1FCFA

Photosystem ii d1 c-terminal processing protease
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
387
structure length
387
Chain Sequence
MVTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II D1 PROTEASE
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
total genus 112
structure length 387
sequence length 387
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fcfA02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fcfA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fcfA03
5HFFA 2ZL4A 3OMEA 3TVUA 3PV4A 1MC7A 4GHNA 2D3TA 4FN8A 3QREA 1N6DA 4K75A 5DUFA 4RYFH 3ZRTA 1TYFA 3OT6A 3QJNA 3T3WA 1HNUA 2YUYA 1Y7NA 5I7ZA 4R2ZA 1X6DA 3TT6A 4NMOA 2IWOA 2F9YB 4E35A 4MI2A 2VSSA 4K29A 5C9GA 2DM8A 3VQFA 1O8UA 1UYVA 2EGNA 4FZWA 1IU2A 4JOKA 2PA1A 3PZKA 2ZL0A 1FC9A 4WYTA 2M10A 1WFVA 3BF0A 3KTIA 3QMJA 1XO6A 1PIXA 2AWXA 1EY3A 1ZUBA 3QXIA 4Q1IA 2D92A 1Q52A 2VRFA 1UYRA 1U39A 4MOUA 3EGGC 3KHFA 3H0SA 3HPMA 4NXRA 2HW5A 1WI2A 4EDJA 4JOTA 3DJ3A 4JSBA 5HFBA 3V5EA 5EYZA 4FGMA 1NZYB 1ZOKA 5DTPA 2LUIA 3IBBA 5JXBA 3CC0A 4Z8JA 3P2LA 3GLMA 5IKLB 5B6LA 3DJAA 1Q3OA 2OSGA 3K82A 1QAVB 2VREA 1YBOA 2AINA 3ID2A 2J5IA 3JU1A 4FNDA 1W9OA 3CBXA 3Q0GA 1ON9A 3GKBA 1WI4A 4RI0A 2OMJA 4U0GH 3K50A 1R6JA 3KTKA 1IHJA 3LKEA 5HFCA 1N7TA 2Q2XA 3B76A 3QDOA 2KL1A 2RRMA 3R68A 5HFDA 1X0UA 1N7FA 2GZVA 2J5GD 2Z9IA 1I16A 2KV8A 4N6XA 2R3YA 3T89A 1WH1A 5HF4A 2ZPMA 5FHTA 1K39A 2QKUA 4IZCA 3R69A 4NMRA 3WG5A 2I6VA 1UEPA 2EJ5A 3CBYA 3QXZA 3RL7A 2BZRA 1SG4A 2KOMA 3T8AA 2AWUA 3PV2A 4YDPA 2KOJA 1MJ3A 1ON3A 3R9TA 4ZDDA 4B3HA 4HOPB 3HLN1 4JYLA 2Z17A 3DJ1A 1WHDA 3QK8A 1UFXA 2IWNA 1V1TA 1UEWA 3ZWCA 2KJDA 1KY9A 3V5IA 2V1WA 2DLUA 2NP9A 4QIIA 5INFA 1J7XA 2PPYA 3R6HA 4ZDCA 2DJTA 3IAVA 1TG6A 1OZIA 1UEQA 2JXOA 3HVQC 2QT5A 2O2TA 1Y7OA 4F47A 1XNWA 3GF7A 2ENOA 3ST9A 2ZL3A 1XX4A 2EDZA 1W2XA 4NEKA 2DMZA 1T2MA 1SZOA 3TLFA 3PS4A 4ELXA 1N6EA 2EEJA 2EJYA 1Z87A 1KWAA 2FZSA 3PEAA 2L4SA 3ID3A 4ZDFA 4NNLA 4GVDA 2M0UA 5E11A 2PZDA 3PE8A 1GM1A 3TDCA 1PDRA 3FF6A 1XNVA 4U0HA 2AWWA 3R9QA 1XZ9A 1K32A 3TMHA 2I0IA 3I47A 3FY5A 3R0OA 3GJ9A 4IZBA 2VWRA 4FJWD 3GCNA 1YG6A 4JOGA 1QLCA 5E0SA 3MFMA 1TQ3A 5KDRA 2IWQA 2KJKA 1UJVA 3VIVA 2YT8A 3MT6A 1Q51A 3HE2A 1OBYA 2EDPA 1V5QA 3OTPA 5HJ1A 3GF3A 2W7RA 3LNXA 3KZEA 4JYJA 3MH6A 1NTEA 4KD6A 4Q6SA 1EF8A 2KPLA 5G1RA 3OU0A 3PDVA 2GTRA 1UJUA 3HP0A 1G9OA 1GQ4A 3VQGA 3TT7A 4ZDEA 5DKPA 3SUZA 1N6FA 2J5IB 4JCQA 3QWDA 4I42A 2KBSA 1RJMA 2HGAA 2OGPA 3K1RA 4I52A 2JILA 3TVWA 2WTBA 1HNOA 4K3WA 3JXTA 1VRGA 2FN5A 2PNTA 5A2PA 2UZFA 2FE5A 4WYUA 4OEPA 4U1AA 2I4SA 4U18A 1FC6A 2J5II 5DU8A 2CSJA 2MHOA 2LC7A 4WZ8B 5H3JA 3TV5A 3Q0JA 2KPKA 3RSIA 1VB7A 2YUBA 3ISAA 5DU4A 1W9EA 4P2AB 4Q3HA 2OPGA 2G2LA 2M0VA 3TSZA 4F8KA 4ZU2A 4KWBA 2VSUE 2KJPA 1V6BA 3GMAA 2JINA 2RCZA 2KAWA 5DZKA 1UYSA 4LMMA 3QJMA 4YLHA 2EXGA 3HPKA 2F0AA 3BPPA 3QYRA 3WKMA 2E7KA 2YT7A 2CBYA 1OBXA 2OQSA 5CTCA 5DL1A 3KTHA 2FBMA 2VSUC 5GLJA 4PQWA 2DAZA 5INIA 1UIYA 4JCTA 2A81A 1M5ZA 2M0TA 4I4ZA 1Z86A 4NMQA 4JCRA 4WYOB 1QAUA 2EGKA 5F3XA 1L6OA 1EF9A 2MX6A 3TSVA 3R9SA 5HF1A 4NMTA 4OAJA 1OD2A 2QQ3A 3SHWA 2K1ZA 3P85A 2H3LA 2I04A 2OCSA 5FB8C 4RYFA 4E34A 3GSLA 3ZWBA 3RRVA 3RL8A 2CS5A 2M3MA 1SOZA 4LK5A 2KYLA 1WG6A 4NMPA 3STJA 3ID1A 2IEXA 3ZW8A 2VSUF 4JOEA 2H2BA 1WDLA 1WF8A 2D90A 4MPAA 4JVTA 3WKLA 1X5RA 5HEYA 4MXIA 4JL7A 1VAEA 3QKAA 4G69A 4OEOA 1U38A 5HETA 3STAA 4IC6A 4G2RA 1IU0A 4EMLA 4Z0MA 5KDRB 4XHVA 1BE9A 1LCYA 2EEIA 5G1DA 3TZ3A 1UYTA 3KTGA 2VX2A 1RGWA 4Q6HA 3HRXA 5DUCA 3DIWA 3MH7A 2F5YA 2ZL2A 5E0NX 5FUSA 3P5MA 3GDVA 1B8QA 3GCOA 4GM2A 2FNEA 3QE1A 2DC2A 5F67A 5G1QA 3NGHA 4Q2QA 1NF3C 1KEFA 4B3IA 3U9TB 4KNPA 1RZXA 2I0LA 1UM1A 2V90A 3MYBA 4DI1A 1W9QA 4FN7A 4L8NA 3SOEA 2X7ZA 2VSSE 2DEOA 5HEDA 2HE2A 2PDZA 4K6YA 4K72A 5DZKH 2M0ZA 3NFKA 2F6QA 3CYYA 2X58A 2FCFA 2EEGA 4NXQA 2Q34A 3H0JA 1N99A 5G1EA 1WHAA 1WZ8A 4E3BA 4JWVA 4L6WA 5HEBA 4OMRA 5MGBA 2HE4A 3TSWA 3QO6A 5HFEA 2L97A 2OS6A 4FZWC 2P3WA 3O5NA 2J5GA 4H11A 2KG2A 4KFVA 1U3BA 1VA8A 3CH8A 2VZ5A 2JWEA 3GDSA 3I4WA 3MH4A 3QIKA 3Q7HA 4B3JA 4HNKA 2VSPA 5CTBA 1RGRA 2G5MB 3LNYA 2KQFA 4Q2PA 2FW2A 2LOBA 1TP3A 4NNMA 4JCSA 1UHPA 3AXAA 1X8SA 4FNBA 2LA8A 2JIKA 4NXPA 2YTWA 4Z33A 2DB5A 3O46A 5HDYA 2KRGA 1MFGA 4ELWA 3CS0A 2CE3A 1V62A 3SHUA 4JOHA 4Q2OA 2JREA 2VSSF 2J5SA 2A7SA 1MFLA 4IZDA 1UJDA 2Q9VA 1UM7A 2H2CA 2QKTA 3NJBA 1OBZA 2EEHA 2IWPA 1HZDA 1D5GA 2F9IA 3MOYA 3IB9A 2EGOA 3U9RB 4AMHA 3M6NA 5INGA 3PDZA 3N6RB 1BFEA 1WJLA 5DTWA 2OZFA 1UEZA 4Q0GA 1YG8A 2C8TA 2EDVA 4JJTA 4RCNA 2QG1A 4UU6A 2F6IA 3RSTA 2QBWA 3L4FD 5E6PB 1N7EA 3DORA 4UU5A 2PBPA 3TRRA 3ZWAA 5D13A 3FDUA 3KQFA 2F9YA 2BYGA 2ZPLA 5E22A 2QKVA 4QFEA 1X5QA 4HC8A 1WIFA 4ASIA 5E0SH 3QGLA 5FIFA 5JBWA 3BEZA 1RY4A 1P1EA 4YYXA 1X5NA 2ZQQA 1DUBA 2PKTA 4NMSA 2PKUA 4NNQA 4O06A 4K76A 4KPKA 2KOHA 2WL7A 3I1EA 4L8KA 5KJPA 4FB8A 2DLSA 3PGQA 5DTHA 2UZCA 1DCIA 4ZDBA 4EMMA 1Q3PA 1NZYA 2D8IA 2I1NA 3GDUA 4REYA 3CBZA 1WFGA 4JOFA 3H02A 3ID4A 1I92A 3BPUA 3NFLA 5DU6A 1V5LA 3L3SA 2K20A 1FC7A 1U37A 5G1SA 3SWXA 3SFJA 1QAVA 2EHRA 4NMVA 2VSUA 3M6MA 3T88A 3SLLA 2W4FA 4ELSA 2A7KA 2LC6A 3U9SB 1UF1A 2DUBA 2VSVA 3HINA 2REYA 4QIJA 1P1DA 4OG1A 4P0CA 1FCFA 1WDKA 5EZ0A 1TE0A 2DKRA 5GNDA 3LAOA 2R4HA 3I18A 4K2NA 4WCZA 4U19A 3H81A 2L4TA 1XNYA 2Q3GA 3ZW9A 3Q1TA 4KFWA 3RLEA 2KA9A 5C90A 3GGEA 1VCWA 3H0UA 1X45A 1WF7A 2Q35A 3E17A 5JBXA 1VJ6A 3H0QA 3PV5A 1WDMA 3NJDA 2ZQRA 4JOPA 1PJHA 1TP5A 4EMPA 3KTJA 3KZDA 2CSSA 3T8BA 1Y8TA 4Q2NA 3K8XA 2W3PA 1OD4A 2EAQA 3R0HA 4HOPA 4JOJA 2VPHA 1JXZA 1Q7XA 1RJNA 4JFCA 4OLQA 5E1YA 4U0GA 3EGHC 2X24A 1SOTA 3G64A 2PG8A 4GVCA 2F9IB 5E21A 2EV8A 1UITA 2JOAA 4JORA 4K78A 1GQ5A 2H3MA 3OC7A
