1FCFA

Photosystem ii d1 c-terminal processing protease
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
387
structure length
387
Chain Sequence
MVTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
molecule keywords PHOTOSYSTEM II D1 PROTEASE
total genus 112
structure length 387
sequence length 387
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fcfA02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fcfA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fcfA03
4E35A 4I42A 1Z86A 2OZFA 3OTPA 2DM8A 2I04A 2VSUA 3KTGA 1VA8A 2VWRA 2ENOA 5DTWA 3GF3A 2V90A 4NXRA 5HEDA 4MXIA 2V1WA 4MPAA 4JOJA 4EMPA 2R3YA 5MGBA 4I4ZA 2DLUA 4JOEA 4JSBA 4NMVA 2YT8A 5DU4A 4ASIA 2D8IA 2JOAA 3R0OA 3RSTA 3H0QA 1IHJA 2VX2A 3MFMA 2F6IA 2F5YA 4PQWA 3HPKA 4WZ8B 3IAVA 5JBXA 2DEOA 4K2NA 3TDCA 2PDZA 1NZYB 3SFJA 2DC2A 3PDVA 2QQ3A 3Q7HA 1W9EA 3BPPA 5KDRB 4ELXA 2HE2A 2OMJA 1VJ6A 2EEJA 1UEQA 1IU0A 2DUBA 3FDUA 4Q0GA 4XHVA 3NGHA 1QAVB 1WHAA 1WI4A 2W4FA 4QIJA 2MHOA 5FHTA 2ZL4A 4ZDDA 1FC6A 3H0SA 3LNXA 2J5SA 3EGGC 4KFVA 2OGPA 4RYFH 5GNDA 4IC6A 3V5EA 1B8QA 1QAVA 3QJMA 2JILA 2QKUA 3PV4A 4U19A 2VRFA 1GQ4A 3H0UA 2ZPMA 2VSUC 3T88A 5EYZA 4FN8A 3TSWA 2M3MA 1XNYA 4Z0MA 5HDYA 3ID1A 3R68A 3BF0A 1MC7A 1T2MA 4JOHA 3MH4A 2VREA 2RCZA 2OQSA 4JWVA 3M6MA 4K75A 3WKMA 3QK8A 1UJDA 3R9TA 4FB8A 1WIFA 4JFCA 2ZPLA 2QG1A 2PZDA 3ISAA 2AINA 1R6JA 4O06A 5EZ0A 4JOTA 2L97A 3I1EA 4NMSA 4ELSA 1ZUBA 1YG6A 3PE8A 3NJDA 2PPYA 3PV5A 3WG5A 1X6DA 1W2XA 4REYA 4N6XA 5DTPA 2OS6A 1Q52A 1N7EA 4KFWA 4LMMA 1WFVA 5HFDA 5D13A 2I6VA 3EGHC 1UYVA 2JWEA 3TSZA 3T3WA 5KDRA 1EY3A 3ST9A 1OBYA 3N6RB 1TP5A 4YYXA 3QREA 1W9QA 1WF8A 3PGQA 1U37A 1UYRA 2J5IA 4U18A 3I47A 5INGA 1TE0A 1KY9A 3IB9A 2DB5A 2WL7A 3QGLA 2IWQA 4Q2OA 3MYBA 3NFKA 