1FC9A

Photosystem ii d1 c-terminal processing protease
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
386
structure length
386
Chain Sequence
VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
molecule keywords PHOTOSYSTEM II D1 PROTEASE
total genus 114
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc9A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc9A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc9A03
2DB5A 4MPAA 3OC7A 4JOPA 1UITA 3VIVA 2DJTA 3KTIA 3KHFA 1RGRA 5H3JA 4NXRA 1V5QA 2H3LA 3WKMA 1L6OA 2CSSA 5FHTA 2IWOA 4NMSA 1UJVA 1WFVA 1UIYA 3STAA 2FN5A 1IHJA 3T8BA 2KPLA 2F9YB 4FN7A 4Q2PA 5C9GA 3MT6A 2YUYA 3GDVA 2EGKA 2VSUA 1Q3OA 4FZWA 3WKLA 5DU6A 1NF3C 3BPUA 5HDYA 1HZDA 1GM1A 1V5LA 3TVUA 4I42A 1UEPA 3HPMA 2X58A 3HLN1 2BYGA 2Z9IA 4ZDDA 2JILA 2LOBA 5DTWA 2FW2A 4JJTA 2F5YA 2QKVA 4PQWA 1V1TA 3V5IA 3GCNA 3GDSA 2RRMA 1WFGA 2EV8A 4LMMA 4Z33A 4WYTA 1OBYA 2QBWA 2M0UA 3IBBA 3ZW8A 1WDMA 4IC6A 2VRFA 3L3SA 3PV2A 5HEYA 1TP3A 3PDVA 3QMJA 5JBXA 1Q7XA 2FBMA 4QIIA 5CTCA 1ON3A 1SG4A 3HE2A 3HINA 3MFMA 2PDZA 3GJ9A 5EYZA 1VJ6A 1UHPA 1Y8TA 1UEZA 5JXBA 2PKTA 2OQSA 2VSUC 5MGBA 4NNLA 2KL1A 1N99A 2D90A 1UEQA 4B3JA 5INFA 5KDRA 2DKRA 1OZIA 1JXZA 3DIWA 3SHUA 2A7SA 4L6WA 5INIA 4OMRA 1TQ3A 4JYJA 4L8KA 4JCRA 5E1YA 1UEWA 2Q3GA 2F6IA 3NJBA 4MXIA 3NFKA 4NMQA 2J5IB 3OT6A 3NGHA 1HNOA 1FC7A 3EGHC 2D8IA 2KG2A 3SOEA 3IAVA 3NJDA 3TSWA 1OD4A 4FGMA 2DC2A 2D92A 1X5QA 1K39A 4ELWA 2I1NA 1W9OA 1RJMA 2PA1A 4F47A 3TLFA 4FJWD 5FB8C 3ISAA 2IWNA 1RJNA 3K82A 4EMPA 2L4SA 2VREA 2AWWA 3PZKA 4O06A 2EJ5A 2F9YA 4JVTA 1EF8A 2OPGA 3CBYA 2KPKA 3QJMA 2F0AA 2JINA 3QKAA 2A81A 3P5MA 1FC9A 2VSSF 3T3WA 2YT7A 4NXQA 1MFLA 4IZCA 3CBZA 5HFEA 2IEXA 3Q0GA 3R0OA 2WTBA 5E21A 3P2LA 3Q1TA 4NMVA 3KZDA 4Q2OA 1RY4A 4JYLA 2KJKA 2UZCA 3QO6A 3OMEA 2VSVA 1G9OA 2E7KA 2H2CA 3L4FD 1PJHA 3H0JA 2ZL0A 3TT7A 1OBZA 3ZWBA 5KDRB 2FZSA 3DJ1A 4Q1IA 5E22A 2LUIA 3QGLA 4DI1A 4NMTA 4EDJA 4Z8JA 4FZWC 2K1ZA 3QYRA 2REYA 2H2BA 2YTWA 2LC6A 3RSIA 4RYFH 3KTJA 1XNWA 5JBWA 1X8SA 2J5GA 5C90A 3SUZA 2EAQA 1N6EA 2JWEA 1X0UA 3U9RB 4GM2A 3PE8A 3T89A 5CTBA 3NFLA 3GMAA 3KTHA 2O2TA 1DUBA 1M5ZA 3LNXA 4G2RA 1EY3A 1T2MA 3N6RB 3H0QA 4QFEA 4ZDCA 4R2ZA 3FF6A 4UU6A 1R6JA 1WF8A 3HP0A 4E3BA 1Q51A 2OSGA 2PBPA 2HE4A 4GVCA 2KBSA 4OAJA 3GCOA 4ZDFA 2QT5A 4U1AA 3SLLA 2PNTA 4JOJA 2Q34A 2DLUA 2G5MB 1WHDA 2KAWA 5B6LA 1WDKA 2IWQA 4E34A 1J7XA 5HEBA 2A7KA 2VX2A 1RGWA 4KFVA 1KY9A 4IZDA 3O5NA 1WH1A 1KWAA 1P1DA 1U39A 1WHAA 4HOPA 5IKLB 1QAVB 4OEOA 3VQFA 4JORA 1UJUA 3PEAA 2JREA 3GF3A 5FIFA 5F67A 1SOTA 1W2XA 3RL8A 4NMPA 4MI2A 3I4WA 2Z17A 4U0GA 5G1SA 2EDZA 2M0TA 3ID2A 4JFCA 3CS0A 2X24A 3MH6A 4RI0A 2P3WA 1NZYA 1UYVA 4K6YA 3ZWAA 1Z87A 1VCWA 2VWRA 3KTGA 5E0NX 4JOGA 5DU4A 4U0GH 2KOMA 2RCZA 2F6QA 3R68A 4N6XA 2AWUA 2MX6A 2QG1A 1BE9A 1UYRA 3VQGA 4WYUA 3RLEA 2OMJA 4NNMA 3SFJA 3MH7A 3R9SA 4Q3HA 2KYLA 2CE3A 3P85A 2JXOA 3TMHA 2QKTA 4ASIA 1QAUA 3CC0A 1D5GA 3ZW9A 3GKBA 2EXGA 4G69A 3QK8A 4K75A 4F8KA 3H0UA 2VSPA 1XNYA 3R6HA 2H3MA 3H02A 2QQ3A 1VB7A 1VA8A 2V90A 1WI2A 5E6PB 4HNKA 2PG8A 1EF9A 5I7ZA 5E0SH 4IZBA 3LKEA 2KA9A 1ON9A 2GZVA 1LCYA 3GSLA 2M10A 5GNDA 2W4FA 4K72A 1XNVA 2F9IA 4KWBA 4Q2NA 3I47A 1U3BA 2YUBA 3TDCA 4Z0MA 3LAOA 3H81A 5G1DA 2AINA 2OCSA 1N7FA 5DUCA 3TT6A 3KQFA 3HPKA 2L4TA 1N6FA 1V6BA 1GQ5A 2JIKA 3TZ3A 2EEIA 4QIJA 2HW5A 3MH4A 5A2PA 2ZQRA 1WZ8A 3R0HA 4HOPB 4HC8A 3U9SB 2X7ZA 1MFGA 2DLSA 3TSVA 4U19A 4ZU2A 3TVWA 5HF4A 3R9TA 1X5NA 3ID3A 5HEDA 3H0SA 2OS6A 2Q2XA 1KEFA 2ENOA 1OBXA 3EGGC 1PDRA 3CBXA 1Y7OA 4P0CA 5KJPA 4YYXA 5F3XA 4K29A 5G1EA 2KJDA 2KQFA 1TP5A 3OU0A 2UZFA 1ZUBA 5G1QA 1I92A 3CH8A 3GGEA 3I1EA 2VPHA 3OTPA 1PIXA 4U18A 2AWXA 3RRVA 1TE0A 4ELSA 2WL7A 1XO6A 2W3PA 1Q3PA 1UJDA 1YG8A 2ZL2A 2FNEA 4JCSA 2M0VA 2DAZA 2DMZA 4I4ZA 1I16A 3ZWCA 3G64A 4JOTA 2PZDA 4REYA 4GHNA 1U38A 2Q35A 4NXPA 3DJ3A 4L8NA 4OLQA 1WDLA 3DJAA 3RL7A 1UM1A 3CYYA 3K50A 4H11A 2V1WA 2I0IA 4WCZA 5DL1A 3QXIA 1IU0A 2HGAA 3K1RA 2ZQQA 2F9IB 1IU2A 2LC7A 1VAEA 5DTPA 5HFFA 1B8QA 3PDZA 1U37A 2KV8A 2VSUE 2KOJA 3BEZA 4K3WA 2EJYA 2VSSA 3K8XA 1X45A 5E11A 1QAVA 2I4SA 3M6MA 2QKUA 5DZKH 4KNPA 3V5EA 1UF1A 3KZEA 1MC7A 2I04A 3AXAA 4NMOA 2CSJA 3HRXA 4JOHA 4JOFA 1K32A 3JU1A 2J5SA 3WG5A 4RYFA 1Y7NA 4JSBA 3PS4A 2FCFA 1O8UA 1YG6A 3STJA 5G1RA 1UM7A 3GF7A 1DCIA 2PPYA 4B3IA 2YT8A 3SWXA 2KJPA 2ZL4A 4JOEA 2D3TA 4JCTA 5INGA 4FNBA 3T88A 1SZOA 3FDUA 3PGQA 2ZL3A 1N7EA 2EDVA 5DUFA 4AMHA 3QIKA 1XZ9A 2EGOA 2W7RA 2EEGA 3B76A 1HNUA 4YLHA 4I52A 5EZ0A 1SOZA 3R69A 4E35A 2LA8A 3MYBA 4JWVA 2ZPLA 4XHVA 3SHWA 3KTKA 2DUBA 4UU5A 1NZYB 4P2AB 2NP9A 2K20A 1UYTA 1BFEA 5DKPA 1WIFA 2VSSE 4NMRA 1UYSA 5HFBA 4KD6A 4FB8A 1FC6A 1P1EA 2M3MA 3JXTA 4K78A 4ZDEA 3RSTA 2MHOA 2R3YA 2G2LA 1WJLA 1V62A 2HE2A 1TG6A 4ELXA 4NEKA 4B3HA 4WYOB 2I6VA 3Q0JA 1N7TA 2EGNA 4FNDA 4FN8A 2M0ZA 5GLJA 4LK5A 1FCFA 3QWDA 4ZDBA 1WF7A 1Z86A 2CS5A 3BF0A 4Q6HA 2J5II 3Q7HA 4Q0GA 5HETA 4JOKA 4EMLA 2JOAA 3PV5A 5DU8A 1WI4A 4U0HA 4K2NA 5FUSA 3TV5A 3MOYA 3O46A 3FY5A 2Q9VA 4EMMA 3QREA 3TRRA 1YBOA 2IWPA 2EDPA 2ZPMA 4OEPA 4WZ8B 4KFWA 3QDOA 1NTEA 5DTHA 2KRGA 2FE5A 3DORA 3TSZA 4NNQA 1MJ3A 3QJNA 1GQ4A 2OZFA 3GDUA 5HFCA 2KOHA 3ST9A 1QLCA 1X5RA 5E0SA 3I18A 2EEJA 4KPKA 3GLMA 1W9QA 2R4HA 3U9TB 4Q2QA 3BPPA 3HVQC 2DM8A 1UFXA 5HF1A 1Q52A 2GTRA 5HFDA 2L97A 1XX4A 3QE1A 3R9QA 1N6DA 4YDPA 4Q6SA 4GVDA 3IB9A 2BZRA 4MOUA 3E17A 3T8AA 4JL7A 3ID4A 1OD2A 2DEOA 1RZXA 1TYFA 3PV4A 4RCNA 2EHRA 2I0LA 2OGPA 3ID1A 1VRGA 2VZ5A 1X6DA 2C8TA 1WG6A 2VSUF 5HJ1A 2PKUA 1W9EA 4JCQA 2J5IA 2CBYA 3QXZA 3ZRTA 5DZKA 5D13A 3LNYA 4K76A 1ZOKA 4OG1A 2EEHA 2J5GD 3M6NA
