1FC9A

Photosystem ii d1 c-terminal processing protease
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
386
structure length
386
Chain Sequence
VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II D1 PROTEASE
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
total genus 114
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc9A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc9A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc9A03
3H0JA 2V90A 3SFJA 2VSUA 4FZWA 2BYGA 5HEBA 5HFDA 4MI2A 1UYRA 2Q9VA 4OMRA 3PV5A 4U19A 4PQWA 2FW2A 3ID3A 3NJBA 3PEAA 4WZ8B 4AMHA 4JOTA 1V5LA 2DKRA 4O06A 3R9QA 1VRGA 4FGMA 2RRMA 4NXPA 2LC6A 1K39A 2K1ZA 3ID1A 3QJMA 3I4WA 2D8IA 3QXIA 1I16A 3R9TA 2L4TA 4NMRA 1XNWA 3TVUA 4JOPA 4GM2A 3HLN1 1I92A 4NNMA 1Q52A 2ZQRA 2UZFA 3M6NA 2VSSA 1WF8A 4Q2NA 1WDLA 2EXGA 4Q6SA 2G5MB 3ST9A 3QREA 4JOEA 4FB8A 2DM8A 5HF4A 3Q0GA 2YTWA 3OU0A 4F8KA 4ZDCA 2J5GA 1WFVA 2I4SA 4B3JA 4YYXA 1UF1A 2PKUA 1R6JA 3H0SA 3PS4A 3QE1A 4JCQA 2VSUF 3ZWCA 3QXZA 4WYTA 2EEJA 1ZOKA 4Q6HA 3RLEA 3CH8A 3I18A 2E7KA 1WDKA 2F9YA 3CC0A 5IKLB 3TSVA 3NFLA 3BF0A 4JCSA 5FUSA 1KEFA 2ENOA 3TSWA 3H02A 3P2LA 3Q0JA 3IBBA 3HPMA 2G2LA 2LOBA 3T8AA 2L97A 3HP0A 4JWVA 5EYZA 2CE3A 1FC6A 4FJWD 2DB5A 5INGA 3OC7A 4JOFA 1K32A 1JXZA 2I1NA 3STAA 5HJ1A 2KYLA 4IC6A 4Q2OA 4K6YA 2D90A 2CSJA 3M6MA 1WG6A 4K72A 4N6XA 5HEYA 5JBXA 3GJ9A 1LCYA 3TMHA 3STJA 2F9YB 1OZIA 4RCNA 2CSSA 2KAWA 3KTHA 2V1WA 5A2PA 2IEXA 2EEIA 4E34A 1W2XA 2KOMA 2PDZA 1XNYA 2QQ3A 3MT6A 5INFA 1RGRA 1VAEA 2AWUA 4NXRA 4JFCA 4MOUA 2A7SA 3GKBA 3GLMA 4NMVA 3FDUA 1WZ8A 2J5IB 2FN5A 2LUIA 4UU6A 2EEGA 2IWPA 2ZL2A 1MC7A 1UEZA 2ZL3A 4U0HA 5E22A 4IZBA 1WFGA 4DI1A 4JVTA 3LNXA 1UHPA 1KY9A 3CS0A 3SHWA 4QIIA 3QDOA 2KA9A 1UEQA 5JXBA 1OD4A 5FIFA 1NTEA 3O5NA 2IWNA 3LAOA 4ELWA 4WCZA 2I6VA 2DLUA 4JOGA 3G64A 3ZW9A 1UM1A 4REYA 4UU5A 3JU1A 4OG1A 1EF8A 1Q51A 3Q1TA 1V5QA 1WH1A 3BPUA 2WTBA 2KV8A 2VSVA 3NFKA 2M3MA 3SOEA 2PG8A 5C90A 5GLJA 5G1SA 3AXAA 5G1DA 2FCFA 3R0OA 2IWQA 4K78A 1GQ4A 1XX4A 3SUZA 4FN7A 2NP9A 2EAQA 1V6BA 4KFVA 4I52A 4K3WA 3JXTA 3R0HA 4ZDDA 3FF6A 2VZ5A 3I47A 2UZCA 4EMLA 3GMAA 2D92A 2MX6A 5C9GA 2PZDA 2H2BA 5KDRA 4U0GH 4Q2PA 1IU2A 1Y7OA 3GSLA 2JXOA 2LA8A 3DORA 3GDSA 3PZKA 5B6LA 3NJDA 1UFXA 4ZDFA 2OCSA 1NF3C 2KJKA 1UJDA 2JOAA 3TSZA 3HVQC 3L3SA 2QKTA 1TP5A 4ELSA 1BFEA 3T89A 2X24A 3P5MA 1HNUA 3R6HA 1J7XA 1HZDA 1UIYA 2Q34A 2PNTA 2J5GD 4GHNA 2D3TA 3ZWAA 3I1EA 4MPAA 3TZ3A 1X6DA 2DEOA 3T88A 5HFBA 2EDZA 3R69A 3V5IA 1M5ZA 2J5SA 2Q35A 3CBYA 3PV2A 5JBWA 5E21A 2BZRA 3RSIA 3SWXA 2HW5A 5CTBA 5KDRB 2F5YA 1TE0A 4RYFH 2EDPA 1Z86A 2VWRA 4G2RA 4QFEA 2VX2A 1P1EA 1Q3OA 2YUYA 4U1AA 1B8QA 2EDVA 4NMTA 4E3BA 3GCNA 3GF7A 4OLQA 1OBZA 4NXQA 4U18A 2MHOA 3H0UA 1N7FA 1MFGA 3Q7HA 3T3WA 2VSUE 3P85A 4Q0GA 1Q7XA 1ON9A 3IAVA 2M10A 2JREA 2EGOA 4K2NA 3NGHA 1EF9A 3QKAA 3QMJA 5D13A 5F3XA 1RY4A 2AWXA 1SG4A 1W9EA 2Z17A 5F67A 2X7ZA 5DTWA 5G1QA 2R4HA 1HNOA 2I0LA 4WYUA 2J5IA 5E11A 3GDVA 4I4ZA 1X8SA 1U39A 3IB9A 4EMPA 4Z33A 2K20A 3TDCA 5GNDA 2ZL4A 4ZU2A 2KL1A 5FHTA 2RCZA 4JOHA 4NMQA 2F9IA 4JOKA 5HFFA 4EDJA 1NZYA 1X0UA 4HC8A 1VCWA 2PBPA 5HETA 2VSSF 1GM1A 4HNKA 4WYOB 3EGGC 1SOTA 5G1RA 4NEKA 1UYSA 3OMEA 2KJPA 1UJVA 3DIWA 1VA8A 3H0QA 1FC7A 1WDMA 4YDPA 2OGPA 5E0SH 2YUBA 5DU4A 2PPYA 2OMJA 2ZPMA 2DLSA 3V5EA 1MJ3A 1N7TA 4NNQA 1L6OA 2JIKA 4Z8JA 4ZDBA 5DTHA 3ZW8A 2R3YA 3GCOA 2FNEA 3L4FD 4K75A 3RSTA 3SLLA 1FC9A 3MH6A 2AINA 4JOJA 2W3PA 2QKVA 3OT6A 2M0TA 1X45A 3K50A 3TRRA 5DKPA 4HOPA 2F9IB 1N6DA 1NZYB 4JJTA 5E0NX 2I04A 1Q3PA 2VPHA 4KFWA 4G69A 1WI2A 1N7EA 4JCTA 3PV4A 1KWAA 1MFLA 4P2AB 5INIA 1G9OA 3ID4A 2YT8A 3U9TB 4LK5A 1QLCA 2OS6A 2CBYA 3QYRA 2QBWA 1WI4A 1X5NA 3VQFA 1YG8A 1BE9A 1IU0A 2QT5A 1RJNA 1SOZA 3ZWBA 4XHVA 1ON3A 3DJ3A 1V1TA 2OZFA 4IZCA 1U38A 3WKLA 3KTKA 5HEDA 5DUFA 2DUBA 4HOPB 2IWOA 2A7KA 4ELXA 2Z9IA 2PA1A 3PGQA 2EHRA 2ZPLA 3GF3A 2HE4A 3CYYA 3HPKA 3EGHC 5HDYA 3TT7A 2KPKA 3PDZA 1N6FA 1QAVB 4R2ZA 1DUBA 3WKMA 1VJ6A 2AWWA 2X58A 3KQFA 2YT7A 1RGWA 2VREA 5DZKA 3MFMA 1P1DA 4L8NA 3QK8A 1UITA 5KJPA 1Y7NA 2FBMA 1U3BA 2CS5A 4LMMA 3U9SB 3KTJA 1OD2A 3ID2A 1TQ3A 2H2CA 1UEPA 2KOJA 2DC2A 5MGBA 2HGAA 2FZSA 4FN8A 3BEZA 3B76A 2VSPA 3FY5A 1WIFA 3DJAA 2KRGA 1ZUBA 4Z0MA 2W7RA 4EMMA 3VQGA 2L4SA 1RZXA 1N99A 2EJYA 4KWBA 2WL7A 4I42A 2F6IA 3OTPA 4OAJA 2M0VA 2ZQQA 2QG1A 3GDUA 2KOHA 1X5RA 2REYA 3LKEA 1TG6A 1YBOA 2KBSA 5DL1A 1UJUA 1XNVA 2HE2A 4K29A 2KJDA 1VB7A 4NMOA 2A81A 4FNBA 4E35A 3N6RB 1WF7A 3R9SA 4U0GA 2GTRA 4JORA 1D5GA 1IHJA 1TYFA 3TT6A 2QKUA 4B3HA 1GQ5A 4B3IA 2OQSA 4GVDA 3KTIA 3BPPA 3RRVA 1W9QA 3QO6A 5EZ0A 2F0AA 1WHAA 4GVCA 2C8TA 2KG2A 3PE8A 3HE2A 1T2MA 4NNLA 1XZ9A 2JILA 5HFEA 2VRFA 2JINA 5DUCA 2EV8A 3VIVA 4ZDEA 1PJHA 2PKTA 5FB8C 4H11A 2I0IA 4NMSA 3RL8A 1PDRA 2EEHA 4RI0A 1UYTA 1YG6A 2EJ5A 4L6WA 5DTPA 2JWEA 4OEOA 1UYVA 1N6EA 4KPKA 2DAZA 2KPLA 5E1YA 3KTGA 3U9RB 3RL7A 1TP3A 1EY3A 2J5II 1Z87A 2VSSE 1OBXA 5I7ZA 3HINA 3K1RA 4RYFA 1FCFA 4Q2QA 2P3WA 3QIKA 4NMPA 3K8XA 1W9OA 4K76A 3QWDA 3TVWA 1V62A 2M0UA 4OEPA 3MYBA 4QIJA 3H81A 3PDVA 1RJMA 3KZDA 4Q3HA 4FNDA 3E17A 3QJNA 2DJTA 3MH4A 2Q2XA 2H3LA 4JYLA 2VSUC 4FZWC 3KHFA 3ZRTA 3TLFA 4JCRA 1Y8TA 2F6QA 2KQFA 1PIXA 5CTCA 2ZL0A 1U37A 3LNYA 1X5QA 2Q3GA 4F47A 2OPGA 5HFCA 3R68A 2LC7A 1QAVA 1DCIA 1WHDA 5E6PB 4JYJA 5DU8A 3T8BA 3CBZA 3MOYA 4ASIA 2OSGA 4JL7A 2FE5A 5G1EA 3MH7A 3TV5A 5HF1A 1QAUA 5DZKH 2W4FA 1OBYA 3DJ1A 4KNPA 1XO6A 1O8UA 2M0ZA 4IZDA 4P0CA 2DMZA 3O46A 2GZVA 1WJLA 3SHUA 1UEWA 2H3MA 3KZEA 3HRXA 3GGEA 2O2TA 1SZOA 4MXIA 2EGNA 3QGLA 4KD6A 3WG5A 1UM7A 4Q1IA 5E0SA 4L8KA 3K82A 5H3JA 2EGKA 5DU6A 3ISAA 4JSBA 4YLHA 3CBXA
