1FC9A

Photosystem ii d1 c-terminal processing protease
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
386
structure length
386
Chain Sequence
b'VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II D1 PROTEASE
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
total genus 114
structure length 386
sequence length 386
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fc9A02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fc9A01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fc9A03
5I7ZA 2EV8A 3SUZA 1KWAA 1O8UA 3GKBA 4FGMA 2F6IA 4WCZA 3H0UA 4NMVA 5HF1A 3ZW9A 1UM7A 1W9EA 3GJ9A 2VSUC 4U19A 5E11A 4ZDFA 3ZWBA 3ZW8A 1RY4A 5E6PB 4EMLA 2DKRA 3GCOA 1Q51A 4FNBA 1UITA 5HFCA 4OG1A 3GLMA 3H81A 5DTHA 3PV5A 3H0SA 3PE8A 5HEBA 4IZDA 2LA8A 1FC9A 2FE5A 3MFMA 4K29A 2DAZA 1UJUA 4RYFH 5G1SA 2C8TA 2EGOA 1YG6A 1VB7A 4NMSA 4Q1IA 1DCIA 1Q52A 2KOHA 1PJHA 2DM8A 4FNDA 3R69A 3H02A 4U18A 3JU1A 2E7KA 3TSZA 5MGBA 1WHDA 3R9TA 3U9RB 3KHFA 1IU2A 1N6DA 3HPKA 2OZFA 3PDVA 5DU8A 2KJKA 5CTCA 2VX2A 1U37A 2H3MA 4MOUA 2V1WA 5KJPA 4GM2A 4IZCA 3I4WA 2H2BA 1PIXA 3P2LA 1IU0A 2KPLA 3CBZA 4MPAA 3RSTA 3T8BA 1N7FA 3TZ3A 2F9YB 1KY9A 2JREA 2F9YA 3R0OA 4G2RA 3I1EA 2IWNA 5EZ0A 2LC6A 1RZXA 1V5QA 1ZUBA 3MH7A 2DMZA 3GSLA 2ZPMA 3BF0A 2RCZA 1QAUA 1TP3A 1P1EA 1TYFA 5DZKA 2BZRA 3KTGA 1ZOKA 3QJNA 1SOTA 4JOPA 4NMPA 1XZ9A 4JCRA 2VSUF 5HEYA 3PGQA 3L3SA 2EJYA 3LNYA 4JJTA 1YBOA 3WG5A 3HLN1 4Z8JA 2REYA 4ZDEA 3NGHA 1VRGA 1UFXA 2G5MB 1XNWA 1X5QA 2J5GD 2J5GA 1UEQA 1WJLA 2KJDA 2ZQQA 4JOGA 5E0SA 2X58A 5DU6A 3DJ1A 2VPHA 2PA1A 1IHJA 4E35A 3TSVA 3STJA 2W7RA 3CS0A 2K20A 4NMOA 1X45A 3I18A 3FDUA 1FCFA 2HGAA 2W4FA 5F67A 3K50A 3R9SA 1L6OA 1QAVB 4UU5A 4I4ZA 1QAVA 4F47A 4NXRA 4F8KA 4I52A 1UEWA 3SHUA 3ID2A 2Q34A 3ID1A 3QREA 3IB9A 3RSIA 1I16A 1N7TA 2Q2XA 4Q3HA 3QK8A 1UJVA 3TSWA 4O06A 3TRRA 2EDPA 2YUBA 1P1DA 2DLSA 1SZOA 2QT5A 2L4TA 3T89A 2L97A 3SOEA 1WH1A 1BE9A 2KYLA 2KRGA 4U0GH 5DUFA 4NMRA 4K75A 2QG1A 2IWQA 1JXZA 3HP0A 5JBWA 5E0NX 2EDZA 2M0VA 3GDUA 2F6QA 2A7SA 3RL8A 2EEIA 3WKMA 2F5YA 3QDOA 4ELWA 3TT7A 2JWEA 4KFVA 5E22A 1V6BA 2H3LA 3L4FD 4P2AB 4K3WA 1TP5A 3LAOA 4WZ8B 4L8NA 4OLQA 2VSSA 1V1TA 2KV8A 4Q2PA 5H3JA 1N6EA 2Q3GA 2YTWA 1XNVA 1X8SA 3ID3A 2OCSA 2PG8A 4U1AA 1RGRA 1RJMA 2HE4A 2EHRA 2D92A 4OMRA 2YT8A 3CC0A 3IBBA 3SWXA 2A81A 3BPUA 3QKAA 4JWVA 4IC6A 4JFCA 4GVCA 1XNYA 1RJNA 3KQFA 3KTIA 3VQGA 3PS4A 2QKUA 2ZL3A 2CSSA 1UYTA 1N6FA 2M0TA 4Q2OA 3K1RA 3OTPA 2J5SA 3LNXA 2BYGA 3TVUA 2KOMA 2WTBA 1Y7OA 3VQFA 3ISAA 5IKLB 5E0SH 2MX6A 5HF4A 2VSSE 5INFA 4ELXA 1FC6A 3NJBA 4Q2NA 5HFEA 5HFFA 4LMMA 3Q1TA 3ZRTA 3V5IA 2RRMA 4WYTA 3QGLA 2OMJA 2I04A 2KOJA 3PZKA 2EEHA 1UHPA 2JILA 2DJTA 3RL7A 3GDSA 3TMHA 2Q35A 2FW2A 5HFDA 2EGKA 1HZDA 3Q7HA 4WYOB 5C9GA 1WFVA 1TQ3A 3KTJA 3EGHC 2KG2A 1GM1A 3RLEA 2F0AA 2KBSA 2JINA 4YDPA 3U9SB 2OGPA 2DC2A 4NMQA 1XX4A 2M3MA 2DB5A 3GMAA 2YT7A 5DUCA 2P3WA 4FB8A 1UJDA 1U3BA 2L4SA 1HNUA 3BEZA 1U38A 1WIFA 5F3XA 2ZL4A 3P85A 4JCTA 1R6JA 3PV4A 3OMEA 3QXIA 3OU0A 4ZDCA 1VCWA 3GDVA 1N99A 3IAVA 4EDJA 3SLLA 1UEZA 2VREA 5B6LA 4FZWA 2LC7A 3MH4A 5HJ1A 3MOYA 4B3HA 5KDRB 1QLCA 3QJMA 5KDRA 2LOBA 4JCQA 2M10A 1EF8A 2D3TA 1V5LA 3O46A 5G1DA 2OSGA 2PBPA 2PPYA 3K82A 4PQWA 5INGA 4K76A 2JOAA 3DORA 1SG4A 1HNOA 3QMJA 4WYUA 3TLFA 5GNDA 3BPPA 1DUBA 3KTHA 1X5NA 4NXPA 5DTWA 1GQ5A 3B76A 2FN5A 3H0JA 1WDLA 1UIYA 4H11A 1Z87A 2WL7A 5FIFA 1RGWA 3MYBA 5HDYA 2J5IB 2OQSA 2ZPLA 2J5IA 2IWPA 1XO6A 2W3PA 4FJWD 4G69A 2QKTA 4NNMA 1UM1A 2I0LA 2J5II 3PEAA 4HOPA 3R0HA 1Q7XA 3G64A 4QIJA 2UZCA 1K32A 4QIIA 4JOTA 4U0HA 4DI1A 2NP9A 4NEKA 2VSVA 3RRVA 3TV5A 4K6YA 1Y7NA 4YLHA 3MT6A 2PZDA 3JXTA 2QBWA 4NNLA 2VSUA 4Q2QA 1WG6A 2V90A 3PV2A 4E34A 3AXAA 2IEXA 3GF7A 4Q6HA 4JOHA 1D5GA 3ST9A 4FN8A 4JSBA 5A2PA 2D8IA 5JXBA 2ZQRA 2FZSA 4L8KA 3I47A 5D13A 4I42A 1G9OA 3NJDA 2A7KA 1WF7A 4Q0GA 4GVDA 2EEJA 4NMTA 3ZWAA 2HW5A 2G2LA 2QKVA 1VJ6A 4JOKA 4JOEA 3SFJA 5DZKH 5G1RA 5HFBA 1NTEA 2KAWA 5FB8C 2DUBA 1MJ3A 2Q9VA 2VRFA 5JBXA 2D90A 1WF8A 1X5RA 4E3BA 2VSUE 4NNQA 2I1NA 3CBXA 4JVTA 4RI0A 4NXQA 1X6DA 1WZ8A 1UF1A 4B3IA 3HRXA 1K39A 3TDCA 2UZFA 1EF9A 1J7XA 3PDZA 5HEDA 5FUSA 1U39A 1UEPA 1OD4A 1WI2A 3R6HA 1NF3C 4N6XA 4HNKA 1MFGA 4KWBA 2KL1A 3EGGC 4AMHA 3ID4A 1UYVA 2AWWA 1I92A 2FNEA 1OBXA 2AINA 2VSPA 2YUYA 3HVQC 4KFWA 1VA8A 1W9QA 4YYXA 5FHTA 2AWUA 1PDRA 2JXOA 2FCFA 2Z9IA 4KNPA 3P5MA 4K72A 4EMPA 3QYRA 2DLUA 3GF3A 2Z17A 3QE1A 1ON9A 4MXIA 3E17A 2KJPA 1WHAA 4MI2A 2R3YA 3CYYA 4ZDDA 1OBZA 2I0IA 3DIWA 5E1YA 2QQ3A 3WKLA 1Y8TA 1TG6A 3OT6A 4R2ZA 4KD6A 2I6VA 4JOFA 2KA9A 3FF6A 1FC7A 2GZVA 3DJ3A 4U0GA 3NFLA 3FY5A 2MHOA 2EEGA 4ASIA 2AWXA 5CTBA 2EDVA 1KEFA 4Z33A 4K78A 2ENOA 1SOZA 3R9QA 4B3JA 5C90A 1WDKA 2FBMA 4OAJA 4IZBA 2O2TA 1MFLA 3CH8A 2DEOA 2VWRA 3QIKA 4JYJA 1VAEA 1ON3A 2EJ5A 1OBYA 1V62A 1Q3PA 2X7ZA 1LCYA 4LK5A 4Q6SA 4JORA 4ZU2A 3VIVA 3MH6A 2PNTA 1UYSA 2CBYA 2K1ZA 4HC8A 1Z86A 1NZYB 4L6WA 1NZYA 2ZL0A 2H2CA 2KPKA 4OEPA 1MC7A 5G1QA 3T88A 2I4SA 2CE3A 1N7EA 1GQ4A 5E21A 2HE2A 2F9IB 2F9IA 2X24A 3OC7A 1BFEA 2CS5A 3GGEA 4RYFA 3HE2A 1W9OA 3DJAA 1UYRA 1W2XA 3M6MA 1TE0A 3SHWA 3Q0GA 3TT6A 4EMMA 2VSSF 5INIA 1M5ZA 3KTKA 3HINA 4KPKA 5DL1A 3STAA 2OPGA 1WI4A 1B8QA 3LKEA 4JL7A 1Q3OA 3H0QA 4HOPB 4FZWC 3T3WA 1YG8A 5DU4A 1OZIA 2R4HA 2ZL2A 3QO6A 1EY3A 1X0UA 4GHNA 1WDMA 3KZEA 3ZWCA 3QXZA 5GLJA 2CSJA 2PKTA 1WFGA 3N6RB 3HPMA 4OEOA 2VZ5A 4JCSA 3TVWA 1OD2A 3V5EA 3KZDA 2EGNA 1T2MA 3R68A 2OS6A 5EYZA 4JYLA 2EAQA 2PDZA 4JOJA 5DTPA 4ELSA 4K2NA 3U9TB 4REYA 3K8XA 2LUIA 2PKUA 3CBYA 4ZDBA 5G1EA 3M6NA 2JIKA 2M0UA 5DKPA 3O5NA 4P0CA 2KQFA 3NFKA 2EXGA 3QWDA 2GTRA 2M0ZA 3GCNA 4Z0MA 4XHVA 3Q0JA 4QFEA 3T8AA 4UU6A 5HETA 2IWOA 4RCNA 4FN7A
