2KPLA 2OPGA 3DIWA 1V1TA 1XNYA 2OMJA 2VRFA 1DCIA 4JCSA 5E21A 5G1EA 3EGHC 3ID2A 4YLHA 4ASIA 1HNUA 2D92A 1WH1A 3R68A 2FZSA 1FC9A 1GQ4A 5CTBA 2LC7A 1WIFA 2AWUA 4PQWA 3U9SB 1WDLA 4K75A 4JFCA 4JWVA 3KTGA 3PV5A 3ZRTA 2YT7A 3R69A 4EMPA 2EV8A 4JOHA 2YT8A 3WKMA 4FN7A 2WTBA 3T3WA 4K76A 2VSVA 2CSSA 3QO6A 2DM8A 4JYJA 3TLFA 2M0ZA 4HOPB 4IZDA 5JBXA 2PA1A 4ZU2A 1QAVA 1WFVA 2YUBA 1WHAA 2EGKA 3LNXA 2QT5A 4NMQA 3T89A 3P2LA 3ID4A 2K20A 2FCFA 5B6LA 3NGHA 3H02A 5HFEA 3H81A 2LOBA 1YG8A 3I1EA 3MH6A 5HFDA 1UITA 2DXLA 2OCSA 4WYTA 5E0SA 4NXPA 2I0IA 3BEZA 4OEPA 3H0QA 3IBBA 3RL7A 2A81A 3I47A 5IL9A 3R0OA 4I52A 4JOPA 3KZEA 4REYA 4OEOA 4NNQA 3MOYA 2J5IA 5G1DA 4F8KA 1NZYB 1OBYA 2M0VA 2EDVA 3MH7A 3QJNA 5I7ZA 2EEJA 4Q1IA 2PPYA 2ZPLA 1OD2A 1N6FA 5B42A 3QDOA 3PS4A 1W2XA 4WYOB 2EDPA 3SFJA 2CSJA 2WL7A 1P1DA 2O2TA 4EDJA 4GVDA 1P1EA 4YDPA 1EY3A 2REYA 3PGQA 2VSUF 1YG6A 4G69A 3OC7A 3GDVA 3CBYA 2A7KA 1QLCA 2VSSE 3NJDA 2IWPA 3ISAA 1SOZA 5FB8C 2ZL3A 1ZOKA 4IZCA 2EHRA 4LK5A 5DL1A 4U19A 1I16A 5CTCA 3HLN1 2QKTA 5HFBA 3Q7HA 4FLNA 2VSUA 1DUBA 2DMZA 4RCNA 5DTHA 1XZ9A 4NNLA 3GCNA 1W9EA 2DLSA 3QREA 4I42A 1N99A 3QJMA 2F9YB 4K2NA 4E35A 5A2PA 3GHFA 4L1CA 4FN8A 4Z0MA 4UU5A 2JXOA 3QMJA 4ZDDA 2Z9IA 4FGMA 4JJ3A 2OS6A 5F67A 2KYLA 1HNOA 4OAJA 2YTWA 4JOKA 5GLJA 3T8BA 5INGA 3H0SA 3FY5A 2F5YA 3KDGA 3ID1A 2H2BA 2PG8A 3MT6A 4KD6A 2FW2A 4Q2QA 3GSLA 1WF7A 1U37A 3OT6A 2OZFA 2LUIA 4G2RA 2MHOA 1L6OA 2BZRA 2PBPA 2R3YA 1PIXA 2MX6A 1V5QA 2ZL2A 1X8SA 4Q6SA 1K32A 1J7XA 5KJPA 3VQGA 2DB5A 4NMOA 5FIFA 1X5NA 5IKLB 2RCZA 4FZWC 5DU4A 1XNVA 2J5II 2PKTA 1FC7A 2QG1A 2W3PA 3SLLA 3DJ1A 2GEFA 1BFEA 5E6PB 4FNDA 1OBXA 2DJTA 5EZ0A 1WZ8A 3TV5A 1K39A 2EGNA 1WG6A 3CH8A 4Q2PA 3GCOA 2W4FA 5KDRB 2KOHA 1BPLA 2JIKA 1VCWA 3MFMA 3QXZA 3NJBA 5HUQA 3G64A 3GKBA 4U0HA 1V62A 1ON9A 2QKVA 4KFWA 3R6HA 4QIJA 2J5GD 4EMLA 5HJ1A 1V6BA 3JXTA 1MJ3A 1I92A 1UJUA 1IU0A 1UYRA 4IZBA 3PDVA 1Z86A 3DJ3A 3ID3A 3RL8A 3QIKA 4HNKA 1Q3PA 3AXAA 2QBWA 1MFGA 5INFA 2ZO9B 4MOUA 3CC0A 4OMRA 2I04A 4ZDFA 3QGLA 2ZQRA 4OG1A 4P0CA 2VSUE 1Y7OA 3TVWA 2J5GA 2KV8A 1N7FA 3ZWCA 4IC6A 3VIVA 5E22A 3ZWAA 4JOJA 3PE8A 4NMSA 3CBZA 1N6EA 1G9OA 3QKAA 3OMEA 3GDSA 3I4WA 5E0SH 1UJDA 4ZDCA 3K50A 5DUCA 3PV2A 1X5RA 4NARA 2KJPA 4Q2NA 1WDMA 1WI2A 4NMTA 4P2AB 1ZUBA 2JSNA 4WCZA 3HINA 1WFGA 4NXQA 2JOAA 3FF6A 1TG6A 3RSIA 1SZOA 2KOJA 3R9QA 1X9ZA 3GF3A 2ENOA 3TVUA 3ZWBA 4DI1A 3ZW9A 4F47A 3GDUA 3TMHA 4I4ZA 5INIA 1TP5A 2HE2A 3QWDA 5HDYA 1Y8TA 2CE3A 4MI2A 3K1RA 4JORA 5G1SA 3HRXA 3R9SA 2RRMA 4NXRA 2JILA 3DJAA 1OD4A 4FNBA 1RZXA 1UM7A 2EGOA 4JOFA 2KA9A 2X7ZA 3OTPA 2OQSA 2VSPA 2QQ3A 3P85A 5DUFA 4E3BA 1HZDA 1KWAA 1VJ6A 4K72A 1EF9A 1N7TA 3R0HA 3ST9A 1RY4A 2PDZA 2JWEA 1UEQA 5C9GA 3STAA 3QE1A 3R9TA 2F9IB 1UF1A 2KG2A 2W7RA 4Q2OA 3NFLA 2LA8A 1X0UA 3O46A 2J5SA 1W9QA 4U18A 4JJTA 2Q34A 4JSBA 2KRGA 3RSTA 1NZYA 2ZL4A 2JINA 4JVTA 5HEDA 1U3BA 2BYGA 3CS0A 4JCRA 4WZ8B 2KPKA 5DU6A 4FB8A 2YUYA 3TZ3A 3IB9A 3WG5A 2VPHA 2D90A 1UEWA 1V5LA 3PV4A 2DAZA 4YYXA 1XO6A 1U38A 4OLQA 2UZFA 3FDUA 1O8UA 2K1ZA 3MOGA 2FE5A 5E11A 4Z8JA 4XHVA 2EEGA 5KDRA 1UJVA 3GGEA 4U0GA 2KJDA 3RLEA 5DTWA 3O5NA 1IU2A 1FC6A 2CS5A 1JXZA 3OU0A 5ILBA 2KBSA 3WKLA 2GTRA 1OZIA 1TP3A 4Q6HA 3HE2A 3V5IA 3BPTA 1Z87A 2VSSA 2Q9VA 1VAEA 5JBWA 2G2LA 4H11A 4KNPA 2Q3GA 1VB7A 1VRGA 2KOMA 2DXNA 2P3WA 4L6WA 3BPUA 3U9TB 3LNYA 2AINA 2DLUA 2I0LA 3DORA 2EJYA 1UIYA 4JYLA 4ZDBA 2OSGA 3ZW8A 4MXIA 5EYZA 4FZWA 2VWRA 2VSSF 3K82A 4NMVA 2FN5A 1OBZA 2M0TA 3GABA 2LC6A 4JL7A 2F6IA 4JCQA 3TSWA 2I1NA 1UEZA 1QAUA 2NP9A 2X24A 2EEHA 3P5MA 2D3TA 4NMRA 3HVQC 2FBMA 3CBXA 4K3WA 3LAOA 1MC7A 1WJLA 1RJMA 4KPKA 5FHTA 5FUSA 2HGAA 2OGPA 2VX2A 1Q3OA 4RYFH 3DUPA 5F3XA 2DUBA 4K6YA 1PJHA 3NFKA 5H3JA 