1FC9A

Photosystem ii d1 c-terminal processing protease
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
386
structure length
386
Chain Sequence
VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
molecule keywords PHOTOSYSTEM II D1 PROTEASE
total genus 114
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc9A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc9A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc9A03
1N7FA 2DUBA 3NGHA 3ID4A 2IEXA 4REYA 3B76A 3MH7A 4FGMA 3ZWAA 1TG6A 2KPLA 2ZQQA 3P2LA 5G1RA 1RGRA 3WG5A 1UJVA 1WIFA 2MHOA 2VSSF 2EV8A 3HPKA 4RI0A 1GQ5A 3ISAA 4B3IA 3GCOA 5KJPA 4B3JA 2KYLA 2H3LA 2M10A 4EMMA 2F9YA 2EEGA 1RJMA 5HFEA 2DEOA 4FJWD 1UM1A 2QKVA 4UU5A 2LC7A 2Q2XA 4YDPA 3R0OA 4JCRA 2DKRA 3P5MA 4KFVA 1ZOKA 1WF8A 3T8BA 2DC2A 3WKLA 3GDUA 4QFEA 2KA9A 2OCSA 3PEAA 4JOPA 2RRMA 2Z9IA 3LNYA 1M5ZA 1WHDA 1MFGA 2L4SA 4G2RA 1LCYA 4Q3HA 2DMZA 2LC6A 3PS4A 3PV4A 2D3TA 5HFDA 3OMEA 3I47A 2PKTA 3R68A 4NXQA 3T89A 2F9IB 1XNYA 2J5GD 5DKPA 2MX6A 1HNOA 2D90A 5E0SA 2EJ5A 5HJ1A 2CE3A 2J5SA 3SUZA 5EYZA 3RL7A 3PZKA 2OSGA 2QQ3A 4YYXA 4WCZA 3KTGA 2EDZA 4FB8A 1L6OA 2X7ZA 4IC6A 1SZOA 3CH8A 2D92A 3BEZA 2V90A 1SG4A 2O2TA 1I16A 1V6BA 5EZ0A 4PQWA 1JXZA 2M3MA 1UEWA 2DLSA 4EMPA 3K1RA 1TE0A 3ID1A 1XNVA 3TLFA 1UYRA 2R4HA 3GSLA 1MC7A 2KOJA 4Z33A 2JILA 4JOEA 4IZCA 3NFLA 4F47A 3PDZA 1OBZA 4OEOA 2ZQRA 4U19A 2PA1A 1U37A 1UITA 1SOTA 1WH1A 5HEBA 5HFCA 3ZRTA 4P2AB 1FC6A 4ZDCA 3RLEA 2IWOA 5HDYA 5DUCA 3MFMA 4NMTA 1VB7A 3BPUA 3I18A 1VCWA 2YUYA 4E35A 5DTHA 2W7RA 1GQ4A 4JCTA 3GDSA 3TT7A 3KTHA 1UEQA 2OGPA 2G2LA 2K20A 4WZ8B 4OMRA 3QYRA 3TSZA 3KTKA 3NJBA 3GMAA 3STJA 4JCQA 4JORA 4LMMA 3LNXA 5HEDA 4ZDDA 4U1AA 4K78A 3SHWA 4U0HA 4HOPA 4JJTA 2AWXA 1SOZA 3BPPA 3IAVA 1HNUA 2AWUA 2HGAA 3OU0A 2PBPA 3IBBA 4WYTA 1VJ6A 1WDLA 1N99A 3HRXA 3R9TA 2VZ5A 1Q7XA 1WI2A 1QAVA 4ELWA 3MH4A 3ID2A 1K32A 3AXAA 4JCSA 3QO6A 4R2ZA 3LAOA 5HFFA 1UEZA 1VA8A 2M0ZA 4JYLA 1N7EA 4RCNA 3TMHA 3DORA 3CC0A 2AINA 1OBXA 4ZDFA 4ZDBA 3V5IA 1FC7A 3R6HA 1WF7A 2EEIA 4ELXA 4RYFH 2I4SA 2WL7A 3Q0GA 3SWXA 1BFEA 4NMPA 2ZPLA 4NMQA 1WHAA 5GNDA 4JYJA 3OTPA 4L8NA 2X24A 2FW2A 2E7KA 4Z8JA 4IZBA 3CS0A 1T2MA 4NMRA 3H0UA 2KG2A 4GVCA 4I42A 2W4FA 1PIXA 1PJHA 2VSSA 4RYFA 2JWEA 3RL8A 2QBWA 3QXZA 2M0UA 4FNDA 4EMLA 1ON3A 2EHRA 1I92A 3U9TB 1KY9A 1UEPA 2PPYA 4GVDA 3H0SA 1Z87A 2KOHA 3T8AA 5E21A 2VSPA 2A81A 2VSVA 4KPKA 4Q1IA 2KRGA 1KWAA 3NFKA 3QDOA 2A7SA 1RJNA 1NZYA 4H11A 2L97A 2H2CA 2KJKA 1V5LA 2QKTA 1EF9A 5DL1A 2F9YB 5JBWA 3QJMA 1OBYA 2K1ZA 5INGA 3K8XA 4Q2QA 4JOFA 2YT7A 4EDJA 5E22A 3SOEA 4U18A 3P85A 2CSJA 2BYGA 2ENOA 2IWNA 5C90A 2I0IA 3GCNA 3DJ3A 3FDUA 3PV5A 4QIJA 3TVUA 2VSUE 2I0LA 2VSUF 5DU8A 2QKUA 1V5QA 2KBSA 4DI1A 4HNKA 3H81A 5FIFA 4JFCA 2V1WA 5KDRB 4MXIA 2EXGA 5H3JA 1DUBA 4NMOA 4GHNA 3ZWCA 2QG1A 4JOKA 1V1TA 1XNWA 1Q3PA 5DU4A 3KTJA 1UM7A 3HLN1 4MI2A 4B3HA 5C9GA 3O46A 1XO6A 1UJDA 5E0SH 2HE2A 3GKBA 1RZXA 3VQGA 3QK8A 2UZCA 1W9EA 2DB5A 4E3BA 1X5QA 2EDVA 3IB9A 1VRGA 1IHJA 4Q2PA 1UFXA 2OPGA 3QJNA 2IWQA 5E1YA 4ZDEA 2Z17A 5E11A 5F67A 1W9QA 2KJPA 2HE4A 1TQ3A 3FY5A 2IWPA 4K3WA 4NMVA 2EGOA 2Q35A 2VSUC 4FZWA 1BE9A 3TV5A 2P3WA 3STAA 2L4TA 4Q2OA 2CS5A 2YUBA 4U0GA 5D13A 5G1QA 3HE2A 5I7ZA 3SLLA 1K39A 2JXOA 3E17A 3QREA 2KAWA 3G64A 2REYA 4JOHA 3ST9A 2M0TA 3L4FD 2VPHA 3TT6A 1QLCA 2DAZA 5HF4A 4OG1A 2JOAA 5GLJA 2VX2A 5A2PA 1UYTA 4ZU2A 4AMHA 3GF3A 3JXTA 4JVTA 2VRFA 1N6EA 2QT5A 4KFWA 3M6NA 3PE8A 1UIYA 5JBXA 1RGWA 3SHUA 4Q6SA 2ZPMA 2J5GA 1J7XA 3HPMA 2M0VA 4L6WA 2EGKA 2J5IB 1X8SA 2ZL0A 1UF1A 1V62A 4WYOB 2FZSA 1X6DA 4KWBA 2Q9VA 4IZDA 2DLUA 4GM2A 2ZL2A 1QAVB 2EJYA 3FF6A 2NP9A 1GM1A 4JOTA 3I1EA 4O06A 1TP5A 3TRRA 1IU2A 1G9OA 2F6QA 3MH6A 3K50A 4K72A 1EY3A 2HW5A 3QMJA 1N7TA 3KTIA 4OLQA 2OMJA 1WJLA 3EGGC 4F8KA 1WZ8A 4Z0MA 2VWRA 2EDPA 1WDMA 2PDZA 4I52A 5E0NX 1EF8A 4QIIA 3GF7A 1WG6A 3HINA 2UZFA 2AWWA 1FC9A 3SFJA 3MT6A 4JWVA 4HC8A 3TSVA 4K76A 2OZFA 3WKMA 4L8KA 3Q1TA 1XZ9A 2LA8A 2VSSE 3CYYA 2EEJA 3R69A 2EAQA 5DUFA 5DU6A 1Y7OA 2H2BA 3ZWBA 3K82A 3NJDA 1X5RA 2DM8A 2OQSA 2X58A 3EGHC 1N6DA 3O5NA 4KNPA 1QAUA 5FB8C 4Q2NA 2WTBA 2VSUA 2LOBA 4NXRA 4Q6HA 1NZYB 2CSSA 3L3SA 3U9RB 3QIKA 2YTWA 2CBYA 3HVQC 3QE1A 4WYUA 1NTEA 4FZWC 3I4WA 5F3XA 5FHTA 1ON9A 4NXPA 3GJ9A 3QKAA 3KHFA 5HEYA 2KJDA 2PKUA 3Q7HA 1U3BA 5G1DA 4OEPA 4P0CA 5KDRA 4FN8A 1XX4A 3H02A 2GTRA 3VIVA 2J5II 4NNQA 1MFLA 3QXIA 3U9SB 1O8UA 3GDVA 4MPAA 3Q0JA 1P1EA 3JU1A 4K2NA 2I6VA 1Q51A 3V5EA 4K75A 2F9IA 3ZW8A 2Q3GA 4Q0GA 3CBXA 1X5NA 5B6LA 2PZDA 2EGNA 3QGLA 2R3YA 3R9SA 3T88A 1UJUA 1OZIA 3LKEA 5DTWA 2H3MA 2JREA 5DTPA 2FN5A 4JOJA 4K29A 1ZUBA 3H0JA 2KV8A 2F5YA 5HFBA 2J5IA 3H0QA 4NNLA 1VAEA 3KZEA 2PG8A 3MYBA 2FE5A 4NNMA 3RSTA 1Y8TA 5MGBA 2KOMA 3OT6A 4ELSA 2FCFA 3HP0A 2I04A 2W3PA 3N6RB 1YG8A 3TSWA 1N6FA 2Q34A 4JSBA 1X0UA 2YT8A 1Q3OA 5G1SA 3KQFA 4G69A 1MJ3A 5DZKH 1WI4A 3ZW9A 2F0AA 3DJ1A 3PGQA 3TVWA 3M6MA 1WDKA 2D8IA 1X45A 3GGEA 4ASIA 2EEHA 2RCZA 2JINA 2FNEA 4HOPB 4K6YA 2VREA 2JIKA 4LK5A 4JOGA 1YG6A 2BZRA 3ID3A 5IKLB 3KZDA 5INIA 2LUIA 4N6XA 3BF0A 1YBOA 3CBZA 1FCFA 2I1NA 3RRVA 4YLHA 2PNTA 5G1EA 1W9OA 1WFGA 3MOYA 1W2XA 3T3WA 3R9QA 2ZL4A 1TP3A 3OC7A 3TZ3A 3QWDA 1UYVA 5HETA 3CBYA 2ZL3A 1UYSA 2FBMA 1TYFA 5E6PB 3DIWA 1RY4A 2OS6A 4OAJA 2F6IA 2KQFA 4XHVA 5JXBA 1U38A 1Y7NA 1Z86A 4U0GH 3R0HA 2DJTA 2KPKA 5HF1A 3DJAA 1Q52A 3GLMA 4MOUA 1HZDA 1NF3C 2A7KA 4NEKA 1P1DA 3TDCA 5CTBA 4UU6A 1PDRA 5DZKA 1B8QA 1D5GA 1WFVA 5CTCA 1UHPA 4FNBA 3PDVA 5FUSA 4JL7A 1U39A 1R6JA 4E34A 3RSIA 3PV2A 3VQFA 1IU0A 2G5MB 5INFA 2KL1A 2C8TA 4NMSA 1KEFA 1OD4A 4KD6A 4I4ZA 2GZVA 1DCIA 1OD2A 4FN7A