chains in the Genus database with same CATH superfamily
2DB5A 4MPAA 4FLNA 3OC7A 4JOPA 1UITA 3VIVA 2DJTA 3KTIA 3KHFA 3AGEA 1RGRA 5H3JA 4NXRA 1V5QA 2H3LA 3WKMA 1L6OA 2CSSA 5FHTA 2IWOA 4NMSA 1UJVA 1WFVA 1UIYA 3STAA 2FN5A 1IHJA 3T8BA 2KPLA 2F9YB 4FN7A 4Q2PA 5C9GA 3MT6A 2YUYA 3GDVA 2EGKA 1TILB 2VSUA 1Q3OA 4FZWA 3WKLA 5DU6A 1NF3C 3BPUA 5HDYA 1HZDA 1GM1A 1V5LA 3TVUA 4I42A 3VSEA 1UEPA 3HPMA 2X58A 3HLN1 2BYGA 2Z9IA 4ZDDA 2JILA 2LOBA 5DTWA 2FW2A 4JJTA 2F5YA 2QKVA 4PQWA 1V1TA 3V5IA 3GCNA 3GDSA 2RRMA 1WFGA 2EV8A 4LMMA 4Z33A 4WYTA 1OBYA 2QBWA 2M0UA 3IBBA 3ZW8A 1WDMA 3KDKA 4IC6A 2VRFA 5IL9A 3L3SA 3PV2A 5HEYA 1TP3A 3PDVA 3QMJA 3NCVA 5JBXA 1Q7XA 2FBMA 4QIIA 5CTCA 1ON3A 1SG4A 3HE2A 3HINA 3MFMA 2PDZA 3GJ9A 5EYZA 1VJ6A 1UHPA 1Y8TA 2VY9A 3LDFA 1UEZA 5JXBA 2PKTA 2OQSA 2VSUC 5MGBA 4NNLA 2KL1A 1N99A 2D90A 1UEQA 4B3JA 5INFA 5KDRA 2DKRA 1OZIA 1JXZA 3DIWA 3SHUA 2A7SA 4L6WA 5INIA 4OMRA 1TQ3A 4JYJA 1BPLA 4L8KA 4JCRA 5E1YA 1UEWA 2Q3GA 2F6IA 3NJBA 4MXIA 3NFKA 4NMQA 2J5IB 3OT6A 3NGHA 1HNOA 1FC7A 3EGHC 2D8IA 2KG2A 3SOEA 3IAVA 3NJDA 3TSWA 1OD4A 4FGMA 2DC2A 2D92A 1SBOA 4L1CA 1X5QA 5ILBA 1K39A 4ELWA 2I1NA 1W9OA 1RJMA 2PA1A 4F47A 4J2UA 4FJWD 5FB8C 3TLFA 3ISAA 2KA5A 2IWNA 1RJNA 3K82A 1THNB 4EMPA 2L4SA 2VREA 2AWWA 5EUUA 3IH8A 3PZKA 4O06A 2EJ5A 2F9YA 4JVTA 1EF8A 2OPGA 3CBYA 2KPKA 3QJMA 2F0AA 3F43A 2JINA 3QKAA 2A81A 3P5MA 1FC9A 5EUZA 2VSSF 3T3WA 2YT7A 4NXQA 1MFLA 4IZCA 3CBZA 5HFEA 2IEXA 3Q0GA 3R0OA 2WTBA 5E21A 3P2LA 3Q1TA 4NMVA 3KZDA 3GABA 4Q2OA 1RY4A 4JYLA 2KJKA 2UZCA 3QO6A 3OMEA 2VSVA 1G9OA 2E7KA 2H2CA 3L4FD 1PJHA 3H0JA 5B42A 2ZL0A 3TT7A 1OBZA 3ZWBA 5KDRB 2FZSA 3DJ1A 4JC0A 5E22A 2LUIA 4Q1IA 3QGLA 4DI1A 3GVLA 3GHFA 4NMTA 4EDJA 3MOGA 4Z8JA 4FZWC 2K1ZA 2OASA 2REYA 2H2BA 3QYRA 2YTWA 1HF2A 2LC6A 3RSIA 4RYFH 3KTJA 1XNWA 1V0EA 1X8SA 5JBWA 2J5GA 5C90A 3SUZA 3NY7A 2GEFA 2EAQA 1N6EA 2JWEA 3D3UA 1X0UA 3U9RB 3KDGA 4GM2A 3PE8A 3T89A 5CTBA 3D03A 3NFLA 3GMAA 3KTHA 2O2TA 1DUBA 1M5ZA 3LNXA 4G2RA 1EY3A 1T2MA 3IHAA 3N6RB 3H0QA 4QFEA 4ZDCA 4R2ZA 3FF6A 4UU6A 1R6JA 1WF8A 3HP0A 4E3BA 1Q51A 2OSGA 2PBPA 2HE4A 4GVCA 2KBSA 4OAJA 3GCOA 4ZDFA 2QT5A 4U1AA 3SLLA 2PNTA 1H4YA 4JOJA 2Q34A 2DLUA 2G5MB 1WHDA 2KAWA 5B6LA 1WDKA 2IWQA 4E34A 1J7XA 5HEBA 2A7KA 2VX2A 1RGWA 4KFVA 1TH8B 3EH7A 1KY9A 4IZDA 3O5NA 1WH1A 1KWAA 1P1DA 1U39A 1WHAA 4HOPA 5IKLB 1QAVB 4OEOA 3VQFA 4JORA 1WXXA 1UJUA 3PEAA 2JREA 3V8VA 3GF3A 5FIFA 5F67A 1SOTA 1W2XA 3RL8A 3DUPA 4NMPA 4MI2A 3I4WA 2Z17A 4U0GA 4AEJA 5G1SA 2EDZA 2M0TA 3ID2A 4DMGA 4JFCA 3CS0A 2X24A 3MH6A 4RI0A 2P3WA 1NZYA 1UYVA 4K6YA 3ZWAA 1Z87A 1VCWA 2VWRA 3KTGA 5E0NX 4JOGA 5DU4A 4U0GH 2KOMA 2RCZA 1V0FA 2F6QA 3R68A 4N6XA 2AWUA 2MX6A 2QG1A 1BE9A 1UYRA 3VQGA 4WYUA 3RLEA 2OMJA 4NNMA 3SFJA 3MH7A 3R9SA 4Q3HA 2KYLA 2CE3A 3P85A 2JXOA 3TMHA 2QKTA 3QDQA 1QAUA 4ASIA 3CC0A 1D5GA 3ZW9A 3MGLA 2EXGA 4G69A 3GKBA 3QK8A 4K75A 4F8KA 3H0UA 2VSPA 1XNYA 3R6HA 2H3MA 3H02A 2QQ3A 1VB7A 2KLNA 1VA8A 2V90A 1WI2A 5E6PB 4HNKA 2PG8A 1EF9A 5I7ZA 5E0SH 3AGDA 4IZBA 2DXNA 3LKEA 2KA9A 4AE2A 1ON9A 2GZVA 1LCYA 3GSLA 2M10A 5GNDA 2W4FA 4K72A 1XNVA 2F9IA 4KWBA 4Q2NA 3I47A 1U3BA 2YUBA 3TDCA 4Z0MA 3LAOA 3H81A 5G1DA 5EUXA 4DGFA 2AINA 2OCSA 2B78A 1N7FA 5DUCA 3TT6A 3KQFA 3HPKA 4NARA 5EUSA 2L4TA 1N6FA 1V6BA 1GQ5A 2JIKA 3TZ3A 2EEIA 4QIJA 2HW5A 3MH4A 3GVJA 5A2PA 2ZQRA 1WZ8A 3OIZA 3R0HA 4HOPB 4HC8A 3U9SB 2X7ZA 1MFGA 2DLSA 3TSVA 4U19A 4ZU2A 3TVWA 5HF4A 3R9TA 1X5NA 3ID3A 5HEDA 3H0SA 2OS6A 2Q2XA 1KEFA 2ENOA 4QTPA 1OBXA 3EGGC 1PDRA 3CBXA 1Y7OA 4P0CA 5KJPA 4YYXA 5F3XA 4DGHA 4K29A 5G1EA 1H4XA 2KJDA 2KQFA 1TP5A 3OU0A 2UZFA 1ZUBA 5G1QA 1I92A 3CH8A 3GGEA 3I1EA 2VPHA 3OTPA 3LKLA 1PIXA 4U18A 2AWXA 3RRVA 1TE0A 4ELSA 2WL7A 4JJ0A 1XO6A 2W3PA 1Q3PA 1UJDA 2DXLA 1YG8A 2ZL2A 2ZOAA 3V97A 2FNEA 4JCSA 2M0VA 2DAZA 2DMZA 4I4ZA 1I16A 3ZWCA 3G64A 4JOTA 2PZDA 4REYA 4GHNA 1U38A 2Q35A 4NXPA 3DJ3A 4L8NA 4OLQA 1WDLA 3DJAA 3RL7A 1UM1A 3CYYA 3K50A 4H11A 2V1WA 2I0IA 4WCZA 5DL1A 1WXWA 3QXIA 1IU0A 2HGAA 3K1RA 2ZQQA 2F9IB 1IU2A 2ZO9B 2LC7A 1VAEA 5DTPA 5HFFA 1B8QA 3PDZA 1U37A 2KV8A 5EZBA 2KOJA 1AUZA 2VSUE 2EJYA 3BEZA 4K3WA 3LLOA 2VSSA 1X45A 5E11A 3K8XA 1QAVA 2I4SA 3M6MA 2QKUA 5DZKH 4KNPA 3V5EA 1UF1A 1VC1A 3OIRA 3KZEA 1MC7A 2I04A 3AXAA 4NMOA 2CSJA 3JU4A 4JOHA 4JOFA 3HRXA 5HUQA 1K32A 3JU1A 2J5SA 3WG5A 4RYFA 1Y7NA 3C0KA 4JSBA 3PS4A 3T6OA 2FCFA 1O8UA 1YG6A 3STJA 5G1RA 1UM7A 3GF7A 1DCIA 2PPYA 4B3IA 2YT8A 3SWXA 2KJPA 3GK7A 2ZL4A 4JOEA 1TIDB 2D3TA 4JCTA 5INGA 1H4ZA 4FNBA 3T88A 1SZOA 3FDUA 3PGQA 2ZL3A 1N7EA 2EDVA 5DUFA 4AMHA 3QIKA 1XZ9A 2EGOA 2W7RA 2EEGA 3B76A 1HNUA 4YLHA 4I52A 5EZ0A 1SOZA 3R69A 3GMFA 4E35A 3BPTA 2JSNA 2LA8A 3MYBA 4JWVA 2ZPLA 4XHVA 3SHWA 3IHBA 3KTKA 2DUBA 4UU5A 1NZYB 4P2AB 2NP9A 2K20A 1UYTA 1BFEA 5DKPA 1WIFA 2VSSE 4NMRA 