3NCVA 4UU6A 5HETA 5HEYA 2X58A 2L4SA 2KL1A 1M5ZA 5MGBA 3Q0JA 2YJGA 2IWNA 3L3SA 1KEFA 1NF3C 1Y7NA 2IWOA 3SWXA 1X6DA 5C90A 1VA8A 4AMHA 4ELXA 3EGGC 2RRLA 3KZDA 5D13A 5DZKA 4MPAA 4WYUA 3I18A 1UFXA 2D8IA 3N6RB 3T88A 1GQ5A 1SOTA 2Q2XA 3B76A 5DKPA 2ZL0A 3KTJA 4ELSA 1ON3A 3HP0A 2I6VA 1YBOA 4U0GH 3TT7A 5G1QA 2KAWA 4B3JA 1WF8A 4K78A 5DU8A 2EJ5A 2KQFA 2M10A 2Z17A 5JXBA 2KJKA 1IHJA 3H0UA 4R2ZA 3SHUA 2AWWA 4HC8A 2A7SA 2EXGA 2V90A 1D5GA 1GM1A 4NNMA 2EAQA 3JU1A 1XX4A 2IEXA 3GF7A 4RI0A 2PNTA 1U39A 3TT6A 4LMMA 3KTKA 2PKUA 3MH4A 3TSZA 2VSUC 4B3IA 1RGWA 1NTEA 5GNDA 1TYFA 1W9OA 2H3MA 2ZQQA 1N7EA 3Q1TA 3HPMA 4J2UA 2Q35A 4JC0A 2G5MB 1WDKA 1X5QA 1XNWA 2H2CA 3TDCA 4EMMA 3SOEA 4HOPA 1WI4A 4N6XA 1UEPA 4E34A 5HF4A 1TQ3A 3MYBA 4JOGA 4HDTA 2QKUA 4AE2A 2V1WA 2VZ5A 5E0NX 1MFLA 4JOEA 2IWQA 3H0JA 4L8KA 4GHNA 1UYVA 5G1RA 3IAVA 2ZPMA 1UYSA 2C8TA 3GJ9A 3GMFA 3VQFA 3KHFA 3U9RB 1SG4A 3SUZA 1B8QA 2M3MA 3QK8A 4RYFA 1UHPA 1Q51A 1WHDA 2DKRA 5HF1A 2H3LA 3M6NA 2I4SA 3KDKA 3BPPA 5E1YA 2HE4A 4ELWA 2R4HA 3TSVA 4Q0GA 5DZKH 5HFFA 5DTPA 2AWXA 3T8AA 2F0AA 4JJ0A 4K29A 3BF0A 4U1AA 4L8NA 3Q0GA 1X45A 3PDZA 3M6MA 3QYRA 4FJWD 3V5EA 4Q3HA 2EEIA 4GM2A 4JCTA 5HEBA 3KQFA 2UZCA 4GVCA 2DC2A 2L97A 4JOTA 2DEOA 1EF8A 2CBYA 4Z33A 1FCFA 1KY9A 4KWBA 2EDZA 1N6DA 3L4FD 2F9YA 4ZDEA 1R6JA 3GLMA 3SHWA 1PDRA 3K8XA 1T2MA 3RRVA 2FNEA 2E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HW5 A;  1Q7X A;  3E17 A;  3GMA A;  2GZV A;  4B3H A;  3STJ A;  1Q52 A;  1UYT A;  4QII A;  2PZD A;  2F6Q A;  1RJN A;  3PZK A;  3CYY A;  3KTI A;  2F9I A;  2M0U A;  2J5I B;  3TRR A;  1TE0 A;  5HFC A;  1QAV B;  3PEA A;  2VRE A;  3QXI A;  4NMP A;  4KFV A;  2JRE A;  3LKE A;  1RGR A;  4O06 A;  1UM1 A;  4NEK A;  2L4T A;  1LCY A;  3KTH A;  3HPK A;  1BE9 A;  4QFE A;  2KPL A;  2OPG A;  3DIW A;  1V1T A;  1XNY A;  2OMJ A;  2VRF A;  1DCI A;  4JCS A;  5E21 A;  5G1E A;  3EGH C;  3ID2 A;  4YLH A;  4ASI A;  1HNU A;  2D92 A;  1WH1 A;  3R68 A;  2FZS A;  1FC9 A;  1GQ4 A;  5CTB A;  2LC7 A;  1WIF A;  2AWU A;  4PQW A;  3U9S B;  1WDL A;  4K75 A;  4JFC A;  4JWV A;  3KTG A;  3PV5 A;  3ZRT A;  2YT7 A;  3R69 A;  4EMP A;  2EV8 A;  4JOH A;  2YT8 A;  3WKM A;  4FN7 A;  2WTB A;  3T3W A;  4K76 A;  2VSV A;  2CSS A;  3QO6 A;  2DM8 A;  4JYJ A;  3TLF A;  2M0Z A;  4HOP B;  4IZD A;  5JBX A;  2PA1 A;  4ZU2 A;  1QAV A;  1WFV A;  2YUB A;  1WHA A;  2EGK A;  3LNX A;  2QT5 A;  4NMQ A;  3T89 A;  3P2L A;  3ID4 A;  2K20 A;  2FCF A;  5B6L A;  3NGH A;  3H02 A;  5HFE A;  3H81 A;  2LOB A;  1YG8 A;  3I1E A;  3MH6 A;  5HFD A;  1UIT A;  2OCS A;  4WYT A;  5E0S A;  4NXP A;  2I0I A;  3BEZ A;  4OEP A;  3H0Q A;  3IBB A;  3RL7 A;  2A81 A;  3I47 A;  3R0O A;  4I52 A;  4JOP A;  3KZE A;  4REY A;  4OEO A;  4NNQ A;  3MOY A;  2J5I A;  5G1D A;  4F8K A;  1NZY B;  1OBY A;  2M0V A;  2EDV A;  3MH7 A;  3QJN A;  5I7Z A;  2EEJ A;  4Q1I A;  2PPY A;  2ZPL A;  1OD2 A;  1N6F A;  3QDO A;  3PS4 A;  1W2X A;  4WYO B;  2EDP A;  3SFJ A;  2CSJ A;  2WL7 A;  1P1D A;  2O2T A;  4EDJ A;  4GVD A;  1P1E A;  4YDP A;  1EY3 A;  2REY A;  3PGQ A;  2VSU F;  1YG6 A;  4G69 A;  3OC7 A;  3GDV A;  3CBY A;  2A7K A;  1QLC A;  2VSS E;  3NJD A;  2IWP A;  3ISA A;  1SOZ A;  5FB8 C;  2ZL3 A;  1ZOK A;  4IZC A;  2EHR A;  4LK5 A;  5DL1 A;  4U19 A;  1I16 A;  5CTC A;  3HLN 1;  2QKT A;  5HFB A;  3Q7H A;  2VSU A;  1DUB A;  2DMZ A;  4RCN A;  5DTH A;  1XZ9 A;  4NNL A;  3GCN A;  1W9E A;  2DLS A;  3QRE A;  4I42 A;  1N99 A;  3QJM A;  2F9Y B;  4K2N A;  4E35 A;  5A2P A;  4FN8 A;  4Z0M A;  4UU5 A;  2JXO A;  3QMJ A;  4ZDD A;  2Z9I A;  4FGM A;  2OS6 A;  5F67 A;  2KYL A;  1HNO A;  4OAJ A;  2YTW A;  4JOK A;  5GLJ A;  3T8B A;  5ING A;  3H0S A;  3FY5 