chains in the Genus database with same CATH superfamily
1V0EA 1N7FA 2DUBA 3NGHA 3ID4A 2IEXA 4REYA 3B76A 3MH7A 4FGMA 3ZWAA 1TG6A 3LKLA 2KPLA 2ZQQA 3IF5A 3P2LA 5G1RA 1RGRA 3WG5A 1UJVA 1WIFA 3MOGA 2MHOA 2VSSF 2EV8A 3HPKA 4RI0A 1GQ5A 3IHAA 3ISAA 4B3IA 3GCOA 5KJPA 3AGDA 4B3JA 2KYLA 2H3LA 2M10A 4EMMA 2F9YA 2EEGA 1RJMA 5HFEA 5EZBA 2DEOA 4FJWD 1UM1A 2QKVA 4UU5A 2LC7A 2Q2XA 4YDPA 3R0OA 4JCRA 2DKRA 3P5MA 4KFVA 1ZOKA 1WF8A 3T8BA 2DC2A 3WKLA 3GDUA 4QFEA 2KA9A 2OCSA 3PEAA 4JOPA 2RRMA 2Z9IA 3LNYA 1M5ZA 1WHDA 1MFGA 2L4SA 4G2RA 1LCYA 4Q3HA 2DMZA 3V97A 2LC6A 3PS4A 3PV4A 2D3TA 5HFDA 4QTPA 3OMEA 3I47A 2PKTA 3R68A 4NXQA 3T89A 2F9IB 1XNYA 2J5GD 5DKPA 2MX6A 1HNOA 2D90A 5E0SA 2EJ5A 5HJ1A 2CE3A 2J5SA 3SUZA 5EYZA 3RL7A 3PZKA 2OSGA 2QQ3A 4YYXA 4WCZA 3KTGA 2EDZA 4FB8A 1L6OA 2X7ZA 3DUPA 4IC6A 1SZOA 2VY9A 4DMGA 3CH8A 2D92A 1THNB 3BEZA 2V90A 1SG4A 2O2TA 1I16A 1V6BA 5EZ0A 4PQWA 1JXZA 4NARA 2M3MA 1UEWA 2DLSA 4EMPA 3K1RA 4FLNA 1TE0A 3ZXNA 3ID1A 1XNVA 3TLFA 1UYRA 2R4HA 3GSLA 1MC7A 2KOJA 4Z33A 5IL9A 3QDQA 2JILA 4JOEA 4IZCA 3NFLA 4F47A 3PDZA 1OBZA 4OEOA 2ZQRA 4U19A 3T6OA 2PA1A 1U37A 1UITA 1SOTA 1WH1A 5HEBA 5HFCA 3ZRTA 4P2AB 1FC6A 4ZDCA 3RLEA 2IWOA 5HDYA 5DUCA 3MFMA 4NMTA 1VB7A 3BPUA 3I18A 2AS0A 3IH9A 1VCWA 2YUYA 4E35A 3C0KA 5DTHA 2W7RA 1GQ4A 4JCTA 2JSNA 3GDSA 3TT7A 3KTHA 1UEQA 2OGPA 2G2LA 2K20A 4WZ8B 4OMRA 3QYRA 3TSZA 3KTKA 3NJBA 1VC1A 3D03A 3STJA 3GMAA 4JCQA 4JORA 4LMMA 3LNXA 5HEDA 4ZDDA 4U1AA 4K78A 3SHWA 4U0HA 4HOPA 4JJTA 2AWXA 1SOZA 3GK7A 3BPPA 1HNUA 3IAVA 4HDTA 2AWUA 2HGAA 3OU0A 2PBPA 3IBBA 4WYTA 1VJ6A 1WDLA 1N99A 3HRXA 3R9TA 2VZ5A 1Q7XA 1WI2A 1QAVA 4ELWA 3MH4A 3ID2A 1K32A 3AXAA 4JCSA 3QO6A 4R2ZA 3LAOA 5HFFA 1UEZA 1VA8A 2M0ZA 4JYLA 1N7EA 4RCNA 3TMHA 3DORA 3CC0A 2AINA 1OBXA 4ZDFA 4ZDBA 3V5IA 1FC7A 3R6HA 1WF7A 2EEIA 4ELXA 4RYFH 2I4SA 2WL7A 3Q0GA 3SWXA 1BFEA 5EUZA 4NMPA 2ZPLA 4NMQA 1WHAA 4JJ0A 5GNDA 4JYJA 3OTPA 4L8NA 2X24A 2FW2A 2E7KA 4Z8JA 4IZBA 3CS0A 1T2MA 4NMRA 3H0UA 2KG2A 4GVCA 3JU4A 4I42A 2W4FA 3V8VA 1PIXA 1PJHA 5EUSA 1BPLA 2VSSA 2JWEA 3RL8A 2QBWA 4RYFA 3QXZA 2M0UA 4FNDA 3GVJA 1ON3A 4EMLA 4HYLA 2EHRA 2DXLA 1I92A 3U9TB 1KY9A 1UEPA 2PPYA 4GVDA 3H0SA 1Z87A 2KOHA 3T8AA 3LDFA 5E21A 1WXXA 2VSPA 2A81A 2VSVA 4KPKA 4Q1IA 2KRGA 4DGHA 1KWAA 3BPTA 3NFKA 3IHBA 3QDOA 2A7SA 1RJNA 1NZYA 4H11A 2L97A 2H2CA 2KJKA 1V5LA 2QKTA 1EF9A 3F43A 2F9YB 5DL1A 5JBWA 3QJMA 1OBYA 2K1ZA 5INGA 3K8XA 4Q2QA 4JOFA 2YT7A 4EDJA 5E22A 3SOEA 4U18A 3P85A 2CSJA 2BYGA 2ENOA 3GMFA 2IWNA 1H4ZA 2I0IA 3GCNA 4HIZA 5C90A 3DJ3A 3FDUA 3PV5A 4QIJA 3TVUA 2VSUE 2I0LA 2VSUF 5DU8A 2QKUA 1V5QA 2KBSA 4DI1A 4HNKA 3H81A 3ZTBA 5FIFA 4JFCA 2V1WA 4XS5A 5KDRB 4IZDA 4MXIA 2EXGA 5H3JA 1DUBA 4NMOA 4GHNA 3ZWCA 2QG1A 4JOKA 1V1TA 1XNWA 1Q3PA 5DU4A 3KTJA 3MGLA 1UM7A 2KLNA 3HLN1 4MI2A 5HUQA 4B3HA 5C9GA 3GVKA 3GHFA 1AUZA 3O46A 1XO6A 1UJDA 5E0SH 2HE2A 3GKBA 1RZXA 3VQGA 4DGFA 3QK8A 2UZCA 1W9EA 2DB5A 4E3BA 1X5QA 2EDVA 3IB9A 1VRGA 1IHJA 4Q2PA 1UFXA 2OPGA 3QJNA 2IWQA 5E1YA 4ZDEA 2Z17A 5E11A 5F67A 1W9QA 2KJPA 2HE4A 1TQ3A 3FY5A 2IWPA 4K3WA 4NMVA 2EGOA 2Q35A 2VSUC 4FZWA 1BE9A 3TV5A 2P3WA 3IH8A 3STAA 2L4TA 4Q2OA 2CS5A 2YUBA 4U0GA 5D13A 5G1QA 3HE2A 5I7ZA 3SLLA 1K39A 2JXOA 3E17A 4JC0A 3EH7A 3QREA 2KAWA 3G64A 2REYA 4JOHA 3ST9A 1TIDB 2M0TA 3L4FD 2VPHA 3TT6A 1QLCA 2DAZA 5HF4A 4OG1A 2JOAA 5GLJA 1BUZA 2VX2A 5A2PA 1UYTA 2KA5A 4ZU2A 4AMHA 3GF3A 3JXTA 4JVTA 4JJ3A 2VRFA 1N6EA 2QT5A 4KFWA 3M6NA 3PE8A 1UIYA 5JBXA 1RGWA 3SHUA 1WXWA 4Q6SA 2ZPMA 2J5GA 1J7XA 3HPMA 2M0VA 4L6WA 2YJGA 2EGKA 2J5IB 1X8SA 2ZL0A 1UF1A 1V62A 4WYOB 4L1CA 2FZSA 1X6DA 4KWBA 2Q9VA 3KDGA 1HF2A 2DLUA 3GABA 2ZL2A 1QAVB 2EJYA 4GM2A 3FF6A 2NP9A 1GM1A 4JOTA 3I1EA 4O06A 1TP5A 3TRRA 1IU2A 3NY7A 1G9OA 2F6QA 3MH6A 3K50A 4K72A 1EY3A 2HW5A 3QMJA 1N7TA 3KTIA 4OLQA 2OMJA 1WJLA 3EGGC 4F8KA 1WZ8A 4Z0MA 2VWRA 2EDPA 4J2UA 1WDMA 2PDZA 4I52A 5EUUA 5E0NX 1EF8A 4QIIA 3GF7A 1WG6A 3HINA 2UZFA 2AWWA 1FC9A 3SFJA 3MT6A 4JWVA 4HC8A 3TSVA 4K76A 2OZFA 3WKMA 4L8KA 3Q1TA 3VSEA 1XZ9A 1SBOA 2LA8A 1H4YA 2VSSE 3CYYA 2EEJA 3R69A 2EAQA 5DUFA 5DU6A 1Y7OA 2H2BA 4FN7A 3K82A 3ZWBA 3NJDA 1X5RA 2DM8A 2OQSA 3OIZA 2X58A 3EGHC 1N6DA 3O5NA 4KNPA 1QAUA 3LLOA 4AEJA 5FB8C 4Q2NA 2WTBA 1X9ZA 2VSUA 2LOBA 2B78A 4NXRA 4Q6HA 1NZYB 2CSSA 3L3SA 3U9RB 3QIKA 2YTWA 2CBYA 3HVQC 3QE1A 4WYUA 1NTEA 4FZWC 3I4WA 5F3XA 5FHTA 1ON9A 4NXPA 3GJ9A 3QKAA 3KHFA 5HEYA 2KJDA 2PKUA 3Q7HA 1U3BA 5G1DA 1H4XA 4OEPA 4P0CA 5KDRA 3OIRA 4FN8A 5EUXA 1XX4A 3H02A 2ZO9B 2GTRA 3VIVA 2J5II 4NNQA 1MFLA 3KDKA 3QXIA 3U9SB 1O8UA 3GDVA 4MPAA 3Q0JA 1P1EA 1TILB 3JU1A 4K2NA 2I6VA 1Q51A 3V5EA 4K75A 2F9IA 3ZW8A 2Q3GA 4Q0GA 3CBXA 1X5NA 5B6LA 2PZDA 2EGNA 3QGLA 2R3YA 3R9SA 3T88A 1UJUA 1OZIA 1V0FA 3LKEA 5DTWA 2H3MA 2JREA 5DTPA 2FN5A 4JOJA 4K29A 1ZUBA 3H0JA 