chains in the Genus database with same CATH superfamily
1VC1A 3H0JA 2V90A 3GK7A 3SFJA 2VSUA 4FZWA 2BYGA 5HEBA 5HFDA 4MI2A 2B78A 1UYRA 2Q9VA 5EUWA 4OMRA 3PV5A 4U19A 4PQWA 2FW2A 3ID3A 3NJBA 3PEAA 4WZ8B 4AMHA 4JOTA 1V5LA 5EZBA 2DKRA 4O06A 3R9QA 1VRGA 4FGMA 2RRMA 4NXPA 2LC6A 2OASA 1H4YA 2K1ZA 3ID1A 3QJMA 1AUZA 1K39A 4FLNA 3I4WA 2D8IA 3QXIA 1I16A 3R9TA 2L4TA 4NMRA 4JJ3A 3IH9A 3IF5A 1XNWA 3TVUA 4JOPA 4GM2A 3HLN1 1I92A 4NNMA 1Q52A 2ZQRA 2UZFA 3M6NA 3MOGA 2VSSA 1WF8A 4Q2NA 1WDLA 2EXGA 3ZXNA 4Q6SA 3GHFA 2G5MB 3ST9A 3QREA 4JOEA 4FB8A 2DM8A 5HF4A 3Q0GA 3MGLA 2YTWA 3OU0A 4F8KA 4ZDCA 2J5GA 3D03A 1WFVA 2I4SA 4B3JA 4YYXA 1UF1A 2PKUA 3GABA 1R6JA 3H0SA 3PS4A 3QE1A 4JCQA 2VSUF 3ZWCA 3QXZA 4WYTA 2EEJA 1ZOKA 4Q6HA 3RLEA 3CH8A 3I18A 2E7KA 1WDKA 2F9YA 3CC0A 5IKLB 3TSVA 3NFLA 3BF0A 4JCSA 5FUSA 1KEFA 2ENOA 3TSWA 3H02A 3P2LA 3Q0JA 3IBBA 3HPMA 2G2LA 2LOBA 3PGQA 3T8AA 2L97A 3HP0A 4JWVA 5EYZA 2CE3A 1FC6A 4FJWD 2DB5A 5INGA 3OC7A 4JOFA 1K32A 1JXZA 2I1NA 2YJGA 3STAA 3F43A 5HJ1A 2KYLA 4IC6A 4Q2OA 4K6YA 1TH8B 2D90A 5EUUA 2CSJA 3M6MA 2KLNA 1WG6A 4K72A 4N6XA 5HEYA 4AEJA 5JBXA 3GJ9A 1LCYA 3TMHA 3STJA 2F9YB 1OZIA 4RCNA 2CSSA 2KAWA 3KTHA 2V1WA 1X9ZA 5A2PA 2IEXA 2EEIA 2JSNA 4E34A 1W2XA 2KOMA 2PDZA 1XNYA 2QQ3A 3MT6A 3ZTBA 1RGRA 1VAEA 5INFA 2AWUA 4NXRA 4JFCA 4MOUA 2A7SA 3GKBA 3GLMA 4NMVA 3FDUA 1WZ8A 3GMFA 1SBOA 2J5IB 2FN5A 2LUIA 4UU6A 2EEGA 1V0EA 1THNB 2IWPA 2ZL2A 1MC7A 1UEZA 2ZL3A 4U0HA 5E22A 3LDFA 4IZBA 1WFGA 4DI1A 4JVTA 3LNXA 1UHPA 4JC0A 1KY9A 3CS0A 3SHWA 4QIIA 3OIZA 3QDOA 2KA9A 1UEQA 5JXBA 1WXXA 1BPLA 1OD4A 5FIFA 1NTEA 3O5NA 3EH7A 2IWNA 3LAOA 4ELWA 4WCZA 2I6VA 2DLUA 4JOGA 3G64A 3ZW9A 1UM1A 4REYA 4UU5A 3JU1A 4OG1A 1EF8A 1Q51A 1WXWA 2DXNA 3Q1TA 1V5QA 1WH1A 3BPUA 5EUZA 2WTBA 2KV8A 2VSVA 3NFKA 2M3MA 3SOEA 4AE2A 2PG8A 5C90A 5GLJA 5G1SA 3AXAA 5G1DA 2FCFA 3R0OA 2IWQA 4K78A 1GQ4A 1XX4A 3SUZA 4FN7A 2NP9A 2EAQA 1V6BA 4KFVA 4I52A 4K3WA 3JXTA 3R0HA 4ZDDA 3FF6A 2VZ5A 3I47A 2UZCA 4EMLA 3GMAA 2D92A 2MX6A 5C9GA 2PZDA 3LLOA 2H2BA 5KDRA 4U0GH 4Q2PA 1IU2A 1Y7OA 3GSLA 2JXOA 2LA8A 3DORA 3GDSA 2AS0A 3PZKA 5B6LA 3NJDA 1UFXA 4ZDFA 2OCSA 1NF3C 2KJKA 1UJDA 2JOAA 3TSZA 3HVQC 3QDQA 3L3SA 2QKTA 1TP5A 4ELSA 1BFEA 3T89A 2X24A 3P5MA 4HYLA 1HNUA 1J7XA 1HZDA 1UIYA 3R6HA 2Q34A 2PNTA 2J5GD 4GHNA 2D3TA 3ZWAA 3I1EA 4MPAA 3IHAA 3TZ3A 1X6DA 2DEOA 3T88A 5HFBA 2EDZA 3R69A 3V5IA 1M5ZA 2J5SA 2Q35A 3CBYA 3PV2A 5JBWA 5E21A 2BZRA 3RSIA 3SWXA 2HW5A 5CTBA 5KDRB 2F5YA 1TE0A 4DGHA 4RYFH 5HUQA 4L1CA 2EDPA 1Z86A 2VWRA 4G2RA 4QFEA 2VX2A 1P1EA 1Q3OA 2YUYA 4U1AA 1B8QA 2EDVA 4NMTA 4E3BA 3GCNA 3GF7A 4OLQA 1OBZA 2DXLA 4NXQA 4U18A 2MHOA 3H0UA 1N7FA 1MFGA 3Q7HA 3T3WA 2VSUE 3P85A 4Q0GA 1Q7XA 1ON9A 3IAVA 2M10A 2JREA 2EGOA 4K2NA 3NGHA 1EF9A 3QKAA 3QMJA 5D13A 3V8VA 5F3XA 1RY4A 2AWXA 1SG4A 1W9EA 2Z17A 5F67A 2X7ZA 5DTWA 5G1QA 2R4HA 1HNOA 2I0LA 4WYUA 2J5IA 3GVLA 5E11A 3GDVA 4I4ZA 5ILBA 1X8SA 1U39A 3IB9A 3GVKA 4EMPA 4Z33A 2K20A 3TDCA 5GNDA 2ZL4A 4ZU2A 2KL1A 5FHTA 2RCZA 4JOHA 4NMQA 2F9IA 4JOKA 5HFFA 4EDJA 1NZYA 1X0UA 4HC8A 1VCWA 2PBPA 5HETA 2VSSF 1GM1A 4HNKA 4WYOB 3EGGC 1SOTA 5G1RA 4NEKA 1UYSA 3OMEA 2KJPA 1UJVA 3DIWA 1VA8A 3H0QA 1FC7A 1WDMA 4YDPA 2OGPA 5E0SH 2YUBA 5DU4A 2PPYA 2OMJA 2ZPMA 2DLSA 3V5EA 1MJ3A 1N7TA 4NNQA 1L6OA 2JIKA 4Z8JA 3JU4A 4ZDBA 5DTHA 3ZW8A 2R3YA 3GCOA 2FNEA 3L4FD 4K75A 1TIDB 4JJ0A 1FC9A 3OIRA 3RSTA 3SLLA 3MH6A 5EUXA 2AINA 4JOJA 2W3PA 2QKVA 3OT6A 2M0TA 1X45A 3K50A 3V97A 3TRRA 5DKPA 4HOPA 4HIZA 2F9IB 1N6DA 1NZYB 4JJTA 5E0NX 2I04A 3IHBA 1Q3PA 2VPHA 4KFWA 2GEFA 4G69A 1WI2A 1N7EA 3NCVA 4JCTA 3PV4A 1KWAA 1MFLA 4P2AB 5INIA 4XS5A 1G9OA 3ID4A 2YT8A 3U9TB 4LK5A 1QLCA 2OS6A 2CBYA 3QYRA 2QBWA 1WI4A 1X5NA 3VQFA 1YG8A 1BE9A 1IU0A 2QT5A 2RRLA 1RJNA 1SOZA 3ZWBA 4XHVA 1ON3A 4DGFA 3DJ3A 1V1TA 2OZFA 4IZCA 1U38A 3WKLA 2ZOAA 5HEDA 3KTKA 5DUFA 2DUBA 4HOPB 2IWOA 2A7KA 4ELXA 2Z9IA 2PA1A 4DMGA 2EHRA 2ZPLA 3AGEA 3GF3A 2HE4A 3CYYA 3HPKA 3EGHC 5HDYA 3TT7A 2KPKA 3IH8A 3PDZA 1N6FA 1QAVB 4R2ZA 1DUBA 3WKMA 2KA5A 1VJ6A 2AWWA 2X58A 3KQFA 2YT7A 1RGWA 2ZO9B 1H4ZA 1V0FA 2VREA 5DZKA 3MFMA 1P1DA 4L8NA 3QK8A 5EUSA 1UITA 5KJPA 1Y7NA 2FBMA 1U3BA 2CS5A 4LMMA 3U9SB 3KTJA 1OD2A 3ID2A 1TQ3A 2H2CA 1UEPA 2KOJA 2DC2A 5MGBA 2HGAA 2FZSA 4FN8A 3AGDA 3BEZA 3B76A 5IL9A 2VSPA 3FY5A 1WIFA 3DJAA 2KRGA 3LKLA 1ZUBA 4Z0MA 3BPTA 2W7RA 4EMMA 3VQGA 2L4SA 1RZXA 1N99A 2EJYA 4KWBA 2WL7A 4I42A 2F6IA 3OTPA 4OAJA 2M0VA 2CWWA 2ZQQA 2QG1A 3GDUA 2KOHA 1X5RA 2REYA 3LKEA 1TG6A 1YBOA 2KBSA 5DL1A 1UJUA 1XNVA 2HE2A 4K29A 2KJDA 1VB7A 4NMOA 2A81A 4FNBA 4E35A 3N6RB 1WF7A 3R9SA 4U0GA 2GTRA 4JORA 1D5GA 1IHJA 1TYFA 3TT6A 2QKUA 4B3HA 1GQ5A 4B3IA 2OQSA 4GVDA 3KTIA 3BPPA 3RRVA 3D3UA 1W9QA 3QO6A 5EZ0A 2F0AA 1WHAA 4GVCA 1H4XA 2C8TA 2KG2A 3PE8A 3HE2A 