A;  2F5Y A;  3ID1 A;  2H2B A;  2PG8 A;  3MT6 A;  4KD6 A;  2FW2 A;  4Q2Q A;  3GSL A;  1WF7 A;  1U37 A;  3OT6 A;  2OZF A;  2LUI A;  4G2R A;  2MHO A;  1L6O A;  2BZR A;  2PBP A;  2R3Y A;  1PIX A;  2MX6 A;  1V5Q A;  2ZL2 A;  1X8S A;  4Q6S A;  1K32 A;  1J7X A;  5KJP A;  3VQG A;  2DB5 A;  4NMO A;  5FIF A;  1X5N A;  5IKL B;  2RCZ A;  4FZW C;  5DU4 A;  1XNV A;  2J5I I;  2PKT A;  1FC7 A;  2QG1 A;  2W3P A;  3SLL A;  3DJ1 A;  5E6P B;  1BFE A;  4FND A;  1OBX A;  2DJT A;  5EZ0 A;  1WZ8 A;  3TV5 A;  1K39 A;  2EGN A;  1WG6 A;  3CH8 A;  4Q2P A;  3GCO A;  2W4F A;  5KDR B;  2KOH A;  2JIK A;  1VCW A;  3MFM A;  3QXZ A;  3NJB A;  3G64 A;  3GKB A;  4U0H A;  1V62 A;  1ON9 A;  2QKV A;  4KFW A;  3R6H A;  4QIJ A;  2J5G D;  4EML A;  5HJ1 A;  1V6B A;  3JXT A;  1MJ3 A;  1I92 A;  1UJU A;  1IU0 A;  1UYR A;  4IZB A;  3PDV A;  1Z86 A;  3DJ3 A;  3ID3 A;  3RL8 A;  3QIK A;  4HNK A;  1Q3P A;  3AXA A;  2QBW A;  1MFG A;  5INF A;  4MOU A;  3CC0 A;  4OMR A;  2I04 A;  4ZDF A;  3QGL A;  2ZQR A;  4OG1 A;  4P0C A;  2VSU E;  1Y7O A;  3TVW A;  2J5G A;  2KV8 A;  1N7F A;  3ZWC A;  4IC6 A;  3VIV A;  5E22 A;  3ZWA A;  4JOJ A;  3PE8 A;  4NMS A;  3CBZ A;  1N6E A;  1G9O A;  3QKA A;  3OME A;  3GDS A;  3I4W A;  5E0S H;  1UJD A;  4ZDC A;  3K50 A;  5DUC A;  3PV2 A;  1X5R A;  2KJP A;  4Q2N A;  1WDM A;  1WI2 A;  4NMT A;  4P2A B;  1ZUB A;  4WCZ A;  3HIN A;  1WFG A;  4NXQ A;  2JOA A;  3FF6 A;  1TG6 A;  3RSI A;  1SZO A;  2KOJ A;  3R9Q A;  3GF3 A;  2ENO A;  3TVU A;  3ZWB A;  4DI1 A;  3ZW9 A;  4F47 A;  3GDU A;  3TMH A;  4I4Z A;  5INI A;  1TP5 A;  2HE2 A;  3QWD A;  5HDY A;  1Y8T A;  2CE3 A;  4MI2 A;  3K1R A;  4JOR A;  5G1S A;  3HRX A;  3R9S A;  2RRM A;  4NXR A;  2JIL A;  3DJA A;  1OD4 A;  4FNB A;  1RZX A;  1UM7 A;  2EGO A;  4JOF A;  2KA9 A;  2X7Z A;  3OTP A;  2OQS A;  2VSP A;  2QQ3 A;  3P85 A;  5DUF A;  4E3B A;  1HZD A;  1KWA A;  1VJ6 A;  4K72 A;  1EF9 A;  1N7T A;  3R0H A;  3ST9 A;  1RY4 A;  2PDZ A;  2JWE A;  1UEQ A;  5C9G A;  3STA A;  3QE1 A;  3R9T A;  2F9I B;  1UF1 A;  2KG2 A;  2W7R A;  4Q2O A;  3NFL A;  2LA8 A;  1X0U A;  3O46 A;  2J5S A;  1W9Q A;  4U18 A;  4JJT A;  2Q34 A;  4JSB A;  2KRG A;  3RST A;  1NZY A;  2ZL4 A;  2JIN A;  4JVT A;  5HED A;  1U3B A;  2BYG A;  3CS0 A;  4JCR A;  4WZ8 B;  2KPK A;  5DU6 A;  4FB8 A;  2YUY A;  3TZ3 A;  3IB9 A;  3WG5 A;  2VPH A;  2D90 A;  1UEW A;  1V5L A;  3PV4 A;  2DAZ A;  4YYX A;  1XO6 A;  1U38 A;  4OLQ A;  2UZF A;  3FDU A;  1O8U A;  2K1Z A;  2FE5 A;  5E11 A;  4Z8J A;  4XHV A;  2EEG A;  5KDR A;  1UJV A;  3GGE A;  4U0G A;  2KJD A;  3RLE A;  5DTW A;  3O5N A;  1IU2 A;  1FC6 A;  2CS5 A;  1JXZ A;  3OU0 A;  2KBS A;  3WKL A;  2GTR A;  1OZI A;  1TP3 A;  4Q6H A;  3HE2 A;  3V5I A;  1Z87 A;  2VSS A;  2Q9V A;  1VAE A;  5JBW A;  2G2L A;  4H11 A;  4KNP A;  2Q3G A;  1VB7 A;  1VRG A;  2KOM A;  2P3W A;  4L6W A;  3BPU A;  3U9T B;  3LNY A;  2AIN A;  2DLU A;  2I0L A;  3DOR A;  2EJY A;  1UIY A;  4JYL A;  4ZDB A;  2OSG A;  3ZW8 A;  4MXI A;  5EYZ A;  4FZW A;  2VWR A;  2VSS F;  3K82 A;  4NMV A;  2FN5 A;  1OBZ A;  2M0T A;  2LC6 A;  4JL7 A;  2F6I A;  4JCQ A;  3TSW A;  2I1N A;  1UEZ A;  1QAU A;  2NP9 A;  2X24 A;  2EEH A;  3P5M A;  2D3T A;  4NMR A;  3HVQ C;  2FBM A;  3CBX A;  4K3W A;  3LAO A;  1MC7 A;  1WJL A;  1RJM A;  4KPK A;  5FHT A;  5FUS A;  2HGA A;  2OGP A;  2VX2 A;  1Q3O A;  4RYF H;  5F3X A;  2DUB A;  4K6Y A;  1PJH A;  3NFK A;  5H3J A;  5HEY A;  4UU6 A;  5HET A;  2X58 A;  2L4S A;  2KL1 A;  1M5Z A;  5MGB A;  3Q0J A;  2IWN A;  3L3S A;  1KEF A;  1NF3 C;  1Y7N A;  2IWO A;  3SWX A;  1X6D A;  5C90 A;  1VA8 A;  4AMH A;  4ELX A;  3EGG C;  3KZD A;  5D13 A;  5DZK A;  4MPA A;  4WYU A;  