2KV8A 2F5YA 5HFBA 2J5IA 3H0QA 4NNLA 1VAEA 3KZEA 2DXNA 2PG8A 2FE5A 4NNMA 3MYBA 1Y8TA 3RSTA 5MGBA 2KOMA 3OT6A 4ELSA 2FCFA 3HP0A 2I04A 2W3PA 3N6RB 1YG8A 3TSWA 1N6FA 2Q34A 4JSBA 1T6RA 1X0UA 2YT8A 2ZOAA 1Q3OA 5G1SA 2GEFA 3KQFA 4G69A 1MJ3A 5DZKH 1WI4A 3ZW9A 2F0AA 3DJ1A 3PGQA 5EUWA 3TVWA 3M6MA 1TH8B 2D8IA 1WDKA 5B42A 2OASA 1X45A 3GGEA 3NCVA 4ASIA 3D3UA 2EEHA 2RCZA 2JINA 2FNEA 4HOPB 4K6YA 2VREA 2JIKA 4LK5A 4JOGA 1YG6A 2BZRA 3ID3A 5IKLB 3KZDA 5INIA 2LUIA 4N6XA 3BF0A 1YBOA 2CWWA 3CBZA 1FCFA 2I1NA 3RRVA 5ILBA 4YLHA 2PNTA 5G1EA 1W9OA 1WFGA 3MOYA 1W2XA 3T3WA 3R9QA 2ZL4A 1TP3A 3OC7A 3TZ3A 3QWDA 1UYVA 5HETA 3CBYA 2ZL3A 1UYSA 3AGEA 1TYFA 5E6PB 2FBMA 3DIWA 1RY4A 2OS6A 4OAJA 2F6IA 2KQFA 4XHVA 5JXBA 1U38A 1Y7NA 1Z86A 4U0GH 3R0HA 2DJTA 2KPKA 5HF1A 2RRLA 3DJAA 1Q52A 3GLMA 4MOUA 1HZDA 1NF3C 2A7KA 4NEKA 1P1DA 3TDCA 5CTBA 4UU6A 1PDRA 5DZKA 3GVLA 1B8QA 1D5GA 1WFVA 5CTCA 1UHPA 4FNBA 3PDVA 5FUSA 4JL7A 1U39A 1R6JA 4E34A 3RSIA 3PV2A 3VQFA 1IU0A 2G5MB 5INFA 2KL1A 2C8TA 4NMSA 1KEFA 1OD4A 4KD6A 4I4ZA 2GZVA 1DCIA 1OD2A 4AE2A
chains in the Genus database with same CATH topology
1N7FA 2DUBA 3NGHA 3ID4A 2IEXA 4REYA 3B76A 3MH7A 4FGMA 3ZWAA 1TG6A 2KPLA 2ZQQA 3P2LA 5G1RA 1RGRA 3WG5A 1UJVA 1WIFA 3MOGA 2MHOA 2VSSF 2EV8A 3HPKA 4RI0A 1GQ5A 3ISAA 4B3IA 3GCOA 5KJPA 4B3JA 2KYLA 2H3LA 2M10A 4EMMA 2F9YA 2EEGA 1RJMA 5HFEA 2DEOA 4FJWD 1UM1A 2QKVA 4UU5A 2LC7A 2Q2XA 4YDPA 3R0OA 4JCRA 2DKRA 3P5MA 4KFVA 1ZOKA 1WF8A 3T8BA 2DC2A 3WKLA 3GDUA 4QFEA 2KA9A 2OCSA 3PEAA 4JOPA 2RRMA 2Z9IA 3LNYA 1M5ZA 1WHDA 1MFGA 2L4SA 4G2RA 1LCYA 4Q3HA 2DMZA 2LC6A 3PS4A 3PV4A 2D3TA 5HFDA 3OMEA 3I47A 2PKTA 3R68A 4NXQA 3T89A 2F9IB 1XNYA 2J5GD 5DKPA 2MX6A 1HNOA 2D90A 5E0SA 2EJ5A 5HJ1A 2CE3A 2J5SA 3SUZA 5EYZA 3RL7A 3PZKA 2OSGA 2QQ3A 4YYXA 4WCZA 3KTGA 2EDZA 4FB8A 1L6OA 2X7ZA 3DUPA 4IC6A 1SZOA 3CH8A 2D92A 3BEZA 2V90A 1SG4A 2O2TA 1I16A 1V6BA 5EZ0A 4PQWA 1JXZA 4NARA 2M3MA 1UEWA 2DLSA 4EMPA 3K1RA 4FLNA 1TE0A 3ID1A 1XNVA 3TLFA 1UYRA 2R4HA 3GSLA 1MC7A 2KOJA 4Z33A 5IL9A 2JILA 4JOEA 4IZCA 3NFLA 4F47A 3PDZA 1OBZA 4OEOA 2ZQRA 4U19A 2PA1A 1U37A 1UITA 1SOTA 1WH1A 5HEBA 5HFCA 3ZRTA 4P2AB 1FC6A 4ZDCA 3RLEA 2IWOA 5HDYA 5DUCA 3MFMA 4NMTA 1VB7A 3BPUA 3I18A 1VCWA 2YUYA 4E35A 5DTHA 2W7RA 1GQ4A 4JCTA 2JSNA 3GDSA 3TT7A 3KTHA 1UEQA 2OGPA 2G2LA 2K20A 4WZ8B 4OMRA 3QYRA 3TSZA 3KTKA 3NJBA 3D03A 3GMAA 3STJA 4JCQA 4JORA 4LMMA 3LNXA 5HEDA 4ZDDA 4U1AA 4K78A 3SHWA 4U0HA 4HOPA 4JJTA 2AWXA 1SOZA 3BPPA 3IAVA 1HNUA 4HDTA 2AWUA 2HGAA 3OU0A 2PBPA 3IBBA 4WYTA 1VJ6A 1WDLA 1N99A 3HRXA 3R9TA 2VZ5A 1Q7XA 1WI2A 1QAVA 4ELWA 3MH4A 3ID2A 1K32A 3AXAA 4JCSA 3QO6A 4R2ZA 3LAOA 5HFFA 1UEZA 1VA8A 2M0ZA 4JYLA 1N7EA 4RCNA 3TMHA 3DORA 3CC0A 2AINA 1OBXA 4ZDFA 4ZDBA 3V5IA 1FC7A 3R6HA 1WF7A 2EEIA 4ELXA 4RYFH 2I4SA 2WL7A 3Q0GA 3SWXA 1BFEA 4NMPA 2ZPLA 4NMQA 1WHAA 4JJ0A 5GNDA 4JYJA 3OTPA 4L8NA 2X24A 2FW2A 2E7KA 4Z8JA 4IZBA 3CS0A 1T2MA 4NMRA 3H0UA 2KG2A 4GVCA 4I42A 2W4FA 1PIXA 1PJHA 1BPLA 2VSSA 2JWEA 3RL8A 2QBWA 4RYFA 3QXZA 2M0UA 4FNDA 4EMLA 1ON3A 2EHRA 2DXLA 1I92A 3U9TB 1KY9A 1UEPA 2PPYA 4GVDA 3H0SA 1Z87A 2KOHA 3T8AA 5E21A 2VSPA 2A81A 2VSVA 4KPKA 4Q1IA 2KRGA 1KWAA 3BPTA 3NFKA 3QDOA 2A7SA 1RJNA 1NZYA 4H11A 2L97A 2H2CA 2KJKA 1V5LA 2QKTA 1EF9A 5DL1A 2F9YB 5JBWA 3QJMA 1OBYA 2K1ZA 5INGA 3K8XA 4Q2QA 4JOFA 2YT7A 4EDJA 5E22A 3SOEA 4U18A 3P85A 2CSJA 2BYGA 2ENOA 3GMFA 2IWNA 5C90A 2I0IA 3GCNA 3DJ3A 3FDUA 3PV5A 4QIJA 3TVUA 2VSUE 2I0LA 2VSUF 5DU8A 2QKUA 1V5QA 2KBSA 4DI1A 4HNKA 3H81A 5FIFA 4JFCA 2V1WA 5KDRB 4MXIA 2EXGA 5H3JA 1DUBA 4NMOA 4GHNA 3ZWCA 2QG1A 4JOKA 1V1TA 1XNWA 1Q3PA 5DU4A 3KTJA 1UM7A 3HLN1 4MI2A 5HUQA 4B3HA 5C9GA 3GHFA 3O46A 1XO6A 1UJDA 5E0SH 2HE2A 3GKBA 1RZXA 3VQGA 3QK8A 2UZCA 1W9EA 2DB5A 4E3BA 1X5QA 2EDVA 3IB9A 1VRGA 1IHJA 4Q2PA 1UFXA 2OPGA 3QJNA 2IWQA 5E1YA 4ZDEA 2Z17A 5E11A 5F67A 1W9QA 2KJPA 2HE4A 1TQ3A 3FY5A 2IWPA 4K3WA 4NMVA 2EGOA 2Q35A 2VSUC 4FZWA 1BE9A 3TV5A 2P3WA 3STAA 2L4TA 4Q2OA 2CS5A 2YUBA 4U0GA 5D13A 5G1QA 3HE2A 5I7ZA 3SLLA 1K39A 2JXOA 3E17A 4JC0A 3QREA 2KAWA 3G64A 2REYA 4JOHA 3ST9A 2M0TA 3L4FD 2VPHA 3TT6A 1QLCA 2DAZA 5HF4A 4OG1A 2JOAA 5GLJA 2VX2A 5A2PA 1UYTA 4ZU2A 4AMHA 3GF3A 3JXTA 4JVTA 4JJ3A 2VRFA 1N6EA 2QT5A 4KFWA 3M6NA 3PE8A 1UIYA 5JBXA 1RGWA 3SHUA 4Q6SA 2ZPMA 2J5GA 1J7XA 3HPMA 2M0VA 4L6WA 2YJGA 2EGKA 2J5IB 1X8SA 2ZL0A 1UF1A 1V62A 4WYOB 4L1CA 2FZSA 1X6DA 4KWBA 2Q9VA 3KDGA 4IZDA 2DLUA 3GABA 2ZL2A 1QAVB 2EJYA 4GM2A 3FF6A 2NP9A 1GM1A 4JOTA 3I1EA 4O06A 1TP5A 3TRRA 1IU2A 1G9OA 2F6QA 3MH6A 3K50A 4K72A 1EY3A 2HW5A 3QMJA 1N7TA 3KTIA 4OLQA 2OMJA 1WJLA 3EGGC 4F8KA 1WZ8A 4Z0MA 2VWRA 2EDPA 4J2UA 1WDMA 2PDZA 4I52A 5E0NX 1EF8A 4QIIA 3GF7A 1WG6A 3HINA 2UZFA 2AWWA 1FC9A 3SFJA 3MT6A 4JWVA 4HC8A 3TSVA 4K76A 2OZFA 3WKMA 4L8KA 3Q1TA 1XZ9A 2LA8A 2VSSE 3CYYA 2EEJA 3R69A 2EAQA 5DUFA 5DU6A 1Y7OA 2H2BA 4FN7A 3K82A 3ZWBA 3NJDA 1X5RA 2DM8A 2OQSA 2X58A 3EGHC 1N6DA 3O5NA 4KNPA 1QAUA 4AEJA 5FB8C 4Q2NA 2WTBA 1X9ZA 2VSUA 2LOBA 4NXRA 4Q6HA 1NZYB 2CSSA 3L3SA 3U9RB 3QIKA 2YTWA 2CBYA 3HVQC 3QE1A 4WYUA 1NTEA 4FZWC 3I4WA 5F3XA 5FHTA 1ON9A 4NXPA 3GJ9A 3QKAA 3KHFA 5HEYA 2KJDA 2PKUA 3Q7HA 1U3BA 5G1DA 4OEPA 4P0CA 5KDRA 4FN8A 1XX4A 3H02A 2ZO9B 2GTRA 