chains in the Genus database with same CATH superfamily
5HFFA 2ZL4A 3OMEA 3LKLA 3TVUA 3PV4A 1MC7A 4GHNA 2D3TA 3MOGA 4FN8A 3QREA 1N6DA 4K75A 5DUFA 4XS5A 3GVLA 4RYFH 3IF5A 3ZRTA 1TYFA 3OT6A 3QJNA 3T3WA 1HNUA 2YUYA 1Y7NA 5I7ZA 4R2ZA 1X6DA 3TT6A 4NMOA 2IWOA 5EUWA 2F9YB 4E35A 4MI2A 2VSSA 4K29A 5IL9A 5C9GA 2DM8A 3VQFA 3IH8A 1O8UA 1UYVA 2EGNA 4FZWA 1IU2A 3OIZA 4JOKA 2PA1A 3PZKA 2ZL0A 1FC9A 4WYTA 2M10A 1WFVA 3BF0A 3KTIA 3QMJA 1XO6A 1PIXA 2AWXA 1EY3A 1ZUBA 3QXIA 4Q1IA 2D92A 1Q52A 2VRFA 1UYRA 1U39A 4MOUA 3EGGC 3KHFA 3LLOA 3HPMA 4NXRA 3H0SA 2HW5A 1WI2A 4EDJA 4JOTA 3DJ3A 4JSBA 5HFBA 3V5EA 5EYZA 4FGMA 1NZYB 1ZOKA 5DTPA 2LUIA 3IBBA 3BPTA 5JXBA 3CC0A 4Z8JA 3P2LA 3GLMA 5IKLB 5B6LA 3DJAA 1Q3OA 2OSGA 3K82A 1QAVB 2VREA 1AUZA 1YBOA 2AINA 3ID2A 2J5IA 3JU1A 4FNDA 1W9OA 3CBXA 3Q0GA 1ON9A 3GKBA 1WI4A 4RI0A 2OMJA 4U0GH 3K50A 1R6JA 4JC0A 1IHJA 1V0FA 5HFCA 3KTKA 3LKEA 1N7TA 4HDTA 2Q2XA 3B76A 3QDOA 2KL1A 2RRMA 3R68A 5HFDA 3IH9A 1X0UA 3ZTBA 1N7FA 2GZVA 2J5GD 2Z9IA 4ELWA 3AGEA 1I16A 2KV8A 4N6XA 2R3YA 3T89A 1WH1A 5HF4A 2ZPMA 5FHTA 3IHAA 2QKUA 1K39A 4IZCA 3R69A 4NMRA 3WG5A 2I6VA 5EUXA 1UEPA 2EJ5A 3CBYA 3QXZA 3RL7A 2BZRA 1SG4A 2KOMA 3T8AA 2AWUA 3PV2A 4YDPA 2KOJA 4QTPA 1MJ3A 1HF2A 1ON3A 3R9TA 4ZDDA 4B3HA 4HOPB 4HIZA 3HLN1 4JYLA 2Z17A 3DJ1A 1WHDA 3QK8A 1UFXA 2IWNA 1V1TA 1UEWA 3ZWCA 2KJDA 1KY9A 3V5IA 2V1WA 2DLUA 2NP9A 4QIIA 5INFA 1J7XA 2PPYA 2GEFA 3R6HA 4ZDCA 2DJTA 3IAVA 3KDKA 1TG6A 1OZIA 1UEQA 2JXOA 3HVQC 2QT5A 2O2TA 1Y7OA 4F47A 1XNWA 3GF7A 2ENOA 3ST9A 2ZL3A 1XX4A 2EDZA 1W2XA 4NEKA 2DMZA 1T2MA 1SZOA 3TLFA 3PS4A 4ELXA 1N6EA 2EEJA 2EJYA 1Z87A 1KWAA 2FZSA 3PEAA 2L4SA 3ID3A 4ZDFA 4NNLA 4GVDA 2M0UA 5E11A 2PZDA 1BUZA 1GM1A 3GVJA 3PE8A 3TDCA 1PDRA 3FF6A 1XNVA 4U0HA 2AWWA 3R9QA 1XZ9A 1K32A 1H4ZA 3TMHA 2I0IA 3I47A 3FY5A 3R0OA 3GJ9A 4IZBA 2VWRA 4FJWD 2RRLA 3GCNA 1YG6A 4JOGA 1QLCA 5E0SA 3MFMA 1TQ3A 5KDRA 2IWQA 2KJKA 1UJVA 3VIVA 2YT8A 3MT6A 1Q51A 3HE2A 1OBYA 2EDPA 1V5QA 3OTPA 5HJ1A 3GF3A 2W7RA 3LNXA 3KZEA 2KLNA 4JYJA 3MH6A 1NTEA 3GMFA 3EH7A 4KD6A 4Q6SA 1EF8A 2KPLA 5G1RA 3OU0A 3PDVA 2GTRA 1UJUA 3HP0A 1G9OA 1GQ4A 3VQGA 3TT7A 1H4YA 4ZDEA 4L1CA 5DKPA 3SUZA 1N6FA 2J5IB 4JCQA 3QWDA 4I42A 2KBSA 1RJMA 2HGAA 2OGPA 3GHFA 3K1RA 4I52A 2JILA 4DGHA 1H4XA 3TVWA 2WTBA 1HNOA 4K3WA 3JXTA 1VRGA 2FN5A 2PNTA 5A2PA 3F43A 3DUPA 2FE5A 4WYUA 4OEPA 2UZFA 4U1AA 2I4SA 4U18A 1FC6A 3QDQA 2J5II 5DU8A 2CSJA 2MHOA 2LC7A 4WZ8B 5H3JA 3TV5A 3Q0JA 2KPKA 3RSIA 4JJ3A 1VB7A 2YUBA 3ISAA 5DU4A 4HYLA 1W9EA 4P2AB 4Q3HA 2OPGA 2G2LA 2M0VA 3TSZA 4F8KA 4ZU2A 4KWBA 2VSUE 2KJPA 1V6BA 3GMAA 2JINA 2RCZA 2KAWA 5DZKA 1UYSA 4LMMA 3QJMA 4YLHA 2EXGA 3HPKA 3IHBA 2F0AA 3BPPA 3QYRA 3WKMA 2E7KA 2YT7A 2CBYA 1OBXA 2OQSA 3KDGA 5CTCA 5DL1A 3KTHA 2FBMA 2VSUC 5GLJA 4PQWA 2DAZA 3V97A 2KA5A 5INIA 1UIYA 4JCTA 2A81A 1M5ZA 2M0TA 4I4ZA 5B42A 1Z86A 1T6RA 4NMQA 3NY7A 4JCRA 4WYOB 1QAUA 2EGKA 5EUZA 5F3XA 1L6OA 1EF9A 2MX6A 3TSVA 3R9SA 5HF1A 4NMTA 4OAJA 1OD2A 2QQ3A 3SHWA 1VC1A 2K1ZA 3P85A 2H3LA 2I04A 2OCSA 5FB8C 4RYFA 4E34A 3GSLA 3ZWBA 1TIDB 3RRVA 2DXLA 3RL8A 2CS5A 2M3MA 1SOZA 4LK5A 2KYLA 1WG6A 4NMPA 3STJA 3ID1A 2IEXA 3ZW8A 2VSUF 3AGDA 4JOEA 2H2BA 1WDLA 1WF8A 2D90A 4MPAA 4JVTA 3WKLA 1X5RA 5HEYA 2B78A 4MXIA 4JL7A 1VAEA 3QKAA 4G69A 4OEOA 1U38A 5HETA 3STAA 4IC6A 4G2RA 1IU0A 4EMLA 4Z0MA 5KDRB 4XHVA 1BE9A 1LCYA 2EEIA 5G1DA 3TZ3A 1UYTA 3KTGA 2VX2A 1RGWA 4Q6HA 3HRXA 5DUCA 3DIWA 3MH7A 2F5YA 2ZL2A 5E0NX 5FUSA 3P5MA 3GDVA 1B8QA 3GCOA 4GM2A 2FNEA 3QE1A 2DC2A 3NCVA 5F67A 5G1QA 3NGHA 4Q2QA 1NF3C 1KEFA 4B3IA 3U9TB 4KNPA 1RZXA 2I0LA 1UM1A 2V90A 3MYBA 4DI1A 1W9QA 4FN7A 4L8NA 3SOEA 2X7ZA 2VSSE 1X9ZA 2DEOA 5HEDA 2HE2A 2PDZA 1TH8B 4K6YA 4K72A 5DZKH 2M0ZA 3NFKA 2F6QA 3CYYA 2X58A 2FCFA 2EEGA 4NXQA 3C0KA 2Q34A 3H0JA 1N99A 5G1EA 1WHAA 1SBOA 1WZ8A 4E3BA 3VSEA 4JWVA 4L6WA 4JJ0A 5HEBA 2JSNA 4OMRA 2HE4A 5MGBA 3D3UA 3TSWA 3QO6A 5HFEA 2L97A 2OS6A 4FZWC 2P3WA 3O5NA 2J5GA 4H11A 2KG2A 4KFVA 1U3BA 1VA8A 1WXXA 3CH8A 2VZ5A 2JWEA 3GDSA 3I4WA 3MH4A 3QIKA 3Q7HA 3T6OA 4B3JA 4HNKA 2VSPA 1TILB 5CTBA 1RGRA 2G5MB 3LNYA 2KQFA 3GABA 4Q2PA 2FW2A 2LOBA 1TP3A 4NNMA 2VY9A 4JCSA 1UHPA 3AXAA 1X8SA 2ZOAA 4FNBA 2LA8A 2JIKA 4NXPA 2YTWA 4Z33A 2DB5A 3O46A 5HDYA 2KRGA 1MFGA 5ILBA 3CS0A 2CE3A 1V62A 3SHUA 4JOHA 4Q2OA 2JREA 2YJGA 2VSSF 2J5SA 3OIRA 2A7SA 1MFLA 4IZDA 1UJDA 2CWWA 2Q9VA 1UM7A 2H2CA 2QKTA 2AS0A 3NJBA 1OBZA 2EEHA 2IWPA 1HZDA 1D5GA 2F9IA 5EZBA 3MOYA 3IB9A 2EGOA 3U9RB 4AMHA 3M6NA 5INGA 3PDZA 3N6RB 1BFEA 1WJLA 5DTWA 2OZFA 1UEZA 4DGFA 4Q0GA 1YG8A 2C8TA 5EUSA 5HUQA 2EDVA 4JJTA 4RCNA 2QG1A 4UU6A 2F6IA 3RSTA 2QBWA 3L4FD 3V8VA 5E6PB 1N7EA 3DORA 4UU5A 2PBPA 3TRRA 3ZWAA 5D13A 3FDUA 3KQFA 2F9YA 2BYGA 2ZPLA 5E22A 2DXNA 2QKVA 