chains in the Genus database with same CATH superfamily
5I7ZA 2EV8A 3SUZA 1KWAA 1O8UA 3GKBA 4FGMA 2F6IA 4WCZA 3H0UA 4NMVA 5HF1A 3ZW9A 1UM7A 1W9EA 3GJ9A 2VSUC 4U19A 5E11A 4ZDFA 3ZWBA 3ZW8A 1RY4A 5E6PB 4EMLA 2DKRA 2DXLA 3F43A 4AE2A 3GCOA 3AGDA 1Q51A 4FNBA 1UITA 5HFCA 4OG1A 3GLMA 3OIRA 2GEFA 3H81A 5DTHA 3PV5A 3H0SA 3PE8A 5HEBA 4IZDA 2LA8A 1FC9A 2FE5A 3MFMA 4K29A 2DAZA 1UJUA 2YJGA 4RYFH 5G1SA 2C8TA 2EGOA 1YG6A 4FLNA 5EUWA 1VB7A 4NMSA 4Q1IA 1DCIA 1Q52A 2KOHA 3MOGA 1PJHA 2DM8A 4FNDA 3R69A 3H02A 3OIZA 4U18A 3JU1A 2E7KA 1H4YA 3TSZA 5MGBA 3GVKA 1WHDA 3R9TA 3U9RB 3KHFA 1IU2A 1N6DA 3HPKA 2OZFA 3PDVA 5DU8A 2KJKA 5CTCA 2VX2A 1U37A 2H3MA 4MOUA 2V1WA 5KJPA 4GM2A 4IZCA 3I4WA 2H2BA 1PIXA 3P2LA 3IF5A 1IU0A 2KPLA 3CBZA 4MPAA 1H4ZA 3IH9A 1N7FA 3RSTA 3T8BA 3TZ3A 2F9YB 1KY9A 2JREA 2F9YA 3R0OA 4G2RA 3I1EA 2IWNA 5EZ0A 2LC6A 1RZXA 1V5QA 1ZUBA 1AUZA 3MH7A 2DMZA 3GSLA 2ZPMA 3BF0A 2RCZA 1QAUA 1TP3A 1P1EA 2RRLA 1TYFA 2BZRA 3KTGA 1ZOKA 5DZKA 3QJNA 1SOTA 4JOPA 4NMPA 1XZ9A 4JCRA 2VSUF 5HEYA 3LLOA 3PGQA 3L3SA 2EJYA 2VY9A 3LNYA 4JJTA 1YBOA 3WG5A 3HLN1 4Z8JA 2REYA 4ZDEA 3NGHA 1VRGA 1UFXA 2G5MB 1XNWA 4J2UA 1X5QA 2J5GD 2KA5A 3EH7A 2J5GA 1UEQA 1WJLA 2KJDA 3LDFA 3NY7A 2ZQQA 4JOGA 5E0SA 2X58A 5DU6A 3DJ1A 2VPHA 2PA1A 1IHJA 4E35A 3TSVA 4JC0A 3STJA 2W7RA 3CS0A 2K20A 4NMOA 1X45A 3I18A 3FDUA 1FCFA 3D3UA 3NCVA 2HGAA 2W4FA 5F67A 3K50A 3R9SA 1L6OA 1QAVB 4UU5A 4I4ZA 1QAVA 4F47A 4NXRA 4F8KA 4I52A 1UEWA 3SHUA 3ID2A 3IHBA 2Q34A 3ID1A 3QREA 3IB9A 3RSIA 1I16A 1N7TA 2Q2XA 4Q3HA 5HUQA 3QK8A 1UJVA 3TSWA 2KLNA 4O06A 3MGLA 3TRRA 4HYLA 2EDPA 2YUBA 1P1DA 2DLSA 1SZOA 2QT5A 2L4TA 3T89A 2L97A 3SOEA 1WH1A 1BE9A 2KYLA 2KRGA 4U0GH 5DUFA 4NMRA 4K75A 2QG1A 2IWQA 1JXZA 3HP0A 5JBWA 5E0NX 2EDZA 2M0VA 3GDUA 2F6QA 2A7SA 3RL8A 2EEIA 3WKMA 2F5YA 3QDOA 4ELWA 3TT7A 2JWEA 4KFVA 5E22A 1V6BA 2H3LA 3L4FD 4P2AB 4K3WA 1TP5A 3LAOA 4WZ8B 4L8NA 4DMGA 4OLQA 2VSSA 5EZBA 1V1TA 2KV8A 4Q2PA 4QTPA 5H3JA 1N6EA 2Q3GA 2YTWA 3D03A 1X8SA 1XNVA 3ID3A 2OCSA 2PG8A 4U1AA 1RGRA 1RJMA 2HE4A 2EHRA 2D92A 3VSEA 4OMRA 2YT8A 3CC0A 3IBBA 3SWXA 2A81A 3BPUA 3QKAA 4JWVA 4IC6A 4JFCA 4GVCA 5ILBA 1XNYA 1RJNA 3KQFA 3KTIA 3VQGA 3PS4A 2QKUA 2ZL3A 2CSSA 1UYTA 1N6FA 1V0FA 2M0TA 4Q2OA 3K1RA 3OTPA 2J5SA 3LNXA 2BYGA 3TVUA 2KOMA 2WTBA 1WXWA 1Y7OA 3VQFA 3ISAA 5IKLB 5E0SH 2MX6A 5HF4A 2VSSE 4XS5A 5INFA 4ELXA 1FC6A 3NJBA 4Q2NA 5HFEA 5HFFA 4LMMA 3Q1TA 3ZRTA 3V5IA 2RRMA 4WYTA 3QGLA 2OMJA 2I04A 2KOJA 3PZKA 2EEHA 1UHPA 2JILA 2DJTA 3RL7A 3GDSA 3TMHA 2Q35A 2FW2A 3T6OA 5HFDA 2EGKA 1HZDA 3Q7HA 4WYOB 5C9GA 1WFVA 1TQ3A 3KTJA 1WXXA 3EGHC 2KG2A 1GM1A 3RLEA 2F0AA 1T6RA 3BPTA 2KBSA 2JINA 4YDPA 4AEJA 3U9SB 2OGPA 2DC2A 4NMQA 1XX4A 1THNB 2M3MA 2DB5A 3GMAA 2YT7A 5DUCA 2P3WA 4FB8A 1UJDA 1U3BA 2L4SA 1HNUA 4DGHA 3BEZA 1U38A 1WIFA 5F3XA 5EUUA 2ZL4A 3P85A 4JCTA 1R6JA 3PV4A 3OMEA 3QXIA 3OU0A 4ZDCA 1VCWA 3GDVA 1N99A 3IAVA 4EDJA 3SLLA 1SBOA 1UEZA 1TIDB 5B6LA 2VREA 4FZWA 2LC7A 3MH4A 5HJ1A 3ZTBA 3MOYA 4B3HA 5KDRB 1QLCA 3QJMA 5KDRA 2LOBA 4JCQA 2M10A 1EF8A 2D3TA 1V5LA 3O46A 5G1DA 2OSGA 5B42A 2PBPA 2PPYA 3K82A 4PQWA 5INGA 3JU4A 4K76A 2JOAA 3DORA 1SG4A 1HNOA 5IL9A 3QMJA 3GVLA 4WYUA 3TLFA 5GNDA 2CWWA 2ZOAA 3BPPA 3V97A 3GK7A 1DUBA 3KTHA 1X5NA 4NXPA 5DTWA 1GQ5A 3B76A 2FN5A 3H0JA 1WDLA 1UIYA 4H11A 1Z87A 2WL7A 1VC1A 5FIFA 1RGWA 3MYBA 3DUPA 5HDYA 2J5IB 2OQSA 2ZPLA 2J5IA 2IWPA 3IHAA 1XO6A 1BPLA 2W3PA 4FJWD 4G69A 2QKTA 4NNMA 1UM1A 2I0LA 2J5II 3PEAA 4HOPA 3R0HA 1Q7XA 3G64A 4QIJA 2UZCA 1K32A 4QIIA 4JOTA 4U0HA 4DI1A 2NP9A 4NEKA 2VSVA 3RRVA 3TV5A 4K6YA 1Y7NA 4YLHA 3MT6A 2PZDA 3JXTA 2QBWA 4NNLA 1TILB 3C0KA 2VSUA 4Q2QA 1WG6A 2V90A 3PV2A 4E34A 3AXAA 2IEXA 3GF7A 2ZO9B 4Q6HA 4JOHA 3GMFA 1D5GA 3ST9A 4FN8A 4JSBA 5A2PA 2D8IA 5JXBA 2ZQRA 2FZSA 1TH8B 4L8KA 3I47A 5D13A 4DGFA 2DXNA 4I42A 5EUXA 1G9OA 2JSNA 2A7KA 3ZXNA 3NJDA 1WF7A 4Q0GA 4GVDA 2EEJA 4NMTA 3ZWAA 4L1CA 2HW5A 2G2LA 2QKVA 1VJ6A 4JOKA 4JOEA 3SFJA 5DZKH 5G1RA 5HFBA 1NTEA 2KAWA 5FB8C 2DUBA 3KDKA 2Q9VA 2VRFA 1H4XA 1MJ3A 2D90A 5JBXA 1WF8A 1X5RA 4E3BA 2VSUE 4NNQA 2I1NA 3CBXA 4JVTA 4RI0A 4NXQA 1X6DA 1WZ8A 1UF1A 4B3IA 3LKLA 3HRXA 1K39A 3TDCA 2AS0A 2UZFA 1EF9A 1J7XA 3PDZA 5HEDA 5FUSA 1U39A 1UEPA 1OD4A 1WI2A 3R6HA 1NF3C 4N6XA 4HNKA 1MFGA 3AGEA 4KWBA 2KL1A 4HIZA 3EGGC 3IH8A 4AMHA 3ID4A 1UYVA 2AWWA 1I92A 2FNEA 1OBXA 2AINA 2VSPA 2YUYA 3HVQC 4KFWA 1VA8A 1W9QA 4YYXA 5FHTA 2AWUA 1PDRA 2JXOA 2FCFA 2Z9IA 4KNPA 3P5MA 4K72A 4EMPA 3QYRA 2DLUA 3GF3A 2Z17A 3QE1A 1ON9A 4MXIA 3E17A 4HDTA 2KJPA 1WHAA 3GHFA 2R3YA 3CYYA 4MI2A 4ZDDA 1OBZA 2I0IA 3DIWA 5E1YA 2QQ3A 3WKLA 1Y8TA 1TG6A 3OT6A 4R2ZA 4KD6A 2I6VA 4JOFA 2KA9A 3FF6A 1FC7A 2GZVA 3DJ3A 4U0GA 3NFLA 3FY5A 3GVJA 2MHOA 2EEGA 4ASIA 2AWXA 5CTBA 