3VIVA 2J5II 4NNQA 1MFLA 3KDKA 3QXIA 3U9SB 1O8UA 3GDVA 4MPAA 3Q0JA 1P1EA 3JU1A 4K2NA 2I6VA 1Q51A 3V5EA 4K75A 2F9IA 3ZW8A 2Q3GA 4Q0GA 3CBXA 1X5NA 5B6LA 2PZDA 2EGNA 3QGLA 2R3YA 3R9SA 3T88A 1UJUA 1OZIA 3LKEA 5DTWA 2H3MA 2JREA 5DTPA 2FN5A 4JOJA 4K29A 1ZUBA 3H0JA 2KV8A 2F5YA 5HFBA 2J5IA 3H0QA 4NNLA 1VAEA 3KZEA 2DXNA 2PG8A 2FE5A 4NNMA 3MYBA 1Y8TA 3RSTA 5MGBA 2KOMA 3OT6A 4ELSA 2FCFA 3HP0A 2I04A 2W3PA 3N6RB 1YG8A 3TSWA 1N6FA 2Q34A 4JSBA 1X0UA 2YT8A 2ZOAA 1Q3OA 5G1SA 2GEFA 3KQFA 4G69A 1MJ3A 5DZKH 1WI4A 3ZW9A 2F0AA 3DJ1A 3PGQA 3TVWA 3M6MA 1WDKA 2D8IA 5B42A 1X45A 3GGEA 3NCVA 4ASIA 2EEHA 2RCZA 2JINA 2FNEA 4HOPB 4K6YA 2VREA 2JIKA 4LK5A 4JOGA 1YG6A 2BZRA 3ID3A 5IKLB 3KZDA 5INIA 2LUIA 4N6XA 3BF0A 1YBOA 3CBZA 1FCFA 2I1NA 3RRVA 5ILBA 4YLHA 2PNTA 5G1EA 1W9OA 1WFGA 3MOYA 1W2XA 3T3WA 3R9QA 2ZL4A 1TP3A 3OC7A 3TZ3A 3QWDA 1UYVA 5HETA 3CBYA 2ZL3A 1UYSA 2FBMA 1TYFA 5E6PB 3DIWA 1RY4A 2OS6A 4OAJA 2F6IA 2KQFA 4XHVA 5JXBA 1U38A 1Y7NA 1Z86A 4U0GH 3R0HA 2DJTA 2KPKA 5HF1A 2RRLA 3DJAA 1Q52A 3GLMA 4MOUA 1HZDA 1NF3C 2A7KA 4NEKA 1P1DA 3TDCA 5CTBA 4UU6A 1PDRA 5DZKA 1B8QA 1D5GA 1WFVA 5CTCA 1UHPA 4FNBA 3PDVA 5FUSA 4JL7A 1U39A 1R6JA 4E34A 3RSIA 3PV2A 3VQFA 1IU0A 2G5MB 5INFA 2KL1A 2C8TA 4NMSA 1KEFA 1OD4A 4KD6A 4I4ZA 2GZVA 1DCIA 1OD2A 4AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7F A;  2DUB A;  3NGH A;  3ID4 A;  2IEX A;  4REY A;  3B76 A;  3MH7 A;  4FGM A;  3ZWA A;  1TG6 A;  2KPL A;  2ZQQ A;  3P2L A;  5G1R A;  1RGR A;  3WG5 A;  1UJV A;  1WIF A;  2MHO A;  2VSS F;  2EV8 A;  3HPK A;  4RI0 A;  1GQ5 A;  3ISA A;  4B3I A;  3GCO A;  5KJP A;  4B3J A;  2KYL A;  2H3L A;  2M10 A;  4EMM A;  2F9Y A;  2EEG A;  1RJM A;  5HFE A;  2DEO A;  4FJW D;  1UM1 A;  2QKV A;  4UU5 A;  2LC7 A;  2Q2X A;  4YDP A;  3R0O A;  4JCR A;  2DKR A;  3P5M A;  4KFV A;  1ZOK A;  1WF8 A;  3T8B A;  2DC2 A;  3WKL A;  3GDU A;  4QFE A;  2KA9 A;  2OCS A;  3PEA A;  4JOP A;  2RRM A;  2Z9I A;  3LNY A;  1M5Z A;  1WHD A;  1MFG A;  2L4S A;  4G2R A;  1LCY A;  4Q3H A;  2DMZ A;  2LC6 A;  3PS4 A;  3PV4 A;  2D3T A;  5HFD A;  3OME A;  3I47 A;  2PKT A;  3R68 A;  4NXQ A;  3T89 A;  2F9I B;  1XNY A;  2J5G D;  5DKP A;  2MX6 A;  1HNO A;  2D90 A;  5E0S A;  2EJ5 A;  5HJ1 A;  2CE3 A;  2J5S A;  3SUZ A;  5EYZ A;  3RL7 A;  3PZK A;  2OSG A;  2QQ3 A;  4YYX A;  4WCZ A;  3KTG A;  2EDZ A;  4FB8 A;  1L6O A;  2X7Z A;  4IC6 A;  1SZO A;  3CH8 A;  2D92 A;  3BEZ A;  2V90 A;  1SG4 A;  2O2T A;  1I16 A;  1V6B A;  5EZ0 A;  4PQW A;  1JXZ A;  2M3M A;  1UEW A;  2DLS A;  4EMP A;  3K1R A;  1TE0 A;  3ID1 A;  1XNV A;  3TLF A;  1UYR A;  2R4H A;  3GSL A;  1MC7 A;  2KOJ A;  4Z33 A;  2JIL A;  4JOE A;  4IZC A;  3NFL A;  4F47 A;  3PDZ A;  1OBZ A;  4OEO A;  2ZQR A;  4U19 A;  2PA1 A;  1U37 A;  1UIT A;  1SOT A;  1WH1 A;  5HEB A;  5HFC A;  3ZRT A;  4P2A B;  1FC6 A;  4ZDC A;  3RLE A;  2IWO A;  5HDY A;  5DUC A;  3MFM A;  4NMT A;  1VB7 A;  3BPU A;  3I18 A;  1VCW A;  2YUY A;  4E35 A;  5DTH A;  2W7R A;  1GQ4 A;  4JCT A;  3GDS A;  3TT7 A;  3KTH A;  1UEQ A;  2OGP A;  2G2L A;  2K20 A;  4WZ8 B;  4OMR A;  3QYR A;  3TSZ A;  3KTK A;  3NJB A;  3GMA A;  3STJ A;  4JCQ A;  4JOR A;  4LMM A;  3LNX A;  5HED A;  4ZDD A;  4U1A A;  4K78 A;  3SHW A;  4U0H A;  4HOP A;  4JJT A;  2AWX A;  1SOZ A;  3BPP A;  3IAV A;  1HNU A;  2AWU A;  2HGA A;  3OU0 A;  2PBP A;  3IBB A;  4WYT A;  1VJ6 A;  1WDL A;  1N99 A;  3HRX A;  3R9T A;  2VZ5 A;  1Q7X A;  1WI2 A;  1QAV A;  4ELW A;  3MH4 A;  3ID2 A;  1K32 A;  3AXA A;  4JCS A;  3QO6 A;  4R2Z A;  3LAO A;  5HFF A;  1UEZ A;  1VA8 A;  2M0Z A;  4JYL A;  1N7E A;  4RCN A;  3TMH A;  3DOR A;  3CC0 A;  2AIN A;  1OBX A;  4ZDF A;  4ZDB A;  3V5I A;  1FC7 A;  3R6H A;  1WF7 A;  2EEI A;  4ELX A;  4RYF H;  2I4S A;  2WL7 A;  3Q0G A;  3SWX A;  1BFE A;  4NMP A;  2ZPL A;  4NMQ A;  1WHA A;  5GND A;  4JYJ A;  3OTP A;  4L8N A;  2X24 A;  2FW2 A;  2E7K A;  4Z8J A;  4IZB A;  3CS0 A;  1T2M A;  4NMR A;  3H0U A;  2KG2 A;  4GVC A;  4I42 A;  2W4F A;  1PIX A;  1PJH A;  2VSS A;  4RYF A;  2JWE A;  3RL8 A;  2QBW A;  3QXZ A;  2M0U A;  4FND A;  4EML A;  1ON3 A;  2EHR A;  1I92 A;  3U9T B;  1KY9 A;  1UEP A;  2PPY A;  4GVD A;  3H0S A;  1Z87 A;  2KOH A;  3T8A A;  5E21 A;  2VSP A;  2A81 A;  2VSV A;  4KPK A;  4Q1I A;  2KRG A;  1KWA A;  3NFK A;  3QDO A;  2A7S A;  1RJN A;  1NZY A;  4H11 A;  2L97 A;  2H2C A;  2KJK A;  1V5L A;  2QKT A;  1EF9 A;  5DL1 A;  2F9Y B;  5JBW A;  3QJM A;  1OBY A;  2K1Z A;  5ING A;  3K8X A;  4Q2Q A;  4JOF A;  2YT7 A;  4EDJ A;  5E22 A;  3SOE A;  4U18 A;  3P85 A;  2CSJ A;  2BYG A;  2ENO A;  2IWN A;  5C90 A;  2I0I A;  3GCN A;  3DJ3 A;  3FDU A;  3PV5 A;  4QIJ A;  3TVU A;  2VSU E;  2I0L A;  2VSU F;  5DU8 A;  2QKU A;  1V5Q A;  2KBS A;  4DI1 A;  4HNK A;  3H81 A;  5FIF A;  4JFC A;  2V1W A;  5KDR B;  4MXI A;  2EXG A;  5H3J A;  1DUB A;  4NMO A;  4GHN A;  3ZWC A;  2QG1 A;  4JOK A;  1V1T A;  1XNW A;  1Q3P A;  5DU4 A;  3KTJ A;  1UM7 A;  3HLN 1;  4MI2 A;  4B3H A;  5C9G A;  3O46 A;  1XO6 A;  1UJD A;  5E0S H;  2HE2 A;  3GKB A;  1RZX A;  3VQG A;  3QK8 A;  2UZC A;  1W9E A;  2DB5 A;  4E3B A;  1X5Q A;  2EDV A;  3IB9 A;  1VRG A;  1IHJ A;  4Q2P A;  1UFX