1T2MA 4NNLA 1XZ9A 2JILA 5HFEA 2VRFA 2JINA 5DUCA 2EV8A 3VIVA 4ZDEA 1PJHA 2PKTA 5FB8C 4H11A 2I0IA 4NMSA 3NY7A 3RL8A 1PDRA 2EEHA 4RI0A 1UYTA 1YG6A 2EJ5A 4L6WA 5DTPA 2JWEA 4OEOA 4J2UA 1UYVA 1N6EA 4KPKA 2DAZA 2KPLA 5E1YA 3KTGA 3U9RB 3RL7A 1TP3A 1EY3A 2J5II 3KDKA 1Z87A 2VSSE 1OBXA 5I7ZA 3HINA 3K1RA 4RYFA 1FCFA 4Q2QA 2P3WA 3QIKA 4NMPA 3K8XA 1W9OA 4K76A 3QWDA 3TVWA 1V62A 2M0UA 4OEPA 3MYBA 4QIJA 3H81A 3PDVA 1RJMA 3KZDA 4Q3HA 4FNDA 3E17A 3QJNA 2DJTA 3GVJA 3MH4A 2Q2XA 2H3LA 4JYLA 2VSUC 4FZWC 3KHFA 3ZRTA 3TLFA 4JCRA 1Y8TA 2F6QA 2KQFA 1PIXA 4HDTA 5CTCA 3KDGA 2ZL0A 1U37A 3LNYA 1T6RA 1X5QA 2Q3GA 4F47A 2OPGA 5HFCA 3R68A 5B42A 2LC7A 1QAVA 1DCIA 1WHDA 5E6PB 1HF2A 4JYJA 5DU8A 3T8BA 3CBZA 4QTPA 3MOYA 3DUPA 4ASIA 2OSGA 4JL7A 1BUZA 2FE5A 3C0KA 5G1EA 3MH7A 2VY9A 3TV5A 5HF1A 1QAUA 5DZKH 2W4FA 1OBYA 3DJ1A 4KNPA 4NARA 1XO6A 1O8UA 2M0ZA 4IZDA 4P0CA 3T6OA 2DMZA 3O46A 2GZVA 1WJLA 3SHUA 1UEWA 2H3MA 3KZEA 3HRXA 3GGEA 2O2TA 1SZOA 4MXIA 2EGNA 3QGLA 4KD6A 3WG5A 1UM7A 4Q1IA 5E0SA 4L8KA 3K82A 5H3JA 2EGKA 5DU6A 3ISAA 4JSBA 3VSEA 4YLHA 1TILB 3CBXA
chains in the Genus database with same CATH topology
3H0JA 2V90A 3SFJA 2VSUA 4FZWA 2BYGA 5HEBA 5HFDA 4MI2A 1UYRA 2Q9VA 4OMRA 3PV5A 4U19A 4PQWA 2FW2A 3ID3A 3NJBA 3PEAA 4WZ8B 4AMHA 4JOTA 1V5LA 2DKRA 4O06A 3R9QA 1VRGA 4FGMA 2RRMA 4NXPA 2LC6A 1K39A 2K1ZA 3ID1A 3QJMA 4FLNA 3I4WA 2D8IA 3QXIA 1I16A 3R9TA 2L4TA 4NMRA 4JJ3A 1XNWA 3TVUA 4JOPA 4GM2A 3HLN1 1I92A 4NNMA 1Q52A 2ZQRA 2UZFA 3M6NA 3MOGA 2VSSA 1WF8A 4Q2NA 1WDLA 2EXGA 4Q6SA 3GHFA 2G5MB 3ST9A 3QREA 4JOEA 4FB8A 2DM8A 5HF4A 3Q0GA 2YTWA 3OU0A 4F8KA 4ZDCA 2J5GA 3D03A 1WFVA 2I4SA 4B3JA 4YYXA 1UF1A 2PKUA 3GABA 1R6JA 3H0SA 3PS4A 3QE1A 4JCQA 2VSUF 3ZWCA 3QXZA 4WYTA 2EEJA 1ZOKA 4Q6HA 3RLEA 3CH8A 3I18A 2E7KA 1WDKA 2F9YA 3CC0A 5IKLB 3TSVA 3NFLA 3BF0A 4JCSA 5FUSA 1KEFA 2ENOA 3TSWA 3H02A 3P2LA 3Q0JA 3IBBA 3HPMA 2G2LA 2LOBA 3T8AA 2L97A 3HP0A 4JWVA 5EYZA 2CE3A 1FC6A 4FJWD 2DB5A 5INGA 3OC7A 4JOFA 1K32A 1JXZA 2I1NA 2YJGA 3STAA 5HJ1A 2KYLA 4IC6A 4Q2OA 4K6YA 2D90A 2CSJA 3M6MA 1WG6A 4K72A 4N6XA 5HEYA 4AEJA 5JBXA 3GJ9A 1LCYA 3TMHA 3STJA 2F9YB 1OZIA 4RCNA 2CSSA 2KAWA 3KTHA 2V1WA 1X9ZA 5A2PA 2IEXA 2EEIA 2JSNA 4E34A 1W2XA 2KOMA 2PDZA 1XNYA 2QQ3A 3MT6A 5INFA 1RGRA 1VAEA 2AWUA 4NXRA 4JFCA 4MOUA 2A7SA 3GKBA 3GLMA 4NMVA 3FDUA 1WZ8A 3GMFA 2J5IB 2FN5A 2LUIA 4UU6A 2EEGA 2IWPA 2ZL2A 1MC7A 1UEZA 2ZL3A 4U0HA 5E22A 4IZBA 1WFGA 4DI1A 4JVTA 3LNXA 1UHPA 4JC0A 1KY9A 3CS0A 3SHWA 4QIIA 3QDOA 2KA9A 1UEQA 5JXBA 1BPLA 1OD4A 5FIFA 1NTEA 3O5NA 2IWNA 3LAOA 4ELWA 4WCZA 2I6VA 2DLUA 4JOGA 3G64A 3ZW9A 1UM1A 4REYA 4UU5A 3JU1A 4OG1A 1EF8A 1Q51A 2DXNA 3Q1TA 1V5QA 1WH1A 3BPUA 2WTBA 2KV8A 2VSVA 3NFKA 2M3MA 3SOEA 4AE2A 2PG8A 5C90A 5GLJA 5G1SA 3AXAA 5G1DA 2FCFA 3R0OA 2IWQA 4K78A 1GQ4A 1XX4A 3SUZA 4FN7A 2NP9A 2EAQA 1V6BA 4KFVA 4I52A 4K3WA 3JXTA 3R0HA 4ZDDA 3FF6A 2VZ5A 3I47A 2UZCA 4EMLA 3GMAA 2D92A 2MX6A 5C9GA 2PZDA 2H2BA 5KDRA 4U0GH 4Q2PA 1IU2A 1Y7OA 3GSLA 2JXOA 2LA8A 3DORA 3GDSA 3PZKA 5B6LA 3NJDA 1UFXA 4ZDFA 2OCSA 1NF3C 2KJKA 1UJDA 2JOAA 3TSZA 3HVQC 3L3SA 2QKTA 1TP5A 4ELSA 1BFEA 3T89A 2X24A 3P5MA 1HNUA 3R6HA 1J7XA 1HZDA 1UIYA 2Q34A 2PNTA 2J5GD 4GHNA 2D3TA 3ZWAA 3I1EA 4MPAA 3TZ3A 1X6DA 2DEOA 3T88A 5HFBA 2EDZA 3R69A 3V5IA 1M5ZA 2J5SA 2Q35A 3CBYA 3PV2A 5JBWA 5E21A 2BZRA 3RSIA 3SWXA 2HW5A 5CTBA 5KDRB 2F5YA 1TE0A 4RYFH 5HUQA 4L1CA 2EDPA 1Z86A 2VWRA 4G2RA 4QFEA 2VX2A 1P1EA 1Q3OA 2YUYA 4U1AA 1B8QA 2EDVA 4NMTA 4E3BA 3GCNA 3GF7A 4OLQA 1OBZA 2DXLA 4NXQA 4U18A 2MHOA 3H0UA 1N7FA 1MFGA 3Q7HA 3T3WA 2VSUE 3P85A 4Q0GA 1Q7XA 1ON9A 3IAVA 2M10A 2JREA 2EGOA 4K2NA 3NGHA 1EF9A 3QKAA 3QMJA 5D13A 5F3XA 1RY4A 2AWXA 1SG4A 1W9EA 2Z17A 5F67A 2X7ZA 5DTWA 5G1QA 2R4HA 1HNOA 2I0LA 4WYUA 2J5IA 5E11A 3GDVA 4I4ZA 5ILBA 1X8SA 1U39A 3IB9A 4EMPA 4Z33A 2K20A 3TDCA 5GNDA 2ZL4A 4ZU2A 2KL1A 5FHTA 2RCZA 4JOHA 4NMQA 2F9IA 4JOKA 5HFFA 4EDJA 1NZYA 1X0UA 4HC8A 1VCWA 2PBPA 5HETA 2VSSF 1GM1A 4HNKA 4WYOB 3EGGC 1SOTA 5G1RA 4NEKA 1UYSA 3OMEA 2KJPA 1UJVA 3DIWA 1VA8A 3H0QA 1FC7A 1WDMA 4YDPA 2OGPA 5E0SH 2YUBA 5DU4A 2PPYA 2OMJA 2ZPMA 2DLSA 3V5EA 1MJ3A 1N7TA 4NNQA 1L6OA 2JIKA 4Z8JA 4ZDBA 5DTHA 3ZW8A 2R3YA 3GCOA 2FNEA 3L4FD 4K75A 3RSTA 4JJ0A 1FC9A 3SLLA 3MH6A 2AINA 4JOJA 2W3PA 2QKVA 3OT6A 2M0TA 1X45A 3K50A 3TRRA 5DKPA 4HOPA 2F9IB 1N6DA 1NZYB 4JJTA 5E0NX 2I04A 1Q3PA 2VPHA 4KFWA 2GEFA 4G69A 1WI2A 1N7EA 3NCVA 4JCTA 3PV4A 1KWAA 1MFLA 4P2AB 5INIA 1G9OA 3ID4A 2YT8A 3U9TB 4LK5A 1QLCA 2OS6A 2CBYA 3QYRA 2QBWA 1WI4A 1X5NA 3VQFA 1YG8A 1BE9A 1IU0A 2QT5A 2RRLA 1RJNA 1SOZA 3ZWBA 4XHVA 1ON3A 3DJ3A 1V1TA 2OZFA 4IZCA 1U38A 3WKLA 2ZOAA 5HEDA 3KTKA 5DUFA 2DUBA 4HOPB 2IWOA 2A7KA 4ELXA 2Z9IA 2PA1A 3PGQA 2EHRA 2ZPLA 3GF3A 2HE4A 3CYYA 3HPKA 3EGHC 5HDYA 3TT7A 2KPKA 3PDZA 1N6FA 1QAVB 4R2ZA 1DUBA 3WKMA 1VJ6A 2AWWA 2X58A 3KQFA 2YT7A 1RGWA 2ZO9B 2VREA 5DZKA 3MFMA 1P1DA 4L8NA 3QK8A 1UITA 5KJPA 1Y7NA 2FBMA 1U3BA 2CS5A 4LMMA 3U9SB 3KTJA 1OD2A 3ID2A 1TQ3A 2H2CA 1UEPA 2KOJA 2DC2A 5MGBA 2HGAA 2FZSA 4FN8A 3BEZA 3B76A 5IL9A 2VSPA 3FY5A 1WIFA 3DJAA 2KRGA 1ZUBA 4Z0MA 3BPTA 2W7RA 4EMMA 3VQGA 2L4SA 1RZXA 1N99A 2EJYA 4KWBA 2WL7A 4I42A 2F6IA 3OTPA 4OAJA 2M0VA 2ZQQA 2QG1A 3GDUA 2KOHA 1X5RA 