4QFEA 1X5QA 4HC8A 1WIFA 4ASIA 5E0SH 3QGLA 5FIFA 5JBWA 3BEZA 1RY4A 1P1EA 4YYXA 1X5NA 2ZQQA 1DUBA 2PKTA 4NMSA 2PKUA 4DMGA 4O06A 4NNQA 4K76A 3D03A 4KPKA 2KOHA 2WL7A 3LDFA 3I1EA 4L8KA 5KJPA 4FB8A 2DLSA 3PGQA 5DTHA 2UZCA 1DCIA 4ZDBA 4EMMA 1Q3PA 1NZYA 4J2UA 2D8IA 2I1NA 3GDUA 4REYA 3CBZA 1WFGA 4JOFA 1BPLA 2OASA 3H02A 3ID4A 1I92A 3BPUA 3NFLA 5DU6A 1V5LA 3L3SA 2K20A 1FC7A 1U37A 4AE2A 5G1SA 3SWXA 3SFJA 1QAVA 2EHRA 4NMVA 2VSUA 3M6MA 3T88A 4FLNA 3SLLA 2W4FA 4ELSA 2A7KA 2LC6A 3U9SB 1UF1A 3GVKA 2DUBA 2VSVA 3HINA 2REYA 4QIJA 1P1DA 4OG1A 4P0CA 1FCFA 1WDKA 5EZ0A 1TE0A 2DKRA 5GNDA 3LAOA 2R4HA 3ZXNA 3I18A 4K2NA 4WCZA 4U19A 4NARA 3H81A 2L4TA 1XNYA 2Q3GA 5EUUA 3ZW9A 3Q1TA 4KFWA 3RLEA 2KA9A 1V0EA 5C90A 3GGEA 1VCWA 3MGLA 3H0UA 1X45A 1WF7A 2Q35A 3E17A 5JBXA 4AEJA 1VJ6A 2ZO9B 3GK7A 3H0QA 3PV5A 1WDMA 3JU4A 3NJDA 2ZQRA 4JOPA 1PJHA 1TP5A 4EMPA 3KTJA 3KZDA 2CSSA 3T8BA 1Y8TA 4Q2NA 3K8XA 1THNB 2W3PA 1OD4A 2EAQA 3R0HA 4HOPA 4JOJA 2VPHA 1JXZA 1Q7XA 1RJNA 4JFCA 4OLQA 5E1YA 4U0GA 3EGHC 2X24A 1SOTA 3G64A 2PG8A 4GVCA 2F9IB 5E21A 1WXWA 2EV8A 1UITA 2JOAA 4JORA 4K78A 1GQ5A 2H3MA 3OC7A
chains in the Genus database with same CATH topology
5HFFA 2ZL4A 3OMEA 3TVUA 3PV4A 1MC7A 4GHNA 2D3TA 3MOGA 4FN8A 3QREA 1N6DA 4K75A 5DUFA 4RYFH 3ZRTA 1TYFA 3OT6A 3QJNA 3T3WA 1HNUA 2YUYA 1Y7NA 5I7ZA 4R2ZA 1X6DA 3TT6A 4NMOA 2IWOA 2F9YB 4E35A 4MI2A 2VSSA 4K29A 5IL9A 5C9GA 2DM8A 3VQFA 1O8UA 1UYVA 2EGNA 4FZWA 1IU2A 4JOKA 2PA1A 3PZKA 2ZL0A 1FC9A 4WYTA 2M10A 1WFVA 3BF0A 3KTIA 3QMJA 1XO6A 1PIXA 2AWXA 1EY3A 1ZUBA 3QXIA 4Q1IA 2D92A 1Q52A 2VRFA 1UYRA 1U39A 4MOUA 3EGGC 3KHFA 3H0SA 3HPMA 4NXRA 2HW5A 1WI2A 4EDJA 4JOTA 3DJ3A 4JSBA 5HFBA 3V5EA 5EYZA 4FGMA 1NZYB 1ZOKA 5DTPA 2LUIA 3IBBA 3BPTA 5JXBA 3CC0A 4Z8JA 3P2LA 3GLMA 5IKLB 5B6LA 3DJAA 1Q3OA 2OSGA 3K82A 1QAVB 2VREA 1YBOA 2AINA 3ID2A 2J5IA 3JU1A 4FNDA 1W9OA 3CBXA 3Q0GA 1ON9A 3GKBA 1WI4A 4RI0A 2OMJA 4U0GH 3K50A 1R6JA 4JC0A 1IHJA 3KTKA 5HFCA 3LKEA 4HDTA 1N7TA 2Q2XA 3B76A 3QDOA 2KL1A 2RRMA 3R68A 5HFDA 1X0UA 1N7FA 2GZVA 2J5GD 2Z9IA 4ELWA 1I16A 2KV8A 4N6XA 2R3YA 3T89A 1WH1A 5HF4A 2ZPMA 5FHTA 1K39A 2QKUA 4IZCA 3R69A 4NMRA 3WG5A 2I6VA 1UEPA 2EJ5A 3CBYA 3QXZA 3RL7A 2BZRA 1SG4A 2KOMA 3T8AA 2AWUA 3PV2A 4YDPA 2KOJA 1MJ3A 1ON3A 3R9TA 4ZDDA 4B3HA 4HOPB 3HLN1 4JYLA 2Z17A 3DJ1A 1WHDA 3QK8A 1UFXA 2IWNA 1V1TA 1UEWA 3ZWCA 2KJDA 1KY9A 3V5IA 2V1WA 2DLUA 2NP9A 4QIIA 5INFA 1J7XA 2PPYA 2GEFA 3R6HA 4ZDCA 2DJTA 3IAVA 3KDKA 1TG6A 1OZIA 1UEQA 2JXOA 3HVQC 2QT5A 2O2TA 1Y7OA 4F47A 1XNWA 3GF7A 2ENOA 3ST9A 2ZL3A 1XX4A 2EDZA 1W2XA 4NEKA 2DMZA 1T2MA 1SZOA 3TLFA 3PS4A 4ELXA 1N6EA 2EEJA 2EJYA 1Z87A 1KWAA 2FZSA 3PEAA 2L4SA 3ID3A 4ZDFA 4NNLA 4GVDA 2M0UA 5E11A 2PZDA 3PE8A 1GM1A 3TDCA 1PDRA 3FF6A 1XNVA 4U0HA 2AWWA 3R9QA 1XZ9A 1K32A 3TMHA 2I0IA 3I47A 3FY5A 3R0OA 3GJ9A 4IZBA 2VWRA 4FJWD 2RRLA 3GCNA 1YG6A 4JOGA 1QLCA 5E0SA 3MFMA 1TQ3A 5KDRA 2IWQA 2KJKA 1UJVA 3VIVA 2YT8A 3MT6A 1Q51A 3HE2A 1OBYA 2EDPA 1V5QA 3OTPA 5HJ1A 3GF3A 2W7RA 3LNXA 3KZEA 4JYJA 3MH6A 1NTEA 3GMFA 4KD6A 4Q6SA 1EF8A 2KPLA 5G1RA 3OU0A 3PDVA 2GTRA 1UJUA 3HP0A 1G9OA 1GQ4A 3VQGA 3TT7A 4ZDEA 4L1CA 5DKPA 3SUZA 1N6FA 2J5IB 4JCQA 3QWDA 4I42A 2KBSA 1RJMA 2HGAA 2OGPA 3GHFA 3K1RA 4I52A 2JILA 3TVWA 2WTBA 1HNOA 4K3WA 3JXTA 1VRGA 2FN5A 2PNTA 5A2PA 2UZFA 3DUPA 2FE5A 4WYUA 4OEPA 4U1AA 2I4SA 4U18A 1FC6A 2J5II 5DU8A 2CSJA 2MHOA 2LC7A 4WZ8B 5H3JA 3TV5A 3Q0JA 2KPKA 3RSIA 4JJ3A 1VB7A 2YUBA 3ISAA 5DU4A 1W9EA 4P2AB 4Q3HA 2OPGA 2G2LA 2M0VA 3TSZA 4F8KA 4ZU2A 4KWBA 2VSUE 2KJPA 1V6BA 3GMAA 2JINA 2RCZA 2KAWA 5DZKA 1UYSA 4LMMA 3QJMA 4YLHA 2EXGA 3HPKA 2F0AA 3BPPA 3QYRA 3WKMA 2E7KA 2YT7A 2CBYA 1OBXA 2OQSA 3KDGA 5CTCA 5DL1A 3KTHA 2FBMA 2VSUC 5GLJA 4PQWA 2DAZA 5INIA 1UIYA 4JCTA 2A81A 1M5ZA 2M0TA 4I4ZA 5B42A 1Z86A 4NMQA 4JCRA 4WYOB 1QAUA 2EGKA 5F3XA 1L6OA 1EF9A 2MX6A 3TSVA 3R9SA 5HF1A 4NMTA 4OAJA 1OD2A 2QQ3A 3SHWA 2K1ZA 3P85A 2H3LA 2I04A 2OCSA 5FB8C 4RYFA 4E34A 3GSLA 3ZWBA 3RRVA 2DXLA 3RL8A 2CS5A 2M3MA 1SOZA 4LK5A 2KYLA 1WG6A 4NMPA 3STJA 3ID1A 2IEXA 3ZW8A 2VSUF 4JOEA 2H2BA 1WDLA 1WF8A 2D90A 4MPAA 4JVTA 3WKLA 1X5RA 5HEYA 4MXIA 4JL7A 1VAEA 3QKAA 4G69A 4OEOA 1U38A 5HETA 3STAA 4IC6A 4G2RA 1IU0A 4EMLA 4Z0MA 5KDRB 4XHVA 1BE9A 1LCYA 2EEIA 5G1DA 3TZ3A 1UYTA 3KTGA 2VX2A 1RGWA 4Q6HA 3HRXA 5DUCA 3DIWA 3MH7A 2F5YA 2ZL2A 5E0NX 5FUSA 3P5MA 3GDVA 1B8QA 3GCOA 4GM2A 2FNEA 3QE1A 2DC2A 3NCVA 5F67A 5G1QA 3NGHA 4Q2QA 1NF3C 1KEFA 4B3IA 3U9TB 4KNPA 1RZXA 2I0LA 1UM1A 2V90A 3MYBA 4DI1A 1W9QA 4FN7A 4L8NA 3SOEA 2X7ZA 2VSSE 1X9ZA 2DEOA 5HEDA 2HE2A 2PDZA 4K6YA 4K72A 5DZKH 2M0ZA 3NFKA 2F6QA 3CYYA 2X58A 2FCFA 2EEGA 4NXQA 2Q34A 3H0JA 1N99A 5G1EA 1WHAA 1WZ8A 4E3BA 4JWVA 4L6WA 4JJ0A 5HEBA 2JSNA 4OMRA 2HE4A 5MGBA 3TSWA 3QO6A 5HFEA 2L97A 2OS6A 4FZWC 2P3WA 3O5NA 2J5GA 4H11A 2KG2A 4KFVA 1U3BA 1VA8A 3CH8A 2VZ5A 2JWEA 3GDSA 3I4WA 3MH4A 3QIKA 3Q7HA 4B3JA 4HNKA 2VSPA 5CTBA 1RGRA 2G5MB 3LNYA 2KQFA 3GABA 4Q2PA 2FW2A 2LOBA 1TP3A 4NNMA 4JCSA 1UHPA 3AXAA 1X8SA 2ZOAA 4FNBA 2LA8A 2JIKA 4NXPA 2YTWA 4Z33A 2DB5A 3O46A 5HDYA 2KRGA 1MFGA 5ILBA 3CS0A 2CE3A 1V62A 3SHUA 4JOHA 4Q2OA 2JREA 2YJGA 2VSSF 2J5SA 2A7SA 1MFLA 4IZDA 1UJDA 2Q9VA 1UM7A 2H2CA 2QKTA 3NJBA 1OBZA 2EEHA 2IWPA 1HZDA 