A;  2OPG A;  3QJN A;  2IWQ A;  5E1Y A;  4ZDE A;  2Z17 A;  5E11 A;  5F67 A;  1W9Q A;  2KJP A;  2HE4 A;  1TQ3 A;  3FY5 A;  2IWP A;  4K3W A;  4NMV A;  2EGO A;  2Q35 A;  2VSU C;  4FZW A;  1BE9 A;  3TV5 A;  2P3W A;  3STA A;  2L4T A;  4Q2O A;  2CS5 A;  2YUB A;  4U0G A;  5D13 A;  5G1Q A;  3HE2 A;  5I7Z A;  3SLL A;  1K39 A;  2JXO A;  3E17 A;  3QRE A;  2KAW A;  3G64 A;  2REY A;  4JOH A;  3ST9 A;  2M0T A;  3L4F D;  2VPH A;  3TT6 A;  1QLC A;  2DAZ A;  5HF4 A;  4OG1 A;  2JOA A;  5GLJ A;  2VX2 A;  5A2P A;  1UYT A;  4ZU2 A;  4AMH A;  3GF3 A;  3JXT A;  4JVT A;  2VRF A;  1N6E A;  2QT5 A;  4KFW A;  3M6N A;  3PE8 A;  1UIY A;  5JBX A;  1RGW A;  3SHU A;  4Q6S A;  2ZPM A;  2J5G A;  1J7X A;  3HPM A;  2M0V A;  4L6W A;  2EGK A;  2J5I B;  1X8S A;  2ZL0 A;  1UF1 A;  1V62 A;  4WYO B;  2FZS A;  1X6D A;  4KWB A;  2Q9V A;  4IZD A;  2DLU A;  4GM2 A;  2ZL2 A;  1QAV B;  2EJY A;  3FF6 A;  2NP9 A;  1GM1 A;  4JOT A;  3I1E A;  4O06 A;  1TP5 A;  3TRR A;  1IU2 A;  1G9O A;  2F6Q A;  3MH6 A;  3K50 A;  4K72 A;  1EY3 A;  2HW5 A;  3QMJ A;  1N7T A;  3KTI A;  4OLQ A;  2OMJ A;  1WJL A;  3EGG C;  4F8K A;  1WZ8 A;  4Z0M A;  2VWR A;  2EDP A;  1WDM A;  2PDZ A;  4I52 A;  5E0N X;  1EF8 A;  4QII A;  3GF7 A;  1WG6 A;  3HIN A;  2UZF A;  2AWW A;  1FC9 A;  3SFJ A;  3MT6 A;  4JWV A;  4HC8 A;  3TSV A;  4K76 A;  2OZF A;  3WKM A;  4L8K A;  3Q1T A;  1XZ9 A;  2LA8 A;  2VSS E;  3CYY A;  2EEJ A;  3R69 A;  2EAQ A;  5DUF A;  5DU6 A;  1Y7O A;  2H2B A;  3ZWB A;  3K82 A;  3NJD A;  1X5R A;  2DM8 A;  2OQS A;  2X58 A;  3EGH C;  1N6D A;  3O5N A;  4KNP A;  1QAU A;  5FB8 C;  4Q2N A;  2WTB A;  2VSU A;  2LOB A;  4NXR A;  4Q6H A;  1NZY B;  2CSS A;  3L3S A;  3U9R B;  3QIK A;  2YTW A;  2CBY A;  3HVQ C;  3QE1 A;  4WYU A;  1NTE A;  4FZW C;  3I4W A;  5F3X A;  5FHT A;  1ON9 A;  4NXP A;  3GJ9 A;  3QKA A;  3KHF A;  5HEY A;  2KJD A;  2PKU A;  3Q7H A;  1U3B A;  5G1D A;  4OEP A;  4P0C A;  5KDR A;  4FN8 A;  1XX4 A;  3H02 A;  2GTR A;  3VIV A;  2J5I I;  4NNQ A;  1MFL A;  3QXI A;  3U9S B;  1O8U A;  3GDV A;  4MPA A;  3Q0J A;  1P1E A;  3JU1 A;  4K2N A;  2I6V A;  1Q51 A;  3V5E A;  4K75 A;  2F9I A;  3ZW8 A;  2Q3G A;  4Q0G A;  3CBX A;  1X5N A;  5B6L A;  2PZD A;  2EGN A;  3QGL A;  2R3Y A;  3R9S A;  3T88 A;  1UJU A;  1OZI A;  3LKE A;  5DTW A;  2H3M A;  2JRE A;  5DTP A;  2FN5 A;  4JOJ A;  4K29 A;  1ZUB A;  3H0J A;  2KV8 A;  2F5Y A;  5HFB A;  2J5I A;  3H0Q A;  4NNL A;  1VAE A;  3KZE A;  2PG8 A;  3MYB A;  2FE5 A;  4NNM A;  3RST A;  1Y8T A;  5MGB A;  2KOM A;  3OT6 A;  4ELS A;  2FCF A;  3HP0 A;  2I04 A;  2W3P A;  3N6R B;  1YG8 A;  3TSW A;  1N6F A;  2Q34 A;  4JSB A;  1X0U A;  2YT8 A;  1Q3O A;  5G1S A;  3KQF A;  4G69 A;  1MJ3 A;  5DZK H;  1WI4 A;  3ZW9 A;  2F0A A;  3DJ1 A;  3PGQ A;  3TVW A;  3M6M A;  1WDK A;  2D8I A;  1X45 A;  3GGE A;  4ASI A;  2EEH A;  2RCZ A;  2JIN A;  2FNE A;  4HOP B;  4K6Y A;  2VRE A;  2JIK A;  4LK5 A;  4JOG A;  1YG6 A;  2BZR A;  3ID3 A;  5IKL B;  3KZD A;  5INI A;  2LUI A;  4N6X A;  3BF0 A;  1YBO A;  3CBZ A;  1FCF A;  2I1N A;  3RRV A;  4YLH A;  2PNT A;  5G1E A;  1W9O A;  1WFG A;  3MOY A;  1W2X A;  3T3W A;  3R9Q A;  2ZL4 A;  1TP3 A;  3OC7 A;  3TZ3 A;  3QWD A;  1UYV A;  5HET A;  3CBY A;  2ZL3 A;  1UYS A;  2FBM A;  1TYF A;  5E6P B;  3DIW A;  1RY4 A;  2OS6 A;  4OAJ A;  2F6I A;  2KQF A;  4XHV A;  5JXB A;  1U38 A;  1Y7N A;  1Z86 A;  4U0G H;  3R0H A;  2DJT A;  2KPK A;  5HF1 A;  3DJA A;  1Q52 A;  3GLM A;  4MOU A;  1HZD A;  1NF3 C;  2A7K A;  4NEK A;  1P1D A;  3TDC A;  5CTB A;  4UU6 A;  1PDR A;  5DZK A;  1B8Q A;  1D5G A;  1WFV A;  5CTC A;  1UHP A;  4FNB A;  3PDV A;  5FUS A;  4JL7 A;  1U39 A;  1R6J A;  4E34 A;  3RSI A;  3PV2 A;  3VQF A;  1IU0 A;  2G5M B;  5INF A;  2KL1 A;  2C8T A;  4NMS A;  1KEF A;  1OD4 A;  4KD6 A;  4I4Z A;  2GZV A;  1DCI A;  1OD2 A;  4FN7 A; 
#chains in the Genus database with same CATH topology
 1V0E A;  1N7F A;  2DUB A;  3NGH A;  3ID4 A;  2IEX A;  4REY A;  3B76 A;  3MH7 A;  4FGM A;  3ZWA A;  1TG6 A;  3LKL A;  2KPL A;  2ZQQ A;  3IF5 A;  3P2L A;  5G1R A;  1RGR A;  3WG5 A;  1UJV A;  1WIF A;  3MOG A;  2MHO A;  2VSS F;  2EV8 A;  3HPK A;  4RI0 A;  1GQ5 A;  3IHA A;  3ISA A;  4B3I A;  3GCO A;  5KJP A;  3AGD A;  4B3J A;  2KYL A;  2H3L A;  2M10 A;  4EMM A;  2F9Y A;  2EEG A;  1RJM A;  5HFE A;  5EZB A;  2DEO A;  4FJW D;  1UM1 A;  2QKV A;  4UU5 A;  2LC7 A;  2Q2X A;  4YDP A;  3R0O A;  4JCR A;  2DKR A;  3P5M A;  4KFV A;  1ZOK A;  1WF8 A;  3T8B A;  2DC2 A;  3WKL A;  3GDU A;  4QFE A;  2KA9 A;  2OCS A;  3PEA A;  4JOP A;  2RRM A;  2Z9I A;  3LNY A;  1M5Z A;  1WHD A;  1MFG A;  2L4S A;  4G2R A;  1LCY A;  4Q3H A;  2DMZ A;  3V97 A;  2LC6 A;  3PS4 A;  3PV4 A;  2D3T A;  5HFD A;  4QTP A;  3OME A;  3I47 A;  2PKT A;  3R68 A;  4NXQ A;  3T89 A;  2F9I B;  1XNY A;  2J5G D;  5DKP A;  2MX6 A;  1HNO A;  2D90 A;  5E0S A;  2EJ5 A;  5HJ1 A;  2CE3 A;  2J5S A;  3SUZ A;  5EYZ A;  3RL7 A;  3PZK A;  2OSG A;  2QQ3 A;  4YYX A;  4WCZ A;  3KTG A;  2EDZ A;  4FB8 A;  1L6O A;  2X7Z A;  3DUP A;  4IC6 A;  1SZO A;  2VY9 A;  4DMG A;  3CH8 A;  2D92 A;  1THN B;  3BEZ A;  2V90 A;  1SG4 A;  2O2T A;  1I16 A;  1V6B