2REYA 3LKEA 1TG6A 1YBOA 2KBSA 5DL1A 1UJUA 1XNVA 2HE2A 4K29A 2KJDA 1VB7A 4NMOA 2A81A 4FNBA 4E35A 3N6RB 1WF7A 3R9SA 4U0GA 2GTRA 4JORA 1D5GA 1IHJA 1TYFA 3TT6A 2QKUA 4B3HA 1GQ5A 4B3IA 2OQSA 4GVDA 3KTIA 3BPPA 3RRVA 1W9QA 3QO6A 5EZ0A 2F0AA 1WHAA 4GVCA 2C8TA 2KG2A 3PE8A 3HE2A 1T2MA 4NNLA 1XZ9A 2JILA 5HFEA 2VRFA 2JINA 5DUCA 2EV8A 3VIVA 4ZDEA 1PJHA 2PKTA 5FB8C 4H11A 2I0IA 4NMSA 3RL8A 1PDRA 2EEHA 4RI0A 1UYTA 1YG6A 2EJ5A 4L6WA 5DTPA 2JWEA 4OEOA 4J2UA 1UYVA 1N6EA 4KPKA 2DAZA 2KPLA 5E1YA 3KTGA 3U9RB 3RL7A 1TP3A 1EY3A 2J5II 3KDKA 1Z87A 2VSSE 1OBXA 5I7ZA 3HINA 3K1RA 4RYFA 1FCFA 4Q2QA 2P3WA 3QIKA 4NMPA 3K8XA 1W9OA 4K76A 3QWDA 3TVWA 1V62A 2M0UA 4OEPA 3MYBA 4QIJA 3H81A 3PDVA 1RJMA 3KZDA 4Q3HA 4FNDA 3E17A 3QJNA 2DJTA 3MH4A 2Q2XA 2H3LA 4JYLA 2VSUC 4FZWC 3KHFA 3ZRTA 3TLFA 4JCRA 1Y8TA 2F6QA 2KQFA 1PIXA 4HDTA 5CTCA 3KDGA 2ZL0A 1U37A 3LNYA 1X5QA 2Q3GA 4F47A 2OPGA 5HFCA 3R68A 5B42A 2LC7A 1QAVA 1DCIA 1WHDA 5E6PB 4JYJA 5DU8A 3T8BA 3CBZA 3MOYA 3DUPA 4ASIA 2OSGA 4JL7A 2FE5A 5G1EA 3MH7A 3TV5A 5HF1A 1QAUA 5DZKH 2W4FA 1OBYA 3DJ1A 4KNPA 4NARA 1XO6A 1O8UA 2M0ZA 4IZDA 4P0CA 2DMZA 3O46A 2GZVA 1WJLA 3SHUA 1UEWA 2H3MA 3KZEA 3HRXA 3GGEA 2O2TA 1SZOA 4MXIA 2EGNA 3QGLA 4KD6A 3WG5A 1UM7A 4Q1IA 5E0SA 4L8KA 3K82A 5H3JA 2EGKA 5DU6A 3ISAA 4JSBA 4YLHA 3CBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0J A;  2V90 A;  3SFJ A;  2VSU A;  4FZW A;  2BYG A;  5HEB A;  5HFD A;  4MI2 A;  1UYR A;  2Q9V A;  4OMR A;  3PV5 A;  4U19 A;  4PQW A;  2FW2 A;  3ID3 A;  3NJB A;  3PEA A;  4WZ8 B;  4AMH A;  4JOT A;  1V5L A;  2DKR A;  4O06 A;  3R9Q A;  1VRG A;  4FGM A;  2RRM A;  4NXP A;  2LC6 A;  1K39 A;  2K1Z A;  3ID1 A;  3QJM A;  3I4W A;  2D8I A;  3QXI A;  1I16 A;  3R9T A;  2L4T A;  4NMR A;  1XNW A;  3TVU A;  4JOP A;  4GM2 A;  3HLN 1;  1I92 A;  4NNM A;  1Q52 A;  2ZQR A;  2UZF A;  3M6N A;  2VSS A;  1WF8 A;  4Q2N A;  1WDL A;  2EXG A;  4Q6S A;  2G5M B;  3ST9 A;  3QRE A;  4JOE A;  4FB8 A;  2DM8 A;  5HF4 A;  3Q0G A;  2YTW A;  3OU0 A;  4F8K A;  4ZDC A;  2J5G A;  1WFV A;  2I4S A;  4B3J A;  4YYX A;  1UF1 A;  2PKU A;  1R6J A;  3H0S A;  3PS4 A;  3QE1 A;  4JCQ A;  2VSU F;  3ZWC A;  3QXZ A;  4WYT A;  2EEJ A;  1ZOK A;  4Q6H A;  3RLE A;  3CH8 A;  3I18 A;  2E7K A;  1WDK A;  2F9Y A;  3CC0 A;  5IKL B;  3TSV A;  3NFL A;  3BF0 A;  4JCS A;  5FUS A;  1KEF A;  2ENO A;  3TSW A;  3H02 A;  3P2L A;  3Q0J A;  3IBB A;  3HPM A;  2G2L A;  2LOB A;  3T8A A;  2L97 A;  3HP0 A;  4JWV A;  5EYZ A;  2CE3 A;  1FC6 A;  4FJW D;  2DB5 A;  5ING A;  3OC7 A;  4JOF A;  1K32 A;  1JXZ A;  2I1N A;  3STA A;  5HJ1 A;  2KYL A;  4IC6 A;  4Q2O A;  4K6Y A;  2D90 A;  2CSJ A;  3M6M A;  1WG6 A;  4K72 A;  4N6X A;  5HEY A;  5JBX A;  3GJ9 A;  1LCY A;  3TMH A;  3STJ A;  2F9Y B;  1OZI A;  4RCN A;  2CSS A;  2KAW A;  3KTH A;  2V1W A;  5A2P A;  2IEX A;  2EEI A;  4E34 A;  1W2X A;  2KOM A;  2PDZ A;  1XNY A;  2QQ3 A;  3MT6 A;  5INF A;  1RGR A;  1VAE A;  2AWU A;  4NXR A;  4JFC A;  4MOU A;  2A7S A;  3GKB A;  3GLM A;  4NMV A;  3FDU A;  1WZ8 A;  2J5I B;  2FN5 A;  2LUI A;  4UU6 A;  2EEG A;  2IWP A;  2ZL2 A;  1MC7 A;  1UEZ A;  2ZL3 A;  4U0H A;  5E22 A;  4IZB A;  1WFG A;  4DI1 A;  4JVT A;  3LNX A;  1UHP A;  1KY9 A;  3CS0 A;  3SHW A;  4QII A;  3QDO A;  2KA9 A;  1UEQ A;  5JXB A;  1OD4 A;  5FIF A;  1NTE A;  3O5N A;  2IWN A;  3LAO A;  4ELW A;  4WCZ A;  2I6V A;  2DLU A;  4JOG A;  3G64 A;  3ZW9 A;  1UM1 A;  4REY A;  4UU5 A;  3JU1 A;  4OG1 A;  1EF8 A;  1Q51 A;  3Q1T A;  1V5Q A;  1WH1 A;  3BPU A;  2WTB A;  2KV8 A;  2VSV A;  3NFK A;  2M3M A;  3SOE A;  2PG8 A;  5C90 A;  5GLJ A;  5G1S A;  3AXA A;  5G1D A;  2FCF A;  3R0O A;  2IWQ A;  4K78 A;  1GQ4 A;  1XX4 A;  3SUZ A;  4FN7 A;  2NP9 A;  2EAQ A;  1V6B A;  4KFV A;  4I52 A;  4K3W A;  3JXT A;  3R0H A;  4ZDD A;  3FF6 A;  2VZ5 A;  3I47 A;  2UZC A;  4EML A;  3GMA A;  2D92 A;  2MX6 A;  5C9G A;  2PZD A;  2H2B A;  5KDR A;  4U0G H;  4Q2P A;  1IU2 A;  1Y7O A;  3GSL A;  2JXO A;  2LA8 A;  3DOR A;  3GDS A;  3PZK A;  5B6L A;  3NJD A;  1UFX A;  4ZDF A;  2OCS A;  1NF3 C;  2KJK A;  1UJD A;  2JOA A;  3TSZ A;  3HVQ C;  3L3S A;  2QKT A;  1TP5 A;  4ELS A;  1BFE A;  3T89 A;  2X24 A;  3P5M A;  1HNU A;  3R6H A;  1J7X A;  1HZD A;  1UIY A;  2Q34 A;  2PNT A;  2J5G D;  4GHN A;  2D3T A;  3ZWA A;  3I1E A;  4MPA A;  3TZ3 A;  1X6D A;  2DEO A;  3T88 A;  5HFB A;  2EDZ A;  3R69 A;  3V5I A;  1M5Z A;  2J5S A;  2Q35 A;  3CBY A;  3PV2 A;  5JBW A;  5E21 A;  2BZR A;  3RSI A;  3SWX A;  2HW5 A;  5CTB A;  5KDR B;  2F5Y A;  1TE0 A;  4RYF H;  2EDP A;  1Z86 A;  2VWR A;  4G2R A;  4QFE A;  2VX2 A;  1P1E A;  1Q3O A;  2YUY A;  4U1A A;  1B8Q A;  2EDV A;  4NMT A;  4E3B A;  3GCN A;  3GF7 A;  4OLQ A;  1OBZ A;  4NXQ A;  4U18 A;  2MHO A;  3H0U A;  1N7F A;  1MFG A;  3Q7H A;  3T3W A;  2VSU E;  3P85 A;  4Q0G A;  1Q7X A;  1ON9 A;  3IAV A;  2M10 A;  2JRE A;  2EGO A;  4K2N A;  3NGH A;  1EF9 A;  3QKA A;  3QMJ A;  5D13 A;  5F3X A;  1RY4 A;  2AWX A;  1SG4 A;  1W9E A;  2Z17 A;  5F67 A;  2X7Z A;  5DTW A;  5G1Q A;  2R4H A;  1HNO A;  2I0L A;  4WYU A;  2J5I A;  5E11 A;  3GDV A;  4I4Z A;  1X8S A;  1U39 A;  3IB9 A;  4EMP A;  4Z33 A;  2K20 A;  3TDC A;  