2EDVA 1KEFA 4Z33A 4K78A 2ENOA 1SOZA 3R9QA 4B3JA 5C90A 1WDKA 2FBMA 4OAJA 4IZBA 2O2TA 5EUSA 1MFLA 3CH8A 2DEOA 2VWRA 3QIKA 4JYJA 4JJ0A 1VAEA 3GABA 1ON3A 2EJ5A 1OBYA 1V62A 1Q3PA 2X7ZA 4NARA 1LCYA 4LK5A 4Q6SA 4JORA 1X9ZA 4ZU2A 3VIVA 3MH6A 2PNTA 1UYSA 2CBYA 2K1ZA 4HC8A 1Z86A 1NZYB 4L6WA 1NZYA 2ZL0A 2H2CA 2KPKA 4OEPA 1MC7A 5G1QA 3T88A 2I4SA 2CE3A 1N7EA 1GQ4A 5E21A 2HE2A 2F9IB 2F9IA 3KDGA 3QDQA 2X24A 3OC7A 1BFEA 2CS5A 3GGEA 4RYFA 3HE2A 1W9OA 3DJAA 1UYRA 1W2XA 3M6MA 1TE0A 3SHWA 3Q0GA 3TT6A 4EMMA 2VSSF 1HF2A 5INIA 1M5ZA 3KTKA 3HINA 4KPKA 5DL1A 3STAA 2OPGA 1WI4A 1B8QA 3LKEA 4JL7A 1Q3OA 3H0QA 4HOPB 4FZWC 3T3WA 1YG8A 5DU4A 1OZIA 2R4HA 2ZL2A 5EUZA 3QO6A 1EY3A 1X0UA 4GHNA 1WDMA 3KZEA 3ZWCA 3QXZA 5GLJA 3V8VA 2CSJA 2PKTA 1WFGA 3N6RB 3HPMA 1BUZA 4OEOA 2VZ5A 4JCSA 1V0EA 3TVWA 1OD2A 3V5EA 3KZDA 2EGNA 1T2MA 3R68A 2OS6A 2OASA 5EYZA 4JYLA 2EAQA 2PDZA 4JOJA 5DTPA 4ELSA 4K2NA 3U9TB 4REYA 3K8XA 2LUIA 2PKUA 3CBYA 4ZDBA 5G1EA 3M6NA 2JIKA 2M0UA 5DKPA 3O5NA 4P0CA 2B78A 2KQFA 3NFKA 2EXGA 3QWDA 2GTRA 2M0ZA 3GCNA 4Z0MA 4XHVA 4JJ3A 3Q0JA 4QFEA 3T8AA 4UU6A 5HETA 2IWOA 4RCNA 4FN7A
chains in the Genus database with same CATH topology
5I7ZA 2EV8A 3SUZA 1KWAA 1O8UA 3GKBA 4FGMA 2F6IA 4WCZA 3H0UA 4NMVA 5HF1A 3ZW9A 1UM7A 1W9EA 3GJ9A 2VSUC 4U19A 5E11A 4ZDFA 3ZWBA 3ZW8A 1RY4A 5E6PB 4EMLA 2DKRA 2DXLA 4AE2A 3GCOA 1Q51A 4FNBA 1UITA 5HFCA 4OG1A 3GLMA 2GEFA 3H81A 5DTHA 3PV5A 3H0SA 3PE8A 5HEBA 4IZDA 2LA8A 1FC9A 2FE5A 3MFMA 4K29A 2DAZA 1UJUA 2YJGA 4RYFH 5G1SA 2C8TA 2EGOA 1YG6A 4FLNA 1VB7A 4NMSA 4Q1IA 1DCIA 1Q52A 2KOHA 3MOGA 1PJHA 2DM8A 4FNDA 3R69A 3H02A 4U18A 3JU1A 2E7KA 3TSZA 5MGBA 1WHDA 3R9TA 3U9RB 3KHFA 1IU2A 1N6DA 3HPKA 2OZFA 3PDVA 5DU8A 2KJKA 5CTCA 2VX2A 1U37A 2H3MA 4MOUA 2V1WA 5KJPA 4GM2A 4IZCA 3I4WA 2H2BA 1PIXA 3P2LA 1IU0A 2KPLA 3CBZA 4MPAA 3RSTA 3T8BA 1N7FA 3TZ3A 2F9YB 1KY9A 2JREA 2F9YA 3R0OA 4G2RA 3I1EA 2IWNA 5EZ0A 2LC6A 1RZXA 1V5QA 1ZUBA 3MH7A 2DMZA 3GSLA 2ZPMA 3BF0A 2RCZA 1QAUA 1TP3A 1P1EA 2RRLA 1TYFA 2BZRA 3KTGA 1ZOKA 5DZKA 3QJNA 1SOTA 4JOPA 4NMPA 1XZ9A 4JCRA 2VSUF 5HEYA 3PGQA 3L3SA 2EJYA 3LNYA 4JJTA 1YBOA 3WG5A 3HLN1 4Z8JA 2REYA 4ZDEA 3NGHA 1VRGA 1UFXA 2G5MB 1XNWA 4J2UA 1X5QA 2J5GD 2J5GA 1UEQA 1WJLA 2KJDA 2ZQQA 4JOGA 5E0SA 2X58A 5DU6A 3DJ1A 2VPHA 2PA1A 1IHJA 4E35A 3TSVA 4JC0A 3STJA 2W7RA 3CS0A 2K20A 4NMOA 1X45A 3I18A 3FDUA 1FCFA 3NCVA 2HGAA 2W4FA 5F67A 3K50A 3R9SA 1L6OA 1QAVB 4UU5A 4I4ZA 1QAVA 4F47A 4NXRA 4F8KA 4I52A 1UEWA 3SHUA 3ID2A 2Q34A 3ID1A 3QREA 3IB9A 3RSIA 1I16A 1N7TA 2Q2XA 4Q3HA 5HUQA 3QK8A 1UJVA 3TSWA 4O06A 3TRRA 2EDPA 2YUBA 1P1DA 2DLSA 1SZOA 2QT5A 2L4TA 3T89A 2L97A 3SOEA 1WH1A 1BE9A 2KYLA 2KRGA 4U0GH 5DUFA 4NMRA 4K75A 2QG1A 2IWQA 1JXZA 3HP0A 5JBWA 5E0NX 2EDZA 2M0VA 3GDUA 2F6QA 2A7SA 3RL8A 2EEIA 3WKMA 2F5YA 3QDOA 4ELWA 3TT7A 2JWEA 4KFVA 5E22A 1V6BA 2H3LA 3L4FD 4P2AB 4K3WA 1TP5A 3LAOA 4WZ8B 4L8NA 4OLQA 2VSSA 1V1TA 2KV8A 4Q2PA 5H3JA 1N6EA 2Q3GA 2YTWA 3D03A 1X8SA 1XNVA 3ID3A 2OCSA 2PG8A 4U1AA 1RGRA 1RJMA 2HE4A 2EHRA 2D92A 4OMRA 2YT8A 3CC0A 3IBBA 3SWXA 2A81A 3BPUA 3QKAA 4JWVA 4IC6A 4JFCA 4GVCA 5ILBA 1XNYA 1RJNA 3KQFA 3KTIA 3VQGA 3PS4A 2QKUA 2ZL3A 2CSSA 1UYTA 1N6FA 2M0TA 4Q2OA 3K1RA 3OTPA 2J5SA 3LNXA 2BYGA 3TVUA 2KOMA 2WTBA 1Y7OA 3VQFA 3ISAA 5IKLB 5E0SH 2MX6A 5HF4A 2VSSE 5INFA 4ELXA 1FC6A 3NJBA 4Q2NA 5HFEA 5HFFA 4LMMA 3Q1TA 3ZRTA 3V5IA 2RRMA 4WYTA 3QGLA 2OMJA 2I04A 2KOJA 3PZKA 2EEHA 1UHPA 2JILA 2DJTA 3RL7A 3GDSA 3TMHA 2Q35A 2FW2A 5HFDA 2EGKA 1HZDA 3Q7HA 4WYOB 5C9GA 1WFVA 1TQ3A 3KTJA 3EGHC 2KG2A 1GM1A 3RLEA 2F0AA 3BPTA 2KBSA 2JINA 4YDPA 4AEJA 3U9SB 2OGPA 2DC2A 4NMQA 1XX4A 2M3MA 2DB5A 3GMAA 2YT7A 5DUCA 2P3WA 4FB8A 1UJDA 1U3BA 2L4SA 1HNUA 3BEZA 1U38A 1WIFA 5F3XA 2ZL4A 3P85A 4JCTA 1R6JA 3PV4A 3OMEA 3QXIA 3OU0A 4ZDCA 1VCWA 3GDVA 1N99A 3IAVA 4EDJA 3SLLA 1UEZA 2VREA 5B6LA 4FZWA 2LC7A 3MH4A 5HJ1A 3MOYA 4B3HA 5KDRB 1QLCA 3QJMA 5KDRA 2LOBA 4JCQA 2M10A 1EF8A 2D3TA 1V5LA 3O46A 5G1DA 2OSGA 5B42A 2PBPA 2PPYA 3K82A 4PQWA 5INGA 4K76A 2JOAA 3DORA 1SG4A 1HNOA 5IL9A 3QMJA 4WYUA 3TLFA 5GNDA 2ZOAA 3BPPA 1DUBA 3KTHA 1X5NA 4NXPA 5DTWA 1GQ5A 3B76A 2FN5A 3H0JA 1WDLA 1UIYA 4H11A 1Z87A 2WL7A 5FIFA 1RGWA 3MYBA 3DUPA 5HDYA 2J5IB 2OQSA 2ZPLA 2J5IA 2IWPA 1XO6A 1BPLA 2W3PA 4FJWD 4G69A 2QKTA 4NNMA 1UM1A 2I0LA 2J5II 3PEAA 4HOPA 3R0HA 1Q7XA 3G64A 4QIJA 2UZCA 1K32A 4QIIA 4JOTA 4U0HA 4DI1A 2NP9A 4NEKA 2VSVA 3RRVA 3TV5A 4K6YA 1Y7NA 4YLHA 3MT6A 2PZDA 3JXTA 2QBWA 4NNLA 2VSUA 4Q2QA 1WG6A 2V90A 3PV2A 4E34A 3AXAA 2IEXA 3GF7A 2ZO9B 4Q6HA 4JOHA 3GMFA 1D5GA 3ST9A 4FN8A 4JSBA 5A2PA 2D8IA 5JXBA 2ZQRA 2FZSA 4L8KA 3I47A 5D13A 2DXNA 4I42A 1G9OA 2JSNA 2A7KA 3NJDA 1WF7A 4Q0GA 4GVDA 2EEJA 4NMTA 3ZWAA 4L1CA 2HW5A 2G2LA 2QKVA 1VJ6A 4JOKA 4JOEA 3SFJA 5DZKH 5G1RA 5HFBA 1NTEA 2KAWA 5FB8C 2DUBA 3KDKA 2Q9VA 2VRFA 1MJ3A 5JBXA 2D90A 1WF8A 1X5RA 4E3BA 2VSUE 4NNQA 2I1NA 3CBXA 4JVTA 4RI0A 4NXQA 1X6DA 1WZ8A 1UF1A 4B3IA 3HRXA 1K39A 3TDCA 2UZFA 1EF9A 1J7XA 3PDZA 5HEDA 5FUSA 1U39A 1UEPA 1OD4A 1WI2A 3R6HA 1NF3C 4N6XA 4HNKA 1MFGA 4KWBA 2KL1A 3EGGC 4AMHA 3ID4A 1UYVA 2AWWA 1I92A 2FNEA 1OBXA 2AINA 2VSPA 2YUYA 3HVQC 4KFWA 1VA8A 1W9QA 4YYXA 5FHTA 2AWUA 1PDRA 2JXOA 2FCFA 2Z9IA 4KNPA 3P5MA 4K72A 