1D5GA 2F9IA 3MOYA 3IB9A 2EGOA 3U9RB 4AMHA 3M6NA 5INGA 3PDZA 3N6RB 1BFEA 1WJLA 5DTWA 2OZFA 1UEZA 4Q0GA 1YG8A 2C8TA 5HUQA 2EDVA 4JJTA 4RCNA 2QG1A 4UU6A 2F6IA 3RSTA 2QBWA 3L4FD 5E6PB 1N7EA 3DORA 4UU5A 2PBPA 3TRRA 3ZWAA 5D13A 3FDUA 3KQFA 2F9YA 2BYGA 2ZPLA 5E22A 2DXNA 2QKVA 4QFEA 1X5QA 4HC8A 1WIFA 4ASIA 5E0SH 3QGLA 5FIFA 5JBWA 3BEZA 1RY4A 1P1EA 4YYXA 1X5NA 2ZQQA 1DUBA 2PKTA 4NMSA 2PKUA 4NNQA 4O06A 4K76A 3D03A 4KPKA 2KOHA 2WL7A 3I1EA 4L8KA 5KJPA 4FB8A 2DLSA 3PGQA 5DTHA 2UZCA 1DCIA 4ZDBA 4EMMA 1Q3PA 1NZYA 4J2UA 2D8IA 2I1NA 3GDUA 4REYA 3CBZA 1WFGA 4JOFA 1BPLA 3H02A 3ID4A 1I92A 3BPUA 3NFLA 5DU6A 1V5LA 3L3SA 2K20A 1FC7A 1U37A 4AE2A 5G1SA 3SWXA 3SFJA 1QAVA 2EHRA 4NMVA 2VSUA 3M6MA 3T88A 4FLNA 3SLLA 2W4FA 4ELSA 2A7KA 2LC6A 3U9SB 1UF1A 2DUBA 2VSVA 3HINA 2REYA 4QIJA 1P1DA 4OG1A 4P0CA 1FCFA 1WDKA 5EZ0A 1TE0A 2DKRA 5GNDA 3LAOA 2R4HA 3I18A 4K2NA 4WCZA 4U19A 4NARA 3H81A 2L4TA 1XNYA 2Q3GA 3ZW9A 3Q1TA 4KFWA 3RLEA 2KA9A 5C90A 3GGEA 1VCWA 3H0UA 1X45A 1WF7A 2Q35A 3E17A 5JBXA 4AEJA 1VJ6A 2ZO9B 3H0QA 3PV5A 1WDMA 3NJDA 2ZQRA 4JOPA 1PJHA 1TP5A 4EMPA 3KTJA 3KZDA 2CSSA 3T8BA 1Y8TA 4Q2NA 3K8XA 2W3PA 1OD4A 2EAQA 3R0HA 4HOPA 4JOJA 2VPHA 1JXZA 1Q7XA 1RJNA 4JFCA 4OLQA 5E1YA 4U0GA 3EGHC 2X24A 1SOTA 3G64A 2PG8A 4GVCA 2F9IB 5E21A 2EV8A 1UITA 2JOAA 4JORA 4K78A 1GQ5A 2H3MA 3OC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFF A;  2ZL4 A;  3OME A;  3TVU A;  3PV4 A;  1MC7 A;  4GHN A;  2D3T A;  4FN8 A;  3QRE A;  1N6D A;  4K75 A;  5DUF A;  4RYF H;  3ZRT A;  1TYF A;  3OT6 A;  3QJN A;  3T3W A;  1HNU A;  2YUY A;  1Y7N A;  5I7Z A;  4R2Z A;  1X6D A;  3TT6 A;  4NMO A;  2IWO A;  2F9Y B;  4E35 A;  4MI2 A;  2VSS A;  4K29 A;  5C9G A;  2DM8 A;  3VQF A;  1O8U A;  1UYV A;  2EGN A;  4FZW A;  1IU2 A;  4JOK A;  2PA1 A;  3PZK A;  2ZL0 A;  1FC9 A;  4WYT A;  2M10 A;  1WFV A;  3BF0 A;  3KTI A;  3QMJ A;  1XO6 A;  1PIX A;  2AWX A;  1EY3 A;  1ZUB A;  3QXI A;  4Q1I A;  2D92 A;  1Q52 A;  2VRF A;  1UYR A;  1U39 A;  4MOU A;  3EGG C;  3KHF A;  3H0S A;  3HPM A;  4NXR A;  2HW5 A;  1WI2 A;  4EDJ A;  4JOT A;  3DJ3 A;  4JSB A;  5HFB A;  3V5E A;  5EYZ A;  4FGM A;  1NZY B;  1ZOK A;  5DTP A;  2LUI A;  3IBB A;  5JXB A;  3CC0 A;  4Z8J A;  3P2L A;  3GLM A;  5IKL B;  5B6L A;  3DJA A;  1Q3O A;  2OSG A;  3K82 A;  1QAV B;  2VRE A;  1YBO A;  2AIN A;  3ID2 A;  2J5I A;  3JU1 A;  4FND A;  1W9O A;  3CBX A;  3Q0G A;  1ON9 A;  3GKB A;  1WI4 A;  4RI0 A;  2OMJ A;  4U0G H;  3K50 A;  1R6J A;  3KTK A;  1IHJ A;  3LKE A;  5HFC A;  1N7T A;  2Q2X A;  3B76 A;  3QDO A;  2KL1 A;  2RRM A;  3R68 A;  5HFD A;  1X0U A;  1N7F A;  2GZV A;  2J5G D;  2Z9I A;  1I16 A;  2KV8 A;  4N6X A;  2R3Y A;  3T89 A;  1WH1 A;  5HF4 A;  2ZPM A;  5FHT A;  1K39 A;  2QKU A;  4IZC A;  3R69 A;  4NMR A;  3WG5 A;  2I6V A;  1UEP A;  2EJ5 A;  3CBY A;  3QXZ A;  3RL7 A;  2BZR A;  1SG4 A;  2KOM A;  3T8A A;  2AWU A;  3PV2 A;  4YDP A;  2KOJ A;  1MJ3 A;  1ON3 A;  3R9T A;  4ZDD A;  4B3H A;  4HOP B;  3HLN 1;  4JYL A;  2Z17 A;  3DJ1 A;  1WHD A;  3QK8 A;  1UFX A;  2IWN A;  1V1T A;  1UEW A;  3ZWC A;  2KJD A;  1KY9 A;  3V5I A;  2V1W A;  2DLU A;  2NP9 A;  4QII A;  5INF A;  1J7X A;  2PPY A;  3R6H A;  4ZDC A;  2DJT A;  3IAV A;  1TG6 A;  1OZI A;  1UEQ A;  2JXO A;  3HVQ C;  2QT5 A;  2O2T A;  1Y7O A;  4F47 A;  1XNW A;  3GF7 A;  2ENO A;  3ST9 A;  2ZL3 A;  1XX4 A;  2EDZ A;  1W2X A;  4NEK A;  2DMZ A;  1T2M A;  1SZO A;  3TLF A;  3PS4 A;  4ELX A;  1N6E A;  2EEJ A;  2EJY A;  1Z87 A;  1KWA A;  2FZS A;  3PEA A;  2L4S A;  3ID3 A;  4ZDF A;  4NNL A;  4GVD A;  2M0U A;  5E11 A;  2PZD A;  3PE8 A;  1GM1 A;  3TDC A;  1PDR A;  3FF6 A;  1XNV A;  4U0H A;  2AWW A;  3R9Q A;  1XZ9 A;  1K32 A;  3TMH A;  2I0I A;  3I47 A;  3FY5 A;  3R0O A;  3GJ9 A;  4IZB A;  2VWR A;  4FJW D;  3GCN A;  1YG6 A;  4JOG A;  1QLC A;  5E0S A;  3MFM A;  1TQ3 A;  5KDR A;  2IWQ A;  2KJK A;  1UJV A;  3VIV A;  2YT8 A;  3MT6 A;  1Q51 A;  3HE2 A;  1OBY A;  2EDP A;  1V5Q A;  3OTP A;  5HJ1 A;  3GF3 A;  2W7R A;  3LNX A;  3KZE A;  4JYJ A;  3MH6 A;  1NTE A;  4KD6 A;  4Q6S A;  1EF8 A;  2KPL A;  5G1R A;  3OU0 A;  3PDV A;  2GTR A;  1UJU A;  3HP0 A;  1G9O A;  1GQ4 A;  3VQG A;  3TT7 A;  4ZDE A;  5DKP A;  3SUZ A;  1N6F A;  2J5I B;  4JCQ A;  3QWD A;  4I42 A;  2KBS A;  1RJM A;  2HGA A;  2OGP A;  3K1R A;  4I52 A;  2JIL A;  3TVW A;  2WTB A;  1HNO A;  4K3W A;  3JXT A;  1VRG A;  2FN5 A;  2PNT A;  5A2P A;  2UZF A;  2FE5 A;  4WYU A;  4OEP A;  4U1A A;  2I4S A;  4U18 A;  1FC6 A;  2J5I I;  5DU8 A;  2CSJ A;  2MHO A;  2LC7 A;  4WZ8 B;  5H3J A;  3TV5 A;  3Q0J A;  2KPK A;  3RSI A;  1VB7 A;  2YUB A;  3ISA A;  5DU4 A;  1W9E A;  4P2A B;  4Q3H A;  2OPG A;  2G2L A;  2M0V A;  3TSZ A;  4F8K A;  4ZU2 A;  4KWB A;  2VSU E;  2KJP A;  1V6B A;  3GMA A;  2JIN A;  2RCZ A;  2KAW A;  5DZK A;  1UYS A;  4LMM A;  3QJM A;  4YLH A;  2EXG A;  3HPK A;  2F0A A;  3BPP A;  3QYR A;  3WKM A;  2E7K A;  2YT7 A;  2CBY A;  1OBX A;  2OQS A;  5CTC A;  5DL1 A;  3KTH A;  2FBM A;  2VSU C;  5GLJ A;  4PQW A;  2DAZ A;  5INI A;  1UIY A;  4JCT A;  2A81 A;  1M5Z A;  2M0T A;  4I4Z A;  1Z86 A;  4NMQ A;  4JCR A;  4WYO B;  1QAU A;  2EGK A;  5F3X A;  1L6O A;  1EF9 