3I18 A;  1UFX A;  2D8I A;  3N6R B;  3T88 A;  1GQ5 A;  1SOT A;  2Q2X A;  3B76 A;  5DKP A;  2ZL0 A;  3KTJ A;  4ELS A;  1ON3 A;  3HP0 A;  2I6V A;  1YBO A;  4U0G H;  3TT7 A;  5G1Q A;  2KAW A;  4B3J A;  1WF8 A;  4K78 A;  5DU8 A;  2EJ5 A;  2KQF A;  2M10 A;  2Z17 A;  5JXB A;  2KJK A;  1IHJ A;  3H0U A;  4R2Z A;  3SHU A;  2AWW A;  4HC8 A;  2A7S A;  2EXG A;  2V90 A;  1D5G A;  1GM1 A;  4NNM A;  2EAQ A;  3JU1 A;  1XX4 A;  2IEX A;  3GF7 A;  4RI0 A;  2PNT A;  1U39 A;  3TT6 A;  4LMM A;  3KTK A;  2PKU A;  3MH4 A;  3TSZ A;  2VSU C;  4B3I A;  1RGW A;  1NTE A;  5GND A;  1TYF A;  1W9O A;  2H3M A;  2ZQQ A;  1N7E A;  3Q1T A;  3HPM A;  2Q35 A;  2G5M B;  1WDK A;  1X5Q A;  1XNW A;  2H2C A;  3TDC A;  4EMM A;  3SOE A;  4HOP A;  1WI4 A;  4N6X A;  1UEP A;  4E34 A;  5HF4 A;  1TQ3 A;  3MYB A;  4JOG A;  2QKU A;  2V1W A;  2VZ5 A;  5E0N X;  1MFL A;  4JOE A;  2IWQ A;  3H0J A;  4L8K A;  4GHN A;  1UYV A;  5G1R A;  3IAV A;  2ZPM A;  1UYS A;  2C8T A;  3GJ9 A;  3VQF A;  3KHF A;  3U9R B;  1SG4 A;  3SUZ A;  1B8Q A;  2M3M A;  3QK8 A;  4RYF A;  1UHP A;  1Q51 A;  1WHD A;  2DKR A;  5HF1 A;  2H3L A;  3M6N A;  2I4S A;  3BPP A;  5E1Y A;  2HE4 A;  4ELW A;  2R4H A;  3TSV A;  4Q0G A;  5DZK H;  5HFF A;  5DTP A;  2AWX A;  3T8A A;  2F0A A;  4K29 A;  3BF0 A;  4U1A A;  4L8N A;  3Q0G A;  1X45 A;  3PDZ A;  3M6M A;  3QYR A;  4FJW D;  3V5E A;  4Q3H A;  2EEI A;  4GM2 A;  4JCT A;  5HEB A;  3KQF A;  2UZC A;  4GVC A;  2DC2 A;  2L97 A;  4JOT A;  2DEO A;  1EF8 A;  2CBY A;  4Z33 A;  1FCF A;  1KY9 A;  4KWB A;  2EDZ A;  1N6D A;  3L4F D;  2F9Y A;  4ZDE A;  1R6J A;  3GLM A;  3SHW A;  1PDR A;  3K8X A;  1T2M A;  3RRV A;  2FNE A;  2E7K A; 
#chains in the Genus database with same CATH topology
 2HW5 A;  1Q7X A;  3E17 A;  2ZOA A;  3GMA A;  2GZV A;  4B3H A;  3STJ A;  1Q52 A;  1UYT A;  4QII A;  2PZD A;  2F6Q A;  1RJN A;  3PZK A;  3CYY A;  3KTI A;  2F9I A;  2M0U A;  2J5I B;  3TRR A;  1TE0 A;  5HFC A;  1QAV B;  3PEA A;  3LDF A;  2VRE A;  3QXI A;  4NMP A;  3D03 A;  3F43 A;  4KFV A;  2JRE A;  3LKE A;  1RGR A;  4O06 A;  1UM1 A;  4NEK A;  2L4T A;  1LCY A;  3KTH A;  4AEJ A;  3ZTB A;  3HPK A;  1BE9 A;  4QFE A;  2KPL A;  2OPG A;  3DIW A;  1V1T A;  3V8V A;  1XNY A;  2OMJ A;  2VRF A;  1DCI A;  4JCS A;  5E21 A;  5G1E A;  1THN B;  3EGH C;  3ID2 A;  4YLH A;  4ASI A;  4QTP A;  1HNU A;  2D92 A;  1WH1 A;  3R68 A;  2FZS A;  1FC9 A;  1GQ4 A;  5CTB A;  2LC7 A;  1WIF A;  2AWU A;  4PQW A;  3U9S B;  1WDL A;  4K75 A;  4JFC A;  4JWV A;  3KTG A;  3PV5 A;  3ZRT A;  2YT7 A;  3R69 A;  4EMP A;  2EV8 A;  1WXW A;  4JOH A;  2YT8 A;  3WKM A;  4FN7 A;  2WTB A;  3T3W A;  4K76 A;  2VSV A;  2CSS A;  3QO6 A;  2DM8 A;  4JYJ A;  1V0F A;  3TLF A;  2M0Z A;  4HOP B;  4IZD A;  5JBX A;  2PA1 A;  4ZU2 A;  1QAV A;  3GVL A;  1WFV A;  2YUB A;  1WHA A;  2EGK A;  3LNX A;  2QT5 A;  4NMQ A;  3T89 A;  3P2L A;  5EZB A;  3ID4 A;  3AGE A;  2K20 A;  2FCF A;  5B6L A;  3NGH A;  3H02 A;  5HFE A;  3H81 A;  2LOB A;  1YG8 A;  3I1E A;  3MH6 A;  5HFD A;  1UIT A;  2DXL A;  2OCS A;  4WYT A;  5EUS A;  5E0S A;  4NXP A;  2I0I A;  3BEZ A;  4OEP A;  3H0Q A;  3IBB A;  3RL7 A;  2A81 A;  3I47 A;  5IL9 A;  3R0O A;  4I52 A;  4JOP A;  3KZE A;  4REY A;  4OEO A;  4NNQ A;  3IF5 A;  2CWW A;  3MOY A;  3ZXN A;  2J5I A;  5G1D A;  4F8K A;  1NZY B;  1OBY A;  2M0V A;  2EDV A;  3MH7 A;  3QJN A;  4DGH A;  5I7Z A;  2EEJ A;  1SBO A;  4Q1I A;  2PPY A;  2ZPL A;  1OD2 A;  1N6F A;  5B42 A;  3QDO A;  3IHA A;  3PS4 A;  1W2X A;  4WYO B;  1V0E A;  2EDP A;  3SFJ A;  2CSJ A;  2WL7 A;  1P1D A;  2O2T A;  4EDJ A;  4GVD A;  1P1E A;  4YDP A;  1EY3 A;  2REY A;  3PGQ A;  2VSU F;  1YG6 A;  4G69 A;  3OC7 A;  3GDV