4EMPA 3QYRA 2DLUA 3GF3A 2Z17A 3QE1A 1ON9A 4MXIA 3E17A 4HDTA 2KJPA 1WHAA 3GHFA 2R3YA 3CYYA 4MI2A 4ZDDA 1OBZA 2I0IA 3DIWA 5E1YA 2QQ3A 3WKLA 1Y8TA 1TG6A 3OT6A 4R2ZA 4KD6A 2I6VA 4JOFA 2KA9A 3FF6A 1FC7A 2GZVA 3DJ3A 4U0GA 3NFLA 3FY5A 2MHOA 2EEGA 4ASIA 2AWXA 5CTBA 2EDVA 1KEFA 4Z33A 4K78A 2ENOA 1SOZA 3R9QA 4B3JA 5C90A 1WDKA 2FBMA 4OAJA 4IZBA 2O2TA 1MFLA 3CH8A 2DEOA 2VWRA 3QIKA 4JYJA 4JJ0A 1VAEA 3GABA 1ON3A 2EJ5A 1OBYA 1V62A 1Q3PA 2X7ZA 4NARA 1LCYA 4LK5A 4Q6SA 4JORA 1X9ZA 4ZU2A 3VIVA 3MH6A 2PNTA 1UYSA 2CBYA 2K1ZA 4HC8A 1Z86A 1NZYB 4L6WA 1NZYA 2ZL0A 2H2CA 2KPKA 4OEPA 1MC7A 5G1QA 3T88A 2I4SA 2CE3A 1N7EA 1GQ4A 5E21A 2HE2A 2F9IB 2F9IA 3KDGA 2X24A 3OC7A 1BFEA 2CS5A 3GGEA 4RYFA 3HE2A 1W9OA 3DJAA 1UYRA 1W2XA 3M6MA 1TE0A 3SHWA 3Q0GA 3TT6A 4EMMA 2VSSF 5INIA 1M5ZA 3KTKA 3HINA 4KPKA 5DL1A 3STAA 2OPGA 1WI4A 1B8QA 3LKEA 4JL7A 1Q3OA 3H0QA 4HOPB 4FZWC 3T3WA 1YG8A 5DU4A 1OZIA 2R4HA 2ZL2A 3QO6A 1EY3A 1X0UA 4GHNA 1WDMA 3KZEA 3ZWCA 3QXZA 5GLJA 2CSJA 2PKTA 1WFGA 3N6RB 3HPMA 4OEOA 2VZ5A 4JCSA 3TVWA 1OD2A 3V5EA 3KZDA 2EGNA 1T2MA 3R68A 2OS6A 5EYZA 4JYLA 2EAQA 2PDZA 4JOJA 5DTPA 4ELSA 4K2NA 3U9TB 4REYA 3K8XA 2LUIA 2PKUA 3CBYA 4ZDBA 5G1EA 3M6NA 2JIKA 2M0UA 5DKPA 3O5NA 4P0CA 2KQFA 3NFKA 2EXGA 3QWDA 2GTRA 2M0ZA 3GCNA 4Z0MA 4XHVA 4JJ3A 3Q0JA 4QFEA 3T8AA 4UU6A 5HETA 2IWOA 4RCNA 4FN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I7Z A;  2EV8 A;  3SUZ A;  1KWA A;  1O8U A;  3GKB A;  4FGM A;  2F6I A;  4WCZ A;  3H0U A;  4NMV A;  5HF1 A;  3ZW9 A;  1UM7 A;  1W9E A;  3GJ9 A;  2VSU C;  4U19 A;  5E11 A;  4ZDF A;  3ZWB A;  3ZW8 A;  1RY4 A;  5E6P B;  4EML A;  2DKR A;  3GCO A;  1Q51 A;  4FNB A;  1UIT A;  5HFC A;  4OG1 A;  3GLM A;  3H81 A;  5DTH A;  3PV5 A;  3H0S A;  3PE8 A;  5HEB A;  4IZD A;  2LA8 A;  1FC9 A;  2FE5 A;  3MFM A;  4K29 A;  2DAZ A;  1UJU A;  4RYF H;  5G1S A;  2C8T A;  2EGO A;  1YG6 A;  1VB7 A;  4NMS A;  4Q1I A;  1DCI A;  1Q52 A;  2KOH A;  1PJH A;  2DM8 A;  4FND A;  3R69 A;  3H02 A;  4U18 A;  3JU1 A;  2E7K A;  3TSZ A;  5MGB A;  1WHD A;  3R9T A;  3U9R B;  3KHF A;  1IU2 A;  1N6D A;  3HPK A;  2OZF A;  3PDV A;  5DU8 A;  2KJK A;  5CTC A;  2VX2 A;  1U37 A;  2H3M A;  4MOU A;  2V1W A;  5KJP A;  4GM2 A;  4IZC A;  3I4W A;  2H2B A;  1PIX A;  3P2L A;  1IU0 A;  2KPL A;  3CBZ A;  4MPA A;  3RST A;  3T8B A;  1N7F A;  3TZ3 A;  2F9Y B;  1KY9 A;  2JRE A;  2F9Y A;  3R0O A;  4G2R A;  3I1E A;  2IWN A;  5EZ0 A;  2LC6 A;  1RZX A;  1V5Q A;  1ZUB A;  3MH7 A;  2DMZ A;  3GSL A;  2ZPM A;  3BF0 A;  2RCZ A;  1QAU A;  1TP3 A;  1P1E A;  1TYF A;  5DZK A;  2BZR A;  3KTG A;  1ZOK A;  3QJN A;  1SOT A;  4JOP A;  4NMP A;  1XZ9 A;  4JCR A;  2VSU F;  5HEY A;  3PGQ A;  3L3S A;  2EJY A;  3LNY A;  4JJT A;  1YBO A;  3WG5 A;  3HLN 1;  4Z8J A;  2REY A;  4ZDE A;  3NGH A;  1VRG A;  1UFX A;  2G5M B;  1XNW A;  1X5Q A;  2J5G D;  2J5G A;  1UEQ A;  1WJL A;  2KJD A;  2ZQQ A;  4JOG A;  5E0S A;  2X58 A;  5DU6 A;  3DJ1 A;  2VPH A;  2PA1 A;  1IHJ A;  4E35 A;  3TSV A;  3STJ A;  2W7R A;  3CS0 A;  2K20 A;  4NMO A;  1X45 A;  3I18 A;  3FDU A;  1FCF A;  2HGA A;  2W4F A;  5F67 A;  3K50 A;  3R9S A;  1L6O A;  1QAV B;  4UU5 A;  4I4Z A;  1QAV A;  4F47 A;  4NXR A;  4F8K A;  4I52 A;  1UEW A;  3SHU A;  3ID2 A;  2Q34 A;  3ID1 A;  3QRE A;  3IB9 A;  3RSI A;  1I16 A;  1N7T A;  2Q2X A;  4Q3H A;  3QK8 A;  1UJV A;  3TSW A;  4O06 A;  3TRR A;  2EDP A;  2YUB A;  1P1D A;  2DLS A;  1SZO A;  2QT5 A;  2L4T A;  3T89 A;  2L97 A;  3SOE A;  1WH1 A;  1BE9 A;  2KYL A;  2KRG A;  4U0G H;  5DUF A;  4NMR A;  4K75 A;  2QG1 A;  2IWQ A;  1JXZ A;  3HP0 A;  5JBW A;  5E0N X;  2EDZ A;  2M0V A;  3GDU A;  2F6Q A;  2A7S A;  3RL8 A;  2EEI A;  3WKM A;  2F5Y A;  3QDO A;  4ELW A;  3TT7 A;  2JWE A;  4KFV A;  5E22 A;  1V6B A;  2H3L A;  3L4F D;  4P2A B;  4K3W A;  1TP5 A;  3LAO A;  4WZ8 B;  4L8N A;  4OLQ A;  2VSS A;  1V1T A;  2KV8 A;  4Q2P A;  5H3J A;  1N6E A;  2Q3G A;  2YTW A;  1XNV A;  1X8S A;  3ID3 A;  2OCS A;  2PG8 A;  4U1A A;  1RGR A;  1RJM A;  2HE4 A;  2EHR A;  2D92 A;  4OMR A;  2YT8 A;  3CC0 A;  3IBB A;  3SWX A;  2A81 A;  3BPU A;  3QKA A;  4JWV A;  4IC6 A;  4JFC A;  4GVC A;  1XNY A;  1RJN A;  3KQF A;  3KTI A;  3VQG A;  3PS4 A;  2QKU A;  2ZL3 A;  2CSS A;  1UYT A;  1N6F A;  2M0T A;  4Q2O A;  3K1R A;  3OTP A;  2J5S A;  3LNX A;  2BYG A;  3TVU A;  2KOM A;  2WTB A;  1Y7O A;  3VQF A;  3ISA A;  5IKL B;  5E0S H;  2MX6 A;  5HF4 A;  2VSS E;  5INF A;  4ELX A;  1FC6 A;  3NJB A;  4Q2N A;  5HFE A;  5HFF A;  4LMM A;  3Q1T A;  3ZRT A;  3V5I A;  2RRM A;  4WYT A;  3QGL A;  2OMJ A;  2I04 A;  2KOJ A;  3PZK A;  2EEH A;  1UHP A;  2JIL A;  2DJT A;  3RL7 A;  3GDS A;  3TMH A;  2Q35 A;  2FW2 A;  5HFD A;  2EGK A;  1HZD A;  3Q7H A;  4WYO B;  5C9G A;  1WFV A;  1TQ3 A;  3KTJ A;  3EGH C;  2KG2 A;  1GM1 A;  3RLE A;  2F0A A;  2KBS A;  2JIN A;  4YDP A;  3U9S B;  2OGP A;  2DC2 A;  4NMQ A;  1XX4 A;  2M3M A;  2DB5 A;  3GMA A;  2YT7 A;  5DUC A;  2P3W A;  4FB8 A;  1UJD A;  1U3B A;  2L4S A;  1HNU A;  3BEZ A;  1U38 A;  1WIF A;  5F3X A;  2ZL4 A;  3P85 A;  4JCT A;  1R6J A;  3PV4 A;  3OME A;  3QXI A;  3OU0 A;  4ZDC A;  1VCW A;  3GDV A;  1N99 A;  3IAV A;  4EDJ A;  3SLL A;  