A;  2MX6 A;  3TSV A;  3R9S A;  5HF1 A;  4NMT A;  4OAJ A;  1OD2 A;  2QQ3 A;  3SHW A;  2K1Z A;  3P85 A;  2H3L A;  2I04 A;  2OCS A;  5FB8 C;  4RYF A;  4E34 A;  3GSL A;  3ZWB A;  3RRV A;  3RL8 A;  2CS5 A;  2M3M A;  1SOZ A;  4LK5 A;  2KYL A;  1WG6 A;  4NMP A;  3STJ A;  3ID1 A;  2IEX A;  3ZW8 A;  2VSU F;  4JOE A;  2H2B A;  1WDL A;  1WF8 A;  2D90 A;  4MPA A;  4JVT A;  3WKL A;  1X5R A;  5HEY A;  4MXI A;  4JL7 A;  1VAE A;  3QKA A;  4G69 A;  4OEO A;  1U38 A;  5HET A;  3STA A;  4IC6 A;  4G2R A;  1IU0 A;  4EML A;  4Z0M A;  5KDR B;  4XHV A;  1BE9 A;  1LCY A;  2EEI A;  5G1D A;  3TZ3 A;  1UYT A;  3KTG A;  2VX2 A;  1RGW A;  4Q6H A;  3HRX A;  5DUC A;  3DIW A;  3MH7 A;  2F5Y A;  2ZL2 A;  5E0N X;  5FUS A;  3P5M A;  3GDV A;  1B8Q A;  3GCO A;  4GM2 A;  2FNE A;  3QE1 A;  2DC2 A;  5F67 A;  5G1Q A;  3NGH A;  4Q2Q A;  1NF3 C;  1KEF A;  4B3I A;  3U9T B;  4KNP A;  1RZX A;  2I0L A;  1UM1 A;  2V90 A;  3MYB A;  4DI1 A;  1W9Q A;  4FN7 A;  4L8N A;  3SOE A;  2X7Z A;  2VSS E;  2DEO A;  5HED A;  2HE2 A;  2PDZ A;  4K6Y A;  4K72 A;  5DZK H;  2M0Z A;  3NFK A;  2F6Q A;  3CYY A;  2X58 A;  2FCF A;  2EEG A;  4NXQ A;  2Q34 A;  3H0J A;  1N99 A;  5G1E A;  1WHA A;  1WZ8 A;  4E3B A;  4JWV A;  4L6W A;  5HEB A;  4OMR A;  5MGB A;  2HE4 A;  3TSW A;  3QO6 A;  5HFE A;  2L97 A;  2OS6 A;  4FZW C;  2P3W A;  3O5N A;  2J5G A;  4H11 A;  2KG2 A;  4KFV A;  1U3B A;  1VA8 A;  3CH8 A;  2VZ5 A;  2JWE A;  3GDS A;  3I4W A;  3MH4 A;  3QIK A;  3Q7H A;  4B3J A;  4HNK A;  2VSP A;  5CTB A;  1RGR A;  2G5M B;  3LNY A;  2KQF A;  4Q2P A;  2FW2 A;  2LOB A;  1TP3 A;  4NNM A;  4JCS A;  1UHP A;  3AXA A;  1X8S A;  4FNB A;  2LA8 A;  2JIK A;  4NXP A;  2YTW A;  4Z33 A;  2DB5 A;  3O46 A;  5HDY A;  2KRG A;  1MFG A;  4ELW A;  3CS0 A;  2CE3 A;  1V62 A;  3SHU A;  4JOH A;  4Q2O A;  2JRE A;  2VSS F;  2J5S A;  2A7S A;  1MFL A;  4IZD A;  1UJD A;  2Q9V A;  1UM7 A;  2H2C A;  2QKT A;  3NJB A;  1OBZ A;  2EEH A;  2IWP A;  1HZD A;  1D5G A;  2F9I A;  3MOY A;  3IB9 A;  2EGO A;  3U9R B;  4AMH A;  3M6N A;  5ING A;  3PDZ A;  3N6R B;  1BFE A;  1WJL A;  5DTW A;  2OZF A;  1UEZ A;  4Q0G A;  1YG8 A;  2C8T A;  2EDV A;  4JJT A;  4RCN A;  2QG1 A;  4UU6 A;  2F6I A;  3RST A;  2QBW A;  3L4F D;  5E6P B;  1N7E A;  3DOR A;  4UU5 A;  2PBP A;  3TRR A;  3ZWA A;  5D13 A;  3FDU A;  3KQF A;  2F9Y A;  2BYG A;  2ZPL A;  5E22 A;  2QKV A;  4QFE A;  1X5Q A;  4HC8 A;  1WIF A;  4ASI A;  5E0S H;  3QGL A;  5FIF A;  5JBW A;  3BEZ A;  1RY4 A;  1P1E A;  4YYX A;  1X5N A;  2ZQQ A;  1DUB A;  2PKT A;  4NMS A;  2PKU A;  4NNQ A;  4O06 A;  4K76 A;  4KPK A;  2KOH A;  2WL7 A;  3I1E A;  4L8K A;  5KJP A;  4FB8 A;  2DLS A;  3PGQ A;  5DTH A;  2UZC A;  1DCI A;  4ZDB A;  4EMM A;  1Q3P A;  1NZY A;  2D8I A;  2I1N A;  3GDU A;  4REY A;  3CBZ A;  1WFG A;  4JOF A;  3H02 A;  3ID4 A;  1I92 A;  3BPU A;  3NFL A;  5DU6 A;  1V5L A;  3L3S A;  2K20 A;  1FC7 A;  1U37 A;  5G1S A;  3SWX A;  3SFJ A;  1QAV A;  2EHR A;  4NMV A;  2VSU A;  3M6M A;  3T88 A;  3SLL A;  2W4F A;  4ELS A;  2A7K A;  2LC6 A;  3U9S B;  1UF1 A;  2DUB A;  2VSV A;  3HIN A;  2REY A;  4QIJ A;  1P1D A;  4OG1 A;  4P0C A;  1FCF A;  1WDK A;  5EZ0 A;  1TE0 A;  2DKR A;  5GND A;  3LAO A;  2R4H A;  3I18 A;  4K2N A;  4WCZ A;  4U19 A;  3H81 A;  2L4T A;  1XNY A;  2Q3G A;  3ZW9 A;  3Q1T A;  4KFW A;  3RLE A;  2KA9 A;  5C90 A;  3GGE A;  1VCW A;  3H0U A;  1X45 A;  1WF7 A;  2Q35 A;  3E17 A;  5JBX A;  1VJ6 A;  3H0Q A;  3PV5 A;  1WDM A;  3NJD A;  2ZQR A;  4JOP A;  1PJH A;  1TP5 A;  4EMP A;  3KTJ A;  3KZD A;  2CSS A;  3T8B A;  1Y8T A;  4Q2N A;  3K8X A;  2W3P A;  1OD4 A;  2EAQ A;  3R0H A;  4HOP A;  4JOJ A;  2VPH A;  1JXZ A;  1Q7X A;  1RJN A;  4JFC A;  4OLQ A;  5E1Y A;  4U0G A;  3EGH C;  2X24 A;  1SOT A;  3G64 A;  2PG8 A;  4GVC A;  2F9I B;  5E21 A;  2EV8 A;  1UIT A;  2JOA A;  4JOR A;  4K78 A;  1GQ5 A;  2H3M A;  3OC7 A; 
#chains in the Genus database with same CATH topology
 5HFF A;  2ZL4 A;  3OME A;  3LKL A;  3TVU A;  3PV4 A;  1MC7 A;  4GHN A;  2D3T A;  3MOG A;  4FN8 A;  3QRE A;  1N6D A;  4K75 A;  5DUF A;  4XS5 A;  3GVL A;  4RYF H;  3IF5 A;  3ZRT A;  1TYF A;  3OT6 A;  3QJN A;  3T3W A;  1HNU A;  2YUY A;  1Y7N A;  5I7Z A;  4R2Z A;  1X6D A;  3TT6 A;  4NMO A;  2IWO A;  5EUW A;  2F9Y B;  4E35 A;  4MI2 A;  2VSS A;  4K29 A;  5IL9 A;  5C9G A;  2DM8 A;  3VQF A;  3IH8 A;  1O8U A;  1UYV A;  2EGN A;  4FZW A;  1IU2 A;  3OIZ A;  4JOK A;  2PA1 A;  3PZK A;  2ZL0 A;  1FC9 A;  4WYT A;  2M10 A;  1WFV A;  3BF0 A;  3KTI A;  3QMJ A;  1XO6 A;  1PIX A;  2AWX A;  1EY3 A;  1ZUB A;  3QXI A;  4Q1I A;  2D92 A;  1Q52 A;  2VRF A;  1UYR A;  1U39 A;  4MOU A;  3EGG C;  3KHF A;  3LLO A;  3HPM A;  4NXR A;  3H0S A;  2HW5 A;  1WI2 A;  4EDJ A;  4JOT A;  3DJ3 A;  4JSB A;  5HFB A;  3V5E A;  5EYZ A;  4FGM A;  1NZY B;  1ZOK A;  5DTP A;  2LUI A;  3IBB A;  3BPT A;  5JXB A;  3CC0 A;  4Z8J A;  3P2L A;  3GLM A;  5IKL B;  5B6L A;  3DJA A;  1Q3O A;  2OSG A;  3K82 A;  1QAV B;  2VRE A;  1AUZ A;  1YBO A;  2AIN A;  3ID2 A;  2J5I A;  3JU1 A;  4FND A;  1W9O A;  3CBX A;  3Q0G A;  1ON9 A;  3GKB A;  1WI4 A;  4RI0 A;  2OMJ A;  4U0G H;  3K50 A;  1R6J A;  4JC0 A;  1IHJ A;  1V0F A;  5HFC A;  3KTK A;  3LKE A;  1N7T A;  4HDT A;  2Q2X A;  3B76 A;  3QDO A;  2KL1 A;  2RRM A;  3R68 A;  5HFD A;  3IH9 A;  1X0U A;  3ZTB A;  1N7F A;  2GZV A;  2J5G D;  2Z9I A;  4ELW A;  3AGE A;  1I16 A;  2KV8 A;  4N6X A;  2R3Y A;  3T89 A;  1WH1 A;  5HF4 A;  2ZPM A;  5FHT A;  3IHA A;  2QKU A;  1K39 A;  4IZC A;  3R69 A;  4NMR A;  3WG5 A;  2I6V A;  5EUX A;  1UEP A;  2EJ5 A;  3CBY A;  3QXZ A;  3RL7 A;  2BZR A;  1SG4 A;  2KOM A;  3T8A A;  2AWU A;  3PV2 A;  4YDP A;  2KOJ A;  4QTP A;  1MJ3 A;  1HF2 A;  1ON3 A;  3R9T A;  4ZDD A;  4B3H A;  4HOP B;  4HIZ A;  3HLN 1;  4JYL A;  2Z17 A;  3DJ1 A;  1WHD A;  3QK8 A;  1UFX A;  2IWN A;  1V1T A;  1UEW A;  3ZWC A;  2KJD A;  1KY9 A;  3V5I A;  2V1W A;  2DLU A;  2NP9 A;  4QII A;  5INF A;  1J7X A;  2PPY A;  2GEF A;  3R6H A;  4ZDC A;  2DJT A;  3IAV A;  3KDK A;  1TG6 A;  1OZI A;  1UEQ A;  2JXO A;  3HVQ C;  2QT5 A;  2O2T A;  1Y7O A;  4F47 A;  1XNW A;  3GF7 A;  2ENO A;  3ST9 A;  2ZL3 A;  1XX4 A;  2EDZ A;  1W2X A;  4NEK A;  2DMZ A;  1T2M A;  1SZO A;  3TLF A;  3PS4 A;  4ELX A;  1N6E A;  2EEJ A;  2EJY A;  1Z87 A;  1KWA A;  2FZS A;  3PEA A;  2L4S A;  3ID3 A;  4ZDF A;  4NNL A;  4GVD A;  2M0U A;  5E11 A;  2PZD A;  1BUZ A;  1GM1 A;  3GVJ A;  3PE8 A;  3TDC A;  1PDR A;  3FF6 A;  1XNV A;  4U0H A;  2AWW A;  3R9Q A;  1XZ9 A;  1K32 A;  1H4Z A;  3TMH A;  2I0I A;  3I47 A;  3FY5 A;  3R0O A;  3GJ9 A;  4IZB A;  2VWR A;  4FJW D;  2RRL A;  3GCN A;  1YG6 A;  4JOG A;  1QLC A;  5E0S A;  3MFM A;  1TQ3 A;  5KDR A;  2IWQ A;  2KJK A;  1UJV A;  3VIV A;  2YT8 A;  3MT6 A;  1Q51 A;  3HE2 A;  1OBY A;  2EDP A;  1V5Q A;  3OTP A;  5HJ1 A;  3GF3 A;  2W7R A;  3LNX A;  3KZE A;  2KLN A;  4JYJ A;  3MH6 A;  1NTE A;  3GMF A;  3EH7 A;  4KD6 A;  4Q6S A;  1EF8 A;  2KPL A;  5G1R A;  3OU0 A;  3PDV A;  2GTR A;  1UJU A;  3HP0 A;  1G9O A;  1GQ4 A;  3VQG A;  3TT7 A;  1H4Y A;  4ZDE A;  4L1C A;  5DKP A;  3SUZ A;  1N6F A;  2J5I B;  4JCQ A;  3QWD A;  4I42 A;  2KBS A;  1RJM A;  2HGA A;  2OGP A;  3GHF A;  3K1R A;  4I52 A;  2JIL A;  4DGH A;  1H4X A;  3TVW A;  2WTB A;  1HNO A;  4K3W A;  3JXT A;  1VRG A;  2FN5 A;  2PNT A;  5A2P A;  3F43 A;  3DUP A;  2FE5 A;  4WYU A;  4OEP A;  2UZF A;  4U1A A;  2I4S A;  4U18 A;  1FC6 A;  3QDQ A;  2J5I I;  5DU8 A;  2CSJ A;  2MHO A;  2LC7 A;  4WZ8 B;  5H3J A;  3TV5 A;  3Q0J A;  2KPK A;  3RSI A;  4JJ3 A;  1VB7 A;  2YUB A;  3ISA A;  5DU4 A;  4HYL A;  1W9E A;  4P2A B;  4Q3H A;  2OPG A;  2G2L A;  2M0V A;  3TSZ A;  4F8K A;  4ZU2 A;  4KWB A;  2VSU E;  2KJP A;  1V6B A;  3GMA A;  2JIN A;  2RCZ A;  2KAW A;  5DZK A;  1UYS A;  4LMM A;  3QJM A;  4YLH A;  2EXG A;  3HPK A;  3IHB A;  2F0A A;  3BPP A;  3QYR A;  3WKM A;  2E7K A;  2YT7 A;  2CBY A;  1OBX A;  2OQS A;  3KDG A;  5CTC A;  5DL1 A;  3KTH A;  2FBM A;  2VSU C;  5GLJ A;  4PQW A;  2DAZ A;  3V97 A;  2KA5 A;  5INI A;  1UIY A;  4JCT A;  2A81 A;  1M5Z A;  2M0T A;  4I4Z A;  5B42 A;  1Z86 A;  1T6R A;  4NMQ A;  3NY7 A;  4JCR A;  4WYO B;  1QAU A;  2EGK A;  5EUZ A;  5F3X A;  1L6O A;  1EF9 A;  2MX6 A;  3TSV A;  3R9S A;  5HF1 A;  4NMT A;  4OAJ A;  1OD2 A;  2QQ3 A;  3SHW A;  1VC1 A;  2K1Z A;  3P85 A;  2H3L A;  2I04 A;  2OCS A;  5FB8 C;  4RYF A;  4E34 A;  3GSL A;  3ZWB A;  1TID B;  3RRV A;  2DXL A;  3RL8 A;  2CS5 A;  2M3M A;  1SOZ A;  4LK5 A;  2KYL A;  1WG6 A;  4NMP A;  3STJ A;  3ID1 A;  2IEX A;  3ZW8 A;  2VSU F;  3AGD A;  4JOE A;  2H2B A;  1WDL A;  1WF8 A;  2D90 A;  4MPA A;  4JVT A;  3WKL A;  1X5R A;  5HEY A;  2B78 A;  4MXI A;  4JL7 A;  1VAE A;  3QKA A;  4G69 A;  4OEO A;  1U38 A;  5HET A;  3STA A;  4IC6 A;  4G2R A;  1IU0 A;  4EML A;  4Z0M A;  5KDR B;  4XHV A;  1BE9 A;  1LCY A;  2EEI A;  5G1D A;  3TZ3 A;  1UYT A;  3KTG A;  2VX2 A;  1RGW A;  4Q6H A;  3HRX A;  5DUC A;  3DIW A;  3MH7 A;  2F5Y A;  2ZL2 A;  5E0N X;  5FUS A;  3P5M A;  3GDV A;  1B8Q A;  3GCO A;  4GM2 A;  2FNE A;  3QE1 A;  2DC2 A;  3NCV A;  5F67 A;  5G1Q A;  3NGH A;  4Q2Q A;  1NF3 C;  1KEF A;  4B3I A;  3U9T B;  4KNP A;  1RZX A;  2I0L A;  1UM1 A;  2V90 A;  3MYB A;  4DI1 A;  1W9Q A;  4FN7 A;  4L8N A;  3SOE A;  2X7Z A;  2VSS E;  1X9Z A;  2DEO A;  5HED A;  2HE2 A;  2PDZ A;  1TH8 B;  4K6Y A;  4K72 A;  5DZK H;  2M0Z A;  3NFK A;  2F6Q A;  3CYY A;  2X58 A;  2FCF A;  2EEG A;  4NXQ A;  3C0K A;  2Q34 A;  3H0J A;  1N99 A;  5G1E A;  1WHA A;  1SBO A;  1WZ8 A;  4E3B A;  3VSE A;  4JWV A;  4L6W A;  4JJ0 A;  5HEB A;  2JSN A;  4OMR A;  2HE4 A;  5MGB A;  3D3U A;  3TSW A;  3QO6 A;  5HFE A;  2L97 A;  2OS6 A;  4FZW C;  2P3W A;  3O5N A;  2J5G A;  4H11 A;  2KG2 A;  4KFV A;  1U3B A;  1VA8 A;  1WXX A;  3CH8 A;  2VZ5 A;  2JWE A;  3GDS A;  3I4W A;  3MH4 A;  3QIK A;  3Q7H A;  3T6O A;  4B3J A;  4HNK A;  2VSP A;  1TIL B;  5CTB A;  1RGR A;  2G5M B;  3LNY A;  2KQF A;  3GAB A;  4Q2P A;  2FW2 A;  2LOB A;  1TP3 A;  4NNM A;  2VY9 A;  4JCS A;  1UHP A;  3AXA A;  1X8S A;  2ZOA A;  4FNB A;  2LA8 A;  2JIK A;  4NXP A;  2YTW A;  4Z33 A;  2DB5 A;  3O46 A;  5HDY A;  2KRG A;  1MFG A;  5ILB A;  3CS0 A;  2CE3 A;  1V62 A;  3SHU A;  4JOH A;  4Q2O A;  2JRE A;  2YJG A;  2VSS F;  2J5S A;  3OIR A;  2A7S A;  1MFL A;  4IZD A;  1UJD A;  2CWW A;  2Q9V A;  1UM7 