1UYSA 5HFBA 4KD6A 4FB8A 1FC6A 1P1EA 2M3MA 3JXTA 4JJ3A 4K78A 4ZDEA 2MHOA 3RSTA 2R3YA 3ZXNA 2G2LA 1WJLA 1V62A 2HE2A 1TG6A 4ELXA 4NEKA 4OG1A 4B3HA 4WYOB 2I6VA 3Q0JA 1N7TA 2EGNA 3ZTBA 4FNDA 4FN8A 4HYLA 2M0ZA 5GLJA 4LK5A 1FCFA 3QWDA 4ZDBA 1WF7A 1Z86A 2CS5A 3BF0A 4Q6HA 2J5II 3Q7HA 4Q0GA 5HETA 4JOKA 4EMLA 2JOAA 3PV5A 4HIZA 5DU8A 1WI4A 4U0HA 4K2NA 5FUSA 3TV5A 3MOYA 3O46A 1X9ZA 3FY5A 3IF5A 2Q9VA 4EMMA 3QREA 3TRRA 1YBOA 2IWPA 2EDPA 2ZPMA 4OEPA 4WZ8B 4KFWA 5EUWA 3QDOA 2YJGA 2RRLA 1NTEA 5DTHA 2KRGA 2FE5A 3IH9A 3DORA 3TSZA 4NNQA 1MJ3A 3QJNA 1GQ4A 2OZFA 3GDUA 5HFCA 2KOHA 3ST9A 1QLCA 1X5RA 5E0SA 3I18A 2EEJA 4KPKA 3GLMA 1W9QA 2R4HA 3U9TB 4Q2QA 3BPPA 3HVQC 2DM8A 1UFXA 5HF1A 1Q52A 2GTRA 5HFDA 2L97A 1XX4A 3QE1A 3R9QA 1N6DA 4YDPA 4Q6SA 4GVDA 3IB9A 2BZRA 3GVKA 3E17A 4MOUA 3T8AA 4JL7A 3ID4A 1OD2A 2DEOA 1RZXA 1TYFA 3PV4A 4RCNA 2EHRA 2I0LA 2OGPA 3ID1A 1VRGA 2VZ5A 1X6DA 2C8TA 2CWWA 1WG6A 2VSUF 5HJ1A 2PKUA 4HDTA 1W9EA 1T6RA 4XS5A 4JCQA 2J5IA 2CBYA 3QXZA 3ZRTA 5DZKA 5D13A 2AS0A 3LNYA 4K76A 1ZOKA 1BUZA 2EEHA 2J5GD 3M6NA
chains in the Genus database with same CATH topology
2DB5A 4MPAA 4FLNA 3OC7A 4JOPA 1UITA 3VIVA 2DJTA 3KTIA 3KHFA 1RGRA 5H3JA 4NXRA 1V5QA 2H3LA 3WKMA 1L6OA 2CSSA 5FHTA 2IWOA 4NMSA 1UJVA 1WFVA 1UIYA 3STAA 2FN5A 1IHJA 3T8BA 2KPLA 2F9YB 4FN7A 4Q2PA 5C9GA 3MT6A 2YUYA 3GDVA 2EGKA 2VSUA 1Q3OA 4FZWA 3WKLA 5DU6A 1NF3C 3BPUA 5HDYA 1HZDA 1GM1A 1V5LA 3TVUA 4I42A 1UEPA 3HPMA 2X58A 3HLN1 2BYGA 2Z9IA 4ZDDA 2JILA 2LOBA 5DTWA 2FW2A 4JJTA 2F5YA 2QKVA 4PQWA 1V1TA 3V5IA 3GCNA 3GDSA 2RRMA 1WFGA 2EV8A 4LMMA 4Z33A 4WYTA 1OBYA 2QBWA 2M0UA 3IBBA 3ZW8A 1WDMA 3KDKA 4IC6A 2VRFA 5IL9A 3L3SA 3PV2A 5HEYA 1TP3A 3PDVA 3QMJA 3NCVA 5JBXA 1Q7XA 2FBMA 4QIIA 5CTCA 1ON3A 1SG4A 3HE2A 3HINA 3MFMA 2PDZA 3GJ9A 5EYZA 1VJ6A 1UHPA 1Y8TA 1UEZA 5JXBA 2PKTA 2OQSA 2VSUC 5MGBA 4NNLA 2KL1A 1N99A 2D90A 1UEQA 4B3JA 5INFA 5KDRA 2DKRA 1OZIA 1JXZA 3DIWA 3SHUA 2A7SA 4L6WA 5INIA 4OMRA 1TQ3A 4JYJA 1BPLA 4L8KA 4JCRA 5E1YA 1UEWA 2Q3GA 2F6IA 3NJBA 4MXIA 3NFKA 4NMQA 2J5IB 3OT6A 3NGHA 1HNOA 1FC7A 3EGHC 2D8IA 2KG2A 3SOEA 3IAVA 3NJDA 3TSWA 1OD4A 4FGMA 2DC2A 2D92A 4L1CA 1X5QA 5ILBA 1K39A 4ELWA 2I1NA 1W9OA 1RJMA 2PA1A 4F47A 4J2UA 4FJWD 5FB8C 3TLFA 3ISAA 2IWNA 1RJNA 3K82A 4EMPA 2L4SA 2VREA 2AWWA 3PZKA 4O06A 2EJ5A 2F9YA 4JVTA 1EF8A 2OPGA 3CBYA 2KPKA 3QJMA 2F0AA 2JINA 3QKAA 2A81A 3P5MA 1FC9A 2VSSF 3T3WA 2YT7A 4NXQA 1MFLA 4IZCA 3CBZA 5HFEA 2IEXA 3Q0GA 3R0OA 2WTBA 5E21A 3P2LA 3Q1TA 4NMVA 3KZDA 3GABA 4Q2OA 1RY4A 4JYLA 2KJKA 2UZCA 3QO6A 3OMEA 2VSVA 1G9OA 2E7KA 2H2CA 3L4FD 1PJHA 3H0JA 5B42A 2ZL0A 3TT7A 1OBZA 3ZWBA 5KDRB 2FZSA 3DJ1A 4JC0A 5E22A 2LUIA 4Q1IA 3QGLA 4DI1A 3GHFA 4NMTA 4EDJA 3MOGA 4Z8JA 4FZWC 2K1ZA 3QYRA 2REYA 2H2BA 2YTWA 2LC6A 3RSIA 4RYFH 3KTJA 1XNWA 5JBWA 1X8SA 2J5GA 5C90A 3SUZA 2GEFA 2EAQA 1N6EA 2JWEA 1X0UA 3U9RB 3KDGA 4GM2A 3PE8A 3T89A 5CTBA 3D03A 3NFLA 3GMAA 3KTHA 2O2TA 1DUBA 1M5ZA 3LNXA 4G2RA 1EY3A 1T2MA 3N6RB 3H0QA 4QFEA 4ZDCA 4R2ZA 3FF6A 4UU6A 1R6JA 1WF8A 3HP0A 4E3BA 1Q51A 2OSGA 2PBPA 2HE4A 4GVCA 2KBSA 4OAJA 3GCOA 4ZDFA 2QT5A 4U1AA 3SLLA 2PNTA 4JOJA 2Q34A 2DLUA 2G5MB 1WHDA 2KAWA 5B6LA 1WDKA 2IWQA 4E34A 1J7XA 5HEBA 2A7KA 2VX2A 1RGWA 4KFVA 1KY9A 4IZDA 3O5NA 1WH1A 1KWAA 1P1DA 1U39A 1WHAA 4HOPA 5IKLB 1QAVB 4OEOA 3VQFA 4JORA 1UJUA 3PEAA 2JREA 3GF3A 5FIFA 5F67A 1SOTA 1W2XA 3RL8A 3DUPA 4NMPA 4MI2A 3I4WA 2Z17A 4U0GA 4AEJA 5G1SA 2EDZA 2M0TA 3ID2A 4JFCA 3CS0A 2X24A 3MH6A 4RI0A 2P3WA 1NZYA 1UYVA 4K6YA 3ZWAA 1Z87A 1VCWA 2VWRA 3KTGA 5E0NX 4JOGA 5DU4A 4U0GH 2KOMA 2RCZA 2F6QA 3R68A 4N6XA 2AWUA 2MX6A 2QG1A 1BE9A 1UYRA 3VQGA 4WYUA 3RLEA 2OMJA 4NNMA 3SFJA 3MH7A 3R9SA 4Q3HA 2KYLA 2CE3A 3P85A 2JXOA 3TMHA 2QKTA 4ASIA 1QAUA 3CC0A 1D5GA 3ZW9A 3GKBA 2EXGA 4G69A 3QK8A 4K75A 4F8KA 3H0UA 2VSPA 1XNYA 3R6HA 2H3MA 3H02A 2QQ3A 1VB7A 1VA8A 2V90A 1WI2A 5E6PB 4HNKA 2PG8A 1EF9A 5I7ZA 5E0SH 4IZBA 2DXNA 3LKEA 2KA9A 4AE2A 1ON9A 2GZVA 1LCYA 3GSLA 2M10A 5GNDA 2W4FA 4K72A 1XNVA 2F9IA 4KWBA 4Q2NA 3I47A 1U3BA 2YUBA 3TDCA 4Z0MA 3LAOA 3H81A 5G1DA 2AINA 2OCSA 1N7FA 5DUCA 3TT6A 3KQFA 3HPKA 4NARA 2L4TA 1N6FA 1V6BA 1GQ5A 2JIKA 3TZ3A 2EEIA 4QIJA 2HW5A 3MH4A 5A2PA 2ZQRA 1WZ8A 3R0HA 4HOPB 4HC8A 3U9SB 2X7ZA 1MFGA 2DLSA 3TSVA 4U19A 4ZU2A 3TVWA 5HF4A 3R9TA 1X5NA 3ID3A 5HEDA 3H0SA 2OS6A 2Q2XA 1KEFA 2ENOA 1OBXA 3EGGC 1PDRA 3CBXA 1Y7OA 4P0CA 5KJPA 4YYXA 5F3XA 4K29A 5G1EA 2KJDA 2KQFA 1TP5A 3OU0A 2UZFA 1ZUBA 5G1QA 1I92A 3CH8A 3GGEA 3I1EA 2VPHA 3OTPA 1PIXA 4U18A 2AWXA 3RRVA 1TE0A 4ELSA 2WL7A 4JJ0A 1XO6A 2W3PA 1Q3PA 1UJDA 2DXLA 1YG8A 2ZL2A 2ZOAA 2FNEA 4JCSA 2M0VA 2DAZA 2DMZA 4I4ZA 1I16A 3ZWCA 3G64A 4JOTA 2PZDA 4REYA 4GHNA 1U38A 2Q35A 4NXPA 3DJ3A 4L8NA 4OLQA 1WDLA 3DJAA 3RL7A 1UM1A 3CYYA 3K50A 4H11A 2V1WA 2I0IA 4WCZA 5DL1A 3QXIA 1IU0A 2HGAA 3K1RA 2ZQQA 2F9IB 1IU2A 2ZO9B 2LC7A 1VAEA 5DTPA 5HFFA 1B8QA 3PDZA 1U37A 2KV8A 2VSUE 2KOJA 3BEZA 4K3WA 2EJYA 2VSSA 3K8XA 1X45A 5E11A 1QAVA 2I4SA 3M6MA 2QKUA 5DZKH 4KNPA 3V5EA 1UF1A 3KZEA 1MC7A 2I04A 3AXAA 4NMOA 2CSJA 3HRXA 4JOHA 4JOFA 5HUQA 1K32A 3JU1A 2J5SA 3WG5A 4RYFA 1Y7NA 4JSBA 3PS4A 2FCFA 1O8UA 1YG6A 3STJA 5G1RA 1UM7A 3GF7A 1DCIA 2PPYA 4B3IA 2YT8A 3SWXA 2KJPA 2ZL4A 4JOEA 