5GND A;  2ZL4 A;  4ZU2 A;  2KL1 A;  5FHT A;  2RCZ A;  4JOH A;  4NMQ A;  2F9I A;  4JOK A;  5HFF A;  4EDJ A;  1NZY A;  1X0U A;  4HC8 A;  1VCW A;  2PBP A;  5HET A;  2VSS F;  1GM1 A;  4HNK A;  4WYO B;  3EGG C;  1SOT A;  5G1R A;  4NEK A;  1UYS A;  3OME A;  2KJP A;  1UJV A;  3DIW A;  1VA8 A;  3H0Q A;  1FC7 A;  1WDM A;  4YDP A;  2OGP A;  5E0S H;  2YUB A;  5DU4 A;  2PPY A;  2OMJ A;  2ZPM A;  2DLS A;  3V5E A;  1MJ3 A;  1N7T A;  4NNQ A;  1L6O A;  2JIK A;  4Z8J A;  4ZDB A;  5DTH A;  3ZW8 A;  2R3Y A;  3GCO A;  2FNE A;  3L4F D;  4K75 A;  3RST A;  3SLL A;  1FC9 A;  3MH6 A;  2AIN A;  4JOJ A;  2W3P A;  2QKV A;  3OT6 A;  2M0T A;  1X45 A;  3K50 A;  3TRR A;  5DKP A;  4HOP A;  2F9I B;  1N6D A;  1NZY B;  4JJT A;  5E0N X;  2I04 A;  1Q3P A;  2VPH A;  4KFW A;  4G69 A;  1WI2 A;  1N7E A;  4JCT A;  3PV4 A;  1KWA A;  1MFL A;  4P2A B;  5INI A;  1G9O A;  3ID4 A;  2YT8 A;  3U9T B;  4LK5 A;  1QLC A;  2OS6 A;  2CBY A;  3QYR A;  2QBW A;  1WI4 A;  1X5N A;  3VQF A;  1YG8 A;  1BE9 A;  1IU0 A;  2QT5 A;  1RJN A;  1SOZ A;  3ZWB A;  4XHV A;  1ON3 A;  3DJ3 A;  1V1T A;  2OZF A;  4IZC A;  1U38 A;  3WKL A;  3KTK A;  5HED A;  5DUF A;  2DUB A;  4HOP B;  2IWO A;  2A7K A;  4ELX A;  2Z9I A;  2PA1 A;  3PGQ A;  2EHR A;  2ZPL A;  3GF3 A;  2HE4 A;  3CYY A;  3HPK A;  3EGH C;  5HDY A;  3TT7 A;  2KPK A;  3PDZ A;  1N6F A;  1QAV B;  4R2Z A;  1DUB A;  3WKM A;  1VJ6 A;  2AWW A;  2X58 A;  3KQF A;  2YT7 A;  1RGW A;  2VRE A;  5DZK A;  3MFM A;  1P1D A;  4L8N A;  3QK8 A;  1UIT A;  5KJP A;  1Y7N A;  2FBM A;  1U3B A;  2CS5 A;  4LMM A;  3U9S B;  3KTJ A;  1OD2 A;  3ID2 A;  1TQ3 A;  2H2C A;  1UEP A;  2KOJ A;  2DC2 A;  5MGB A;  2HGA A;  2FZS A;  4FN8 A;  3BEZ A;  3B76 A;  2VSP A;  3FY5 A;  1WIF A;  3DJA A;  2KRG A;  1ZUB A;  4Z0M A;  2W7R A;  4EMM A;  3VQG A;  2L4S A;  1RZX A;  1N99 A;  2EJY A;  4KWB A;  2WL7 A;  4I42 A;  2F6I A;  3OTP A;  4OAJ A;  2M0V A;  2ZQQ A;  2QG1 A;  3GDU A;  2KOH A;  1X5R A;  2REY A;  3LKE A;  1TG6 A;  1YBO A;  2KBS A;  5DL1 A;  1UJU A;  1XNV A;  2HE2 A;  4K29 A;  2KJD A;  1VB7 A;  4NMO A;  2A81 A;  4FNB A;  4E35 A;  3N6R B;  1WF7 A;  3R9S A;  4U0G A;  2GTR A;  4JOR A;  1D5G A;  1IHJ A;  1TYF A;  3TT6 A;  2QKU A;  4B3H A;  1GQ5 A;  4B3I A;  2OQS A;  4GVD A;  3KTI A;  3BPP A;  3RRV A;  1W9Q A;  3QO6 A;  5EZ0 A;  2F0A A;  1WHA A;  4GVC A;  2C8T A;  2KG2 A;  3PE8 A;  3HE2 A;  1T2M A;  4NNL A;  1XZ9 A;  2JIL A;  5HFE A;  2VRF A;  2JIN A;  5DUC A;  2EV8 A;  3VIV A;  4ZDE A;  1PJH A;  2PKT A;  5FB8 C;  4H11 A;  2I0I A;  4NMS A;  3RL8 A;  1PDR A;  2EEH A;  4RI0 A;  1UYT A;  1YG6 A;  2EJ5 A;  4L6W A;  5DTP A;  2JWE A;  4OEO A;  1UYV A;  1N6E A;  4KPK A;  2DAZ A;  2KPL A;  5E1Y A;  3KTG A;  3U9R B;  3RL7 A;  1TP3 A;  1EY3 A;  2J5I I;  1Z87 A;  2VSS E;  1OBX A;  5I7Z A;  3HIN A;  3K1R A;  4RYF A;  1FCF A;  4Q2Q A;  2P3W A;  3QIK A;  4NMP A;  3K8X A;  1W9O A;  4K76 A;  3QWD A;  3TVW A;  1V62 A;  2M0U A;  4OEP A;  3MYB A;  4QIJ A;  3H81 A;  3PDV A;  1RJM A;  3KZD A;  4Q3H A;  4FND A;  3E17 A;  3QJN A;  2DJT A;  3MH4 A;  2Q2X A;  2H3L A;  4JYL A;  2VSU C;  4FZW C;  3KHF A;  3ZRT A;  3TLF A;  4JCR A;  1Y8T A;  2F6Q A;  2KQF A;  1PIX A;  5CTC A;  2ZL0 A;  1U37 A;  3LNY A;  1X5Q A;  2Q3G A;  4F47 A;  2OPG A;  5HFC A;  3R68 A;  2LC7 A;  1QAV A;  1DCI A;  1WHD A;  5E6P B;  4JYJ A;  5DU8 A;  3T8B A;  3CBZ A;  3MOY A;  4ASI A;  2OSG A;  4JL7 A;  2FE5 A;  5G1E A;  3MH7 A;  3TV5 A;  5HF1 A;  1QAU A;  5DZK H;  2W4F A;  1OBY A;  3DJ1 A;  4KNP A;  1XO6 A;  1O8U A;  2M0Z A;  4IZD A;  4P0C A;  2DMZ A;  3O46 A;  2GZV A;  1WJL A;  3SHU A;  1UEW A;  2H3M A;  3KZE A;  3HRX A;  3GGE A;  2O2T A;  1SZO A;  4MXI A;  2EGN A;  3QGL A;  4KD6 A;  3WG5 A;  1UM7 A;  4Q1I A;  5E0S A;  4L8K A;  3K82 A;  5H3J A;  2EGK A;  5DU6 A;  3ISA A;  4JSB A;  4YLH A;  3CBX A; 
#chains in the Genus database with same CATH topology
 1VC1 A;  3H0J A;  2V90 A;  3GK7 A;  3SFJ A;  2VSU A;  4FZW A;  2BYG A;  5HEB A;  5HFD A;  4MI2 A;  2B78 A;  1UYR A;  2Q9V A;  5EUW A;  4OMR A;  3PV5 A;  4U19 A;  4PQW A;  2FW2 A;  3ID3 A;  3NJB A;  3PEA A;  4WZ8 B;  4AMH A;  4JOT A;  1V5L A;  5EZB A;  2DKR A;  4O06 A;  3R9Q A;  1VRG A;  4FGM A;  2RRM A;  4NXP A;  2LC6 A;  2OAS A;  1H4Y A;  2K1Z A;  3ID1 A;  3QJM A;  1AUZ A;  1K39 A;  4FLN A;  3I4W A;  2D8I A;  3QXI A;  1I16 A;  3R9T A;  2L4T A;  4NMR A;  4JJ3 A;  3IH9 A;  3IF5 A;  1XNW A;  3TVU A;  4JOP A;  4GM2 A;  3HLN 1;  1I92 A;  4NNM A;  1Q52 A;  2ZQR A;  2UZF A;  3M6N A;  3MOG A;  2VSS A;  1WF8 A;  4Q2N A;  1WDL A;  2EXG A;  3ZXN A;  4Q6S A;  3GHF A;  2G5M B;  3ST9 A;  3QRE A;  4JOE A;  4FB8 A;  2DM8 A;  5HF4 A;  3Q0G A;  3MGL A;  2YTW A;  3OU0 A;  4F8K A;  4ZDC A;  2J5G A;  3D03 A;  1WFV A;  2I4S A;  4B3J A;  4YYX A;  1UF1 A;  2PKU A;  3GAB A;  1R6J A;  3H0S A;  3PS4 A;  3QE1 A;  4JCQ A;  2VSU F;  3ZWC A;  3QXZ A;  4WYT A;  2EEJ A;  1ZOK A;  4Q6H A;  3RLE A;  3CH8 A;  3I18 A;  2E7K A;  1WDK A;  2F9Y A;  3CC0 A;  5IKL B;  3TSV A;  3NFL A;  3BF0 A;  4JCS A;  5FUS A;  1KEF A;  2ENO A;  3TSW A;  3H02 A;  3P2L A;  3Q0J A;  3IBB A;  3HPM A;  2G2L A;  2LOB