A;  5EZ0 A;  4PQW A;  1JXZ A;  4NAR A;  2M3M A;  1UEW A;  2DLS A;  4EMP A;  3K1R A;  4FLN A;  1TE0 A;  3ZXN A;  3ID1 A;  1XNV A;  3TLF A;  1UYR A;  2R4H A;  3GSL A;  1MC7 A;  2KOJ A;  4Z33 A;  5IL9 A;  3QDQ A;  2JIL A;  4JOE A;  4IZC A;  3NFL A;  4F47 A;  3PDZ A;  1OBZ A;  4OEO A;  2ZQR A;  4U19 A;  3T6O A;  2PA1 A;  1U37 A;  1UIT A;  1SOT A;  1WH1 A;  5HEB A;  5HFC A;  3ZRT A;  4P2A B;  1FC6 A;  4ZDC A;  3RLE A;  2IWO A;  5HDY A;  5DUC A;  3MFM A;  4NMT A;  1VB7 A;  3BPU A;  3I18 A;  2AS0 A;  3IH9 A;  1VCW A;  2YUY A;  4E35 A;  3C0K A;  5DTH A;  2W7R A;  1GQ4 A;  4JCT A;  2JSN A;  3GDS A;  3TT7 A;  3KTH A;  1UEQ A;  2OGP A;  2G2L A;  2K20 A;  4WZ8 B;  4OMR A;  3QYR A;  3TSZ A;  3KTK A;  3NJB A;  1VC1 A;  3D03 A;  3STJ A;  3GMA A;  4JCQ A;  4JOR A;  4LMM A;  3LNX A;  5HED A;  4ZDD A;  4U1A A;  4K78 A;  3SHW A;  4U0H A;  4HOP A;  4JJT A;  2AWX A;  1SOZ A;  3GK7 A;  3BPP A;  1HNU A;  3IAV A;  4HDT A;  2AWU A;  2HGA A;  3OU0 A;  2PBP A;  3IBB A;  4WYT A;  1VJ6 A;  1WDL A;  1N99 A;  3HRX A;  3R9T A;  2VZ5 A;  1Q7X A;  1WI2 A;  1QAV A;  4ELW A;  3MH4 A;  3ID2 A;  1K32 A;  3AXA A;  4JCS A;  3QO6 A;  4R2Z A;  3LAO A;  5HFF A;  1UEZ A;  1VA8 A;  2M0Z A;  4JYL A;  1N7E A;  4RCN A;  3TMH A;  3DOR A;  3CC0 A;  2AIN A;  1OBX A;  4ZDF A;  4ZDB A;  3V5I A;  1FC7 A;  3R6H A;  1WF7 A;  2EEI A;  4ELX A;  4RYF H;  2I4S A;  2WL7 A;  3Q0G A;  3SWX A;  1BFE A;  5EUZ A;  4NMP A;  2ZPL A;  4NMQ A;  1WHA A;  4JJ0 A;  5GND A;  4JYJ A;  3OTP A;  4L8N A;  2X24 A;  2FW2 A;  2E7K A;  4Z8J A;  4IZB A;  3CS0 A;  1T2M A;  4NMR A;  3H0U A;  2KG2 A;  4GVC A;  3JU4 A;  4I42 A;  2W4F A;  3V8V A;  1PIX A;  1PJH A;  5EUS A;  1BPL A;  2VSS A;  2JWE A;  3RL8 A;  2QBW A;  4RYF A;  3QXZ A;  2M0U A;  4FND A;  3GVJ A;  1ON3 A;  4EML A;  4HYL A;  2EHR A;  2DXL A;  1I92 A;  3U9T B;  1KY9 A;  1UEP A;  2PPY A;  4GVD A;  3H0S A;  1Z87 A;  2KOH A;  3T8A A;  3LDF A;  5E21 A;  1WXX A;  2VSP A;  2A81 A;  2VSV A;  4KPK A;  4Q1I A;  2KRG A;  4DGH A;  1KWA A;  3BPT A;  3NFK A;  3IHB A;  3QDO A;  2A7S A;  1RJN A;  1NZY A;  4H11 A;  2L97 A;  2H2C A;  2KJK A;  1V5L A;  2QKT A;  1EF9 A;  3F43 A;  2F9Y B;  5DL1 A;  5JBW A;  3QJM A;  1OBY A;  2K1Z A;  5ING A;  3K8X A;  4Q2Q A;  4JOF A;  2YT7 A;  4EDJ A;  5E22 A;  3SOE A;  4U18 A;  3P85 A;  2CSJ A;  2BYG A;  2ENO A;  3GMF A;  2IWN A;  1H4Z A;  2I0I A;  3GCN A;  4HIZ A;  5C90 A;  3DJ3 A;  3FDU A;  3PV5 A;  4QIJ A;  3TVU A;  2VSU E;  2I0L A;  2VSU F;  5DU8 A;  2QKU A;  1V5Q A;  2KBS A;  4DI1 A;  4HNK A;  3H81 A;  3ZTB A;  5FIF A;  4JFC A;  2V1W A;  4XS5 A;  5KDR B;  4IZD A;  4MXI A;  2EXG A;  5H3J A;  1DUB A;  4NMO A;  4GHN A;  3ZWC A;  2QG1 A;  4JOK A;  1V1T A;  1XNW A;  1Q3P A;  5DU4 A;  3KTJ A;  3MGL A;  1UM7 A;  2KLN A;  3HLN 1;  4MI2 A;  5HUQ A;  4B3H A;  5C9G A;  3GVK A;  3GHF A;  1AUZ A;  3O46 A;  1XO6 A;  1UJD A;  5E0S H;  2HE2 A;  3GKB A;  1RZX A;  3VQG A;  4DGF A;  3QK8 A;  2UZC A;  1W9E A;  2DB5 A;  4E3B A;  1X5Q A;  2EDV A;  3IB9 A;  1VRG A;  1IHJ A;  4Q2P A;  1UFX A;  2OPG A;  3QJN A;  2IWQ A;  5E1Y A;  4ZDE A;  2Z17 A;  5E11 A;  5F67 A;  1W9Q A;  2KJP A;  2HE4 A;  1TQ3 A;  3FY5 A;  2IWP A;  4K3W A;  4NMV A;  2EGO A;  2Q35 A;  2VSU C;  4FZW A;  1BE9 A;  3TV5 A;  2P3W A;  3IH8 A;  3STA A;  2L4T A;  4Q2O A;  2CS5 A;  2YUB A;  4U0G A;  5D13 A;  5G1Q A;  3HE2 A;  5I7Z A;  3SLL A;  1K39 A;  2JXO A;  3E17 A;  4JC0 A;  3EH7 A;  3QRE A;  2KAW A;  3G64 A;  2REY A;  4JOH A;  3ST9 A;  1TID B;  2M0T A;  3L4F D;  2VPH A;  3TT6 A;  1QLC A;  2DAZ A;  5HF4 A;  4OG1 A;  2JOA A;  5GLJ A;  1BUZ A;  2VX2 A;  5A2P A;  1UYT A;  2KA5 A;  4ZU2 A;  4AMH A;  3GF3 A;  3JXT A;  4JVT A;  4JJ3 A;  2VRF A;  1N6E A;  2QT5 A;  4KFW A;  3M6N A;  3PE8 A;  1UIY A;  5JBX A;  1RGW A;  3SHU A;  1WXW A;  4Q6S A;  2ZPM A;  2J5G A;  1J7X A;  3HPM A;  2M0V A;  4L6W A;  2YJG A;  2EGK A;  2J5I B;  1X8S A;  2ZL0 A;  1UF1 A;  1V62 A;  4WYO B;  4L1C A;  2FZS A;  1X6D A;  4KWB A;  2Q9V A;  3KDG A;  1HF2 A;  2DLU A;  3GAB A;  2ZL2 A;  1QAV B;  2EJY A;  4GM2 A;  3FF6 A;  2NP9 A;  1GM1 A;  4JOT A;  3I1E A;  4O06 A;  1TP5 A;  3TRR A;  1IU2 A;  3NY7 A;  1G9O A;  2F6Q A;  3MH6 A;  3K50 A;  4K72 A;  1EY3 A;  2HW5 A;  3QMJ A;  1N7T A;  3KTI A;  4OLQ A;  2OMJ A;  1WJL A;  3EGG C;  4F8K A;  1WZ8 A;  4Z0M A;  2VWR A;  2EDP A;  4J2U A;  1WDM A;  2PDZ A;  4I52 A;  5EUU A;  5E0N X;  1EF8 A;  4QII A;  3GF7 A;  1WG6 A;  3HIN A;  2UZF A;  2AWW A;  1FC9 A;  3SFJ A;  3MT6 A;  4JWV A;  4HC8 A;  3TSV A;  4K76 A;  2OZF A;  3WKM A;  4L8K A;  3Q1T A;  3VSE A;  1XZ9 A;  1SBO A;  2LA8 A;  1H4Y A;  2VSS E;  3CYY A;  2EEJ A;  3R69 A;  2EAQ A;  5DUF A;  5DU6 A;  1Y7O A;  2H2B A;  4FN7 A;  3K82 A;  3ZWB A;  3NJD A;  1X5R A;  2DM8 A;  2OQS A;  3OIZ A;  2X58 A;  3EGH C;  1N6D A;  3O5N A;  4KNP A;  1QAU A;  3LLO A;  4AEJ A;  5FB8 C;  4Q2N A;  2WTB A;  1X9Z A;  2VSU A;  2LOB A;  2B78 A;  4NXR A;  4Q6H A;  1NZY B;  2CSS A;  3L3S A;  3U9R B;  3QIK A;  2YTW A;  2CBY A;  3HVQ C;  3QE1 A;  4WYU A;  1NTE A;  4FZW C;  3I4W A;  5F3X A;  5FHT A;  1ON9 A;  4NXP A;  3GJ9 