1LCYA 4Q2QA 3TVWA 2EEHA 4K76A 2JREA 2PKUA 3BPUA 2KOHA 3DORA 5DUFA 1UM1A 4JYLA 2D90A 4H11A 4JL7A 2CSJA 2H3MA 1UYSA 2Q35A 2VSSA 2JINA 2KQFA 1I16A 1RZXA 1UITA 1VB7A 1I92A 3TSVA 3ZRTA 3AXAA 3KZEA 3OT6A 5CTBA 4Z8JA 3PV2A 1QLCA 1UHPA 4JOPA 3B76A 2KPLA 3Q0GA 2YUYA 1VAEA 4K3WA 4JCTA 3GDVA 2EXGA 3H81A 2CBYA 1WF7A 4P0CA 1NF3C 4U0GA 1FC7A 1YBOA 1O8UA 3MH6A 2YT7A 3TVUA 4OEPA 5JXBA 5E6PB 3HE2A 1QAUA 1PJHA 2IEXA 2F6QA 4WYTA 2ZL2A 4L6WA 5F67A 3RL8A 4RI0A 3TV5A 4NXQA 4G69A 4Q6HA 4JCSA 4U1AA 2ZQQA 2LUIA 3DJ1A 4Q6SA 2A81A 3K8XA 4IZCA 2KRGA 1WDMA 1OZIA 3JXTA 5DL1A 4RYFA 3GDUA 4E3BA 1OBZA 2F9YA 3P5MA 3U9TB 2NP9A 3RLEA 2GZVA 2QKTA 1HNOA 4ZDBA 1VCWA 2PNTA 1P1DA 3K1RA 2R4HA 4EMLA 1WI2A 2IWPA 3HRXA 1M5ZA 3WKLA 2H2CA 1RGWA 3KTKA 3FF6A 3KTJA 5HFBA 3ZW8A 3KZDA 3CH8A 1Q3PA 3GGEA 5HJ1A 4OG1A 3QXIA 2DLSA 2KOJA 5HFEA 3ID4A 2KA9A 1L6OA 2GTRA 1MFLA 3RL7A 4UU6A 2A7SA 2M0TA 2FW2A 1XX4A 5E11A 2EDZA 3KTIA 3BEZA 1HZDA 1SOTA 3DJ3A 2VSUE 2F0AA 3PS4A 4B3IA 1UIYA 2M0UA 1VRGA 3LAOA 2LOBA 1TG6A 3STJA 1N7FA 3TMHA 1KWAA 3O5NA 3O46A 4K6YA 1U3BA 4G2RA 3CBZA 1FCFA 4NEKA 1JXZA 5DU8A 1WZ8A 2FCFA 2UZCA 4K78A 5FB8C 1UJVA 1UEZA 2FE5A 5E21A 4HOPA 2KOMA 3LKEA 4FJWD 3G64A 4RCNA 1Z87A 4HNKA 1UEPA 2F9IA 3U9SB 1Y8TA 4JYJA 2VSVA 2PG8A 1UEWA 2EDPA 3CS0A 1UYTA 1X5NA 3QE1A 2W7RA 1UFXA 1OD2A 2K1ZA 2EDVA 2UZFA 2BYGA 3I4WA 3PDZA 3OMEA 1TYFA 4LK5A 1W9OA 2Q9VA 3R69A 2BZRA 1OBXA 5F3XA 2EEGA 3GMAA 2LC7A 2KL1A 4GM2A 2LA8A 3H0JA 3K82A 1Q7XA 4FZWC 5A2PA 3GLMA 1TQ3A 4NMPA 4IZBA 3GJ9A 3SUZA 5DZKA 3SLLA 3QMJA 5HF1A 5KJPA 4R2ZA 3TT7A 2DJTA 2FZSA 3STAA 3QYRA 2J5GD 4NNLA 3LNYA 3KQFA 2K20A 4FN7A 2J5IB 2G2LA 1ZOKA 3QO6A 5FIFA 3HINA 1DUBA 2FBMA 2J5GA 4KPKA 4ZDFA 3ID2A 2W3PA 2P3WA 3QJNA 2L4SA 3R6HA 1WH1A 3QKAA 1K32A 3E17A 4Q2NA 3QIKA 4UU5A 3T89A 4B3HA 2VPHA 5E22A 3GCOA 4K72A 3SOEA 1G9OA 2QT5A 4NMTA 2VSUF 2EHRA 4Z33A 4ZDEA 4JCRA 3T8BA 5HFFA 4YLHA 2C8TA 1X8SA 5G1RA 3MT6A 2KYLA 3H02A 1N6DA 3L4FD 1HNUA 1UF1A 3SHUA 2REYA 5CTCA 4OMRA 1WJLA 3OC7A 4NNMA 3VQFA 1Y7OA 2PBPA 1UM7A 2KJKA 4AMHA 2M0ZA 2KJDA 1RJMA 4IZDA 5IKLB 2KAWA 2JXOA 4QIIA 2KJPA 2EAQA 2PKTA 5G1DA 1ON3A 3RRVA 2EGKA 3CBXA 4JORA 4F47A 3KTHA 2G5MB 3U9RB 4DI1A 5DZKH 1V5LA 2HGAA 4FGMA 5HF4A 3GF7A 4FNDA 3ZWBA 4U0GH 3CBYA 1SZOA 5E1YA 4L8KA 3RSIA 2E7KA 2Z9IA 2I4SA 4KWBA 1WHDA 2H3LA 5G1EA 4EDJA 2CS5A 4K29A 3JU1A 1FC9A 4OEOA 3DJAA 4HOPB 1WDKA 1V1TA 5DTHA 1MJ3A 1X5RA 3TRRA 3MH7A 4JCQA 2AWUA 1ON9A 4L8NA 4Q1IA 1EF9A 5INIA 4B3JA 2HE4A 3MOYA 4ZDCA 2JIKA 4KNPA 5G1QA 2I0LA 2IWOA 1NTEA 3T8AA 1V62A 2DAZA 2J5II 1XZ9A 2Q3GA 4NMRA 2EV8A 2CSSA 3TLFA 3QDOA 5I7ZA 1MFGA 3P85A 3PZKA 1N6EA 2Z17A 4JVTA 5C90A 1TP3A 2D92A 2F9IB 1X45A 5H3JA 3NJBA 3VIVA 4MI2A 4JOKA 3OU0A 4E34A 3K50A 3Q1TA 5C9GA 3I18A 4FZWA 1U38A 5E0SH 3KHFA 3CC0A 2OPGA 4NMOA 3SHWA 1XNWA 2ZQRA 4Q3HA 4JOGA 3TT6A 3NFLA 3R9SA 3QXZA 2KG2A 1X5QA 2FNEA 2VZ5A 5HETA 4JJTA 2EJYA 2VSPA 1YG8A 3L3SA 4KD6A 1GM1A 4NNQA 2DKRA 2A7KA 3IBBA 2EEIA 2AWWA 3FY5A 1XNVA 1PIXA 2M0VA 2X58A 1SOZA 3GSLA 4GVDA 3QWDA 4HC8A 3ZWCA 1D5GA 2FN5A 5GLJA 4MOUA 2OCSA 4YDPA 3PEAA 1N99A 4ZU2A 2I0IA 4FNBA 2KPKA 1U39A 2EJ5A 1K39A 2IWNA 4JOFA 2VSSE 2AWXA 2YUBA 2O2TA 4QFEA 4NMQA 2D3TA 5FUSA 3R0HA 1XO6A 2ZL3A 1KEFA 4F8KA 1X0UA 3DIWA 3P2LA 5JBWA 1P1EA 1EF8A 2LC6A 4U0HA 3R9QA 2VSSF 2CE3A 4GHNA 1WFGA 1IU2A 5HEBA 1NZYA 1UJUA 4OAJA 1SG4A 2X7ZA 2KBSA 3CYYA 1WDLA 3M6NA 1RGRA 4WYOB 1Q3OA 3TZ3A 3HLN1 3ZWAA 2X24A 3ZW9A 2Q2XA 3ID3A 5HFCA 4WCZA 5E0SA 2H2BA 1V5QA 2QKVA 1RJNA 5DKPA 2EGNA 2WTBA 2QBWA 2YTWA 2RRMA 3GDSA 2DMZA 4WYUA 3HP0A 5INFA 4Q2PA 