A;  3PGQ A;  3T8A A;  2L97 A;  3HP0 A;  4JWV A;  5EYZ A;  2CE3 A;  1FC6 A;  4FJW D;  2DB5 A;  5ING A;  3OC7 A;  4JOF A;  1K32 A;  1JXZ A;  2I1N A;  2YJG A;  3STA A;  3F43 A;  5HJ1 A;  2KYL A;  4IC6 A;  4Q2O A;  4K6Y A;  1TH8 B;  2D90 A;  5EUU A;  2CSJ A;  3M6M A;  2KLN A;  1WG6 A;  4K72 A;  4N6X A;  5HEY A;  4AEJ A;  5JBX A;  3GJ9 A;  1LCY A;  3TMH A;  3STJ A;  2F9Y B;  1OZI A;  4RCN A;  2CSS A;  2KAW A;  3KTH A;  2V1W A;  1X9Z A;  5A2P A;  2IEX A;  2EEI A;  2JSN A;  4E34 A;  1W2X A;  2KOM A;  2PDZ A;  1XNY A;  2QQ3 A;  3MT6 A;  3ZTB A;  1RGR A;  1VAE A;  5INF A;  2AWU A;  4NXR A;  4JFC A;  4MOU A;  2A7S A;  3GKB A;  3GLM A;  4NMV A;  3FDU A;  1WZ8 A;  3GMF A;  1SBO A;  2J5I B;  2FN5 A;  2LUI A;  4UU6 A;  2EEG A;  1V0E A;  1THN B;  2IWP A;  2ZL2 A;  1MC7 A;  1UEZ A;  2ZL3 A;  4U0H A;  5E22 A;  3LDF A;  4IZB A;  1WFG A;  4DI1 A;  4JVT A;  3LNX A;  1UHP A;  4JC0 A;  1KY9 A;  3CS0 A;  3SHW A;  4QII A;  3OIZ A;  3QDO A;  2KA9 A;  1UEQ A;  5JXB A;  1WXX A;  1BPL A;  1OD4 A;  5FIF A;  1NTE A;  3O5N A;  3EH7 A;  2IWN A;  3LAO A;  4ELW A;  4WCZ A;  2I6V A;  2DLU A;  4JOG A;  3G64 A;  3ZW9 A;  1UM1 A;  4REY A;  4UU5 A;  3JU1 A;  4OG1 A;  1EF8 A;  1Q51 A;  1WXW A;  2DXN A;  3Q1T A;  1V5Q A;  1WH1 A;  3BPU A;  5EUZ A;  2WTB A;  2KV8 A;  2VSV A;  3NFK A;  2M3M A;  3SOE A;  4AE2 A;  2PG8 A;  5C90 A;  5GLJ A;  5G1S A;  3AXA A;  5G1D A;  2FCF A;  3R0O A;  2IWQ A;  4K78 A;  1GQ4 A;  1XX4 A;  3SUZ A;  4FN7 A;  2NP9 A;  2EAQ A;  1V6B A;  4KFV A;  4I52 A;  4K3W A;  3JXT A;  3R0H A;  4ZDD A;  3FF6 A;  2VZ5 A;  3I47 A;  2UZC A;  4EML A;  3GMA A;  2D92 A;  2MX6 A;  5C9G A;  2PZD A;  3LLO A;  2H2B A;  5KDR A;  4U0G H;  4Q2P A;  1IU2 A;  1Y7O A;  3GSL A;  2JXO A;  2LA8 A;  3DOR A;  3GDS A;  2AS0 A;  3PZK A;  5B6L A;  3NJD A;  1UFX A;  4ZDF A;  2OCS A;  1NF3 C;  2KJK A;  1UJD A;  2JOA A;  3TSZ A;  3HVQ C;  3QDQ A;  3L3S A;  2QKT A;  1TP5 A;  4ELS A;  1BFE A;  3T89 A;  2X24 A;  3P5M A;  4HYL A;  1HNU A;  1J7X A;  1HZD A;  1UIY A;  3R6H A;  2Q34 A;  2PNT A;  2J5G D;  4GHN A;  2D3T A;  3ZWA A;  3I1E A;  4MPA A;  3IHA A;  3TZ3 A;  1X6D A;  2DEO A;  3T88 A;  5HFB A;  2EDZ A;  3R69 A;  3V5I A;  1M5Z A;  2J5S A;  2Q35 A;  3CBY A;  3PV2 A;  5JBW A;  5E21 A;  2BZR A;  3RSI A;  3SWX A;  2HW5 A;  5CTB A;  5KDR B;  2F5Y A;  1TE0 A;  4DGH A;  4RYF H;  5HUQ A;  4L1C A;  2EDP A;  1Z86 A;  2VWR A;  4G2R A;  4QFE A;  2VX2 A;  1P1E A;  1Q3O A;  2YUY A;  4U1A A;  1B8Q A;  2EDV A;  4NMT A;  4E3B A;  3GCN A;  3GF7 A;  4OLQ A;  1OBZ A;  2DXL A;  4NXQ A;  4U18 A;  2MHO A;  3H0U A;  1N7F A;  1MFG A;  3Q7H A;  3T3W A;  2VSU E;  3P85 A;  4Q0G A;  1Q7X A;  1ON9 A;  3IAV A;  2M10 A;  2JRE A;  2EGO A;  4K2N A;  3NGH A;  1EF9 A;  3QKA A;  3QMJ A;  5D13 A;  3V8V A;  5F3X A;  1RY4 A;  2AWX A;  1SG4 A;  1W9E A;  2Z17 A;  5F67 A;  2X7Z A;  5DTW A;  5G1Q A;  2R4H A;  1HNO A;  2I0L A;  4WYU A;  2J5I A;  3GVL A;  5E11 A;  3GDV A;  4I4Z A;  5ILB A;  1X8S A;  1U39 A;  3IB9 A;  3GVK A;  4EMP A;  4Z33 A;  2K20 A;  3TDC A;  5GND A;  2ZL4 A;  4ZU2 A;  2KL1 A;  5FHT A;  2RCZ A;  4JOH A;  4NMQ A;  2F9I A;  4JOK A;  5HFF A;  4EDJ A;  1NZY A;  1X0U A;  4HC8 A;  1VCW A;  2PBP A;  5HET A;  2VSS F;  1GM1 A;  4HNK A;  4WYO B;  3EGG C;  1SOT A;  5G1R A;  4NEK A;  1UYS A;  3OME A;  2KJP A;  1UJV A;  3DIW A;  1VA8 A;  3H0Q A;  1FC7 A;  1WDM A;  4YDP A;  2OGP A;  5E0S H;  2YUB A;  5DU4 A;  2PPY A;  2OMJ A;  2ZPM A;  2DLS A;  3V5E A;  1MJ3 A;  1N7T A;  4NNQ A;  1L6O A;  2JIK A;  4Z8J A;  3JU4 A;  4ZDB A;  5DTH A;  3ZW8 A;  2R3Y A;  3GCO A;  2FNE A;  3L4F D;  4K75 A;  1TID B;  4JJ0 A;  1FC9 A;  3OIR A;  3RST A;  3SLL A;  3MH6 A;  5EUX A;  2AIN A;  4JOJ A;  2W3P A;  2QKV A;  3OT6 A;  2M0T A;  1X45 A;  3K50 A;  3V97 A;  3TRR A;  5DKP A;  4HOP A;  4HIZ A;  2F9I B;  1N6D A;  1NZY B;  4JJT A;  5E0N X;  2I04 A;  3IHB A;  1Q3P A;  2VPH A;  4KFW A;  2GEF A;  4G69 A;  1WI2 A;  1N7E A;  3NCV A;  4JCT A;  3PV4 A;  1KWA A;  1MFL A;  4P2A B;  5INI A;  4XS5 A;  1G9O A;  3ID4 A;  2YT8 A;  3U9T B;  4LK5 A;  1QLC A;  2OS6 A;  2CBY A;  3QYR A;  2QBW A;  1WI4 A;  1X5N A;  3VQF A;  1YG8 A;  1BE9 A;  1IU0 A;  2QT5 A;  2RRL A;  1RJN A;  1SOZ A;  3ZWB A;  4XHV A;  1ON3 A;  4DGF A;  3DJ3 A;  1V1T A;  2OZF A;  4IZC A;  1U38 A;  3WKL A;  2ZOA A;  5HED A;  3KTK A;  5DUF A;  2DUB A;  4HOP B;  2IWO A;  2A7K A;  4ELX A;  2Z9I A;  2PA1 A;  4DMG A;  2EHR A;  2ZPL A;  3AGE A;  3GF3 A;  2HE4 A;  3CYY A;  3HPK A;  3EGH C;  5HDY A;  3TT7 A;  2KPK A;  3IH8 A;  3PDZ A;  1N6F A;  1QAV B;  4R2Z A;  1DUB A;  3WKM A;  2KA5 A;  1VJ6 A;  2AWW A;  2X58 A;  3KQF A;  2YT7 A;  1RGW A;  2ZO9 B;  1H4Z A;  1V0F A;  2VRE A;  5DZK A;  3MFM A;  1P1D A;  4L8N A;  3QK8 A;  5EUS A;  1UIT A;  5KJP A;  1Y7N A;  2FBM A;  1U3B A;  2CS5 A;  4LMM A;  3U9S B;  3KTJ A;  1OD2 A;  3ID2 A;  1TQ3 A;  2H2C A;  1UEP A;  2KOJ A;  2DC2 A;  5MGB A;  2HGA A;  2FZS A;  4FN8 A;  3AGD A;  3BEZ A;  3B76 A;  5IL9 A;  2VSP A;  3FY5 A;  1WIF A;  3DJA A;  2KRG A;  3LKL A;  1ZUB A;  4Z0M A;  3BPT A;  2W7R A;  4EMM A;  3VQG A;  2L4S A;  1RZX A;  