A;  2H2C A;  2QKT A;  2AS0 A;  3NJB A;  1OBZ A;  2EEH A;  2IWP A;  1HZD A;  1D5G A;  2F9I A;  5EZB A;  3MOY A;  3IB9 A;  2EGO A;  3U9R B;  4AMH A;  3M6N A;  5ING A;  3PDZ A;  3N6R B;  1BFE A;  1WJL A;  5DTW A;  2OZF A;  1UEZ A;  4DGF A;  4Q0G A;  1YG8 A;  2C8T A;  5EUS A;  5HUQ A;  2EDV A;  4JJT A;  4RCN A;  2QG1 A;  4UU6 A;  2F6I A;  3RST A;  2QBW A;  3L4F D;  3V8V A;  5E6P B;  1N7E A;  3DOR A;  4UU5 A;  2PBP A;  3TRR A;  3ZWA A;  5D13 A;  3FDU A;  3KQF A;  2F9Y A;  2BYG A;  2ZPL A;  5E22 A;  2DXN A;  2QKV A;  4QFE A;  1X5Q A;  4HC8 A;  1WIF A;  4ASI A;  5E0S H;  3QGL A;  5FIF A;  5JBW A;  3BEZ A;  1RY4 A;  1P1E A;  4YYX A;  1X5N A;  2ZQQ A;  1DUB A;  2PKT A;  4NMS A;  2PKU A;  4DMG A;  4O06 A;  4NNQ A;  4K76 A;  3D03 A;  4KPK A;  2KOH A;  2WL7 A;  3LDF A;  3I1E A;  4L8K A;  5KJP A;  4FB8 A;  2DLS A;  3PGQ A;  5DTH A;  2UZC A;  1DCI A;  4ZDB A;  4EMM A;  1Q3P A;  1NZY A;  4J2U A;  2D8I A;  2I1N A;  3GDU A;  4REY A;  3CBZ A;  1WFG A;  4JOF A;  1BPL A;  2OAS A;  3H02 A;  3ID4 A;  1I92 A;  3BPU A;  3NFL A;  5DU6 A;  1V5L A;  3L3S A;  2K20 A;  1FC7 A;  1U37 A;  4AE2 A;  5G1S A;  3SWX A;  3SFJ A;  1QAV A;  2EHR A;  4NMV A;  2VSU A;  3M6M A;  3T88 A;  4FLN A;  3SLL A;  2W4F A;  4ELS A;  2A7K A;  2LC6 A;  3U9S B;  1UF1 A;  3GVK A;  2DUB A;  2VSV A;  3HIN A;  2REY A;  4QIJ A;  1P1D A;  4OG1 A;  4P0C A;  1FCF A;  1WDK A;  5EZ0 A;  1TE0 A;  2DKR A;  5GND A;  3LAO A;  2R4H A;  3ZXN A;  3I18 A;  4K2N A;  4WCZ A;  4U19 A;  4NAR A;  3H81 A;  2L4T A;  1XNY A;  2Q3G A;  5EUU A;  3ZW9 A;  3Q1T A;  4KFW A;  3RLE A;  2KA9 A;  1V0E A;  5C90 A;  3GGE A;  1VCW A;  3MGL A;  3H0U A;  1X45 A;  1WF7 A;  2Q35 A;  3E17 A;  5JBX A;  4AEJ A;  1VJ6 A;  2ZO9 B;  3GK7 A;  3H0Q A;  3PV5 A;  1WDM A;  3JU4 A;  3NJD A;  2ZQR A;  4JOP A;  1PJH A;  1TP5 A;  4EMP A;  3KTJ A;  3KZD A;  2CSS A;  3T8B A;  1Y8T A;  4Q2N A;  3K8X A;  1THN B;  2W3P A;  1OD4 A;  2EAQ A;  3R0H A;  4HOP A;  4JOJ A;  2VPH A;  1JXZ A;  1Q7X A;  1RJN A;  4JFC A;  4OLQ A;  5E1Y A;  4U0G A;  3EGH C;  2X24 A;  1SOT A;  3G64 A;  2PG8 A;  4GVC A;  2F9I B;  5E21 A;  1WXW A;  2EV8 A;  1UIT A;  2JOA A;  4JOR A;  4K78 A;  1GQ5 A;  2H3M A;  3OC7 A; 
#chains in the Genus database with same CATH homology
 5HFF A;  2ZL4 A;  3OME A;  3TVU A;  3PV4 A;  1MC7 A;  4GHN A;  2D3T A;  3MOG A;  4FN8 A;  3QRE A;  1N6D A;  4K75 A;  5DUF A;  4RYF H;  3ZRT A;  1TYF A;  3OT6 A;  3QJN A;  3T3W A;  1HNU A;  2YUY A;  1Y7N A;  5I7Z A;  4R2Z A;  1X6D A;  3TT6 A;  4NMO A;  2IWO A;  2F9Y B;  4E35 A;  4MI2 A;  2VSS A;  4K29 A;  5IL9 A;  5C9G A;  2DM8 A;  3VQF A;  1O8U A;  1UYV A;  2EGN A;  4FZW A;  1IU2 A;  4JOK A;  2PA1 A;  3PZK A;  2ZL0 A;  1FC9 A;  4WYT A;  2M10 A;  1WFV A;  3BF0 A;  3KTI A;  3QMJ A;  1XO6 A;  1PIX A;  2AWX A;  1EY3 A;  1ZUB A;  3QXI A;  4Q1I A;  2D92 A;  1Q52 A;  2VRF A;  1UYR A;  1U39 A;  4MOU A;  3EGG C;  3KHF A;  3H0S A;  3HPM A;  4NXR A;  2HW5 A;  1WI2 A;  4EDJ A;  4JOT A;  3DJ3 A;  4JSB A;  5HFB A;  3V5E A;  5EYZ A;  4FGM A;  1NZY B;  1ZOK A;  5DTP A;  2LUI A;  3IBB A;  3BPT A;  5JXB A;  3CC0 A;  4Z8J A;  3P2L A;  3GLM A;  5IKL B;  5B6L A;  3DJA A;  1Q3O A;  2OSG A;  3K82 A;  1QAV B;  2VRE A;  1YBO A;  2AIN A;  3ID2 A;  2J5I A;  3JU1 A;  4FND A;  1W9O A;  3CBX A;  3Q0G A;  1ON9 A;  3GKB A;  1WI4 A;  4RI0 A;  2OMJ A;  4U0G H;  3K50 A;  1R6J A;  4JC0 A;  1IHJ A;  3KTK A;  5HFC A;  3LKE A;  4HDT A;  1N7T A;  2Q2X A;  3B76 A;  3QDO A;  2KL1 A;  2RRM A;  3R68 A;  5HFD A;  1X0U A;  1N7F A;  2GZV A;  2J5G D;  2Z9I A;  4ELW A;  1I16 A;  2KV8 A;  4N6X A;  2R3Y A;  3T89 A;  1WH1 A;  5HF4 A;  2ZPM A;  5FHT A;  1K39 A;  2QKU A;  4IZC A;  3R69 A;  4NMR A;  3WG5 A;  2I6V A;  1UEP A;  2EJ5 A;  3CBY A;  3QXZ A;  3RL7 A;  2BZR A;  1SG4 A;  2KOM A;  3T8A A;  2AWU A;  3PV2 A;  4YDP A;  2KOJ A;  1MJ3 A;  1ON3 A;  3R9T A;  4ZDD A;  4B3H A;  4HOP B;  3HLN 1;  4JYL A;  2Z17 A;  3DJ1 A;  1WHD A;  3QK8 A;  1UFX A;  2IWN A;  1V1T A;  1UEW A;  3ZWC A;  2KJD A;  1KY9 A;  3V5I A;  2V1W A;  2DLU A;  2NP9 A;  4QII A;  5INF A;  1J7X A;  2PPY A;  2GEF A;  3R6H A;  4ZDC A;  2DJT A;  3IAV A;  3KDK A;  1TG6 A;  1OZI A;  1UEQ A;  2JXO A;  3HVQ C;  2QT5 A;  2O2T A;  1Y7O A;  4F47 A;  1XNW A;  3GF7 A;  2ENO A;  3ST9 A;  2ZL3 A;  1XX4 A;  2EDZ A;  1W2X A;  4NEK A;  2DMZ A;  1T2M A;  1SZO A;  3TLF A;  3PS4 A;  4ELX A;  1N6E A;  2EEJ A;  2EJY A;  1Z87 A;  1KWA A;  2FZS A;  3PEA A;  2L4S A;  3ID3 A;  4ZDF A;  4NNL A;  4GVD A;  2M0U A;  5E11 A;  2PZD A;  3PE8 A;  1GM1 A;  3TDC A;  1PDR A;  3FF6 A;  1XNV A;  4U0H A;  2AWW A;  3R9Q A;  1XZ9 A;  1K32 A;  3TMH A;  2I0I A;  3I47 A;  3FY5 A;  3R0O A;  3GJ9 A;  4IZB A;  2VWR A;  4FJW D;  2RRL A;  3GCN A;  1YG6 A;  4JOG A;  1QLC A;  5E0S A;  3MFM A;  1TQ3 A;  5KDR A;  2IWQ A;  2KJK A;  1UJV A;  3VIV A;  2YT8 A;  3MT6 A;  1Q51 A;  3HE2 A;  1OBY A;  2EDP A;  1V5Q A;  3OTP A;  5HJ1 A;  3GF3 A;  2W7R A;  3LNX A;  3KZE A;  4JYJ A;  3MH6 A;  1NTE A;  3GMF A;  4KD6 A;  4Q6S A;  1EF8 A;  2KPL A;  5G1R A;  3OU0 A;  3PDV A;  2GTR A;  1UJU A;  3HP0 A;  1G9O A;  1GQ4 A;  3VQG