2D3TA 4JCTA 5INGA 4FNBA 3T88A 1SZOA 3FDUA 3PGQA 2ZL3A 1N7EA 2EDVA 5DUFA 4AMHA 3QIKA 1XZ9A 2EGOA 2W7RA 2EEGA 3B76A 1HNUA 4YLHA 4I52A 5EZ0A 1SOZA 3R69A 3GMFA 4E35A 3BPTA 2JSNA 2LA8A 3MYBA 4JWVA 2ZPLA 4XHVA 3SHWA 3KTKA 2DUBA 4UU5A 1NZYB 4P2AB 2NP9A 2K20A 1UYTA 1BFEA 5DKPA 1WIFA 2VSSE 4NMRA 1UYSA 5HFBA 4KD6A 4FB8A 1FC6A 1P1EA 2M3MA 3JXTA 4JJ3A 4K78A 4ZDEA 2MHOA 3RSTA 2R3YA 2G2LA 1WJLA 1V62A 2HE2A 1TG6A 4ELXA 4NEKA 4B3HA 4WYOB 2I6VA 3Q0JA 1N7TA 2EGNA 4FNDA 4FN8A 2M0ZA 5GLJA 4LK5A 1FCFA 3QWDA 4ZDBA 1WF7A 1Z86A 2CS5A 3BF0A 4Q6HA 2J5II 3Q7HA 4Q0GA 5HETA 4JOKA 4EMLA 2JOAA 3PV5A 5DU8A 1WI4A 4U0HA 4K2NA 5FUSA 3TV5A 3MOYA 3O46A 1X9ZA 3FY5A 2Q9VA 4EMMA 3QREA 3TRRA 1YBOA 2IWPA 2EDPA 2ZPMA 4OEPA 4WZ8B 4KFWA 3QDOA 2YJGA 2RRLA 1NTEA 5DTHA 2KRGA 2FE5A 3DORA 3TSZA 4NNQA 1MJ3A 3QJNA 1GQ4A 2OZFA 3GDUA 5HFCA 2KOHA 3ST9A 1QLCA 1X5RA 5E0SA 3I18A 2EEJA 4KPKA 3GLMA 1W9QA 2R4HA 3U9TB 4Q2QA 3BPPA 3HVQC 2DM8A 1UFXA 5HF1A 1Q52A 2GTRA 5HFDA 2L97A 1XX4A 3QE1A 3R9QA 1N6DA 4YDPA 4Q6SA 4GVDA 3IB9A 2BZRA 4MOUA 3E17A 3T8AA 4JL7A 3ID4A 1OD2A 2DEOA 1RZXA 1TYFA 3PV4A 4RCNA 2EHRA 2I0LA 2OGPA 3ID1A 1VRGA 2VZ5A 1X6DA 2C8TA 1WG6A 2VSUF 5HJ1A 2PKUA 4HDTA 1W9EA 4JCQA 2J5IA 2CBYA 3QXZA 3ZRTA 5DZKA 5D13A 3LNYA 4K76A 1ZOKA 4OG1A 2EEHA 2J5GD 3M6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB5 A;  4MPA A;  3OC7 A;  4JOP A;  1UIT A;  3VIV A;  2DJT A;  3KTI A;  3KHF A;  1RGR A;  5H3J A;  4NXR A;  1V5Q A;  2H3L A;  3WKM A;  1L6O A;  2CSS A;  5FHT A;  2IWO A;  4NMS A;  1UJV A;  1WFV A;  1UIY A;  3STA A;  2FN5 A;  1IHJ A;  3T8B A;  2KPL A;  2F9Y B;  4FN7 A;  4Q2P A;  5C9G A;  3MT6 A;  2YUY A;  3GDV A;  2EGK A;  2VSU A;  1Q3O A;  4FZW A;  3WKL A;  5DU6 A;  1NF3 C;  3BPU A;  5HDY A;  1HZD A;  1GM1 A;  1V5L A;  3TVU A;  4I42 A;  1UEP A;  3HPM A;  2X58 A;  3HLN 1;  2BYG A;  2Z9I A;  4ZDD A;  2JIL A;  2LOB A;  5DTW A;  2FW2 A;  4JJT A;  2F5Y A;  2QKV A;  4PQW A;  1V1T A;  3V5I A;  3GCN A;  3GDS A;  2RRM A;  1WFG A;  2EV8 A;  4LMM A;  4Z33 A;  4WYT A;  1OBY A;  2QBW A;  2M0U A;  3IBB A;  3ZW8 A;  1WDM A;  4IC6 A;  2VRF A;  3L3S A;  3PV2 A;  5HEY A;  1TP3 A;  3PDV A;  3QMJ A;  5JBX A;  1Q7X A;  2FBM A;  4QII A;  5CTC A;  1ON3 A;  1SG4 A;  3HE2 A;  3HIN A;  3MFM A;  2PDZ A;  3GJ9 A;  5EYZ A;  1VJ6 A;  1UHP A;  1Y8T A;  1UEZ A;  5JXB A;  2PKT A;  2OQS A;  2VSU C;  5MGB A;  4NNL A;  2KL1 A;  1N99 A;  2D90 A;  1UEQ A;  4B3J A;  5INF A;  5KDR A;  2DKR A;  1OZI A;  1JXZ A;  3DIW A;  3SHU A;  2A7S A;  4L6W A;  5INI A;  4OMR A;  1TQ3 A;  4JYJ A;  4L8K A;  4JCR A;  5E1Y A;  1UEW A;  2Q3G A;  2F6I A;  3NJB A;  4MXI A;  3NFK A;  4NMQ A;  2J5I B;  3OT6 A;  3NGH A;  1HNO A;  1FC7 A;  3EGH C;  2D8I A;  2KG2 A;  3SOE A;  3IAV A;  3NJD A;  3TSW A;  1OD4 A;  4FGM A;  2DC2 A;  2D92 A;  1X5Q A;  1K39 A;  4ELW A;  2I1N A;  1W9O A;  1RJM A;  2PA1 A;  4F47 A;  3TLF A;  4FJW D;  5FB8 C;  3ISA A;  2IWN A;  1RJN A;  3K82 A;  4EMP A;  2L4S A;  2VRE A;  2AWW A;  3PZK A;  4O06 A;  2EJ5 A;  2F9Y A;  4JVT A;  1EF8 A;  2OPG A;  3CBY A;  2KPK A;  3QJM A;  2F0A A;  2JIN A;  3QKA A;  2A81 A;  3P5M A;  1FC9 A;  2VSS F;  3T3W A;  2YT7 A;  4NXQ A;  1MFL A;  4IZC A;  3CBZ A;  5HFE A;  2IEX A;  3Q0G A;  3R0O A;  2WTB A;  5E21 A;  3P2L A;  3Q1T A;  4NMV A;  3KZD A;  4Q2O A;  1RY4 A;  4JYL A;  2KJK A;  2UZC A;  3QO6 A;  3OME A;  2VSV A;  1G9O A;  2E7K A;  2H2C A;  3L4F D;  1PJH A;  3H0J A;  2ZL0 A;  3TT7 A;  1OBZ A;  3ZWB A;  5KDR B;  2FZS A;  3DJ1 A;  4Q1I A;  5E22 A;  2LUI A;  3QGL A;  4DI1 A;  4NMT A;  4EDJ A;  4Z8J A;  4FZW C;  2K1Z A;  3QYR A;  2REY A;  2H2B A;  2YTW A;  2LC6 A;  3RSI A;  4RYF H;  3KTJ A;  1XNW A;  5JBW A;  1X8S A;  2J5G A;  5C90 A;  3SUZ A;  2EAQ A;  1N6E A;  2JWE A;  1X0U A;  3U9R B;  4GM2 A;  3PE8 A;  3T89 A;  5CTB A;  3NFL A;  3GMA A;  3KTH A;  2O2T A;  1DUB A;  1M5Z A;  3LNX A;  4G2R A;  1EY3 A;  1T2M A;  3N6R B;  3H0Q A;  4QFE A;  4ZDC A;  4R2Z A;  3FF6 A;  4UU6 A;  1R6J A;  1WF8 A;  3HP0 A;  4E3B A;  1Q51 A;  2OSG A;  2PBP A;  2HE4 A;  4GVC A;  2KBS A;  4OAJ A;  3GCO A;  4ZDF A;  2QT5 A;  4U1A A;  3SLL A;  2PNT A;  4JOJ A;  2Q34 A;  2DLU A;  2G5M B;  1WHD A;  2KAW A;  5B6L A;  1WDK A;  2IWQ A;  4E34 A;  1J7X A;  5HEB A;  2A7K A;  2VX2 A;  1RGW A;  4KFV A;  1KY9 A;  4IZD A;  3O5N A;  1WH1 A;  1KWA A;  1P1D A;  1U39 A;  1WHA A;  4HOP A;  5IKL B;  1QAV B;  4OEO A;  3VQF A;  4JOR A;  1UJU A;  3PEA A;  2JRE A;  3GF3 A;  5FIF A;  5F67 A;  1SOT A;  1W2X A;  3RL8 A;  4NMP A;  4MI2 A;  3I4W A;  2Z17 A;  4U0G A;  5G1S A;  2EDZ A;  2M0T A;  3ID2 A;  4JFC A;  3CS0 A;  2X24 A;  3MH6 A;  4RI0 A;  2P3W A;  1NZY A;  1UYV A;  4K6Y A;  3ZWA A;  1Z87 A;  1VCW A;  2VWR A;  3KTG A;  5E0N X;  4JOG A;  5DU4 A;  4U0G H;  2KOM A;  2RCZ A;  2F6Q A;  3R68 A;  4N6X A;  2AWU A;  2MX6 A;  2QG1 A;  1BE9 A;  1UYR A;  3VQG A;  4WYU A;  3RLE A;  2OMJ A;  4NNM A;  3SFJ A;  3MH7 A;  3R9S A;  4Q3H A;  2KYL A;  2CE3 A;  3P85 A;  2JXO A;  3TMH A;  2QKT A;  4ASI A;  1QAU A;  3CC0 A;  1D5G A;  3ZW9 A;  3GKB A;  2EXG A;  4G69 A;  3QK8 A;  4K75 A;  4F8K A;  3H0U A;  2VSP A;  1XNY A;  3R6H