1N99 A;  2EJY A;  4KWB A;  2WL7 A;  4I42 A;  2F6I A;  3OTP A;  4OAJ A;  2M0V A;  2CWW A;  2ZQQ A;  2QG1 A;  3GDU A;  2KOH A;  1X5R A;  2REY A;  3LKE A;  1TG6 A;  1YBO A;  2KBS A;  5DL1 A;  1UJU A;  1XNV A;  2HE2 A;  4K29 A;  2KJD A;  1VB7 A;  4NMO A;  2A81 A;  4FNB A;  4E35 A;  3N6R B;  1WF7 A;  3R9S A;  4U0G A;  2GTR A;  4JOR A;  1D5G A;  1IHJ A;  1TYF A;  3TT6 A;  2QKU A;  4B3H A;  1GQ5 A;  4B3I A;  2OQS A;  4GVD A;  3KTI A;  3BPP A;  3RRV A;  3D3U A;  1W9Q A;  3QO6 A;  5EZ0 A;  2F0A A;  1WHA A;  4GVC A;  1H4X A;  2C8T A;  2KG2 A;  3PE8 A;  3HE2 A;  1T2M A;  4NNL A;  1XZ9 A;  2JIL A;  5HFE A;  2VRF A;  2JIN A;  5DUC A;  2EV8 A;  3VIV A;  4ZDE A;  1PJH A;  2PKT A;  5FB8 C;  4H11 A;  2I0I A;  4NMS A;  3NY7 A;  3RL8 A;  1PDR A;  2EEH A;  4RI0 A;  1UYT A;  1YG6 A;  2EJ5 A;  4L6W A;  5DTP A;  2JWE A;  4OEO A;  4J2U A;  1UYV A;  1N6E A;  4KPK A;  2DAZ A;  2KPL A;  5E1Y A;  3KTG A;  3U9R B;  3RL7 A;  1TP3 A;  1EY3 A;  2J5I I;  3KDK A;  1Z87 A;  2VSS E;  1OBX A;  5I7Z A;  3HIN A;  3K1R A;  4RYF A;  1FCF A;  4Q2Q A;  2P3W A;  3QIK A;  4NMP A;  3K8X A;  1W9O A;  4K76 A;  3QWD A;  3TVW A;  1V62 A;  2M0U A;  4OEP A;  3MYB A;  4QIJ A;  3H81 A;  3PDV A;  1RJM A;  3KZD A;  4Q3H A;  4FND A;  3E17 A;  3QJN A;  2DJT A;  3GVJ A;  3MH4 A;  2Q2X A;  2H3L A;  4JYL A;  2VSU C;  4FZW C;  3KHF A;  3ZRT A;  3TLF A;  4JCR A;  1Y8T A;  2F6Q A;  2KQF A;  1PIX A;  4HDT A;  5CTC A;  3KDG A;  2ZL0 A;  1U37 A;  3LNY A;  1T6R A;  1X5Q A;  2Q3G A;  4F47 A;  2OPG A;  5HFC A;  3R68 A;  5B42 A;  2LC7 A;  1QAV A;  1DCI A;  1WHD A;  5E6P B;  1HF2 A;  4JYJ A;  5DU8 A;  3T8B A;  3CBZ A;  4QTP A;  3MOY A;  3DUP A;  4ASI A;  2OSG A;  4JL7 A;  1BUZ A;  2FE5 A;  3C0K A;  5G1E A;  3MH7 A;  2VY9 A;  3TV5 A;  5HF1 A;  1QAU A;  5DZK H;  2W4F A;  1OBY A;  3DJ1 A;  4KNP A;  4NAR A;  1XO6 A;  1O8U A;  2M0Z A;  4IZD A;  4P0C A;  3T6O A;  2DMZ A;  3O46 A;  2GZV A;  1WJL A;  3SHU A;  1UEW A;  2H3M A;  3KZE A;  3HRX A;  3GGE A;  2O2T A;  1SZO A;  4MXI A;  2EGN A;  3QGL A;  4KD6 A;  3WG5 A;  1UM7 A;  4Q1I A;  5E0S A;  4L8K A;  3K82 A;  5H3J A;  2EGK A;  5DU6 A;  3ISA A;  4JSB A;  3VSE A;  4YLH A;  1TIL B;  3CBX A; 
#chains in the Genus database with same CATH homology
 3H0J A;  2V90 A;  3SFJ A;  2VSU A;  4FZW A;  2BYG A;  5HEB A;  5HFD A;  4MI2 A;  1UYR A;  2Q9V A;  4OMR A;  3PV5 A;  4U19 A;  4PQW A;  2FW2 A;  3ID3 A;  3NJB A;  3PEA A;  4WZ8 B;  4AMH A;  4JOT A;  1V5L A;  2DKR A;  4O06 A;  3R9Q A;  1VRG A;  4FGM A;  2RRM A;  4NXP A;  2LC6 A;  1K39 A;  2K1Z A;  3ID1 A;  3QJM A;  4FLN A;  3I4W A;  2D8I A;  3QXI A;  1I16 A;  3R9T A;  2L4T A;  4NMR A;  4JJ3 A;  1XNW A;  3TVU A;  4JOP A;  4GM2 A;  3HLN 1;  1I92 A;  4NNM A;  1Q52 A;  2ZQR A;  2UZF A;  3M6N A;  3MOG A;  2VSS A;  1WF8 A;  4Q2N A;  1WDL A;  2EXG A;  4Q6S A;  3GHF A;  2G5M B;  3ST9 A;  3QRE A;  4JOE A;  4FB8 A;  2DM8 A;  5HF4 A;  3Q0G A;  2YTW A;  3OU0 A;  4F8K A;  4ZDC A;  2J5G A;  3D03 A;  1WFV A;  2I4S A;  4B3J A;  4YYX A;  1UF1 A;  2PKU A;  3GAB A;  1R6J A;  3H0S A;  3PS4 A;  3QE1 A;  4JCQ A;  2VSU F;  3ZWC A;  3QXZ A;  4WYT A;  2EEJ A;  1ZOK A;  4Q6H A;  3RLE A;  3CH8 A;  3I18 A;  2E7K A;  1WDK A;  2F9Y A;  3CC0 A;  5IKL B;  3TSV A;  3NFL A;  3BF0 A;  4JCS A;  5FUS A;  1KEF A;  2ENO A;  3TSW A;  3H02 A;  3P2L A;  3Q0J A;  3IBB A;  3HPM A;  2G2L A;  2LOB A;  3T8A A;  2L97 A;  3HP0 A;  4JWV A;  5EYZ A;  2CE3 A;  1FC6 A;  4FJW D;  2DB5 A;  5ING A;  3OC7 A;  4JOF A;  1K32 A;  1JXZ A;  2I1N A;  2YJG A;  3STA A;  5HJ1 A;  2KYL A;  4IC6 A;  4Q2O A;  4K6Y A;  2D90 A;  2CSJ A;  3M6M A;  1WG6 A;  4K72 A;  4N6X A;  5HEY A;  4AEJ A;  5JBX A;  3GJ9 A;  1LCY A;  3TMH A;  3STJ A;  2F9Y B;  1OZI A;  4RCN A;  2CSS A;  2KAW A;  3KTH A;  2V1W A;  1X9Z A;  5A2P A;  2IEX A;  2EEI A;  2JSN A;  4E34 A;  1W2X A;  2KOM A;  2PDZ A;  1XNY A;  2QQ3 A;  3MT6 A;  5INF A;  1RGR A;  1VAE A;  2AWU A;  4NXR A;  4JFC A;  4MOU A;  2A7S A;  3GKB A;  3GLM A;  4NMV A;  3FDU A;  1WZ8 A;  3GMF A;  2J5I B;  2FN5 A;  2LUI A;  4UU6 A;  2EEG A;  2IWP A;  2ZL2 A;  1MC7 A;  1UEZ A;  2ZL3 A;  4U0H A;  5E22 A;  4IZB A;  1WFG A;  4DI1 A;  4JVT A;  3LNX A;  1UHP A;  4JC0 A;  1KY9 A;  3CS0 A;  3SHW A;  4QII A;  3QDO A;  2KA9 A;  1UEQ A;  5JXB A;  1BPL A;  1OD4 A;  5FIF A;  1NTE A;  3O5N A;  2IWN A;  3LAO A;  4ELW A;  4WCZ A;  2I6V A;  2DLU A;  4JOG A;  3G64 A;  3ZW9 A;  1UM1 A;  4REY A;  4UU5 A;  3JU1 A;  4OG1 A;  1EF8 A;  1Q51 A;  2DXN A;  3Q1T A;  1V5Q A;  1WH1 A;  3BPU A;  2WTB A;  2KV8 A;  2VSV A;  3NFK A;  2M3M A;  3SOE A;  4AE2 A;  2PG8 A;  5C90 A;  5GLJ A;  5G1S A;  3AXA A;  5G1D A;  2FCF A;  3R0O A;  2IWQ A;  4K78 A;  1GQ4 A;  1XX4 A;  3SUZ A;  4FN7 A;  2NP9 A;  2EAQ A;  1V6B A;  4KFV A;  4I52 A;  4K3W A;  3JXT A;  3R0H A;  4ZDD A;  3FF6 A;  2VZ5 A;  3I47 A;  2UZC A;  4EML A;  3GMA A;  2D92 A;  2MX6 A;  5C9G A;  2PZD A;  2H2B A;  5KDR A;  4U0G H;  4Q2P A;  1IU2 A;  1Y7O A;  3GSL A;  2JXO A;  2LA8 A;  3DOR A;  3GDS A;  3PZK A;  5B6L A;  3NJD A;  1UFX A;  4ZDF A;  2OCS A;  1NF3 C;  2KJK A;  1UJD A;  2JOA A;  3TSZ A;  