1WG6A 2PA1A 5DU6A 1Q51A 1OD4A 3GKBA 5DUCA 5E0NX 1V6BA 3Q0JA 4OLQA 1DCIA 4ELWA 1N6FA 1BFEA 1PDRA 2ZL0A 4GVCA 2MX6A 4EMMA 4NXPA 5HEYA 3HPMA 1GQ5A 2KV8A 2I1NA 3SWXA 5G1SA 1BE9A 3HVQC 2OSGA 1Y7NA 2L4TA 3GCNA 1RY4A 5B6LA 4P2AB 1J7XA 4I52A 2M10A 3VQGA 2F9YB 3V5IA 2EGOA 1N7TA 2Q34A 2HW5A
chains in the Genus database with same CATH superfamily
4E35A 4I42A 1Z86A 2OZFA 3OTPA 2DM8A 2I04A 2VSUA 3KTGA 1VA8A 3AGDA 2VWRA 2ENOA 5DTWA 3GF3A 2V90A 4NXRA 5HEDA 3IH9A 2V1WA 4MXIA 4MPAA 4JOJA 4EMPA 2R3YA 5MGBA 4I4ZA 2DLUA 4JOEA 4JSBA 4NMVA 2YT8A 5DU4A 4ASIA 2D8IA 2JOAA 3R0OA 3RSTA 3H0QA 1IHJA 2VX2A 3MFMA 2F6IA 3BPTA 2F5YA 4PQWA 3HPKA 4WZ8B 4QTPA 3IAVA 5JBXA 3NY7A 2DEOA 4K2NA 5ILBA 3TDCA 2PDZA 1NZYB 3SFJA 2DC2A 3PDVA 2QQ3A 3Q7HA 1W9EA 3BPPA 5KDRB 4ELXA 2HE2A 2OMJA 1VJ6A 2EEJA 1UEQA 1IU0A 2DUBA 3FDUA 4Q0GA 4XHVA 3NGHA 1QAVB 1WHAA 1WI4A 2W4FA 3V8VA 2MHOA 4QIJA 5FHTA 3EH7A 3F43A 2ZL4A 4ZDDA 1FC6A 3H0SA 3LNXA 2J5SA 3EGGC 4KFVA 2OGPA 4RYFH 5GNDA 4IC6A 3V5EA 1B8QA 1QAVA 3GABA 2JILA 3QJMA 2QKUA 3PV4A 4U19A 2VRFA 1GQ4A 3H0UA 2ZPMA 2VSUC 3T88A 5EYZA 4FN8A 3TSWA 2M3MA 1XNYA 4Z0MA 5HDYA 3ID1A 3R68A 3BF0A 3KDGA 1MC7A 1T2MA 4JOHA 3MH4A 2VREA 2RCZA 2OQSA 4JWVA 3M6MA 4K75A 3WKMA 3QK8A 1UJDA 3R9TA 4FB8A 1WIFA 3KDKA 4JFCA 2ZPLA 2QG1A 2PZDA 3ISAA 2AINA 1R6JA 4O06A 5EZ0A 4JOTA 2ZOAA 2L97A 3I1EA 4NMSA 4ELSA 1ZUBA 1YG6A 3PE8A 3NJDA 2PPYA 3PV5A 3WG5A 1X6DA 1W2XA 4REYA 4N6XA 5DTPA 2OS6A 1Q52A 1N7EA 4KFWA 4LMMA 1SBOA 1WFVA 5HFDA 5D13A 2I6VA 3EGHC 1UYVA 2JWEA 3TSZA 3T3WA 1H4XA 5KDRA 1EY3A 3ST9A 1OBYA 3N6RB 1TP5A 4YYXA 3QREA 1W9QA 1WF8A 3PGQA 1U37A 1UYRA 2J5IA 4U18A 3I47A 5INGA 1TE0A 3T6OA 1KY9A 3IB9A 2DB5A 2WL7A 3QGLA 2IWQA 4Q2OA 5EUZA 3MYBA 3NFKA 1LCYA 4Q2QA 3D3UA 3TVWA 5EUWA 2AS0A 2EEHA 4K76A 