A;  2H3M A;  3H02 A;  2QQ3 A;  1VB7 A;  1VA8 A;  2V90 A;  1WI2 A;  5E6P B;  4HNK A;  2PG8 A;  1EF9 A;  5I7Z A;  5E0S H;  4IZB A;  3LKE A;  2KA9 A;  1ON9 A;  2GZV A;  1LCY A;  3GSL A;  2M10 A;  5GND A;  2W4F A;  4K72 A;  1XNV A;  2F9I A;  4KWB A;  4Q2N A;  3I47 A;  1U3B A;  2YUB A;  3TDC A;  4Z0M A;  3LAO A;  3H81 A;  5G1D A;  2AIN A;  2OCS A;  1N7F A;  5DUC A;  3TT6 A;  3KQF A;  3HPK A;  2L4T A;  1N6F A;  1V6B A;  1GQ5 A;  2JIK A;  3TZ3 A;  2EEI A;  4QIJ A;  2HW5 A;  3MH4 A;  5A2P A;  2ZQR A;  1WZ8 A;  3R0H A;  4HOP B;  4HC8 A;  3U9S B;  2X7Z A;  1MFG A;  2DLS A;  3TSV A;  4U19 A;  4ZU2 A;  3TVW A;  5HF4 A;  3R9T A;  1X5N A;  3ID3 A;  5HED A;  3H0S A;  2OS6 A;  2Q2X A;  1KEF A;  2ENO A;  1OBX A;  3EGG C;  1PDR A;  3CBX A;  1Y7O A;  4P0C A;  5KJP A;  4YYX A;  5F3X A;  4K29 A;  5G1E A;  2KJD A;  2KQF A;  1TP5 A;  3OU0 A;  2UZF A;  1ZUB A;  5G1Q A;  1I92 A;  3CH8 A;  3GGE A;  3I1E A;  2VPH A;  3OTP A;  1PIX A;  4U18 A;  2AWX A;  3RRV A;  1TE0 A;  4ELS A;  2WL7 A;  1XO6 A;  2W3P A;  1Q3P A;  1UJD A;  1YG8 A;  2ZL2 A;  2FNE A;  4JCS A;  2M0V A;  2DAZ A;  2DMZ A;  4I4Z A;  1I16 A;  3ZWC A;  3G64 A;  4JOT A;  2PZD A;  4REY A;  4GHN A;  1U38 A;  2Q35 A;  4NXP A;  3DJ3 A;  4L8N A;  4OLQ A;  1WDL A;  3DJA A;  3RL7 A;  1UM1 A;  3CYY A;  3K50 A;  4H11 A;  2V1W A;  2I0I A;  4WCZ A;  5DL1 A;  3QXI A;  1IU0 A;  2HGA A;  3K1R A;  2ZQQ A;  2F9I B;  1IU2 A;  2LC7 A;  1VAE A;  5DTP A;  5HFF A;  1B8Q A;  3PDZ A;  1U37 A;  2KV8 A;  2VSU E;  2KOJ A;  3BEZ A;  4K3W A;  2EJY A;  2VSS A;  3K8X A;  1X45 A;  5E11 A;  1QAV A;  2I4S A;  3M6M A;  2QKU A;  5DZK H;  4KNP A;  3V5E A;  1UF1 A;  3KZE A;  1MC7 A;  2I04 A;  3AXA A;  4NMO A;  2CSJ A;  3HRX A;  4JOH A;  4JOF A;  1K32 A;  3JU1 A;  2J5S A;  3WG5 A;  4RYF A;  1Y7N A;  4JSB A;  3PS4 A;  2FCF A;  1O8U A;  1YG6 A;  3STJ A;  5G1R A;  1UM7 A;  3GF7 A;  1DCI A;  2PPY A;  4B3I A;  2YT8 A;  3SWX A;  2KJP A;  2ZL4 A;  4JOE A;  2D3T A;  4JCT A;  5ING A;  4FNB A;  3T88 A;  1SZO A;  3FDU A;  3PGQ A;  2ZL3 A;  1N7E A;  2EDV A;  5DUF A;  4AMH A;  3QIK A;  1XZ9 A;  2EGO A;  2W7R A;  2EEG A;  3B76 A;  1HNU A;  4YLH A;  4I52 A;  5EZ0 A;  1SOZ A;  3R69 A;  4E35 A;  2LA8 A;  3MYB A;  4JWV A;  2ZPL A;  4XHV A;  3SHW A;  3KTK A;  2DUB A;  4UU5 A;  1NZY B;  4P2A B;  2NP9 A;  2K20 A;  1UYT A;  1BFE A;  5DKP A;  1WIF A;  2VSS E;  4NMR A;  1UYS A;  5HFB A;  4KD6 A;  4FB8 A;  1FC6 A;  1P1E A;  2M3M A;  3JXT A;  4K78 A;  4ZDE A;  3RST A;  2MHO A;  2R3Y A;  2G2L A;  1WJL A;  1V62 A;  2HE2 A;  1TG6 A;  4ELX A;  4NEK A;  4B3H A;  4WYO B;  2I6V A;  3Q0J A;  1N7T A;  2EGN A;  4FND A;  4FN8 A;  2M0Z A;  5GLJ A;  4LK5 A;  1FCF A;  3QWD A;  4ZDB A;  1WF7 A;  1Z86 A;  2CS5 A;  3BF0 A;  4Q6H A;  2J5I I;  3Q7H A;  4Q0G A;  5HET A;  4JOK A;  4EML A;  2JOA A;  3PV5 A;  5DU8 A;  1WI4 A;  4U0H A;  4K2N A;  5FUS A;  3TV5 A;  3MOY A;  3O46 A;  3FY5 A;  2Q9V A;  4EMM A;  3QRE A;  3TRR A;  1YBO A;  2IWP A;  2EDP A;  2ZPM A;  4OEP A;  4WZ8 B;  4KFW A;  3QDO A;  1NTE A;  5DTH A;  2KRG A;  2FE5 A;  3DOR A;  3TSZ A;  4NNQ A;  1MJ3 A;  3QJN A;  1GQ4 A;  2OZF A;  3GDU A;  5HFC A;  2KOH A;  3ST9 A;  1QLC A;  1X5R A;  5E0S A;  3I18 A;  2EEJ A;  4KPK A;  3GLM A;  1W9Q A;  2R4H A;  3U9T B;  4Q2Q A;  3BPP A;  3HVQ C;  2DM8 A;  1UFX A;  5HF1 A;  1Q52 A;  2GTR A;  5HFD A;  2L97 A;  1XX4 A;  3QE1 A;  3R9Q A;  1N6D A;  4YDP A;  4Q6S A;  4GVD A;  3IB9 A;  2BZR A;  4MOU A;  3E17 A;  3T8A A;  4JL7 A;  3ID4 A;  1OD2 A;  2DEO A;  1RZX A;  1TYF A;  3PV4 A;  4RCN A;  2EHR A;  2I0L A;  2OGP A;  3ID1 A;  1VRG A;  2VZ5 A;  1X6D A;  2C8T A;  1WG6 A;  2VSU F;  5HJ1 A;  2PKU A;  1W9E A;  4JCQ A;  2J5I A;  2CBY A;  3QXZ A;  3ZRT A;  5DZK A;  5D13 A;  3LNY A;  4K76 A;  1ZOK A;  4OG1 A;  2EEH A;  2J5G D;  3M6N A; 
#chains in the Genus database with same CATH topology
 2DB5 A;  4MPA A;  4FLN A;  3OC7 A;  4JOP A;  1UIT A;  3VIV A;  2DJT A;  3KTI A;  3KHF A;  3AGE A;  1RGR A;  5H3J A;  4NXR A;  1V5Q A;  2H3L A;  3WKM A;  1L6O A;  2CSS A;  5FHT A;  2IWO A;  4NMS A;  1UJV A;  1WFV A;  1UIY A;  3STA A;  2FN5 A;  1IHJ A;  3T8B A;  2KPL A;  2F9Y B;  4FN7 A;  4Q2P A;  5C9G A;  3MT6 A;  2YUY A;  3GDV A;  2EGK A;  1TIL B;  2VSU A;  1Q3O A;  4FZW A;  3WKL A;  5DU6 A;  1NF3 C;  3BPU A;  5HDY A;  1HZD A;  1GM1 A;  1V5L A;  3TVU A;  4I42 A;  3VSE A;  1UEP A;  3HPM A;  2X58 A;  3HLN 1;  2BYG A;  2Z9I A;  4ZDD A;  2JIL A;  2LOB A;  5DTW A;  2FW2 A;  4JJT A;  2F5Y A;  2QKV A;  4PQW A;  1V1T A;  3V5I A;  3GCN A;  3GDS A;  2RRM A;  1WFG A;  2EV8 A;  4LMM A;  4Z33 A;  4WYT A;  1OBY A;  2QBW A;  2M0U A;  3IBB A;  3ZW8 A;  1WDM A;  3KDK A;  4IC6 A;  2VRF A;  5IL9 A;  3L3S A;  3PV2 A;  5HEY A;  1TP3 A;  3PDV A;  3QMJ A;  3NCV A;  5JBX A;  1Q7X A;  2FBM A;  4QII A;  5CTC A;  1ON3 A;  1SG4 A;  3HE2 A;  3HIN A;  3MFM A;  2PDZ A;  3GJ9 A;  5EYZ A;  1VJ6 A;  1UHP A;  1Y8T A;  2VY9 A;  3LDF A;  1UEZ A;  5JXB A;  2PKT A;  2OQS A;  2VSU C;  5MGB A;  4NNL A;  2KL1 A;  1N99 A;  2D90 A;  1UEQ A;  4B3J A;  5INF A;  5KDR A;  2DKR A;  1OZI A;  1JXZ A;  3DIW A;  3SHU