A;  3CBY A;  2A7K A;  1QLC A;  2VSS E;  3NJD A;  2IWP A;  5EUU A;  3ISA A;  1SOZ A;  5FB8 C;  2ZL3 A;  1ZOK A;  4IZC A;  2EHR A;  1T6R A;  4LK5 A;  5DL1 A;  4U19 A;  1I16 A;  5CTC A;  3HLN 1;  2QKT A;  5HFB A;  3Q7H A;  4FLN A;  2VSU A;  1DUB A;  2DMZ A;  1AUZ A;  4RCN A;  5DTH A;  1XZ9 A;  4NNL A;  2VY9 A;  3GCN A;  1W9E A;  2DLS A;  3QRE A;  4I42 A;  1N99 A;  4DMG A;  3QJM A;  2F9Y B;  4K2N A;  4E35 A;  5A2P A;  3GHF A;  4L1C A;  4FN8 A;  2OAS A;  4UU5 A;  2JXO A;  4Z0M A;  3QMJ A;  4ZDD A;  2Z9I A;  4FGM A;  4JJ3 A;  2OS6 A;  5F67 A;  2KYL A;  3D3U A;  1HNO A;  4OAJ A;  2YTW A;  4JOK A;  5GLJ A;  3T8B A;  5ING A;  3H0S A;  3FY5 A;  2F5Y A;  3KDG A;  3ID1 A;  2H2B A;  2PG8 A;  3MT6 A;  4KD6 A;  2FW2 A;  4Q2Q A;  3GSL A;  1H4Z A;  1WF7 A;  1U37 A;  3OT6 A;  2OZF A;  2LUI A;  4G2R A;  2MHO A;  1L6O A;  2BZR A;  2PBP A;  2R3Y A;  1PIX A;  2MX6 A;  1V5Q A;  2ZL2 A;  1X8S A;  4Q6S A;  1K32 A;  1J7X A;  5KJP A;  3VQG A;  2DB5 A;  4NMO A;  5FIF A;  1X5N A;  5IKL B;  2RCZ A;  4FZW C;  5DU4 A;  1XNV A;  2J5I I;  2PKT A;  1FC7 A;  2QG1 A;  2W3P A;  3SLL A;  3DJ1 A;  2GEF A;  1BFE A;  5E6P B;  4FND A;  1OBX A;  2DJT A;  5EZ0 A;  1WZ8 A;  3TV5 A;  1K39 A;  2EGN A;  1WG6 A;  3CH8 A;  4Q2P A;  3GCO A;  2W4F A;  5KDR B;  3GVJ A;  2KOH A;  2KLN A;  1BPL A;  2JIK A;  1VCW A;  3IH9 A;  3MFM A;  3QXZ A;  3NJB A;  5HUQ A;  3G64 A;  3GKB A;  4U0H A;  1V62 A;  1ON9 A;  2QKV A;  4KFW A;  3R6H A;  4QIJ A;  2J5G D;  4EML A;  5HJ1 A;  1V6B A;  3JXT A;  1MJ3 A;  1I92 A;  5EUX A;  1UJU A;  1IU0 A;  1UYR A;  4IZB A;  3PDV A;  1Z86 A;  3DJ3 A;  3ID3 A;  3RL8 A;  3QIK A;  4HNK A;  1Q3P A;  3AXA A;  2QBW A;  1MFG A;  5INF A;  2ZO9 B;  4MOU A;  3CC0 A;  4OMR A;  2I04 A;  4ZDF A;  3QGL A;  2ZQR A;  4OG1 A;  4P0C A;  2VSU E;  1Y7O A;  3TVW A;  2J5G A;  2KV8 A;  1N7F A;  3ZWC A;  4IC6 A;  3VIV A;  5E22 A;  3ZWA A;  4JOJ A;  3PE8 A;  4NMS A;  5EUW A;  3CBZ A;  1N6E A;  1G9O A;  3QKA A;  3OME A;  3GDS A;  3I4W A;  5E0S H;  1UJD A;  4ZDC A;  3K50 A;  4DGF A;  5DUC A;  3GVK A;  3PV2 A;  1X5R A;  4NAR A;  2KJP A;  4Q2N A;  1WXX A;  1WDM A;  1WI2 A;  4NMT A;  4P2A B;  1ZUB A;  2JSN A;  4WCZ A;  3HIN A;  1WFG A;  4NXQ A;  3GK7 A;  2JOA A;  3FF6 A;  1TG6 A;  3RSI A;  1SZO A;  2KOJ A;  3R9Q A;  1X9Z A;  1BUZ A;  3QDQ A;  3GF3 A;  2ENO A;  3TVU A;  3ZWB A;  4DI1 A;  3ZW9 A;  4F47 A;  3GDU A;  3TMH A;  4I4Z A;  5INI A;  1TP5 A;  2HE2 A;  3QWD A;  5HDY A;  1Y8T A;  2CE3 A;  4MI2 A;  3K1R A;  4JOR A;  5G1S A;  1VC1 A;  3HRX A;  3R9S A;  2RRM A;  4NXR A;  2JIL A;  3DJA A;  3LKL A;  1OD4 A;  4FNB A;  1RZX A;  1UM7 A;  2EGO A;  4JOF A;  2KA9 A;  2X7Z A;  3OTP A;  2OQS A;  2VSP A;  2QQ3 A;  3P85 A;  5DUF A;  4E3B A;  1HZD A;  1KWA A;  4HIZ A;  1VJ6 A;  4K72 A;  1EF9 A;  1N7T A;  3R0H A;  3ST9 A;  1RY4 A;  2PDZ A;  2JWE A;  1UEQ A;  3IHB A;  5C9G A;  3STA A;  3QE1 A;  3R9T A;  2F9I B;  1UF1 A;  2KG2 A;  2W7R A;  4Q2O A;  3IH8 A;  3NFL A;  2LA8 A;  1X0U A;  3O46 A;  2J5S A;  1W9Q A;  4U18 A;  4JJT A;  2Q34 A;  4JSB A;  2KRG A;  3RST A;  1NZY A;  2ZL4 A;  2JIN A;  4JVT A;  5HED A;  4HYL A;  1U3B A;  1TID B;  2BYG A;  3CS0 A;  4JCR A;  4WZ8 B;  3V97 A;  2KPK A;  5DU6 A;  4FB8 A;  2YUY A;  3OIZ A;  3TZ3 A;  3IB9 A;  3WG5 A;  2VPH A;  2D90 A;  1UEW A;  1V5L A;  3PV4 A;  2DAZ A;  4YYX A;  1XO6 A;  1U38 A;  4OLQ A;  2UZF A;  3FDU A;  1O8U A;  1TIL B;  2K1Z A;  3MOG A;  2FE5 A;  5E11 A;  4Z8J A;  4XHV A;  2EEG A;  3JU4 A;  1UJV A;  3GGE A;  5KDR A;  4U0G A;  2KJD A;  3RLE A;  5DTW A;  3O5N A;  1IU2 A;  3AGD A;  1FC6 A;  2CS5 A;  1JXZ A;  3OU0 A;  5ILB A;  2KBS A;  3WKL A;  2GTR A;  