2JREA 2PKUA 3BPUA 2KOHA 3DORA 5DUFA 1UM1A 4JYLA 2D90A 4H11A 4JL7A 2CSJA 2H3MA 3D03A 1UYSA 3NCVA 2Q35A 1THNB 2VSSA 5EUUA 2JINA 2KQFA 1I16A 1RZXA 1UITA 1VB7A 1I92A 3TSVA 3ZRTA 3OIZA 3ZTBA 3AXAA 3KZEA 3OT6A 5CTBA 4Z8JA 3PV2A 1QLCA 1UHPA 4JOPA 3B76A 2KPLA 3Q0GA 2YUYA 1VAEA 4K3WA 4JCTA 3GDVA 2EXGA 3H81A 2CBYA 1WF7A 4P0CA 1NF3C 4U0GA 1FC7A 1YBOA 1O8UA 3MH6A 2YT7A 3V97A 3TVUA 4OEPA 5JXBA 4JJ0A 5E6PB 1QAUA 2KA5A 1PJHA 2F6QA 4WYTA 2IEXA 2ZL2A 4L6WA 5F67A 3RL8A 4RI0A 3TV5A 1H4YA 4NXQA 4G69A 4Q6HA 4JCSA 4U1AA 2ZQQA 2LUIA 3DJ1A 4Q6SA 1T6RA 2A81A 3K8XA 4IZCA 2KRGA 1WDMA 1OZIA 3JXTA 5DL1A 4RYFA 3GDUA 4E3BA 3LLOA 1OBZA 2F9YA 3P5MA 3U9TB 2NP9A 3RLEA 2GZVA 2QKTA 1HNOA 4ZDBA 3GMFA 1VCWA 2PNTA 1P1DA 3K1RA 2R4HA 4EMLA 1WI2A 1VC1A 3MGLA 2IWPA 3HE2A 5B42A 3HRXA 1M5ZA 3WKLA 2H2CA 1RGWA 3KTKA 3FF6A 3KTJA 3GHFA 5HFBA 3ZW8A 4FLNA 3KZDA 3IHAA 3CH8A 1Q3PA 3GGEA 5HJ1A 4OG1A 3QXIA 2DLSA 2KOJA 5HFEA 3ID4A 2KA9A 1L6OA 2GTRA 1MFLA 2RRLA 3RL7A 4UU6A 2A7SA 2M0TA 2FW2A 3LKLA 1XX4A 5E11A 2EDZA 3KTIA 3BEZA 1HZDA 1SOTA 3DJ3A 2VSUE 2F0AA 3PS4A 4B3IA 1WXWA 1UIYA 2M0UA 3IF5A 1VRGA 3LAOA 2LOBA 1TG6A 3STJA 1N7FA 3TMHA 1BUZA 1KWAA 3O5NA 3O46A 4K6YA 1U3BA 3IH8A 3CBZA 4G2RA 1FCFA 4NEKA 1JXZA 5DU8A 1WZ8A 2FCFA 2UZCA 4K78A 5FB8C 1UJVA 1UEZA 2FE5A 5E21A 4HOPA 2KOMA 3LKEA 4FJWD 4HDTA 3G64A 4RCNA 1Z87A 4HNKA 2DXNA 1UEPA 2F9IA 3U9SB 1Y8TA 4JYJA 4J2UA 2VSVA 2PG8A 1UEWA 2EDPA 3CS0A 1TH8B 1UYTA 1X5NA 2JSNA 3QE1A 2W7RA 1UFXA 1OD2A 2K1ZA 2EDVA 2UZFA 2BYGA 3I4WA 3PDZA 1V0FA 3AGEA 1TYFA 1W9OA 3OMEA 4LK5A 2Q9VA 3R69A 3GVJA 2BZRA 1OBXA 5F3XA 2EEGA 3GMAA 2LC7A 2KL1A 4GM2A 2LA8A 3H0JA 3K82A 1Q7XA 4FZWC 5A2PA 3GLMA 1TQ3A 4NMPA 4IZBA 3GJ9A 3SUZA 5DZKA 3SLLA 3QMJA 5HF1A 3MOGA 4R2ZA 5KJPA 3TT7A 2DJTA 2FZSA 3STAA 3QYRA 2J5GD 4NNLA 3LNYA 3KQFA 2K20A 4FN7A 2J5IB 2G2LA 1ZOKA 3QO6A 5FIFA 3HINA 1DUBA 2FBMA 2J5GA 4KPKA 4ZDFA 3ID2A 2W3PA 2P3WA 4DGHA 3QJNA 2L4SA 3R6HA 1WH1A 3QKAA 1K32A 3E17A 4Q2NA 3QIKA 4UU5A 3T89A 4B3HA 4HIZA 2VPHA 5E22A 3GCOA 4K72A 2OASA 3SOEA 1G9OA 2QT5A 4NMTA 2VSUF 2B78A 2EHRA 4Z33A 4ZDEA 4JCRA 3T8BA 5HFFA 4YLHA 2C8TA 1X8SA 5G1RA 3MT6A 2KYLA 3H02A 1N6DA 3L4FD 1HNUA 1UF1A 3SHUA 2REYA 5CTCA 4OMRA 1WJLA 3OC7A 4NNMA 3VQFA 1Y7OA 2PBPA 1UM7A 2KJKA 3DUPA 1HF2A 4AMHA 2M0ZA 2KJDA 1RJMA 4IZDA 5IKLB 2KAWA 4HYLA 2JXOA 4QIIA 2KJPA 2EAQA 2PKTA 5G1DA 1ON3A 3RRVA 2EGKA 3CBXA 4JORA 4DMGA 4F47A 3KTHA 2G5MB 3U9RB 4DI1A 5DZKH 1V5LA 2HGAA 4FGMA 5HF4A 3GF7A 4FNDA 3ZWBA 4U0GH 3CBYA 1SZOA 5E1YA 4L8KA 3RSIA 2E7KA 2Z9IA 2I4SA 4KWBA 1WHDA 2H3LA 5G1EA 4EDJA 2CS5A 4K29A 3JU1A 1FC9A 4OEOA 3DJAA 4HOPB 1WDKA 1V1TA 5DTHA 1MJ3A 1X5RA 3GVLA 4AE2A 3TRRA 3MH7A 4JJ3A 2AWUA 1ON9A 4L8NA 4JCQA 4Q1IA 1EF9A 5INIA 4B3JA 1BPLA 2HE4A 5IL9A 3VSEA 3MOYA 1H4ZA 4ZDCA 2JIKA 4KNPA 2VY9A 5G1QA 2I0LA 3QDQA 3C0KA 2IWOA 1NTEA 3T8AA 1V62A 2DAZA 4XS5A 1XZ9A 2J5II 2Q3GA 4NMRA 2EV8A 2CSSA 3TLFA 4DGFA 4NARA 3QDOA 5I7ZA 1MFGA 3P85A 3ZXNA 3PZKA 1N6EA 1V0EA 2Z17A 4JVTA 5C90A 1TP3A 2D92A 1TILB 2F9IB 1X45A 5H3JA 3NJBA 3VIVA 4MI2A 5HUQA 4JOKA 3OU0A 4E34A 3K50A 3Q1TA 5C9GA 3I18A 4FZWA 1U38A 5E0SH 3KHFA 3CC0A 2OPGA 4NMOA 3SHWA 1XNWA 2ZQRA 4Q3HA 4JOGA 3TT6A 3NFLA 3R9SA 3QXZA 2KG2A 3JU4A 1X5QA 2FNEA 2VZ5A 5HETA 4JJTA 2EJYA 2VSPA 1YG8A 3L3SA 4KD6A 1GM1A 4NNQA 2DKRA 2A7KA 3IBBA 2EEIA 2AWWA 3FY5A 1XNVA 1PIXA 2M0VA 2X58A 1SOZA 3GSLA 4GVDA 3QWDA 4HC8A 3ZWCA 1D5GA 2FN5A 5GLJA 4MOUA 2OCSA 4YDPA 5EUSA 1N99A 3PEAA 4ZU2A 2I0IA 5EUXA 4FNBA 2KPKA 1U39A 2EJ5A 1K39A 2IWNA 2GEFA 4JOFA 2VSSE 2AWXA 1X9ZA 2KLNA 2YUBA 2O2TA 4QFEA 4NMQA 