A;  2A7S A;  4L6W A;  5INI A;  4OMR A;  1TQ3 A;  4JYJ A;  1BPL A;  4L8K A;  4JCR A;  5E1Y A;  1UEW A;  2Q3G A;  2F6I A;  3NJB A;  4MXI A;  3NFK A;  4NMQ A;  2J5I B;  3OT6 A;  3NGH A;  1HNO A;  1FC7 A;  3EGH C;  2D8I A;  2KG2 A;  3SOE A;  3IAV A;  3NJD A;  3TSW A;  1OD4 A;  4FGM A;  2DC2 A;  2D92 A;  1SBO A;  4L1C A;  1X5Q A;  5ILB A;  1K39 A;  4ELW A;  2I1N A;  1W9O A;  1RJM A;  2PA1 A;  4F47 A;  4J2U A;  4FJW D;  5FB8 C;  3TLF A;  3ISA A;  2KA5 A;  2IWN A;  1RJN A;  3K82 A;  1THN B;  4EMP A;  2L4S A;  2VRE A;  2AWW A;  5EUU A;  3IH8 A;  3PZK A;  4O06 A;  2EJ5 A;  2F9Y A;  4JVT A;  1EF8 A;  2OPG A;  3CBY A;  2KPK A;  3QJM A;  2F0A A;  3F43 A;  2JIN A;  3QKA A;  2A81 A;  3P5M A;  1FC9 A;  5EUZ A;  2VSS F;  3T3W A;  2YT7 A;  4NXQ A;  1MFL A;  4IZC A;  3CBZ A;  5HFE A;  2IEX A;  3Q0G A;  3R0O A;  2WTB A;  5E21 A;  3P2L A;  3Q1T A;  4NMV A;  3KZD A;  3GAB A;  4Q2O A;  1RY4 A;  4JYL A;  2KJK A;  2UZC A;  3QO6 A;  3OME A;  2VSV A;  1G9O A;  2E7K A;  2H2C A;  3L4F D;  1PJH A;  3H0J A;  5B42 A;  2ZL0 A;  3TT7 A;  1OBZ A;  3ZWB A;  5KDR B;  2FZS A;  3DJ1 A;  4JC0 A;  5E22 A;  2LUI A;  4Q1I A;  3QGL A;  4DI1 A;  3GVL A;  3GHF A;  4NMT A;  4EDJ A;  3MOG A;  4Z8J A;  4FZW C;  2K1Z A;  2OAS A;  2REY A;  2H2B A;  3QYR A;  2YTW A;  1HF2 A;  2LC6 A;  3RSI A;  4RYF H;  3KTJ A;  1XNW A;  1V0E A;  1X8S A;  5JBW A;  2J5G A;  5C90 A;  3SUZ A;  3NY7 A;  2GEF A;  2EAQ A;  1N6E A;  2JWE A;  3D3U A;  1X0U A;  3U9R B;  3KDG A;  4GM2 A;  3PE8 A;  3T89 A;  5CTB A;  3D03 A;  3NFL A;  3GMA A;  3KTH A;  2O2T A;  1DUB A;  1M5Z A;  3LNX A;  4G2R A;  1EY3 A;  1T2M A;  3IHA A;  3N6R B;  3H0Q A;  4QFE A;  4ZDC A;  4R2Z A;  3FF6 A;  4UU6 A;  1R6J A;  1WF8 A;  3HP0 A;  4E3B A;  1Q51 A;  2OSG A;  2PBP A;  2HE4 A;  4GVC A;  2KBS A;  4OAJ A;  3GCO A;  4ZDF A;  2QT5 A;  4U1A A;  3SLL A;  2PNT A;  1H4Y A;  4JOJ A;  2Q34 A;  2DLU A;  2G5M B;  1WHD A;  2KAW A;  5B6L A;  1WDK A;  2IWQ A;  4E34 A;  1J7X A;  5HEB A;  2A7K A;  2VX2 A;  1RGW A;  4KFV A;  1TH8 B;  3EH7 A;  1KY9 A;  4IZD A;  3O5N A;  1WH1 A;  1KWA A;  1P1D A;  1U39 A;  1WHA A;  4HOP A;  5IKL B;  1QAV B;  4OEO A;  3VQF A;  4JOR A;  1WXX A;  1UJU A;  3PEA A;  2JRE A;  3V8V A;  3GF3 A;  5FIF A;  5F67 A;  1SOT A;  1W2X A;  3RL8 A;  3DUP A;  4NMP A;  4MI2 A;  3I4W A;  2Z17 A;  4U0G A;  4AEJ A;  5G1S A;  2EDZ A;  2M0T A;  3ID2 A;  4DMG A;  4JFC A;  3CS0 A;  2X24 A;  3MH6 A;  4RI0 A;  2P3W A;  1NZY A;  1UYV A;  4K6Y A;  3ZWA A;  1Z87 A;  1VCW A;  2VWR A;  3KTG A;  5E0N X;  4JOG A;  5DU4 A;  4U0G H;  2KOM A;  2RCZ A;  1V0F A;  2F6Q A;  3R68 A;  4N6X A;  2AWU A;  2MX6 A;  2QG1 A;  1BE9 A;  1UYR A;  3VQG A;  4WYU A;  3RLE A;  2OMJ A;  4NNM A;  3SFJ A;  3MH7 A;  3R9S A;  4Q3H A;  2KYL A;  2CE3 A;  3P85 A;  2JXO A;  3TMH A;  2QKT A;  3QDQ A;  1QAU A;  4ASI A;  3CC0 A;  1D5G A;  3ZW9 A;  3MGL A;  2EXG A;  4G69 A;  3GKB A;  3QK8 A;  4K75 A;  4F8K A;  3H0U A;  2VSP A;  1XNY A;  3R6H A;  2H3M A;  3H02 A;  2QQ3 A;  1VB7 A;  2KLN A;  1VA8 A;  2V90 A;  1WI2 A;  5E6P B;  4HNK A;  2PG8 A;  1EF9 A;  5I7Z A;  5E0S H;  3AGD A;  4IZB A;  2DXN A;  3LKE A;  2KA9 A;  4AE2 A;  1ON9 A;  2GZV A;  1LCY A;  3GSL A;  2M10 A;  5GND A;  2W4F A;  4K72 A;  1XNV A;  2F9I A;  4KWB A;  4Q2N A;  3I47 A;  1U3B A;  2YUB A;  3TDC A;  4Z0M A;  3LAO A;  3H81 A;  5G1D A;  5EUX A;  4DGF A;  2AIN A;  2OCS A;  2B78 A;  1N7F A;  5DUC A;  3TT6 A;  3KQF A;  3HPK A;  4NAR A;  5EUS A;  2L4T A;  1N6F A;  1V6B A;  1GQ5 A;  2JIK A;  3TZ3 A;  2EEI A;  4QIJ A;  2HW5 A;  3MH4 A;  3GVJ A;  5A2P A;  2ZQR A;  1WZ8 A;  3OIZ A;  3R0H A;  4HOP B;  4HC8 A;  3U9S B;  2X7Z A;  1MFG A;  2DLS A;  3TSV A;  4U19 A;  4ZU2 A;  3TVW A;  5HF4 A;  3R9T A;  1X5N A;  3ID3 A;  5HED A;  3H0S A;  2OS6 A;  2Q2X A;  1KEF A;  2ENO A;  4QTP A;  1OBX A;  3EGG C;  1PDR A;  3CBX A;  1Y7O A;  4P0C A;  5KJP A;  4YYX A;  5F3X A;  4DGH A;  4K29 A;  5G1E A;  1H4X A;  2KJD A;  2KQF A;  1TP5 A;  3OU0 A;  2UZF A;  1ZUB A;  5G1Q A;  1I92 A;  3CH8 A;  3GGE A;  3I1E A;  2VPH A;  3OTP A;  3LKL A;  1PIX A;  4U18 A;  2AWX A;  3RRV A;  1TE0 A;  4ELS A;  2WL7 A;  4JJ0 A;  1XO6 A;  2W3P A;  1Q3P A;  1UJD A;  2DXL A;  1YG8 A;  2ZL2 A;  2ZOA A;  3V97 A;  2FNE A;  4JCS A;  2M0V A;  2DAZ A;  2DMZ A;  4I4Z A;  1I16 A;  3ZWC A;  3G64 A;  4JOT A;  2PZD A;  4REY A;  4GHN A;  1U38 A;  2Q35 A;  4NXP A;  3DJ3 A;  4L8N A;  4OLQ A;  1WDL A;  3DJA A;  3RL7 A;  1UM1 A;  3CYY A;  3K50 A;  4H11 A;  2V1W A;  2I0I A;  4WCZ A;  5DL1 A;  1WXW A;  3QXI A;  1IU0 A;  2HGA A;  3K1R A;  2ZQQ A;  2F9I B;  1IU2 A;  2ZO9 B;  2LC7 A;  1VAE A;  5DTP A;  5HFF A;  1B8Q A;  3PDZ A;  1U37 A;  2KV8 A;  5EZB A;  2KOJ A;  1AUZ A;  2VSU E;  2EJY A;  3BEZ A;  4K3W A;  3LLO A;  2VSS A;  1X45 A;  5E11 A;  3K8X A;  1QAV A;  2I4S A;  3M6M A;  2QKU A;  5DZK H;  4KNP A;  3V5E A;  1UF1 A;  1VC1 A;  3OIR A;  3KZE A;  1MC7 A;  2I04 A;  3AXA A;  4NMO A;  2CSJ A;  3JU4 A;  4JOH A;  4JOF A;  3HRX A;  5HUQ A;  1K32 A;  3JU1 A;  2J5S A;  3WG5 A;  4RYF A;  1Y7N A;  3C0K A;  4JSB A;  3PS4 A;  3T6O A;  2FCF A;  1O8U A;  1YG6 