1OZI A;  1TP3 A;  4Q6H A;  3HE2 A;  3V5I A;  3BPT A;  1Z87 A;  2VSS A;  2Q9V A;  1VAE A;  5JBW A;  2G2L A;  4H11 A;  4KNP A;  1H4Y A;  2Q3G A;  1VB7 A;  2KA5 A;  1VRG A;  2KOM A;  2DXN A;  2P3W A;  4L6W A;  3BPU A;  3U9T B;  3LNY A;  2AIN A;  2DLU A;  2I0L A;  3DOR A;  2EJY A;  1UIY A;  4JYL A;  4ZDB A;  2OSG A;  3ZW8 A;  3T6O A;  4MXI A;  5EYZ A;  4FZW A;  2VWR A;  2VSS F;  3K82 A;  4NMV A;  2FN5 A;  1OBZ A;  2M0T A;  3GAB A;  2LC6 A;  4JL7 A;  2F6I A;  4JCQ A;  3TSW A;  2I1N A;  1UEZ A;  1QAU A;  2NP9 A;  2X24 A;  2EEH A;  3P5M A;  2D3T A;  4NMR A;  3HVQ C;  3MGL A;  2FBM A;  3CBX A;  4K3W A;  3LAO A;  1MC7 A;  1WJL A;  1RJM A;  4KPK A;  5FHT A;  5FUS A;  2HGA A;  2OGP A;  2VX2 A;  1Q3O A;  4RYF H;  3DUP A;  3OIR A;  5F3X A;  2DUB A;  4K6Y A;  1PJH A;  3NFK A;  5H3J A;  3NCV A;  4UU6 A;  5HET A;  5HEY A;  2X58 A;  2L4S A;  2KL1 A;  1M5Z A;  5MGB A;  3Q0J A;  2YJG A;  2B78 A;  2IWN A;  3L3S A;  1KEF A;  1NF3 C;  1Y7N A;  2IWO A;  3EH7 A;  3SWX A;  1X6D A;  5C90 A;  1VA8 A;  4AMH A;  4ELX A;  3EGG C;  2RRL A;  3KZD A;  5D13 A;  5DZK A;  4MPA A;  4WYU A;  3I18 A;  1UFX A;  2D8I A;  3N6R B;  3T88 A;  1GQ5 A;  1SOT A;  2Q2X A;  3B76 A;  5DKP A;  2ZL0 A;  3KTJ A;  4ELS A;  1ON3 A;  3NY7 A;  3HP0 A;  2I6V A;  1YBO A;  4U0G H;  3TT7 A;  5G1Q A;  2KAW A;  4B3J A;  1WF8 A;  4K78 A;  5DU8 A;  2EJ5 A;  2KQF A;  2M10 A;  2Z17 A;  5JXB A;  2KJK A;  1IHJ A;  3H0U A;  4R2Z A;  3SHU A;  2AWW A;  4HC8 A;  2A7S A;  2EXG A;  2V90 A;  1D5G A;  1GM1 A;  4NNM A;  2EAQ A;  3JU1 A;  1XX4 A;  2IEX A;  3GF7 A;  4RI0 A;  2PNT A;  1U39 A;  3TT6 A;  4LMM A;  3KTK A;  2PKU A;  3MH4 A;  3TSZ A;  2VSU C;  4B3I A;  1RGW A;  1NTE A;  5GND A;  1TYF A;  1W9O A;  2H3M A;  2ZQQ A;  1N7E A;  5EUZ A;  3Q1T A;  3HPM A;  4J2U A;  2Q35 A;  4JC0 A;  2G5M B;  1WDK A;  1X5Q A;  1XNW A;  2H2C A;  3TDC A;  4EMM A;  3SOE A;  4HOP A;  1WI4 A;  4N6X A;  1UEP A;  4E34 A;  5HF4 A;  1TQ3 A;  3MYB A;  4JOG A;  4HDT A;  2QKU A;  4AE2 A;  3C0K A;  2V1W A;  2VZ5 A;  5E0N X;  1MFL A;  4JOE A;  2IWQ A;  3H0J A;  4L8K A;  4GHN A;  1UYV A;  5G1R A;  3IAV A;  2ZPM A;  1UYS A;  2C8T A;  3GJ9 A;  3GMF A;  3VQF A;  3KHF A;  3U9R B;  1SG4 A;  3SUZ A;  1HF2 A;  1B8Q A;  2M3M A;  3QK8 A;  4RYF A;  1UHP A;  3LLO A;  1Q51 A;  1WHD A;  2DKR A;  5HF1 A;  2H3L A;  3M6N A;  2I4S A;  3KDK A;  3BPP A;  5E1Y A;  2HE4 A;  4XS5 A;  4ELW A;  2R4H A;  3TSV A;  4Q0G A;  1TH8 B;  5DZK H;  5HFF A;  5DTP A;  2AWX A;  3T8A A;  2F0A A;  4JJ0 A;  4K29 A;  3VSE A;  3BF0 A;  4U1A A;  4L8N A;  3Q0G A;  1X45 A;  3PDZ A;  3M6M A;  3QYR A;  4FJW D;  3V5E A;  4Q3H A;  2EEI A;  4GM2 A;  4JCT A;  5HEB A;  3KQF A;  2UZC A;  4GVC A;  2DC2 A;  2L97 A;  4JOT A;  2DEO A;  1EF8 A;  2CBY A;  4Z33 A;  1FCF A;  1KY9 A;  4KWB A;  2EDZ A;  1N6D A;  2AS0 A;  3L4F D;  2F9Y A;  4ZDE A;  1R6J A;  3GLM A;  1H4X A;  3SHW A;  1PDR A;  3K8X A;  1T2M A;  3RRV A;  2FNE A;  2E7K A; 
#chains in the Genus database with same CATH homology
 2HW5 A;  1Q7X A;  3E17 A;  2ZOA A;  3GMA A;  2GZV A;  4B3H A;  3STJ A;  1Q52 A;  1UYT A;  4QII A;  2PZD A;  2F6Q A;  1RJN A;  3PZK A;  3CYY A;  3KTI A;  2F9I A;  2M0U A;  2J5I B;  3TRR A;  1TE0 A;  5HFC A;  1QAV B;  3PEA A;  2VRE A;  3QXI A;  4NMP A;  3D03 A;  4KFV A;  2JRE A;  3LKE A;  1RGR A;  4O06 A;  1UM1 A;  4NEK A;  2L4T A;  1LCY A;  3KTH A;  4AEJ A;  3HPK A;  1BE9 A;  4QFE A;  2KPL A;  2OPG A;  3DIW A;  1V1T A;  1XNY A;  2OMJ A;  2VRF A;  1DCI A;  4JCS A;  5E21 A;  5G1E A;  3EGH C;  3ID2 A;  4YLH A;  4ASI A;  1HNU A;  2D92 A;  1WH1 A;  3R68 A;  2FZS A;  1FC9 A;  1GQ4 A;  5CTB A;  2LC7 A;  1WIF A;  2AWU