1TIDB 4AEJA 2D3TA 5FUSA 3R0HA 1XO6A 2ZL3A 1KEFA 4F8KA 1X0UA 3DIWA 3P2LA 5JBWA 1P1EA 1EF8A 2LC6A 4U0HA 3GVKA 3OIRA 3R9QA 2VSSF 2CE3A 2ZO9B 4GHNA 2YJGA 1WFGA 1IU2A 5HEBA 1NZYA 1UJUA 4OAJA 1SG4A 2X7ZA 2KBSA 3CYYA 1WDLA 3M6NA 1RGRA 4WYOB 1Q3OA 3TZ3A 3HLN1 3ZWAA 2X24A 3ZW9A 2Q2XA 3ID3A 5HFCA 4WCZA 5E0SA 2H2BA 1V5QA 2QKVA 1RJNA 2CWWA 4JC0A 5DKPA 2EGNA 1WXXA 2WTBA 2QBWA 2YTWA 2RRMA 3GDSA 2DMZA 3GK7A 4WYUA 3HP0A 5INFA 4Q2PA 1WG6A 2PA1A 5DU6A 1Q51A 1OD4A 3GKBA 5DUCA 5E0NX 1V6BA 3Q0JA 4OLQA 1DCIA 4ELWA 1N6FA 1BFEA 1PDRA 2ZL0A 4GVCA 2MX6A 4L1CA 4EMMA 4NXPA 5HEYA 5EZBA 3HPMA 1GQ5A 2KV8A 2I1NA 2DXLA 3SWXA 3IHBA 5G1SA 1BE9A 3LDFA 3HVQC 2OSGA 1Y7NA 2L4TA 3GCNA 1RY4A 5B6LA 4P2AB 1J7XA 4I52A 2M10A 3VQGA 2F9YB 3V5IA 1AUZA 2EGOA 1N7TA 2Q34A 2HW5A
chains in the Genus database with same CATH topology
4E35A 4I42A 1Z86A 2OZFA 3OTPA 2DM8A 2I04A 2VSUA 3KTGA 1VA8A 2VWRA 2ENOA 5DTWA 3GF3A 2V90A 4NXRA 5HEDA 4MXIA 2V1WA 4MPAA 4JOJA 4EMPA 2R3YA 5MGBA 4I4ZA 2DLUA 4JOEA 4JSBA 4NMVA 2YT8A 5DU4A 4ASIA 2D8IA 2JOAA 3R0OA 3RSTA 3H0QA 1IHJA 2VX2A 3MFMA 2F6IA 3BPTA 2F5YA 4PQWA 3HPKA 4WZ8B 3IAVA 5JBXA 2DEOA 4K2NA 5ILBA 3TDCA 2PDZA 1NZYB 3SFJA 2DC2A 3PDVA 2QQ3A 3Q7HA 1W9EA 3BPPA 5KDRB 4ELXA 2HE2A 2OMJA 1VJ6A 2EEJA 1UEQA 1IU0A 2DUBA 3FDUA 4Q0GA 4XHVA 3NGHA 1QAVB 1WHAA 1WI4A 2W4FA 4QIJA 2MHOA 5FHTA 2ZL4A 4ZDDA 1FC6A 3H0SA 3LNXA 2J5SA 3EGGC 4KFVA 2OGPA 4RYFH 5GNDA 4IC6A 3V5EA 1B8QA 1QAVA 3GABA 2JILA 3QJMA 2QKUA 3PV4A 4U19A 2VRFA 1GQ4A 3H0UA 2ZPMA 2VSUC 3T88A 5EYZA 4FN8A 3TSWA 2M3MA 1XNYA 4Z0MA 5HDYA 3ID1A 3R68A 3BF0A 3KDGA 1MC7A 1T2MA 4JOHA 3MH4A 2VREA 2RCZA 2OQSA 4JWVA 3M6MA 4K75A 3WKMA 3QK8A 1UJDA 3R9TA 4FB8A 1WIFA 3KDKA 4JFCA 2ZPLA 2QG1A 2PZDA 3ISAA 2AINA 1R6JA 4O06A 5EZ0A 4JOTA 2ZOAA 