A;  3TT7 A;  4ZDE A;  4L1C A;  5DKP A;  3SUZ A;  1N6F A;  2J5I B;  4JCQ A;  3QWD A;  4I42 A;  2KBS A;  1RJM A;  2HGA A;  2OGP A;  3GHF A;  3K1R A;  4I52 A;  2JIL A;  3TVW A;  2WTB A;  1HNO A;  4K3W A;  3JXT A;  1VRG A;  2FN5 A;  2PNT A;  5A2P A;  2UZF A;  3DUP A;  2FE5 A;  4WYU A;  4OEP A;  4U1A A;  2I4S A;  4U18 A;  1FC6 A;  2J5I I;  5DU8 A;  2CSJ A;  2MHO A;  2LC7 A;  4WZ8 B;  5H3J A;  3TV5 A;  3Q0J A;  2KPK A;  3RSI A;  4JJ3 A;  1VB7 A;  2YUB A;  3ISA A;  5DU4 A;  1W9E A;  4P2A B;  4Q3H A;  2OPG A;  2G2L A;  2M0V A;  3TSZ A;  4F8K A;  4ZU2 A;  4KWB A;  2VSU E;  2KJP A;  1V6B A;  3GMA A;  2JIN A;  2RCZ A;  2KAW A;  5DZK A;  1UYS A;  4LMM A;  3QJM A;  4YLH A;  2EXG A;  3HPK A;  2F0A A;  3BPP A;  3QYR A;  3WKM A;  2E7K A;  2YT7 A;  2CBY A;  1OBX A;  2OQS A;  3KDG A;  5CTC A;  5DL1 A;  3KTH A;  2FBM A;  2VSU C;  5GLJ A;  4PQW A;  2DAZ A;  5INI A;  1UIY A;  4JCT A;  2A81 A;  1M5Z A;  2M0T A;  4I4Z A;  5B42 A;  1Z86 A;  4NMQ A;  4JCR A;  4WYO B;  1QAU A;  2EGK A;  5F3X A;  1L6O A;  1EF9 A;  2MX6 A;  3TSV A;  3R9S A;  5HF1 A;  4NMT A;  4OAJ A;  1OD2 A;  2QQ3 A;  3SHW A;  2K1Z A;  3P85 A;  2H3L A;  2I04 A;  2OCS A;  5FB8 C;  4RYF A;  4E34 A;  3GSL A;  3ZWB A;  3RRV A;  2DXL A;  3RL8 A;  2CS5 A;  2M3M A;  1SOZ A;  4LK5 A;  2KYL A;  1WG6 A;  4NMP A;  3STJ A;  3ID1 A;  2IEX A;  3ZW8 A;  2VSU F;  4JOE A;  2H2B A;  1WDL A;  1WF8 A;  2D90 A;  4MPA A;  4JVT A;  3WKL A;  1X5R A;  5HEY A;  4MXI A;  4JL7 A;  1VAE A;  3QKA A;  4G69 A;  4OEO A;  1U38 A;  5HET A;  3STA A;  4IC6 A;  4G2R A;  1IU0 A;  4EML A;  4Z0M A;  5KDR B;  4XHV A;  1BE9 A;  1LCY A;  2EEI A;  5G1D A;  3TZ3 A;  1UYT A;  3KTG A;  2VX2 A;  1RGW A;  4Q6H A;  3HRX A;  5DUC A;  3DIW A;  3MH7 A;  2F5Y A;  2ZL2 A;  5E0N X;  5FUS A;  3P5M A;  3GDV A;  1B8Q A;  3GCO A;  4GM2 A;  2FNE A;  3QE1 A;  2DC2 A;  3NCV A;  5F67 A;  5G1Q A;  3NGH A;  4Q2Q A;  1NF3 C;  1KEF A;  4B3I A;  3U9T B;  4KNP A;  1RZX A;  2I0L A;  1UM1 A;  2V90 A;  3MYB A;  4DI1 A;  1W9Q A;  4FN7 A;  4L8N A;  3SOE A;  2X7Z A;  2VSS E;  1X9Z A;  2DEO A;  5HED A;  2HE2 A;  2PDZ A;  4K6Y A;  4K72 A;  5DZK H;  2M0Z A;  3NFK A;  2F6Q A;  3CYY A;  2X58 A;  2FCF A;  2EEG A;  4NXQ A;  2Q34 A;  3H0J A;  1N99 A;  5G1E A;  1WHA A;  1WZ8 A;  4E3B A;  4JWV A;  4L6W A;  4JJ0 A;  5HEB A;  2JSN A;  4OMR A;  2HE4 A;  5MGB A;  3TSW A;  3QO6 A;  5HFE A;  2L97 A;  2OS6 A;  4FZW C;  2P3W A;  3O5N A;  2J5G A;  4H11 A;  2KG2 A;  4KFV A;  1U3B A;  1VA8 A;  3CH8 A;  2VZ5 A;  2JWE A;  3GDS A;  3I4W A;  3MH4 A;  3QIK A;  3Q7H A;  4B3J A;  4HNK A;  2VSP A;  5CTB A;  1RGR A;  2G5M B;  3LNY A;  2KQF A;  3GAB A;  4Q2P A;  2FW2 A;  2LOB A;  1TP3 A;  4NNM A;  4JCS A;  1UHP A;  3AXA A;  1X8S A;  2ZOA A;  4FNB A;  2LA8 A;  2JIK A;  4NXP A;  2YTW A;  4Z33 A;  2DB5 A;  3O46 A;  5HDY A;  2KRG A;  1MFG A;  5ILB A;  3CS0 A;  2CE3 A;  1V62 A;  3SHU A;  4JOH A;  4Q2O A;  2JRE A;  2YJG A;  2VSS F;  2J5S A;  2A7S A;  1MFL A;  4IZD A;  1UJD A;  2Q9V A;  1UM7 A;  2H2C A;  2QKT A;  3NJB A;  1OBZ A;  2EEH A;  2IWP A;  1HZD A;  1D5G A;  2F9I A;  3MOY A;  3IB9 A;  2EGO A;  3U9R B;  4AMH A;  3M6N A;  5ING A;  3PDZ A;  3N6R B;  1BFE A;  1WJL A;  5DTW A;  2OZF A;  1UEZ A;  4Q0G A;  1YG8 A;  2C8T A;  5HUQ A;  2EDV A;  4JJT A;  4RCN A;  2QG1 A;  4UU6 A;  2F6I A;  3RST A;  2QBW A;  3L4F D;  5E6P B;  1N7E A;  3DOR A;  4UU5 A;  2PBP A;  3TRR A;  3ZWA A;  5D13 A;  3FDU A;  3KQF A;  2F9Y A;  2BYG A;  2ZPL A;  5E22 A;  2DXN A;  2QKV A;  4QFE A;  1X5Q A;  4HC8 A;  1WIF A;  4ASI A;  5E0S H;  3QGL A;  5FIF A;  5JBW A;  3BEZ A;  1RY4 A;  1P1E A;  4YYX A;  1X5N A;  2ZQQ A;  1DUB A;  2PKT A;  4NMS A;  2PKU A;  4NNQ A;  4O06 A;  4K76 A;  3D03 A;  4KPK A;  2KOH A;  2WL7 A;  3I1E A;  4L8K A;  5KJP A;  4FB8 A;  2DLS A;  3PGQ A;  5DTH A;  2UZC A;  1DCI A;  4ZDB A;  4EMM A;  1Q3P A;  1NZY A;  4J2U A;  2D8I A;  2I1N A;  3GDU A;  4REY A;  3CBZ A;  1WFG A;  4JOF A;  1BPL A;  3H02 A;  3ID4 A;  1I92 A;  3BPU A;  3NFL A;  5DU6 A;  1V5L A;  3L3S A;  2K20 A;  1FC7 A;  1U37 A;  4AE2 A;  5G1S A;  3SWX A;  3SFJ A;  1QAV A;  2EHR A;  4NMV A;  2VSU A;  3M6M A;  3T88 A;  4FLN A;  3SLL A;  2W4F A;  4ELS A;  2A7K A;  2LC6 A;  3U9S B;  1UF1 A;  2DUB A;  2VSV A;  3HIN A;  2REY A;  4QIJ A;  1P1D A;  4OG1 A;  4P0C A;  1FCF A;  1WDK A;  5EZ0 A;  1TE0 A;  2DKR A;  5GND A;  3LAO A;  2R4H A;  3I18 A;  4K2N A;  4WCZ A;  4U19 A;  4NAR A;  3H81 A;  2L4T A;  1XNY A;  2Q3G A;  3ZW9 A;  3Q1T A;  4KFW A;  3RLE A;  2KA9 A;  5C90 A;  3GGE A;  1VCW A;  3H0U A;  1X45 A;  1WF7 A;  2Q35 A;  3E17 A;  5JBX A;  4AEJ A;  1VJ6 A;  2ZO9 B;  3H0Q A;  3PV5 A;  1WDM A;  3NJD A;  2ZQR A;  4JOP A;  1PJH A;  1TP5 A;  4EMP A;  3KTJ A;  3KZD A;  2CSS A;  3T8B A;  1Y8T A;  4Q2N A;  3K8X A;  2W3P A;  1OD4 A;  2EAQ A;  3R0H A;  4HOP A;  4JOJ A;  2VPH A;  1JXZ A;  1Q7X A;  1RJN A;  4JFC A;  4OLQ A;  5E1Y A;  4U0G A;  3EGH C;  2X24 A;  1SOT A;  3G64 A;  2PG8 A;  4GVC A;  2F9I B;  5E21 A;  2EV8 A;  1UIT A;  2JOA A;  4JOR A;  4K78 A;  1GQ5 A;  2H3M A;  3OC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...