A;  4PQW A;  3U9S B;  1WDL A;  4K75 A;  4JFC A;  4JWV A;  3KTG A;  3PV5 A;  3ZRT A;  2YT7 A;  3R69 A;  4EMP A;  2EV8 A;  4JOH A;  2YT8 A;  3WKM A;  4FN7 A;  2WTB A;  3T3W A;  4K76 A;  2VSV A;  2CSS A;  3QO6 A;  2DM8 A;  4JYJ A;  3TLF A;  2M0Z A;  4HOP B;  4IZD A;  5JBX A;  2PA1 A;  4ZU2 A;  1QAV A;  1WFV A;  2YUB A;  1WHA A;  2EGK A;  3LNX A;  2QT5 A;  4NMQ A;  3T89 A;  3P2L A;  3ID4 A;  2K20 A;  2FCF A;  5B6L A;  3NGH A;  3H02 A;  5HFE A;  3H81 A;  2LOB A;  1YG8 A;  3I1E A;  3MH6 A;  5HFD A;  1UIT A;  2DXL A;  2OCS A;  4WYT A;  5E0S A;  4NXP A;  2I0I A;  3BEZ A;  4OEP A;  3H0Q A;  3IBB A;  3RL7 A;  2A81 A;  3I47 A;  5IL9 A;  3R0O A;  4I52 A;  4JOP A;  3KZE A;  4REY A;  4OEO A;  4NNQ A;  3MOY A;  2J5I A;  5G1D A;  4F8K A;  1NZY B;  1OBY A;  2M0V A;  2EDV A;  3MH7 A;  3QJN A;  5I7Z A;  2EEJ A;  4Q1I A;  2PPY A;  2ZPL A;  1OD2 A;  1N6F A;  5B42 A;  3QDO A;  3PS4 A;  1W2X A;  4WYO B;  2EDP A;  3SFJ A;  2CSJ A;  2WL7 A;  1P1D A;  2O2T A;  4EDJ A;  4GVD A;  1P1E A;  4YDP A;  1EY3 A;  2REY A;  3PGQ A;  2VSU F;  1YG6 A;  4G69 A;  3OC7 A;  3GDV A;  3CBY A;  2A7K A;  1QLC A;  2VSS E;  3NJD A;  2IWP A;  3ISA A;  1SOZ A;  5FB8 C;  2ZL3 A;  1ZOK A;  4IZC A;  2EHR A;  4LK5 A;  5DL1 A;  4U19 A;  1I16 A;  5CTC A;  3HLN 1;  2QKT A;  5HFB A;  3Q7H A;  4FLN A;  2VSU A;  1DUB A;  2DMZ A;  4RCN A;  5DTH A;  1XZ9 A;  4NNL A;  3GCN A;  1W9E A;  2DLS A;  3QRE A;  4I42 A;  1N99 A;  3QJM A;  2F9Y B;  4K2N A;  4E35 A;  5A2P A;  3GHF A;  4L1C A;  4FN8 A;  4Z0M A;  4UU5 A;  2JXO A;  3QMJ A;  4ZDD A;  2Z9I A;  4FGM A;  4JJ3 A;  2OS6 A;  5F67 A;  2KYL A;  1HNO A;  4OAJ A;  2YTW A;  4JOK A;  5GLJ A;  3T8B A;  5ING A;  3H0S A;  3FY5 A;  2F5Y A;  3KDG A;  3ID1 A;  2H2B A;  2PG8 A;  3MT6 A;  4KD6 A;  2FW2 A;  4Q2Q A;  3GSL A;  1WF7 A;  1U37 A;  3OT6 A;  2OZF A;  2LUI A;  4G2R A;  2MHO A;  1L6O A;  2BZR A;  2PBP A;  2R3Y A;  1PIX A;  2MX6 A;  1V5Q A;  2ZL2 A;  1X8S A;  4Q6S A;  1K32 A;  1J7X A;  5KJP A;  3VQG A;  2DB5 A;  4NMO A;  5FIF A;  1X5N A;  5IKL B;  2RCZ A;  4FZW C;  5DU4 A;  1XNV A;  2J5I I;  2PKT A;  1FC7 A;  2QG1 A;  2W3P A;  3SLL A;  3DJ1 A;  2GEF A;  1BFE A;  5E6P B;  4FND A;  1OBX A;  2DJT A;  5EZ0 A;  1WZ8 A;  3TV5 A;  1K39 A;  2EGN A;  1WG6 A;  3CH8 A;  4Q2P A;  3GCO A;  2W4F A;  5KDR B;  2KOH A;  1BPL A;  2JIK A;  1VCW A;  3MFM A;  3QXZ A;  3NJB A;  5HUQ A;  3G64 A;  3GKB A;  4U0H A;  1V62 A;  1ON9 A;  2QKV A;  4KFW A;  3R6H A;  4QIJ A;  2J5G D;  4EML A;  5HJ1 A;  1V6B A;  3JXT A;  1MJ3 A;  1I92 A;  1UJU A;  1IU0 A;  1UYR A;  4IZB A;  3PDV A;  1Z86 A;  3DJ3 A;  3ID3 A;  3RL8 A;  3QIK A;  4HNK A;  1Q3P A;  3AXA A;  2QBW A;  1MFG A;  5INF A;  2ZO9 B;  4MOU A;  3CC0 A;  4OMR A;  2I04 A;  4ZDF A;  3QGL A;  2ZQR A;  4OG1 A;  4P0C A;  2VSU E;  1Y7O A;  3TVW A;  2J5G A;  2KV8 A;  1N7F A;  3ZWC A;  4IC6 A;  3VIV A;  5E22 A;  3ZWA A;  4JOJ A;  3PE8 A;  4NMS A;  3CBZ A;  1N6E A;  1G9O A;  3QKA A;  3OME A;  3GDS A;  3I4W A;  5E0S H;  1UJD A;  4ZDC A;  3K50 A;  5DUC A;  3PV2 A;  1X5R A;  4NAR A;  2KJP A;  4Q2N A;  1WDM A;  1WI2 A;  4NMT A;  4P2A B;  1ZUB A;  2JSN A;  4WCZ A;  3HIN A;  1WFG A;  4NXQ A;  2JOA A;  3FF6 A;  1TG6 A;  3RSI A;  1SZO A;  2KOJ A;  3R9Q A;  1X9Z A;  3GF3 A;  2ENO A;  3TVU A;  3ZWB A;  4DI1 A;  3ZW9 A;  4F47 A;  3GDU A;  3TMH A;  4I4Z A;  5INI A;  1TP5 A;  2HE2 A;  3QWD A;  5HDY A;  1Y8T A;  2CE3 A;  4MI2 A;  3K1R A;  4JOR A;  5G1S A;  3HRX A;  3R9S A;  2RRM A;  4NXR A;  2JIL A;  3DJA A;  1OD4 A;  4FNB A;  1RZX A;  1UM7 A;  2EGO A;  4JOF A;  2KA9 A;  2X7Z A;  3OTP A;  2OQS A;  2VSP A;  2QQ3 A;  3P85 A;  5DUF A;  4E3B A;  1HZD A;  