1UEZ A;  2VRE A;  5B6L A;  4FZW A;  2LC7 A;  3MH4 A;  5HJ1 A;  3MOY A;  4B3H A;  5KDR B;  1QLC A;  3QJM A;  5KDR A;  2LOB A;  4JCQ A;  2M10 A;  1EF8 A;  2D3T A;  1V5L A;  3O46 A;  5G1D A;  2OSG A;  2PBP A;  2PPY A;  3K82 A;  4PQW A;  5ING A;  4K76 A;  2JOA A;  3DOR A;  1SG4 A;  1HNO A;  3QMJ A;  4WYU A;  3TLF A;  5GND A;  3BPP A;  1DUB A;  3KTH A;  1X5N A;  4NXP A;  5DTW A;  1GQ5 A;  3B76 A;  2FN5 A;  3H0J A;  1WDL A;  1UIY A;  4H11 A;  1Z87 A;  2WL7 A;  5FIF A;  1RGW A;  3MYB A;  5HDY A;  2J5I B;  2OQS A;  2ZPL A;  2J5I A;  2IWP A;  1XO6 A;  2W3P A;  4FJW D;  4G69 A;  2QKT A;  4NNM A;  1UM1 A;  2I0L A;  2J5I I;  3PEA A;  4HOP A;  3R0H A;  1Q7X A;  3G64 A;  4QIJ A;  2UZC A;  1K32 A;  4QII A;  4JOT A;  4U0H A;  4DI1 A;  2NP9 A;  4NEK A;  2VSV A;  3RRV A;  3TV5 A;  4K6Y A;  1Y7N A;  4YLH A;  3MT6 A;  2PZD A;  3JXT A;  2QBW A;  4NNL A;  2VSU A;  4Q2Q A;  1WG6 A;  2V90 A;  3PV2 A;  4E34 A;  3AXA A;  2IEX A;  3GF7 A;  4Q6H A;  4JOH A;  1D5G A;  3ST9 A;  4FN8 A;  4JSB A;  5A2P A;  2D8I A;  5JXB A;  2ZQR A;  2FZS A;  4L8K A;  3I47 A;  5D13 A;  4I42 A;  1G9O A;  3NJD A;  2A7K A;  1WF7 A;  4Q0G A;  4GVD A;  2EEJ A;  4NMT A;  3ZWA A;  2HW5 A;  2G2L A;  2QKV A;  1VJ6 A;  4JOK A;  4JOE A;  3SFJ A;  5DZK H;  5G1R A;  5HFB A;  1NTE A;  2KAW A;  5FB8 C;  2DUB A;  1MJ3 A;  2Q9V A;  2VRF A;  5JBX A;  2D90 A;  1WF8 A;  1X5R A;  4E3B A;  2VSU E;  4NNQ A;  2I1N A;  3CBX A;  4JVT A;  4RI0 A;  4NXQ A;  1X6D A;  1WZ8 A;  1UF1 A;  4B3I A;  3HRX A;  1K39 A;  3TDC A;  2UZF A;  1EF9 A;  1J7X A;  3PDZ A;  5HED A;  5FUS A;  1U39 A;  1UEP A;  1OD4 A;  1WI2 A;  3R6H A;  1NF3 C;  4N6X A;  4HNK A;  1MFG A;  4KWB A;  2KL1 A;  3EGG C;  4AMH A;  3ID4 A;  1UYV A;  2AWW A;  1I92 A;  2FNE A;  1OBX A;  2AIN A;  2VSP A;  2YUY A;  3HVQ C;  4KFW A;  1VA8 A;  1W9Q A;  4YYX A;  5FHT A;  2AWU A;  1PDR A;  2JXO A;  2FCF A;  2Z9I A;  4KNP A;  3P5M A;  4K72 A;  4EMP A;  3QYR A;  2DLU A;  3GF3 A;  2Z17 A;  3QE1 A;  1ON9 A;  4MXI A;  3E17 A;  2KJP A;  1WHA A;  4MI2 A;  2R3Y A;  3CYY A;  4ZDD A;  1OBZ A;  2I0I A;  3DIW A;  5E1Y A;  2QQ3 A;  3WKL A;  1Y8T A;  1TG6 A;  3OT6 A;  4R2Z A;  4KD6 A;  2I6V A;  4JOF A;  2KA9 A;  3FF6 A;  1FC7 A;  2GZV A;  3DJ3 A;  4U0G A;  3NFL A;  3FY5 A;  2MHO A;  2EEG A;  4ASI A;  2AWX A;  5CTB A;  2EDV A;  1KEF A;  4Z33 A;  4K78 A;  2ENO A;  1SOZ A;  3R9Q A;  4B3J A;  5C90 A;  1WDK A;  2FBM A;  4OAJ A;  4IZB A;  2O2T A;  1MFL A;  3CH8 A;  2DEO A;  2VWR A;  3QIK A;  4JYJ A;  1VAE A;  1ON3 A;  2EJ5 A;  1OBY A;  1V62 A;  1Q3P A;  2X7Z A;  1LCY A;  4LK5 A;  4Q6S A;  4JOR A;  4ZU2 A;  3VIV A;  3MH6 A;  2PNT A;  1UYS A;  2CBY A;  2K1Z A;  4HC8 A;  1Z86 A;  1NZY B;  4L6W A;  1NZY A;  2ZL0 A;  2H2C A;  2KPK A;  4OEP A;  1MC7 A;  5G1Q A;  3T88 A;  2I4S A;  2CE3 A;  1N7E A;  1GQ4 A;  5E21 A;  2HE2 A;  2F9I B;  2F9I A;  2X24 A;  3OC7 A;  1BFE A;  2CS5 A;  3GGE A;  4RYF A;  3HE2 A;  1W9O A;  3DJA A;  1UYR A;  1W2X A;  3M6M A;  1TE0 A;  3SHW A;  3Q0G A;  3TT6 A;  4EMM A;  2VSS F;  5INI A;  1M5Z A;  3KTK A;  3HIN A;  4KPK A;  5DL1 A;  3STA A;  2OPG A;  1WI4 A;  1B8Q A;  3LKE A;  4JL7 A;  1Q3O A;  3H0Q A;  4HOP B;  4FZW C;  3T3W A;  1YG8 A;  5DU4 A;  1OZI A;  2R4H A;  2ZL2 A;  3QO6 A;  1EY3 A;  1X0U A;  4GHN A;  1WDM A;  3KZE A;  3ZWC A;  3QXZ A;  5GLJ A;  2CSJ A;  2PKT A;  1WFG A;  3N6R B;  3HPM A;  4OEO A;  2VZ5 A;  4JCS A;  3TVW A;  1OD2 A;  3V5E A;  3KZD A;  2EGN A;  1T2M A;  3R68 A;  2OS6 A;  5EYZ A;  4JYL A;  2EAQ A;  2PDZ A;  4JOJ A;  5DTP A;  4ELS A;  4K2N A;  3U9T B;  4REY A;  3K8X A;  2LUI A;  2PKU A;  3CBY A;  4ZDB A;  5G1E A;  3M6N A;  2JIK A;  2M0U A;  5DKP A;  3O5N A;  4P0C A;  2KQF A;  3NFK A;  2EXG A;  3QWD A;  2GTR A;  2M0Z A;  3GCN A;  4Z0M A;  4XHV A;  3Q0J A;  4QFE A;  3T8A A;  4UU6 A;  5HET A;  2IWO A;  4RCN A;  4FN7 A; 
#chains in the Genus database with same CATH topology
 5I7Z A;  2EV8 A;  3SUZ A;  1KWA A;  1O8U A;  3GKB A;  4FGM A;  2F6I A;  4WCZ A;  3H0U A;  4NMV A;  5HF1 A;  3ZW9 A;  1UM7 A;  1W9E A;  3GJ9 A;  2VSU C;  4U19 A;  5E11 A;  4ZDF A;  3ZWB A;  3ZW8 A;  1RY4 A;  5E6P B;  4EML A;  2DKR A;  2DXL A;  3F43 A;  4AE2 A;  3GCO A;  3AGD A;  1Q51 A;  4FNB A;  1UIT A;  5HFC A;  4OG1 A;  3GLM A;  3OIR A;  2GEF A;  3H81 A;  5DTH A;  3PV5 A;  3H0S A;  3PE8 A;  5HEB A;  4IZD A;  2LA8 A;  1FC9 A;  2FE5 A;  3MFM A;  4K29 A;  2DAZ A;  1UJU A;  2YJG A;  4RYF H;  5G1S A;  2C8T A;  2EGO A;  1YG6 A;  4FLN A;  5EUW A;  1VB7 A;  4NMS A;  4Q1I A;  1DCI A;  1Q52 A;  2KOH A;  3MOG A;  1PJH A;  2DM8 A;  4FND A;  3R69 A;  3H02 A;  3OIZ A;  4U18 A;  3JU1 A;  2E7K A;  1H4Y A;  3TSZ A;  5MGB A;  3GVK A;  1WHD A;  3R9T A;  3U9R B;  3KHF A;  1IU2 A;  1N6D A;  3HPK A;  2OZF A;  3PDV A;  5DU8 A;  2KJK A;  5CTC A;  2VX2 A;  1U37 A;  2H3M A;  4MOU A;  2V1W A;  5KJP A;  4GM2 A;  4IZC A;  3I4W A;  2H2B A;  1PIX A;  3P2L A;  3IF5 A;  1IU0 A;  2KPL A;  3CBZ A;  4MPA A;  1H4Z A;  3IH9 A;  1N7F A;  3RST A;  3T8B A;  3TZ3 A;  2F9Y B;  1KY9 A;  2JRE A;  2F9Y A;  3R0O A;  4G2R A;  3I1E A;  2IWN A;  5EZ0 A;  2LC6 A;  1RZX A;  1V5Q A;  1ZUB