A;  3QKA A;  3KHF A;  5HEY A;  2KJD A;  2PKU A;  3Q7H A;  1U3B A;  5G1D A;  1H4X A;  4OEP A;  4P0C A;  5KDR A;  3OIR A;  4FN8 A;  5EUX A;  1XX4 A;  3H02 A;  2ZO9 B;  2GTR A;  3VIV A;  2J5I I;  4NNQ A;  1MFL A;  3KDK A;  3QXI A;  3U9S B;  1O8U A;  3GDV A;  4MPA A;  3Q0J A;  1P1E A;  1TIL B;  3JU1 A;  4K2N A;  2I6V A;  1Q51 A;  3V5E A;  4K75 A;  2F9I A;  3ZW8 A;  2Q3G A;  4Q0G A;  3CBX A;  1X5N A;  5B6L A;  2PZD A;  2EGN A;  3QGL A;  2R3Y A;  3R9S A;  3T88 A;  1UJU A;  1OZI A;  1V0F A;  3LKE A;  5DTW A;  2H3M A;  2JRE A;  5DTP A;  2FN5 A;  4JOJ A;  4K29 A;  1ZUB A;  3H0J A;  2KV8 A;  2F5Y A;  5HFB A;  2J5I A;  3H0Q A;  4NNL A;  1VAE A;  3KZE A;  2DXN A;  2PG8 A;  2FE5 A;  4NNM A;  3MYB A;  1Y8T A;  3RST A;  5MGB A;  2KOM A;  3OT6 A;  4ELS A;  2FCF A;  3HP0 A;  2I04 A;  2W3P A;  3N6R B;  1YG8 A;  3TSW A;  1N6F A;  2Q34 A;  4JSB A;  1T6R A;  1X0U A;  2YT8 A;  2ZOA A;  1Q3O A;  5G1S A;  2GEF A;  3KQF A;  4G69 A;  1MJ3 A;  5DZK H;  1WI4 A;  3ZW9 A;  2F0A A;  3DJ1 A;  3PGQ A;  5EUW A;  3TVW A;  3M6M A;  1TH8 B;  2D8I A;  1WDK A;  5B42 A;  2OAS A;  1X45 A;  3GGE A;  3NCV A;  4ASI A;  3D3U A;  2EEH A;  2RCZ A;  2JIN A;  2FNE A;  4HOP B;  4K6Y A;  2VRE A;  2JIK A;  4LK5 A;  4JOG A;  1YG6 A;  2BZR A;  3ID3 A;  5IKL B;  3KZD A;  5INI A;  2LUI A;  4N6X A;  3BF0 A;  1YBO A;  2CWW A;  3CBZ A;  1FCF A;  2I1N A;  3RRV A;  5ILB A;  4YLH A;  2PNT A;  5G1E A;  1W9O A;  1WFG A;  3MOY A;  1W2X A;  3T3W A;  3R9Q A;  2ZL4 A;  1TP3 A;  3OC7 A;  3TZ3 A;  3QWD A;  1UYV A;  5HET A;  3CBY A;  2ZL3 A;  1UYS A;  3AGE A;  1TYF A;  5E6P B;  2FBM A;  3DIW A;  1RY4 A;  2OS6 A;  4OAJ A;  2F6I A;  2KQF A;  4XHV A;  5JXB A;  1U38 A;  1Y7N A;  1Z86 A;  4U0G H;  3R0H A;  2DJT A;  2KPK A;  5HF1 A;  2RRL A;  3DJA A;  1Q52 A;  3GLM A;  4MOU A;  1HZD A;  1NF3 C;  2A7K A;  4NEK A;  1P1D A;  3TDC A;  5CTB A;  4UU6 A;  1PDR A;  5DZK A;  3GVL A;  1B8Q A;  1D5G A;  1WFV A;  5CTC A;  1UHP A;  4FNB A;  3PDV A;  5FUS A;  4JL7 A;  1U39 A;  1R6J A;  4E34 A;  3RSI A;  3PV2 A;  3VQF A;  1IU0 A;  2G5M B;  5INF A;  2KL1 A;  2C8T A;  4NMS A;  1KEF A;  1OD4 A;  4KD6 A;  4I4Z A;  2GZV A;  1DCI A;  1OD2 A;  4AE2 A; 
#chains in the Genus database with same CATH homology
 1N7F A;  2DUB A;  3NGH A;  3ID4 A;  2IEX A;  4REY A;  3B76 A;  3MH7 A;  4FGM A;  3ZWA A;  1TG6 A;  2KPL A;  2ZQQ A;  3P2L A;  5G1R A;  1RGR A;  3WG5 A;  1UJV A;  1WIF A;  3MOG A;  2MHO A;  2VSS F;  2EV8 A;  3HPK A;  4RI0 A;  1GQ5 A;  3ISA A;  4B3I A;  3GCO A;  5KJP A;  4B3J A;  2KYL A;  2H3L A;  2M10 A;  4EMM A;  2F9Y A;  2EEG A;  1RJM A;  5HFE A;  2DEO A;  4FJW D;  1UM1 A;  2QKV A;  4UU5 A;  2LC7 A;  2Q2X A;  4YDP A;  3R0O A;  4JCR A;  2DKR A;  3P5M A;  4KFV A;  1ZOK A;  1WF8 A;  3T8B A;  2DC2 A;  3WKL A;  3GDU A;  4QFE A;  2KA9 A;  2OCS A;  3PEA A;  4JOP A;  2RRM A;  2Z9I A;  3LNY A;  1M5Z A;  1WHD A;  1MFG A;  2L4S A;  4G2R A;  1LCY A;  4Q3H A;  2DMZ A;  2LC6 A;  3PS4 A;  3PV4 A;  2D3T A;  5HFD A;  3OME A;  3I47 A;  2PKT A;  3R68 A;  4NXQ A;  3T89 A;  2F9I B;  1XNY A;  2J5G D;  5DKP A;  2MX6 A;  1HNO A;  2D90 A;  5E0S A;  2EJ5 A;  5HJ1 A;  2CE3 A;  2J5S A;  3SUZ A;  5EYZ A;  3RL7 A;  3PZK A;  2OSG A;  2QQ3 A;  4YYX A;  4WCZ A;  3KTG A;  2EDZ A;  4FB8 A;  1L6O A;  2X7Z A;  3DUP A;  4IC6 A;  1SZO A;  3CH8 A;  2D92 A;  3BEZ A;  2V90 A;  1SG4 A;  2O2T A;  1I16 A;  1V6B A;  5EZ0 A;  4PQW A;  1JXZ A;  4NAR A;  2M3M A;  1UEW A;  2DLS A;  4EMP A;  3K1R A;  4FLN A;  1TE0 A;  3ID1 A;  1XNV A;  3TLF A;  1UYR A;  2R4H A;  3GSL A;  1MC7 A;  2KOJ A;  4Z33 A;  5IL9 A;  2JIL A;  4JOE A;  4IZC A;  3NFL A;  4F47 A;  3PDZ A;  1OBZ A;  4OEO A;  2ZQR A;  4U19 A;  2PA1 A;  1U37 A;  1UIT A;  1SOT A;  1WH1 A;  5HEB A;  5HFC A;  3ZRT A;  4P2A B;  1FC6 A;  4ZDC A;  3RLE A;  2IWO A;  5HDY A;  5DUC A;  3MFM A;  4NMT A;  1VB7 A;  3BPU A;  3I18 A;  1VCW A;  2YUY A;  4E35 A;  5DTH A;  2W7R A;  1GQ4 A;  4JCT A;  2JSN A;  3GDS A;  3TT7 A;  3KTH A;  1UEQ A;  2OGP A;  2G2L A;  2K20 A;  4WZ8 B;  4OMR A;  3QYR A;  3TSZ A;  3KTK A;  3NJB A;  3D03 A;  3GMA A;  3STJ A;  4JCQ A;  4JOR A;  4LMM A;  3LNX A;  5HED A;  4ZDD A;  4U1A A;  4K78 A;  3SHW A;  4U0H A;  4HOP A;  4JJT A;  2AWX A;  1SOZ A;  3BPP A;  3IAV A;  1HNU A;  4HDT A;  2AWU A;  2HGA A;  3OU0 A;  2PBP A;  3IBB A;  4WYT A;  1VJ6 A;  1WDL A;  1N99 A;  3HRX A;  3R9T A;  2VZ5 A;  1Q7X A;  1WI2 A;  1QAV A;  4ELW A;  3MH4 A;  3ID2 A;  1K32 A;  3AXA A;  4JCS A;  3QO6 A;  4R2Z A;  3LAO A;  5HFF A;  1UEZ A;  1VA8 A;  2M0Z A;  4JYL A;  1N7E A;  4RCN A;  3TMH A;  3DOR A;  3CC0 A;  2AIN A;  1OBX A;  4ZDF A;  4ZDB A;  3V5I A;  1FC7 A;  3R6H A;  1WF7 A;  2EEI A;  4ELX A;  4RYF H;  2I4S A;  2WL7 A;  3Q0G A;  3SWX A;  1BFE A;  4NMP A;  2ZPL A;  4NMQ A;  1WHA A;  4JJ0 A;  5GND A;  4JYJ A;  3OTP A;  4L8N A;  2X24 A;  2FW2 A;  2E7K A;  4Z8J A;  4IZB A;  3CS0 A;  1T2M A;  4NMR A;  3H0U A;  2KG2 A;  4GVC A;  4I42 A;  2W4F A;  1PIX A;  1PJH A;  1BPL A;  2VSS A;  2JWE A;  3RL8 A;  2QBW A;  4RYF A;  3QXZ A;  2M0U A;  4FND A;  4EML A;  1ON3 A;  2EHR A;  2DXL A;  1I92 A;  3U9T