3HVQ C;  3L3S A;  2QKT A;  1TP5 A;  4ELS A;  1BFE A;  3T89 A;  2X24 A;  3P5M A;  1HNU A;  3R6H A;  1J7X A;  1HZD A;  1UIY A;  2Q34 A;  2PNT A;  2J5G D;  4GHN A;  2D3T A;  3ZWA A;  3I1E A;  4MPA A;  3TZ3 A;  1X6D A;  2DEO A;  3T88 A;  5HFB A;  2EDZ A;  3R69 A;  3V5I A;  1M5Z A;  2J5S A;  2Q35 A;  3CBY A;  3PV2 A;  5JBW A;  5E21 A;  2BZR A;  3RSI A;  3SWX A;  2HW5 A;  5CTB A;  5KDR B;  2F5Y A;  1TE0 A;  4RYF H;  5HUQ A;  4L1C A;  2EDP A;  1Z86 A;  2VWR A;  4G2R A;  4QFE A;  2VX2 A;  1P1E A;  1Q3O A;  2YUY A;  4U1A A;  1B8Q A;  2EDV A;  4NMT A;  4E3B A;  3GCN A;  3GF7 A;  4OLQ A;  1OBZ A;  2DXL A;  4NXQ A;  4U18 A;  2MHO A;  3H0U A;  1N7F A;  1MFG A;  3Q7H A;  3T3W A;  2VSU E;  3P85 A;  4Q0G A;  1Q7X A;  1ON9 A;  3IAV A;  2M10 A;  2JRE A;  2EGO A;  4K2N A;  3NGH A;  1EF9 A;  3QKA A;  3QMJ A;  5D13 A;  5F3X A;  1RY4 A;  2AWX A;  1SG4 A;  1W9E A;  2Z17 A;  5F67 A;  2X7Z A;  5DTW A;  5G1Q A;  2R4H A;  1HNO A;  2I0L A;  4WYU A;  2J5I A;  5E11 A;  3GDV A;  4I4Z A;  5ILB A;  1X8S A;  1U39 A;  3IB9 A;  4EMP A;  4Z33 A;  2K20 A;  3TDC A;  5GND A;  2ZL4 A;  4ZU2 A;  2KL1 A;  5FHT A;  2RCZ A;  4JOH A;  4NMQ A;  2F9I A;  4JOK A;  5HFF A;  4EDJ A;  1NZY A;  1X0U A;  4HC8 A;  1VCW A;  2PBP A;  5HET A;  2VSS F;  1GM1 A;  4HNK A;  4WYO B;  3EGG C;  1SOT A;  5G1R A;  4NEK A;  1UYS A;  3OME A;  2KJP A;  1UJV A;  3DIW A;  1VA8 A;  3H0Q A;  1FC7 A;  1WDM A;  4YDP A;  2OGP A;  5E0S H;  2YUB A;  5DU4 A;  2PPY A;  2OMJ A;  2ZPM A;  2DLS A;  3V5E A;  1MJ3 A;  1N7T A;  4NNQ A;  1L6O A;  2JIK A;  4Z8J A;  4ZDB A;  5DTH A;  3ZW8 A;  2R3Y A;  3GCO A;  2FNE A;  3L4F D;  4K75 A;  3RST A;  4JJ0 A;  1FC9 A;  3SLL A;  3MH6 A;  2AIN A;  4JOJ A;  2W3P A;  2QKV A;  3OT6 A;  2M0T A;  1X45 A;  3K50 A;  3TRR A;  5DKP A;  4HOP A;  2F9I B;  1N6D A;  1NZY B;  4JJT A;  5E0N X;  2I04 A;  1Q3P A;  2VPH A;  4KFW A;  2GEF A;  4G69 A;  1WI2 A;  1N7E A;  3NCV A;  4JCT A;  3PV4 A;  1KWA A;  1MFL A;  4P2A B;  5INI A;  1G9O A;  3ID4 A;  2YT8 A;  3U9T B;  4LK5 A;  1QLC A;  2OS6 A;  2CBY A;  3QYR A;  2QBW A;  1WI4 A;  1X5N A;  3VQF A;  1YG8 A;  1BE9 A;  1IU0 A;  2QT5 A;  2RRL A;  1RJN A;  1SOZ A;  3ZWB A;  4XHV A;  1ON3 A;  3DJ3 A;  1V1T A;  2OZF A;  4IZC A;  1U38 A;  3WKL A;  2ZOA A;  5HED A;  3KTK A;  5DUF A;  2DUB A;  4HOP B;  2IWO A;  2A7K A;  4ELX A;  2Z9I A;  2PA1 A;  3PGQ A;  2EHR A;  2ZPL A;  3GF3 A;  2HE4 A;  3CYY A;  3HPK A;  3EGH C;  5HDY A;  3TT7 A;  2KPK A;  3PDZ A;  1N6F A;  1QAV B;  4R2Z A;  1DUB A;  3WKM A;  1VJ6 A;  2AWW A;  2X58 A;  3KQF A;  2YT7 A;  1RGW A;  2ZO9 B;  2VRE A;  5DZK A;  3MFM A;  1P1D A;  4L8N A;  3QK8 A;  1UIT A;  5KJP A;  1Y7N A;  2FBM A;  1U3B A;  2CS5 A;  4LMM A;  3U9S B;  3KTJ A;  1OD2 A;  3ID2 A;  1TQ3 A;  2H2C A;  1UEP A;  2KOJ A;  2DC2 A;  5MGB A;  2HGA A;  2FZS A;  4FN8 A;  3BEZ A;  3B76 A;  5IL9 A;  2VSP A;  3FY5 A;  1WIF A;  3DJA A;  2KRG A;  1ZUB A;  4Z0M A;  3BPT A;  2W7R A;  4EMM A;  3VQG A;  2L4S A;  1RZX A;  1N99 A;  2EJY A;  4KWB A;  2WL7 A;  4I42 A;  2F6I A;  3OTP A;  4OAJ A;  2M0V A;  2ZQQ A;  2QG1 A;  3GDU A;  2KOH A;  1X5R A;  2REY A;  3LKE A;  1TG6 A;  1YBO A;  2KBS A;  5DL1 A;  1UJU A;  1XNV A;  2HE2 A;  4K29 A;  2KJD A;  1VB7 A;  4NMO A;  2A81 A;  4FNB A;  4E35 A;  3N6R B;  1WF7 A;  3R9S A;  4U0G A;  2GTR A;  4JOR A;  1D5G A;  1IHJ A;  1TYF A;  3TT6 A;  2QKU A;  4B3H A;  1GQ5 A;  4B3I A;  2OQS A;  4GVD A;  3KTI A;  3BPP A;  3RRV A;  1W9Q A;  3QO6 A;  5EZ0 A;  2F0A A;  1WHA A;  4GVC A;  2C8T A;  2KG2 A;  3PE8 A;  3HE2 A;  1T2M A;  4NNL A;  1XZ9 A;  2JIL A;  5HFE A;  2VRF A;  2JIN A;  5DUC A;  2EV8 A;  3VIV A;  4ZDE A;  1PJH A;  2PKT A;  5FB8 C;  4H11 A;  2I0I A;  4NMS A;  3RL8 A;  1PDR A;  2EEH A;  4RI0 A;  1UYT A;  1YG6 A;  2EJ5 A;  4L6W A;  5DTP A;  2JWE A;  4OEO A;  4J2U A;  1UYV A;  1N6E A;  4KPK A;  2DAZ A;  2KPL A;  5E1Y A;  3KTG A;  3U9R B;  3RL7 A;  1TP3 A;  1EY3 A;  2J5I I;  3KDK A;  1Z87 A;  2VSS E;  1OBX A;  5I7Z A;  3HIN A;  3K1R A;  4RYF A;  1FCF A;  4Q2Q A;  2P3W A;  3QIK A;  4NMP A;  3K8X A;  1W9O A;  4K76 A;  3QWD A;  3TVW A;  1V62 A;  2M0U A;  4OEP A;  3MYB A;  4QIJ A;  3H81 A;  3PDV A;  1RJM A;  3KZD A;  4Q3H A;  4FND A;  3E17 A;  3QJN A;  2DJT A;  3MH4 A;  2Q2X A;  2H3L A;  4JYL A;  2VSU C;  4FZW C;  3KHF A;  3ZRT A;  3TLF A;  4JCR A;  1Y8T A;  2F6Q A;  2KQF A;  1PIX A;  4HDT A;  5CTC A;  3KDG A;  2ZL0 A;  1U37 A;  3LNY A;  1X5Q A;  2Q3G A;  4F47 A;  2OPG A;  5HFC A;  3R68 A;  5B42 A;  2LC7 A;  1QAV A;  1DCI A;  1WHD A;  5E6P B;  4JYJ A;  5DU8 A;  3T8B A;  3CBZ A;  3MOY A;  3DUP A;  4ASI A;  2OSG A;  4JL7 A;  2FE5 A;  5G1E A;  3MH7 A;  3TV5 A;  5HF1 A;  1QAU A;  5DZK H;  2W4F A;  1OBY A;  3DJ1 A;  4KNP A;  4NAR A;  1XO6 A;  1O8U A;  2M0Z A;  4IZD A;  4P0C A;  2DMZ A;  3O46 A;  2GZV A;  1WJL A;  3SHU A;  1UEW A;  2H3M A;  3KZE A;  3HRX A;  3GGE A;  2O2T A;  1SZO A;  4MXI A;  2EGN A;  3QGL A;  4KD6 A;  3WG5 A;  1UM7 A;  4Q1I A;  5E0S A;  4L8K A;  3K82 A;  5H3J A;  2EGK A;  5DU6 A;  3ISA A;  4JSB A;  4YLH A;  3CBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...