1KWA A;  1VJ6 A;  4K72 A;  1EF9 A;  1N7T A;  3R0H A;  3ST9 A;  1RY4 A;  2PDZ A;  2JWE A;  1UEQ A;  5C9G A;  3STA A;  3QE1 A;  3R9T A;  2F9I B;  1UF1 A;  2KG2 A;  2W7R A;  4Q2O A;  3NFL A;  2LA8 A;  1X0U A;  3O46 A;  2J5S A;  1W9Q A;  4U18 A;  4JJT A;  2Q34 A;  4JSB A;  2KRG A;  3RST A;  1NZY A;  2ZL4 A;  2JIN A;  4JVT A;  5HED A;  1U3B A;  2BYG A;  3CS0 A;  4JCR A;  4WZ8 B;  2KPK A;  5DU6 A;  4FB8 A;  2YUY A;  3TZ3 A;  3IB9 A;  3WG5 A;  2VPH A;  2D90 A;  1UEW A;  1V5L A;  3PV4 A;  2DAZ A;  4YYX A;  1XO6 A;  1U38 A;  4OLQ A;  2UZF A;  3FDU A;  1O8U A;  2K1Z A;  3MOG A;  2FE5 A;  5E11 A;  4Z8J A;  4XHV A;  2EEG A;  5KDR A;  1UJV A;  3GGE A;  4U0G A;  2KJD A;  3RLE A;  5DTW A;  3O5N A;  1IU2 A;  1FC6 A;  2CS5 A;  1JXZ A;  3OU0 A;  5ILB A;  2KBS A;  3WKL A;  2GTR A;  1OZI A;  1TP3 A;  4Q6H A;  3HE2 A;  3V5I A;  3BPT A;  1Z87 A;  2VSS A;  2Q9V A;  1VAE A;  5JBW A;  2G2L A;  4H11 A;  4KNP A;  2Q3G A;  1VB7 A;  1VRG A;  2KOM A;  2DXN A;  2P3W A;  4L6W A;  3BPU A;  3U9T B;  3LNY A;  2AIN A;  2DLU A;  2I0L A;  3DOR A;  2EJY A;  1UIY A;  4JYL A;  4ZDB A;  2OSG A;  3ZW8 A;  4MXI A;  5EYZ A;  4FZW A;  2VWR A;  2VSS F;  3K82 A;  4NMV A;  2FN5 A;  1OBZ A;  2M0T A;  3GAB A;  2LC6 A;  4JL7 A;  2F6I A;  4JCQ A;  3TSW A;  2I1N A;  1UEZ A;  1QAU A;  2NP9 A;  2X24 A;  2EEH A;  3P5M A;  2D3T A;  4NMR A;  3HVQ C;  2FBM A;  3CBX A;  4K3W A;  3LAO A;  1MC7 A;  1WJL A;  1RJM A;  4KPK A;  5FHT A;  5FUS A;  2HGA A;  2OGP A;  2VX2 A;  1Q3O A;  4RYF H;  3DUP A;  5F3X A;  2DUB A;  4K6Y A;  1PJH A;  3NFK A;  5H3J A;  3NCV A;  4UU6 A;  5HET A;  5HEY A;  2X58 A;  2L4S A;  2KL1 A;  1M5Z A;  5MGB A;  3Q0J A;  2YJG A;  2IWN A;  3L3S A;  1KEF A;  1NF3 C;  1Y7N A;  2IWO A;  3SWX A;  1X6D A;  5C90 A;  1VA8 A;  4AMH A;  4ELX A;  3EGG C;  2RRL A;  3KZD A;  5D13 A;  5DZK A;  4MPA A;  4WYU A;  3I18 A;  1UFX A;  2D8I A;  3N6R B;  3T88 A;  1GQ5 A;  1SOT A;  2Q2X A;  3B76 A;  5DKP A;  2ZL0 A;  3KTJ A;  4ELS A;  1ON3 A;  3HP0 A;  2I6V A;  1YBO A;  4U0G H;  3TT7 A;  5G1Q A;  2KAW A;  4B3J A;  1WF8 A;  4K78 A;  5DU8 A;  2EJ5 A;  2KQF A;  2M10 A;  2Z17 A;  5JXB A;  2KJK A;  1IHJ A;  3H0U A;  4R2Z A;  3SHU A;  2AWW A;  4HC8 A;  2A7S A;  2EXG A;  2V90 A;  1D5G A;  1GM1 A;  4NNM A;  2EAQ A;  3JU1 A;  1XX4 A;  2IEX A;  3GF7 A;  4RI0 A;  2PNT A;  1U39 A;  3TT6 A;  4LMM A;  3KTK A;  2PKU A;  3MH4 A;  3TSZ A;  2VSU C;  4B3I A;  1RGW A;  1NTE A;  5GND A;  1TYF A;  1W9O A;  2H3M A;  2ZQQ A;  1N7E A;  3Q1T A;  3HPM A;  4J2U A;  2Q35 A;  4JC0 A;  2G5M B;  1WDK A;  1X5Q A;  1XNW A;  2H2C A;  3TDC A;  4EMM A;  3SOE A;  4HOP A;  1WI4 A;  4N6X A;  1UEP A;  4E34 A;  5HF4 A;  1TQ3 A;  3MYB A;  4JOG A;  4HDT A;  2QKU A;  4AE2 A;  2V1W A;  2VZ5 A;  5E0N X;  1MFL A;  4JOE A;  2IWQ A;  3H0J A;  4L8K A;  4GHN A;  1UYV A;  5G1R A;  3IAV A;  2ZPM A;  1UYS A;  2C8T A;  3GJ9 A;  3GMF A;  3VQF A;  3KHF A;  3U9R B;  1SG4 A;  3SUZ A;  1B8Q A;  2M3M A;  3QK8 A;  4RYF A;  1UHP A;  1Q51 A;  1WHD A;  2DKR A;  5HF1 A;  2H3L A;  3M6N A;  2I4S A;  3KDK A;  3BPP A;  5E1Y A;  2HE4 A;  4ELW A;  2R4H A;  3TSV A;  4Q0G A;  5DZK H;  5HFF A;  5DTP A;  2AWX A;  3T8A A;  2F0A A;  4JJ0 A;  4K29 A;  3BF0 A;  4U1A A;  4L8N A;  3Q0G A;  1X45 A;  3PDZ A;  3M6M A;  3QYR A;  4FJW D;  3V5E A;  4Q3H A;  2EEI A;  4GM2 A;  4JCT A;  5HEB A;  3KQF A;  2UZC A;  4GVC A;  2DC2 A;  2L97 A;  4JOT A;  2DEO A;  1EF8 A;  2CBY A;  4Z33 A;  1FCF A;  1KY9 A;  4KWB A;  2EDZ A;  1N6D A;  3L4F D;  2F9Y A;  4ZDE A;  1R6J A;  3GLM A;  3SHW A;  1PDR A;  3K8X A;  1T2M A;  3RRV A;  2FNE A;  2E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...