A;  3STJ A;  5G1R A;  1UM7 A;  3GF7 A;  1DCI A;  2PPY A;  4B3I A;  2YT8 A;  3SWX A;  2KJP A;  3GK7 A;  2ZL4 A;  4JOE A;  1TID B;  2D3T A;  4JCT A;  5ING A;  1H4Z A;  4FNB A;  3T88 A;  1SZO A;  3FDU A;  3PGQ A;  2ZL3 A;  1N7E A;  2EDV A;  5DUF A;  4AMH A;  3QIK A;  1XZ9 A;  2EGO A;  2W7R A;  2EEG A;  3B76 A;  1HNU A;  4YLH A;  4I52 A;  5EZ0 A;  1SOZ A;  3R69 A;  3GMF A;  4E35 A;  3BPT A;  2JSN A;  2LA8 A;  3MYB A;  4JWV A;  2ZPL A;  4XHV A;  3SHW A;  3IHB A;  3KTK A;  2DUB A;  4UU5 A;  1NZY B;  4P2A B;  2NP9 A;  2K20 A;  1UYT A;  1BFE A;  5DKP A;  1WIF A;  2VSS E;  4NMR A;  1UYS A;  5HFB A;  4KD6 A;  4FB8 A;  1FC6 A;  1P1E A;  2M3M A;  3JXT A;  4JJ3 A;  4K78 A;  4ZDE A;  2MHO A;  3RST A;  2R3Y A;  3ZXN A;  2G2L A;  1WJL A;  1V62 A;  2HE2 A;  1TG6 A;  4ELX A;  4NEK A;  4OG1 A;  4B3H A;  4WYO B;  2I6V A;  3Q0J A;  1N7T A;  2EGN A;  3ZTB A;  4FND A;  4FN8 A;  4HYL A;  2M0Z A;  5GLJ A;  4LK5 A;  1FCF A;  3QWD A;  4ZDB A;  1WF7 A;  1Z86 A;  2CS5 A;  3BF0 A;  4Q6H A;  2J5I I;  3Q7H A;  4Q0G A;  5HET A;  4JOK A;  4EML A;  2JOA A;  3PV5 A;  4HIZ A;  5DU8 A;  1WI4 A;  4U0H A;  4K2N A;  5FUS A;  3TV5 A;  3MOY A;  3O46 A;  1X9Z A;  3FY5 A;  3IF5 A;  2Q9V A;  4EMM A;  3QRE A;  3TRR A;  1YBO A;  2IWP A;  2EDP A;  2ZPM A;  4OEP A;  4WZ8 B;  4KFW A;  5EUW A;  3QDO A;  2YJG A;  2RRL A;  1NTE A;  5DTH A;  2KRG A;  2FE5 A;  3IH9 A;  3DOR A;  3TSZ A;  4NNQ A;  1MJ3 A;  3QJN A;  1GQ4 A;  2OZF A;  3GDU A;  5HFC A;  2KOH A;  3ST9 A;  1QLC A;  1X5R A;  5E0S A;  3I18 A;  2EEJ A;  4KPK A;  3GLM A;  1W9Q A;  2R4H A;  3U9T B;  4Q2Q A;  3BPP A;  3HVQ C;  2DM8 A;  1UFX A;  5HF1 A;  1Q52 A;  2GTR A;  5HFD A;  2L97 A;  1XX4 A;  3QE1 A;  3R9Q A;  1N6D A;  4YDP A;  4Q6S A;  4GVD A;  3IB9 A;  2BZR A;  3GVK A;  3E17 A;  4MOU A;  3T8A A;  4JL7 A;  3ID4 A;  1OD2 A;  2DEO A;  1RZX A;  1TYF A;  3PV4 A;  4RCN A;  2EHR A;  2I0L A;  2OGP A;  3ID1 A;  1VRG A;  2VZ5 A;  1X6D A;  2C8T A;  2CWW A;  1WG6 A;  2VSU F;  5HJ1 A;  2PKU A;  4HDT A;  1W9E A;  1T6R A;  4XS5 A;  4JCQ A;  2J5I A;  2CBY A;  3QXZ A;  3ZRT A;  5DZK A;  5D13 A;  2AS0 A;  3LNY A;  4K76 A;  1ZOK A;  1BUZ A;  2EEH A;  2J5G D;  3M6N A; 
#chains in the Genus database with same CATH homology
 2DB5 A;  4MPA A;  4FLN A;  3OC7 A;  4JOP A;  1UIT A;  3VIV A;  2DJT A;  3KTI A;  3KHF A;  1RGR A;  5H3J A;  4NXR A;  1V5Q A;  2H3L A;  3WKM A;  1L6O A;  2CSS A;  5FHT A;  2IWO A;  4NMS A;  1UJV A;  1WFV A;  1UIY A;  3STA A;  2FN5 A;  1IHJ A;  3T8B A;  2KPL A;  2F9Y B;  4FN7 A;  4Q2P A;  5C9G A;  3MT6 A;  2YUY A;  3GDV A;  2EGK A;  2VSU A;  1Q3O A;  4FZW A;  3WKL A;  5DU6 A;  1NF3 C;  3BPU A;  5HDY A;  1HZD A;  1GM1 A;  1V5L A;  3TVU A;  4I42 A;  1UEP A;  3HPM A;  2X58 A;  3HLN 1;  2BYG A;  2Z9I A;  4ZDD A;  2JIL A;  2LOB A;  5DTW A;  2FW2 A;  4JJT A;  2F5Y A;  2QKV A;  4PQW A;  1V1T A;  3V5I A;  3GCN A;  3GDS A;  2RRM A;  1WFG A;  2EV8 A;  4LMM A;  4Z33 A;  4WYT A;  1OBY A;  2QBW A;  2M0U A;  3IBB A;  3ZW8 A;  1WDM A;  3KDK A;  4IC6 A;  2VRF A;  5IL9 A;  3L3S A;  3PV2 A;  5HEY A;  1TP3 A;  3PDV A;  3QMJ A;  3NCV A;  5JBX A;  1Q7X A;  2FBM A;  4QII A;  5CTC A;  1ON3 A;  1SG4 A;  3HE2 A;  3HIN A;  3MFM A;  2PDZ A;  3GJ9 A;  5EYZ A;  1VJ6 A;  1UHP A;  1Y8T A;  1UEZ A;  5JXB A;  2PKT A;  2OQS A;  2VSU C;  5MGB A;  4NNL A;  2KL1 A;  1N99 A;  2D90 A;  1UEQ A;  4B3J A;  5INF A;  5KDR A;  2DKR A;  1OZI A;  1JXZ A;  3DIW A;  3SHU A;  2A7S A;  4L6W A;  5INI A;  4OMR A;  1TQ3 A;  4JYJ A;  1BPL A;  4L8K A;  4JCR A;  5E1Y A;  1UEW A;  2Q3G A;  2F6I A;  3NJB A;  4MXI A;  3NFK A;  4NMQ A;  2J5I B;  3OT6 A;  3NGH A;  1HNO A;  1FC7 A;  3EGH C;  2D8I A;  2KG2 A;  3SOE A;  3IAV A;  3NJD A;  3TSW A;  1OD4 A;  4FGM A;  2DC2 A;  2D92 A;  4L1C A;  1X5Q A;  5ILB A;  1K39 A;  4ELW A;  2I1N A;  1W9O A;  1RJM A;  2PA1 A;  4F47 A;  4J2U A;  4FJW D;  5FB8 C;  3TLF A;  3ISA A;  2IWN A;  1RJN A;  3K82 A;  4EMP A;  2L4S A;  2VRE A;  2AWW A;  3PZK A;  4O06 A;  2EJ5 A;  2F9Y A;  4JVT A;  1EF8 A;  2OPG A;  3CBY A;  2KPK A;  3QJM A;  2F0A A;  2JIN A;  3QKA A;  2A81 A;  3P5M A;  1FC9 A;  2VSS F;  3T3W A;  2YT7 A;  4NXQ A;  1MFL A;  4IZC A;  3CBZ A;  5HFE A;  2IEX A;  3Q0G A;  3R0O A;  2WTB A;  5E21 A;  3P2L A;  3Q1T A;  4NMV A;  3KZD A;  3GAB A;  4Q2O A;  1RY4 A;  4JYL A;  2KJK A;  2UZC A;  3QO6 A;  3OME A;  2VSV A;  1G9O A;  2E7K A;  2H2C A;  3L4F D;  1PJH A;  3H0J A;  5B42 A;  2ZL0 A;  3TT7 A;  1OBZ A;  3ZWB A;  5KDR B;  2FZS A;  3DJ1 A;  4JC0 A;  5E22 A;  2LUI A;  4Q1I A;  3QGL A;  4DI1 A;  3GHF A;  4NMT A;  4EDJ A;  3MOG A;  4Z8J A;  4FZW C;  2K1Z A;  3QYR A;  2REY A;  2H2B A;  2YTW A;  2LC6 A;  3RSI A;  4RYF H;  3KTJ A;  1XNW A;  5JBW A;  1X8S A;  2J5G A;  5C90 A;  3SUZ A;  2GEF A;  2EAQ A;  1N6E A;  2JWE A;  1X0U A;  3U9R B;  3KDG A;  4GM2 A;  3PE8 A;  3T89 A;  5CTB A;  3D03 A;  3NFL A;  3GMA A;  3KTH A;  2O2T A;  1DUB A;  1M5Z A;  3LNX A;  4G2R A;  1EY3 A;  1T2M A;  3N6R B;  3H0Q A;  4QFE A;  4ZDC A;  4R2Z A;  3FF6 A;  4UU6 A;  1R6J A;  1WF8 A;  3HP0 A;  4E3B A;  1Q51 A;  2OSG A;  2PBP A;  2HE4 A;  4GVC