B;  1KY9 A;  1UEP A;  2PPY A;  4GVD A;  3H0S A;  1Z87 A;  2KOH A;  3T8A A;  5E21 A;  2VSP A;  2A81 A;  2VSV A;  4KPK A;  4Q1I A;  2KRG A;  1KWA A;  3BPT A;  3NFK A;  3QDO A;  2A7S A;  1RJN A;  1NZY A;  4H11 A;  2L97 A;  2H2C A;  2KJK A;  1V5L A;  2QKT A;  1EF9 A;  5DL1 A;  2F9Y B;  5JBW A;  3QJM A;  1OBY A;  2K1Z A;  5ING A;  3K8X A;  4Q2Q A;  4JOF A;  2YT7 A;  4EDJ A;  5E22 A;  3SOE A;  4U18 A;  3P85 A;  2CSJ A;  2BYG A;  2ENO A;  3GMF A;  2IWN A;  5C90 A;  2I0I A;  3GCN A;  3DJ3 A;  3FDU A;  3PV5 A;  4QIJ A;  3TVU A;  2VSU E;  2I0L A;  2VSU F;  5DU8 A;  2QKU A;  1V5Q A;  2KBS A;  4DI1 A;  4HNK A;  3H81 A;  5FIF A;  4JFC A;  2V1W A;  5KDR B;  4MXI A;  2EXG A;  5H3J A;  1DUB A;  4NMO A;  4GHN A;  3ZWC A;  2QG1 A;  4JOK A;  1V1T A;  1XNW A;  1Q3P A;  5DU4 A;  3KTJ A;  1UM7 A;  3HLN 1;  4MI2 A;  5HUQ A;  4B3H A;  5C9G A;  3GHF A;  3O46 A;  1XO6 A;  1UJD A;  5E0S H;  2HE2 A;  3GKB A;  1RZX A;  3VQG A;  3QK8 A;  2UZC A;  1W9E A;  2DB5 A;  4E3B A;  1X5Q A;  2EDV A;  3IB9 A;  1VRG A;  1IHJ A;  4Q2P A;  1UFX A;  2OPG A;  3QJN A;  2IWQ A;  5E1Y A;  4ZDE A;  2Z17 A;  5E11 A;  5F67 A;  1W9Q A;  2KJP A;  2HE4 A;  1TQ3 A;  3FY5 A;  2IWP A;  4K3W A;  4NMV A;  2EGO A;  2Q35 A;  2VSU C;  4FZW A;  1BE9 A;  3TV5 A;  2P3W A;  3STA A;  2L4T A;  4Q2O A;  2CS5 A;  2YUB A;  4U0G A;  5D13 A;  5G1Q A;  3HE2 A;  5I7Z A;  3SLL A;  1K39 A;  2JXO A;  3E17 A;  4JC0 A;  3QRE A;  2KAW A;  3G64 A;  2REY A;  4JOH A;  3ST9 A;  2M0T A;  3L4F D;  2VPH A;  3TT6 A;  1QLC A;  2DAZ A;  5HF4 A;  4OG1 A;  2JOA A;  5GLJ A;  2VX2 A;  5A2P A;  1UYT A;  4ZU2 A;  4AMH A;  3GF3 A;  3JXT A;  4JVT A;  4JJ3 A;  2VRF A;  1N6E A;  2QT5 A;  4KFW A;  3M6N A;  3PE8 A;  1UIY A;  5JBX A;  1RGW A;  3SHU A;  4Q6S A;  2ZPM A;  2J5G A;  1J7X A;  3HPM A;  2M0V A;  4L6W A;  2YJG A;  2EGK A;  2J5I B;  1X8S A;  2ZL0 A;  1UF1 A;  1V62 A;  4WYO B;  4L1C A;  2FZS A;  1X6D A;  4KWB A;  2Q9V A;  3KDG A;  4IZD A;  2DLU A;  3GAB A;  2ZL2 A;  1QAV B;  2EJY A;  4GM2 A;  3FF6 A;  2NP9 A;  1GM1 A;  4JOT A;  3I1E A;  4O06 A;  1TP5 A;  3TRR A;  1IU2 A;  1G9O A;  2F6Q A;  3MH6 A;  3K50 A;  4K72 A;  1EY3 A;  2HW5 A;  3QMJ A;  1N7T A;  3KTI A;  4OLQ A;  2OMJ A;  1WJL A;  3EGG C;  4F8K A;  1WZ8 A;  4Z0M A;  2VWR A;  2EDP A;  4J2U A;  1WDM A;  2PDZ A;  4I52 A;  5E0N X;  1EF8 A;  4QII A;  3GF7 A;  1WG6 A;  3HIN A;  2UZF A;  2AWW A;  1FC9 A;  3SFJ A;  3MT6 A;  4JWV A;  4HC8 A;  3TSV A;  4K76 A;  2OZF A;  3WKM A;  4L8K A;  3Q1T A;  1XZ9 A;  2LA8 A;  2VSS E;  3CYY A;  2EEJ A;  3R69 A;  2EAQ A;  5DUF A;  5DU6 A;  1Y7O A;  2H2B A;  4FN7 A;  3K82 A;  3ZWB A;  3NJD A;  1X5R A;  2DM8 A;  2OQS A;  2X58 A;  3EGH C;  1N6D A;  3O5N A;  4KNP A;  1QAU A;  4AEJ A;  5FB8 C;  4Q2N A;  2WTB A;  1X9Z A;  2VSU A;  2LOB A;  4NXR A;  4Q6H A;  1NZY B;  2CSS A;  3L3S A;  3U9R B;  3QIK A;  2YTW A;  2CBY A;  3HVQ C;  3QE1 A;  4WYU A;  1NTE A;  4FZW C;  3I4W A;  5F3X A;  5FHT A;  1ON9 A;  4NXP A;  3GJ9 A;  3QKA A;  3KHF A;  5HEY A;  2KJD A;  2PKU A;  3Q7H A;  1U3B A;  5G1D A;  4OEP A;  4P0C A;  5KDR A;  4FN8 A;  1XX4 A;  3H02 A;  2ZO9 B;  2GTR A;  3VIV A;  2J5I I;  4NNQ A;  1MFL A;  3KDK A;  3QXI A;  3U9S B;  1O8U A;  3GDV A;  4MPA A;  3Q0J A;  1P1E A;  3JU1 A;  4K2N A;  2I6V A;  1Q51 A;  3V5E A;  4K75 A;  2F9I A;  3ZW8 A;  2Q3G A;  4Q0G A;  3CBX A;  1X5N A;  5B6L A;  2PZD A;  2EGN A;  3QGL A;  2R3Y A;  3R9S A;  3T88 A;  1UJU A;  1OZI A;  3LKE A;  5DTW A;  2H3M A;  2JRE A;  5DTP A;  2FN5 A;  4JOJ A;  4K29 A;  1ZUB A;  3H0J A;  2KV8 A;  2F5Y A;  5HFB A;  2J5I A;  3H0Q A;  4NNL A;  1VAE A;  3KZE A;  2DXN A;  2PG8 A;  2FE5 A;  4NNM A;  3MYB A;  1Y8T A;  3RST A;  5MGB A;  2KOM A;  3OT6 A;  4ELS A;  2FCF A;  3HP0 A;  2I04 A;  2W3P A;  3N6R B;  1YG8 A;  3TSW A;  1N6F A;  2Q34 A;  4JSB A;  1X0U A;  2YT8 A;  2ZOA A;  1Q3O A;  5G1S A;  2GEF A;  3KQF A;  4G69 A;  1MJ3 A;  5DZK H;  1WI4 A;  3ZW9 A;  2F0A A;  3DJ1 A;  3PGQ A;  3TVW A;  3M6M A;  1WDK A;  2D8I A;  5B42 A;  1X45 A;  3GGE A;  3NCV A;  4ASI A;  2EEH A;  2RCZ A;  2JIN A;  2FNE A;  4HOP B;  4K6Y A;  2VRE A;  2JIK A;  4LK5 A;  4JOG A;  1YG6 A;  2BZR A;  3ID3 A;  5IKL B;  3KZD A;  5INI A;  2LUI A;  4N6X A;  3BF0 A;  1YBO A;  3CBZ A;  1FCF A;  2I1N A;  3RRV A;  5ILB A;  4YLH A;  2PNT A;  5G1E A;  1W9O A;  1WFG A;  3MOY A;  1W2X A;  3T3W A;  3R9Q A;  2ZL4 A;  1TP3 A;  3OC7 A;  3TZ3 A;  3QWD A;  1UYV A;  5HET A;  3CBY A;  2ZL3 A;  1UYS A;  2FBM A;  1TYF A;  5E6P B;  3DIW A;  1RY4 A;  2OS6 A;  4OAJ A;  2F6I A;  2KQF A;  4XHV A;  5JXB A;  1U38 A;  1Y7N A;  1Z86 A;  4U0G H;  3R0H A;  2DJT A;  2KPK A;  5HF1 A;  2RRL A;  3DJA A;  1Q52 A;  3GLM A;  4MOU A;  1HZD A;  1NF3 C;  2A7K A;  4NEK A;  1P1D A;  3TDC A;  5CTB A;  4UU6 A;  1PDR A;  5DZK A;  1B8Q A;  1D5G A;  1WFV A;  5CTC A;  1UHP A;  4FNB A;  3PDV A;  5FUS A;  4JL7 A;  1U39 A;  1R6J A;  4E34 A;  3RSI A;  3PV2 A;  3VQF A;  1IU0 A;  2G5M B;  5INF A;  2KL1 A;  2C8T A;  4NMS A;  1KEF A;  1OD4 A;  4KD6 A;  4I4Z A;  2GZV A;  1DCI A;  1OD2 A;  4AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...