A;  1AUZ A;  3MH7 A;  2DMZ A;  3GSL A;  2ZPM A;  3BF0 A;  2RCZ A;  1QAU A;  1TP3 A;  1P1E A;  2RRL A;  1TYF A;  2BZR A;  3KTG A;  1ZOK A;  5DZK A;  3QJN A;  1SOT A;  4JOP A;  4NMP A;  1XZ9 A;  4JCR A;  2VSU F;  5HEY A;  3LLO A;  3PGQ A;  3L3S A;  2EJY A;  2VY9 A;  3LNY A;  4JJT A;  1YBO A;  3WG5 A;  3HLN 1;  4Z8J A;  2REY A;  4ZDE A;  3NGH A;  1VRG A;  1UFX A;  2G5M B;  1XNW A;  4J2U A;  1X5Q A;  2J5G D;  2KA5 A;  3EH7 A;  2J5G A;  1UEQ A;  1WJL A;  2KJD A;  3LDF A;  3NY7 A;  2ZQQ A;  4JOG A;  5E0S A;  2X58 A;  5DU6 A;  3DJ1 A;  2VPH A;  2PA1 A;  1IHJ A;  4E35 A;  3TSV A;  4JC0 A;  3STJ A;  2W7R A;  3CS0 A;  2K20 A;  4NMO A;  1X45 A;  3I18 A;  3FDU A;  1FCF A;  3D3U A;  3NCV A;  2HGA A;  2W4F A;  5F67 A;  3K50 A;  3R9S A;  1L6O A;  1QAV B;  4UU5 A;  4I4Z A;  1QAV A;  4F47 A;  4NXR A;  4F8K A;  4I52 A;  1UEW A;  3SHU A;  3ID2 A;  3IHB A;  2Q34 A;  3ID1 A;  3QRE A;  3IB9 A;  3RSI A;  1I16 A;  1N7T A;  2Q2X A;  4Q3H A;  5HUQ A;  3QK8 A;  1UJV A;  3TSW A;  2KLN A;  4O06 A;  3MGL A;  3TRR A;  4HYL A;  2EDP A;  2YUB A;  1P1D A;  2DLS A;  1SZO A;  2QT5 A;  2L4T A;  3T89 A;  2L97 A;  3SOE A;  1WH1 A;  1BE9 A;  2KYL A;  2KRG A;  4U0G H;  5DUF A;  4NMR A;  4K75 A;  2QG1 A;  2IWQ A;  1JXZ A;  3HP0 A;  5JBW A;  5E0N X;  2EDZ A;  2M0V A;  3GDU A;  2F6Q A;  2A7S A;  3RL8 A;  2EEI A;  3WKM A;  2F5Y A;  3QDO A;  4ELW A;  3TT7 A;  2JWE A;  4KFV A;  5E22 A;  1V6B A;  2H3L A;  3L4F D;  4P2A B;  4K3W A;  1TP5 A;  3LAO A;  4WZ8 B;  4L8N A;  4DMG A;  4OLQ A;  2VSS A;  5EZB A;  1V1T A;  2KV8 A;  4Q2P A;  4QTP A;  5H3J A;  1N6E A;  2Q3G A;  2YTW A;  3D03 A;  1X8S A;  1XNV A;  3ID3 A;  2OCS A;  2PG8 A;  4U1A A;  1RGR A;  1RJM A;  2HE4 A;  2EHR A;  2D92 A;  3VSE A;  4OMR A;  2YT8 A;  3CC0 A;  3IBB A;  3SWX A;  2A81 A;  3BPU A;  3QKA A;  4JWV A;  4IC6 A;  4JFC A;  4GVC A;  5ILB A;  1XNY A;  1RJN A;  3KQF A;  3KTI A;  3VQG A;  3PS4 A;  2QKU A;  2ZL3 A;  2CSS A;  1UYT A;  1N6F A;  1V0F A;  2M0T A;  4Q2O A;  3K1R A;  3OTP A;  2J5S A;  3LNX A;  2BYG A;  3TVU A;  2KOM A;  2WTB A;  1WXW A;  1Y7O A;  3VQF A;  3ISA A;  5IKL B;  5E0S H;  2MX6 A;  5HF4 A;  2VSS E;  4XS5 A;  5INF A;  4ELX A;  1FC6 A;  3NJB A;  4Q2N A;  5HFE A;  5HFF A;  4LMM A;  3Q1T A;  3ZRT A;  3V5I A;  2RRM A;  4WYT A;  3QGL A;  2OMJ A;  2I04 A;  2KOJ A;  3PZK A;  2EEH A;  1UHP A;  2JIL A;  2DJT A;  3RL7 A;  3GDS A;  3TMH A;  2Q35 A;  2FW2 A;  3T6O A;  5HFD A;  2EGK A;  1HZD A;  3Q7H A;  4WYO B;  5C9G A;  1WFV A;  1TQ3 A;  3KTJ A;  1WXX A;  3EGH C;  2KG2 A;  1GM1 A;  3RLE A;  2F0A A;  1T6R A;  3BPT A;  2KBS A;  2JIN A;  4YDP A;  4AEJ A;  3U9S B;  2OGP A;  2DC2 A;  4NMQ A;  1XX4 A;  1THN B;  2M3M A;  2DB5 A;  3GMA A;  2YT7 A;  5DUC A;  2P3W A;  4FB8 A;  1UJD A;  1U3B A;  2L4S A;  1HNU A;  4DGH A;  3BEZ A;  1U38 A;  1WIF A;  5F3X A;  5EUU A;  2ZL4 A;  3P85 A;  4JCT A;  1R6J A;  3PV4 A;  3OME A;  3QXI A;  3OU0 A;  4ZDC A;  1VCW A;  3GDV A;  1N99 A;  3IAV A;  4EDJ A;  3SLL A;  1SBO A;  1UEZ A;  1TID B;  5B6L A;  2VRE A;  4FZW A;  2LC7 A;  3MH4 A;  5HJ1 A;  3ZTB A;  3MOY A;  4B3H A;  5KDR B;  1QLC A;  3QJM A;  5KDR A;  2LOB A;  4JCQ A;  2M10 A;  1EF8 A;  2D3T A;  1V5L A;  3O46 A;  5G1D A;  2OSG A;  5B42 A;  2PBP A;  2PPY A;  3K82 A;  4PQW A;  5ING A;  3JU4 A;  4K76 A;  2JOA A;  3DOR A;  1SG4 A;  1HNO A;  5IL9 A;  3QMJ A;  3GVL A;  4WYU A;  3TLF A;  5GND A;  2CWW A;  2ZOA A;  3BPP A;  3V97 A;  3GK7 A;  1DUB A;  3KTH A;  1X5N A;  4NXP A;  5DTW A;  1GQ5 A;  3B76 A;  2FN5 A;  3H0J A;  1WDL A;  1UIY A;  4H11 A;  1Z87 A;  2WL7 A;  1VC1 A;  5FIF A;  1RGW A;  3MYB A;  3DUP A;  5HDY A;  2J5I B;  2OQS A;  2ZPL A;  2J5I A;  2IWP A;  3IHA A;  1XO6 A;  1BPL A;  2W3P A;  4FJW D;  4G69 A;  2QKT A;  4NNM A;  1UM1 A;  2I0L A;  2J5I I;  3PEA A;  4HOP A;  3R0H A;  1Q7X A;  3G64 A;  4QIJ A;  2UZC A;  1K32 A;  4QII A;  4JOT A;  4U0H A;  4DI1 A;  2NP9 A;  4NEK A;  2VSV A;  3RRV A;  3TV5 A;  4K6Y A;  1Y7N A;  4YLH A;  3MT6 A;  2PZD A;  3JXT A;  2QBW A;  4NNL A;  1TIL B;  3C0K A;  2VSU A;  4Q2Q A;  1WG6 A;  2V90 A;  3PV2 A;  4E34 A;  3AXA A;  2IEX A;  3GF7 A;  2ZO9 B;  4Q6H A;  4JOH A;  3GMF A;  1D5G A;  3ST9 A;  4FN8 A;  4JSB A;  5A2P A;  2D8I A;  5JXB A;  2ZQR A;  2FZS A;  1TH8 B;  4L8K A;  3I47 A;  5D13 A;  4DGF A;  2DXN A;  4I42 A;  5EUX A;  1G9O A;  2JSN A;  2A7K A;  3ZXN A;  3NJD A;  1WF7 A;  4Q0G A;  4GVD A;  2EEJ A;  4NMT A;  3ZWA A;  4L1C A;  2HW5 A;  2G2L A;  2QKV A;  1VJ6 A;  4JOK A;  4JOE A;  3SFJ A;  5DZK H;  5G1R A;  5HFB A;  1NTE A;  2KAW A;  5FB8 C;  2DUB A;  3KDK A;  2Q9V A;  2VRF A;  1H4X A;  1MJ3 A;  2D90 A;  5JBX A;  1WF8 A;  1X5R A;  4E3B A;  2VSU E;  4NNQ A;  2I1N A;  3CBX A;  4JVT A;  4RI0 A;  4NXQ A;  1X6D A;  1WZ8 A;  1UF1 A;  4B3I A;  3LKL A;  3HRX A;  1K39 A;  3TDC A;  2AS0 A;  2UZF A;  1EF9 A;  1J7X A;  3PDZ A;  5HED A;  5FUS A;  1U39 A;  1UEP A;  1OD4 A;  1WI2 A;  3R6H A;  1NF3 C;  4N6X A;  4HNK A;  1MFG A;  3AGE A;  4KWB A;  2KL1 A;  4HIZ A;  3EGG C;  3IH8 A;  4AMH A;  3ID4 A;  1UYV A;  2AWW A;  1I92 A;  2FNE A;  1OBX A;  2AIN A;  2VSP A;  2YUY A;  3HVQ C;  4KFW A;  1VA8 A;  1W9Q A;  4YYX A;  5FHT A;  2AWU A;  1PDR A;  2JXO A;  2FCF A;  2Z9I A;  4KNP A;  3P5M A;  4K72 A;  4EMP A;  3QYR A;  2DLU A;  3GF3 A;  2Z17 A;  3QE1 A;  1ON9 A;  4MXI A;  3E17 A;  4HDT A;  2KJP A;  1WHA A;  3GHF A;  2R3Y A;  3CYY A;  4MI2 A;  4ZDD A;  1OBZ A;  2I0I A;  3DIW A;  5E1Y A;  2QQ3 A;  3WKL A;  1Y8T A;  1TG6 A;  3OT6 A;  4R2Z A;  4KD6 A;  2I6V A;  4JOF A;  2KA9 A;  3FF6 A;  1FC7 A;  2GZV A;  3DJ3 A;  4U0G A;  3NFL A;  3FY5 A;  3GVJ A;  2MHO A;  2EEG A;  4ASI A;  2AWX A;  5CTB A;  2EDV A;  1KEF A;  4Z33 A;  4K78 A;  2ENO A;  1SOZ A;  3R9Q A;  4B3J A;  5C90 A;  1WDK A;  2FBM A;  4OAJ A;  4IZB A;  2O2T A;  5EUS A;  1MFL A;  3CH8 A;  2DEO A;  2VWR A;  3QIK A;  4JYJ A;  4JJ0 A;  1VAE A;  3GAB A;  1ON3 A;  2EJ5 A;  1OBY A;  1V62 A;  1Q3P A;  2X7Z A;  4NAR A;  1LCY A;  4LK5 A;  4Q6S A;  4JOR A;  1X9Z A;  4ZU2 A;  3VIV A;  3MH6 A;  2PNT A;  1UYS A;  2CBY A;  2K1Z A;  4HC8 A;  1Z86 A;  1NZY B;  4L6W A;  1NZY A;  2ZL0 A;  2H2C A;  2KPK A;  4OEP A;  1MC7 A;  5G1Q A;  3T88 A;  2I4S A;  2CE3 A;  1N7E A;  1GQ4 A;  5E21 A;  2HE2 A;  2F9I B;  2F9I A;  3KDG A;  3QDQ A;  2X24 A;  3OC7 A;  1BFE A;  2CS5 A;  3GGE A;  4RYF A;  3HE2 A;  1W9O A;  3DJA A;  1UYR A;  1W2X A;  3M6M A;  1TE0 A;  3SHW A;  3Q0G A;  3TT6 A;  4EMM A;  2VSS F;  1HF2 A;  5INI A;  1M5Z A;  3KTK A;  3HIN A;  4KPK A;  5DL1 A;  3STA A;  2OPG A;  1WI4 A;  1B8Q A;  3LKE A;  4JL7 A;  1Q3O A;  3H0Q A;  4HOP B;  4FZW C;  3T3W A;  1YG8 A;  5DU4 A;  1OZI A;  2R4H A;  2ZL2 A;  5EUZ A;  3QO6 A;  1EY3 A;  1X0U A;  4GHN A;  1WDM A;  3KZE A;  3ZWC A;  3QXZ A;  5GLJ A;  3V8V A;  2CSJ A;  2PKT A;  1WFG A;  3N6R B;  3HPM A;  1BUZ A;  4OEO A;  2VZ5 A;  4JCS A;  1V0E A;  3TVW A;  1OD2 A;  3V5E A;  3KZD A;  2EGN A;  1T2M A;  3R68 A;  2OS6 A;  2OAS A;  5EYZ A;  4JYL A;  2EAQ A;  2PDZ A;  4JOJ A;  5DTP A;  4ELS A;  4K2N A;  3U9T B;  4REY A;  3K8X A;  2LUI A;  2PKU A;  3CBY A;  4ZDB A;  5G1E A;  3M6N A;  2JIK A;  2M0U A;  5DKP A;  3O5N A;  4P0C A;  2B78 A;  2KQF A;  3NFK A;  2EXG A;  3QWD A;  2GTR A;  2M0Z A;  3GCN A;  4Z0M A;  4XHV A;  4JJ3 A;  3Q0J A;  4QFE A;  3T8A A;  4UU6 A;  5HET A;  2IWO A;  4RCN A;  4FN7 A; 
#chains in the Genus database with same CATH homology
 5I7Z A;  2EV8 A;  3SUZ A;  1KWA A;  1O8U A;  3GKB A;  4FGM A;  2F6I A;  4WCZ A;  3H0U A;  4NMV A;  5HF1 A;  3ZW9 A;  1UM7 A;  1W9E A;  3GJ9 A;  2VSU C;  4U19 A;  5E11 A;  4ZDF A;  3ZWB A;  3ZW8 A;  1RY4 A;  5E6P B;  4EML A;  2DKR A;  2DXL A;  4AE2 A;  3GCO A;  1Q51 A;  4FNB A;  1UIT A;  5HFC A;  4OG1 A;  3GLM A;  2GEF A;  3H81 A;  5DTH A;  3PV5 A;  3H0S A;  3PE8 A;  5HEB A;  4IZD A;  2LA8 A;  1FC9 A;  2FE5 A;  3MFM A;  4K29 A;  2DAZ A;  1UJU A;  2YJG A;  4RYF H;  5G1S A;  2C8T A;  2EGO A;  1YG6 A;  4FLN A;  1VB7 A;  4NMS A;  4Q1I A;  1DCI A;  1Q52 A;  2KOH A;  3MOG A;  1PJH A;  2DM8 A;  4FND A;  3R69 A;  3H02 A;  4U18 A;  3JU1 A;  2E7K A;  3TSZ A;  5MGB A;  1WHD A;  3R9T A;  3U9R B;  3KHF A;  1IU2 A;  1N6D A;  3HPK A;  2OZF A;  3PDV A;  5DU8 A;  2KJK A;  5CTC A;  2VX2 A;  1U37 A;  2H3M A;  4MOU A;  2V1W A;  5KJP A;  4GM2 A;  4IZC A;  3I4W A;  2H2B A;  1PIX A;  3P2L A;  1IU0 A;  2KPL A;  3CBZ A;  4MPA A;  3RST A;  3T8B A;  1N7F A;  3TZ3 A;  2F9Y B;  1KY9 A;  2JRE A;  2F9Y A;  3R0O A;  4G2R A;  3I1E A;  2IWN A;  5EZ0 A;  2LC6 A;  1RZX A;  1V5Q A;  1ZUB A;  3MH7 A;  2DMZ A;  3GSL A;  2ZPM A;  3BF0 A;  2RCZ A;  1QAU A;  1TP3 A;  1P1E A;  2RRL A;  1TYF A;  2BZR A;  3KTG A;  1ZOK A;  5DZK A;  3QJN A;  1SOT A;  4JOP A;  4NMP A;  1XZ9 A;  4JCR A;  2VSU F;  5HEY A;  3PGQ A;  3L3S A;  2EJY A;  3LNY A;  4JJT A;  1YBO A;  3WG5 A;  3HLN 1;  4Z8J A;  2REY A;  4ZDE A;  3NGH A;  1VRG A;  1UFX A;  2G5M B;  1XNW A;  4J2U A;  1X5Q A;  2J5G D;  2J5G A;  1UEQ A;  1WJL A;  2KJD A;  2ZQQ A;  4JOG A;  5E0S A;  2X58 A;  5DU6 A;  3DJ1 A;  2VPH A;  2PA1 A;  1IHJ A;  4E35 A;  3TSV A;  4JC0 A;  3STJ A;  2W7R A;  3CS0 A;  2K20 A;  4NMO A;  1X45 A;  3I18 A;  3FDU A;  1FCF A;  3NCV A;  2HGA A;  2W4F A;  5F67 A;  3K50 A;  3R9S A;  1L6O A;  1QAV B;  4UU5 A;  4I4Z A;  1QAV A;  4F47 A;  4NXR A;  4F8K A;  4I52 A;  1UEW A;  3SHU A;  3ID2 A;  2Q34 A;  3ID1 A;  3QRE A;  3IB9 A;  3RSI A;  1I16 A;  1N7T A;  2Q2X A;  4Q3H A;  5HUQ A;  3QK8 A;  1UJV A;  3TSW A;  4O06 A;  3TRR A;  2EDP A;  2YUB A;  1P1D A;  2DLS A;  1SZO A;  2QT5 A;  2L4T A;  3T89 A;  2L97 A;  3SOE A;  1WH1 A;  1BE9 A;  2KYL A;  2KRG A;  4U0G H;  5DUF A;  4NMR A;  4K75 A;  2QG1 A;  2IWQ A;  1JXZ A;  3HP0 A;  5JBW A;  5E0N X;  2EDZ A;  2M0V A;  3GDU A;  2F6Q A;  2A7S A;  3RL8 A;  2EEI A;  3WKM A;  2F5Y A;  3QDO A;  4ELW A;  3TT7 A;  2JWE A;  4KFV A;  5E22 A;  1V6B A;  2H3L A;  3L4F D;  4P2A B;  4K3W A;  1TP5 A;  3LAO A;  4WZ8 B;  4L8N A;  4OLQ A;  2VSS A;  1V1T A;  2KV8 A;  4Q2P A;  5H3J A;  1N6E A;  2Q3G A;  2YTW A;  3D03 A;  1X8S A;  1XNV A;  3ID3 A;  2OCS A;  2PG8 A;  4U1A A;  1RGR A;  1RJM A;  2HE4 A;  2EHR A;  2D92 A;  4OMR A;  2YT8 A;  3CC0 A;  3IBB A;  3SWX A;  2A81 A;  3BPU A;  3QKA A;  4JWV A;  4IC6 A;  4JFC A;  4GVC A;  5ILB A;  1XNY