A;  2KBS A;  4OAJ A;  3GCO A;  4ZDF A;  2QT5 A;  4U1A A;  3SLL A;  2PNT A;  4JOJ A;  2Q34 A;  2DLU A;  2G5M B;  1WHD A;  2KAW A;  5B6L A;  1WDK A;  2IWQ A;  4E34 A;  1J7X A;  5HEB A;  2A7K A;  2VX2 A;  1RGW A;  4KFV A;  1KY9 A;  4IZD A;  3O5N A;  1WH1 A;  1KWA A;  1P1D A;  1U39 A;  1WHA A;  4HOP A;  5IKL B;  1QAV B;  4OEO A;  3VQF A;  4JOR A;  1UJU A;  3PEA A;  2JRE A;  3GF3 A;  5FIF A;  5F67 A;  1SOT A;  1W2X A;  3RL8 A;  3DUP A;  4NMP A;  4MI2 A;  3I4W A;  2Z17 A;  4U0G A;  4AEJ A;  5G1S A;  2EDZ A;  2M0T A;  3ID2 A;  4JFC A;  3CS0 A;  2X24 A;  3MH6 A;  4RI0 A;  2P3W A;  1NZY A;  1UYV A;  4K6Y A;  3ZWA A;  1Z87 A;  1VCW A;  2VWR A;  3KTG A;  5E0N X;  4JOG A;  5DU4 A;  4U0G H;  2KOM A;  2RCZ A;  2F6Q A;  3R68 A;  4N6X A;  2AWU A;  2MX6 A;  2QG1 A;  1BE9 A;  1UYR A;  3VQG A;  4WYU A;  3RLE A;  2OMJ A;  4NNM A;  3SFJ A;  3MH7 A;  3R9S A;  4Q3H A;  2KYL A;  2CE3 A;  3P85 A;  2JXO A;  3TMH A;  2QKT A;  4ASI A;  1QAU A;  3CC0 A;  1D5G A;  3ZW9 A;  3GKB A;  2EXG A;  4G69 A;  3QK8 A;  4K75 A;  4F8K A;  3H0U A;  2VSP A;  1XNY A;  3R6H A;  2H3M A;  3H02 A;  2QQ3 A;  1VB7 A;  1VA8 A;  2V90 A;  1WI2 A;  5E6P B;  4HNK A;  2PG8 A;  1EF9 A;  5I7Z A;  5E0S H;  4IZB A;  2DXN A;  3LKE A;  2KA9 A;  4AE2 A;  1ON9 A;  2GZV A;  1LCY A;  3GSL A;  2M10 A;  5GND A;  2W4F A;  4K72 A;  1XNV A;  2F9I A;  4KWB A;  4Q2N A;  3I47 A;  1U3B A;  2YUB A;  3TDC A;  4Z0M A;  3LAO A;  3H81 A;  5G1D A;  2AIN A;  2OCS A;  1N7F A;  5DUC A;  3TT6 A;  3KQF A;  3HPK A;  4NAR A;  2L4T A;  1N6F A;  1V6B A;  1GQ5 A;  2JIK A;  3TZ3 A;  2EEI A;  4QIJ A;  2HW5 A;  3MH4 A;  5A2P A;  2ZQR A;  1WZ8 A;  3R0H A;  4HOP B;  4HC8 A;  3U9S B;  2X7Z A;  1MFG A;  2DLS A;  3TSV A;  4U19 A;  4ZU2 A;  3TVW A;  5HF4 A;  3R9T A;  1X5N A;  3ID3 A;  5HED A;  3H0S A;  2OS6 A;  2Q2X A;  1KEF A;  2ENO A;  1OBX A;  3EGG C;  1PDR A;  3CBX A;  1Y7O A;  4P0C A;  5KJP A;  4YYX A;  5F3X A;  4K29 A;  5G1E A;  2KJD A;  2KQF A;  1TP5 A;  3OU0 A;  2UZF A;  1ZUB A;  5G1Q A;  1I92 A;  3CH8 A;  3GGE A;  3I1E A;  2VPH A;  3OTP A;  1PIX A;  4U18 A;  2AWX A;  3RRV A;  1TE0 A;  4ELS A;  2WL7 A;  4JJ0 A;  1XO6 A;  2W3P A;  1Q3P A;  1UJD A;  2DXL A;  1YG8 A;  2ZL2 A;  2ZOA A;  2FNE A;  4JCS A;  2M0V A;  2DAZ A;  2DMZ A;  4I4Z A;  1I16 A;  3ZWC A;  3G64 A;  4JOT A;  2PZD A;  4REY A;  4GHN A;  1U38 A;  2Q35 A;  4NXP A;  3DJ3 A;  4L8N A;  4OLQ A;  1WDL A;  3DJA A;  3RL7 A;  1UM1 A;  3CYY A;  3K50 A;  4H11 A;  2V1W A;  2I0I A;  4WCZ A;  5DL1 A;  3QXI A;  1IU0 A;  2HGA A;  3K1R A;  2ZQQ A;  2F9I B;  1IU2 A;  2ZO9 B;  2LC7 A;  1VAE A;  5DTP A;  5HFF A;  1B8Q A;  3PDZ A;  1U37 A;  2KV8 A;  2VSU E;  2KOJ A;  3BEZ A;  4K3W A;  2EJY A;  2VSS A;  3K8X A;  1X45 A;  5E11 A;  1QAV A;  2I4S A;  3M6M A;  2QKU A;  5DZK H;  4KNP A;  3V5E A;  1UF1 A;  3KZE A;  1MC7 A;  2I04 A;  3AXA A;  4NMO A;  2CSJ A;  3HRX A;  4JOH A;  4JOF A;  5HUQ A;  1K32 A;  3JU1 A;  2J5S A;  3WG5 A;  4RYF A;  1Y7N A;  4JSB A;  3PS4 A;  2FCF A;  1O8U A;  1YG6 A;  3STJ A;  5G1R A;  1UM7 A;  3GF7 A;  1DCI A;  2PPY A;  4B3I A;  2YT8 A;  3SWX A;  2KJP A;  2ZL4 A;  4JOE A;  2D3T A;  4JCT A;  5ING A;  4FNB A;  3T88 A;  1SZO A;  3FDU A;  3PGQ A;  2ZL3 A;  1N7E A;  2EDV A;  5DUF A;  4AMH A;  3QIK A;  1XZ9 A;  2EGO A;  2W7R A;  2EEG A;  3B76 A;  1HNU A;  4YLH A;  4I52 A;  5EZ0 A;  1SOZ A;  3R69 A;  3GMF A;  4E35 A;  3BPT A;  2JSN A;  2LA8 A;  3MYB A;  4JWV A;  2ZPL A;  4XHV A;  3SHW A;  3KTK A;  2DUB A;  4UU5 A;  1NZY B;  4P2A B;  2NP9 A;  2K20 A;  1UYT A;  1BFE A;  5DKP A;  1WIF A;  2VSS E;  4NMR A;  1UYS A;  5HFB A;  4KD6 A;  4FB8 A;  1FC6 A;  1P1E A;  2M3M A;  3JXT A;  4JJ3 A;  4K78 A;  4ZDE A;  2MHO A;  3RST A;  2R3Y A;  2G2L A;  1WJL A;  1V62 A;  2HE2 A;  1TG6 A;  4ELX A;  4NEK A;  4B3H A;  4WYO B;  2I6V A;  3Q0J A;  1N7T A;  2EGN A;  4FND A;  4FN8 A;  2M0Z A;  5GLJ A;  4LK5 A;  1FCF A;  3QWD A;  4ZDB A;  1WF7 A;  1Z86 A;  2CS5 A;  3BF0 A;  4Q6H A;  2J5I I;  3Q7H A;  4Q0G A;  5HET A;  4JOK A;  4EML A;  2JOA A;  3PV5 A;  5DU8 A;  1WI4 A;  4U0H A;  4K2N A;  5FUS A;  3TV5 A;  3MOY A;  3O46 A;  1X9Z A;  3FY5 A;  2Q9V A;  4EMM A;  3QRE A;  3TRR A;  1YBO A;  2IWP A;  2EDP A;  2ZPM A;  4OEP A;  4WZ8 B;  4KFW A;  3QDO A;  2YJG A;  2RRL A;  1NTE A;  5DTH A;  2KRG A;  2FE5 A;  3DOR A;  3TSZ A;  4NNQ A;  1MJ3 A;  3QJN A;  1GQ4 A;  2OZF A;  3GDU A;  5HFC A;  2KOH A;  3ST9 A;  1QLC A;  1X5R A;  5E0S A;  3I18 A;  2EEJ A;  4KPK A;  3GLM A;  1W9Q A;  2R4H A;  3U9T B;  4Q2Q A;  3BPP A;  3HVQ C;  2DM8 A;  1UFX A;  5HF1 A;  1Q52 A;  2GTR A;  5HFD A;  2L97 A;  1XX4 A;  3QE1 A;  3R9Q A;  1N6D A;  4YDP A;  4Q6S A;  4GVD A;  3IB9 A;  2BZR A;  4MOU A;  3E17 A;  3T8A A;  4JL7 A;  3ID4 A;  1OD2 A;  2DEO A;  1RZX A;  1TYF A;  3PV4 A;  4RCN A;  2EHR A;  2I0L A;  2OGP A;  3ID1 A;  1VRG A;  2VZ5 A;  1X6D A;  2C8T A;  1WG6 A;  2VSU F;  5HJ1 A;  2PKU A;  4HDT A;  1W9E A;  4JCQ A;  2J5I A;  2CBY A;  3QXZ A;  3ZRT A;  5DZK A;  5D13 A;  3LNY A;  4K76 A;  1ZOK A;  4OG1 A;  2EEH A;  2J5G D;  3M6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...