A;  1RJN A;  3KQF A;  3KTI A;  3VQG A;  3PS4 A;  2QKU A;  2ZL3 A;  2CSS A;  1UYT A;  1N6F A;  2M0T A;  4Q2O A;  3K1R A;  3OTP A;  2J5S A;  3LNX A;  2BYG A;  3TVU A;  2KOM A;  2WTB A;  1Y7O A;  3VQF A;  3ISA A;  5IKL B;  5E0S H;  2MX6 A;  5HF4 A;  2VSS E;  5INF A;  4ELX A;  1FC6 A;  3NJB A;  4Q2N A;  5HFE A;  5HFF A;  4LMM A;  3Q1T A;  3ZRT A;  3V5I A;  2RRM A;  4WYT A;  3QGL A;  2OMJ A;  2I04 A;  2KOJ A;  3PZK A;  2EEH A;  1UHP A;  2JIL A;  2DJT A;  3RL7 A;  3GDS A;  3TMH A;  2Q35 A;  2FW2 A;  5HFD A;  2EGK A;  1HZD A;  3Q7H A;  4WYO B;  5C9G A;  1WFV A;  1TQ3 A;  3KTJ A;  3EGH C;  2KG2 A;  1GM1 A;  3RLE A;  2F0A A;  3BPT A;  2KBS A;  2JIN A;  4YDP A;  4AEJ A;  3U9S B;  2OGP A;  2DC2 A;  4NMQ A;  1XX4 A;  2M3M A;  2DB5 A;  3GMA A;  2YT7 A;  5DUC A;  2P3W A;  4FB8 A;  1UJD A;  1U3B A;  2L4S A;  1HNU A;  3BEZ A;  1U38 A;  1WIF A;  5F3X A;  2ZL4 A;  3P85 A;  4JCT A;  1R6J A;  3PV4 A;  3OME A;  3QXI A;  3OU0 A;  4ZDC A;  1VCW A;  3GDV A;  1N99 A;  3IAV A;  4EDJ A;  3SLL A;  1UEZ A;  2VRE A;  5B6L A;  4FZW A;  2LC7 A;  3MH4 A;  5HJ1 A;  3MOY A;  4B3H A;  5KDR B;  1QLC A;  3QJM A;  5KDR A;  2LOB A;  4JCQ A;  2M10 A;  1EF8 A;  2D3T A;  1V5L A;  3O46 A;  5G1D A;  2OSG A;  5B42 A;  2PBP A;  2PPY A;  3K82 A;  4PQW A;  5ING A;  4K76 A;  2JOA A;  3DOR A;  1SG4 A;  1HNO A;  5IL9 A;  3QMJ A;  4WYU A;  3TLF A;  5GND A;  2ZOA A;  3BPP A;  1DUB A;  3KTH A;  1X5N A;  4NXP A;  5DTW A;  1GQ5 A;  3B76 A;  2FN5 A;  3H0J A;  1WDL A;  1UIY A;  4H11 A;  1Z87 A;  2WL7 A;  5FIF A;  1RGW A;  3MYB A;  3DUP A;  5HDY A;  2J5I B;  2OQS A;  2ZPL A;  2J5I A;  2IWP A;  1XO6 A;  1BPL A;  2W3P A;  4FJW D;  4G69 A;  2QKT A;  4NNM A;  1UM1 A;  2I0L A;  2J5I I;  3PEA A;  4HOP A;  3R0H A;  1Q7X A;  3G64 A;  4QIJ A;  2UZC A;  1K32 A;  4QII A;  4JOT A;  4U0H A;  4DI1 A;  2NP9 A;  4NEK A;  2VSV A;  3RRV A;  3TV5 A;  4K6Y A;  1Y7N A;  4YLH A;  3MT6 A;  2PZD A;  3JXT A;  2QBW A;  4NNL A;  2VSU A;  4Q2Q A;  1WG6 A;  2V90 A;  3PV2 A;  4E34 A;  3AXA A;  2IEX A;  3GF7 A;  2ZO9 B;  4Q6H A;  4JOH A;  3GMF A;  1D5G A;  3ST9 A;  4FN8 A;  4JSB A;  5A2P A;  2D8I A;  5JXB A;  2ZQR A;  2FZS A;  4L8K A;  3I47 A;  5D13 A;  2DXN A;  4I42 A;  1G9O A;  2JSN A;  2A7K A;  3NJD A;  1WF7 A;  4Q0G A;  4GVD A;  2EEJ A;  4NMT A;  3ZWA A;  4L1C A;  2HW5 A;  2G2L A;  2QKV A;  1VJ6 A;  4JOK A;  4JOE A;  3SFJ A;  5DZK H;  5G1R A;  5HFB A;  1NTE A;  2KAW A;  5FB8 C;  2DUB A;  3KDK A;  2Q9V A;  2VRF A;  1MJ3 A;  5JBX A;  2D90 A;  1WF8 A;  1X5R A;  4E3B A;  2VSU E;  4NNQ A;  2I1N A;  3CBX A;  4JVT A;  4RI0 A;  4NXQ A;  1X6D A;  1WZ8 A;  1UF1 A;  4B3I A;  3HRX A;  1K39 A;  3TDC A;  2UZF A;  1EF9 A;  1J7X A;  3PDZ A;  5HED A;  5FUS A;  1U39 A;  1UEP A;  1OD4 A;  1WI2 A;  3R6H A;  1NF3 C;  4N6X A;  4HNK A;  1MFG A;  4KWB A;  2KL1 A;  3EGG C;  4AMH A;  3ID4 A;  1UYV A;  2AWW A;  1I92 A;  2FNE A;  1OBX A;  2AIN A;  2VSP A;  2YUY A;  3HVQ C;  4KFW A;  1VA8 A;  1W9Q A;  4YYX A;  5FHT A;  2AWU A;  1PDR A;  2JXO A;  2FCF A;  2Z9I A;  4KNP A;  3P5M A;  4K72 A;  4EMP A;  3QYR A;  2DLU A;  3GF3 A;  2Z17 A;  3QE1 A;  1ON9 A;  4MXI A;  3E17 A;  4HDT A;  2KJP A;  1WHA A;  3GHF A;  2R3Y A;  3CYY A;  4MI2 A;  4ZDD A;  1OBZ A;  2I0I A;  3DIW A;  5E1Y A;  2QQ3 A;  3WKL A;  1Y8T A;  1TG6 A;  3OT6 A;  4R2Z A;  4KD6 A;  2I6V A;  4JOF A;  2KA9 A;  3FF6 A;  1FC7 A;  2GZV A;  3DJ3 A;  4U0G A;  3NFL A;  3FY5 A;  2MHO A;  2EEG A;  4ASI A;  2AWX A;  5CTB A;  2EDV A;  1KEF A;  4Z33 A;  4K78 A;  2ENO A;  1SOZ A;  3R9Q A;  4B3J A;  5C90 A;  1WDK A;  2FBM A;  4OAJ A;  4IZB A;  2O2T A;  1MFL A;  3CH8 A;  2DEO A;  2VWR A;  3QIK A;  4JYJ A;  4JJ0 A;  1VAE A;  3GAB A;  1ON3 A;  2EJ5 A;  1OBY A;  1V62 A;  1Q3P A;  2X7Z A;  4NAR A;  1LCY A;  4LK5 A;  4Q6S A;  4JOR A;  1X9Z A;  4ZU2 A;  3VIV A;  3MH6 A;  2PNT A;  1UYS A;  2CBY A;  2K1Z A;  4HC8 A;  1Z86 A;  1NZY B;  4L6W A;  1NZY A;  2ZL0 A;  2H2C A;  2KPK A;  4OEP A;  1MC7 A;  5G1Q A;  3T88 A;  2I4S A;  2CE3 A;  1N7E A;  1GQ4 A;  5E21 A;  2HE2 A;  2F9I B;  2F9I A;  3KDG A;  2X24 A;  3OC7 A;  1BFE A;  2CS5 A;  3GGE A;  4RYF A;  3HE2 A;  1W9O A;  3DJA A;  1UYR A;  1W2X A;  3M6M A;  1TE0 A;  3SHW A;  3Q0G A;  3TT6 A;  4EMM A;  2VSS F;  5INI A;  1M5Z A;  3KTK A;  3HIN A;  4KPK A;  5DL1 A;  3STA A;  2OPG A;  1WI4 A;  1B8Q A;  3LKE A;  4JL7 A;  1Q3O A;  3H0Q A;  4HOP B;  4FZW C;  3T3W A;  1YG8 A;  5DU4 A;  1OZI A;  2R4H A;  2ZL2 A;  3QO6 A;  1EY3 A;  1X0U A;  4GHN A;  1WDM A;  3KZE A;  3ZWC A;  3QXZ A;  5GLJ A;  2CSJ A;  2PKT A;  1WFG A;  3N6R B;  3HPM A;  4OEO A;  2VZ5 A;  4JCS A;  3TVW A;  1OD2 A;  3V5E A;  3KZD A;  2EGN A;  1T2M A;  3R68 A;  2OS6 A;  5EYZ A;  4JYL A;  2EAQ A;  2PDZ A;  4JOJ A;  5DTP A;  4ELS A;  4K2N A;  3U9T B;  4REY A;  3K8X A;  2LUI A;  2PKU A;  3CBY A;  4ZDB A;  5G1E A;  3M6N A;  2JIK A;  2M0U A;  5DKP A;  3O5N A;  4P0C A;  2KQF A;  3NFK A;  2EXG A;  3QWD A;  2GTR A;  2M0Z A;  3GCN A;  4Z0M A;  4XHV A;  4JJ3 A;  3Q0J A;  4QFE A;  3T8A A;  4UU6 A;  5HET A;  2IWO A;  4RCN A;  4FN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...