2L97A 3I1EA 4NMSA 4ELSA 1ZUBA 1YG6A 3PE8A 3NJDA 2PPYA 3PV5A 3WG5A 1X6DA 1W2XA 4REYA 4N6XA 5DTPA 2OS6A 1Q52A 1N7EA 4KFWA 4LMMA 1WFVA 5HFDA 5D13A 2I6VA 3EGHC 1UYVA 2JWEA 3TSZA 3T3WA 5KDRA 1EY3A 3ST9A 1OBYA 3N6RB 1TP5A 4YYXA 3QREA 1W9QA 1WF8A 3PGQA 1U37A 1UYRA 2J5IA 4U18A 3I47A 5INGA 1TE0A 1KY9A 3IB9A 2DB5A 2WL7A 3QGLA 2IWQA 4Q2OA 3MYBA 3NFKA 1LCYA 4Q2QA 3TVWA 2EEHA 4K76A 2JREA 2PKUA 3BPUA 2KOHA 3DORA 5DUFA 1UM1A 4JYLA 2D90A 4H11A 4JL7A 2CSJA 2H3MA 3D03A 1UYSA 3NCVA 2Q35A 2VSSA 2JINA 2KQFA 1I16A 1RZXA 1UITA 1VB7A 1I92A 3TSVA 3ZRTA 3AXAA 3KZEA 3OT6A 5CTBA 4Z8JA 3PV2A 1QLCA 1UHPA 4JOPA 3B76A 2KPLA 3Q0GA 2YUYA 1VAEA 4K3WA 4JCTA 3GDVA 2EXGA 3H81A 2CBYA 1WF7A 4P0CA 1NF3C 4U0GA 1FC7A 1YBOA 1O8UA 3MH6A 2YT7A 3TVUA 4OEPA 5JXBA 4JJ0A 5E6PB 1QAUA 1PJHA 2IEXA 2F6QA 4WYTA 2ZL2A 4L6WA 5F67A 3RL8A 4RI0A 3TV5A 4NXQA 4G69A 4Q6HA 4JCSA 4U1AA 2ZQQA 2LUIA 3DJ1A 4Q6SA 2A81A 3K8XA 4IZCA 2KRGA 1WDMA 1OZIA 3JXTA 5DL1A 4RYFA 3GDUA 4E3BA 1OBZA 2F9YA 3P5MA 3U9TB 2NP9A 3RLEA 2GZVA 2QKTA 1HNOA 4ZDBA 3GMFA 1VCWA 2PNTA 1P1DA 3K1RA 2R4HA 4EMLA 1WI2A 2IWPA 3HE2A 5B42A 3HRXA 1M5ZA 3WKLA 2H2CA 1RGWA 3KTKA 3FF6A 3KTJA 3GHFA 5HFBA 3ZW8A 4FLNA 3KZDA 3CH8A 1Q3PA 3GGEA 5HJ1A 4OG1A 3QXIA 2DLSA 2KOJA 5HFEA 3ID4A 2KA9A 1L6OA 2GTRA 1MFLA 2RRLA 3RL7A 4UU6A 2A7SA 2M0TA 2FW2A 1XX4A 5E11A 2EDZA 3KTIA 3BEZA 1HZDA 1SOTA 3DJ3A 2VSUE 2F0AA 3PS4A 4B3IA 1UIYA 2M0UA 1VRGA 3LAOA 2LOBA 1TG6A 3STJA 1N7FA 3TMHA 1KWAA 3O5NA 3O46A 4K6YA 1U3BA 4G2RA 3CBZA 1FCFA 4NEKA 1JXZA 5DU8A 1WZ8A 2FCFA 2UZCA 4K78A 5FB8C 1UJVA 1UEZA 2FE5A 5E21A 4HOPA 2KOMA 3LKEA 4FJWD 4HDTA 3G64A 4RCNA 1Z87A 4HNKA 2DXNA 1UEPA 2F9IA 3U9SB 1Y8TA 4JYJA 4J2UA 2VSVA 2PG8A 1UEWA 2EDPA 3CS0A 1UYTA 1X5NA 2JSNA 3QE1A 2W7RA 1UFXA 1OD2A 2K1ZA 2EDVA 2UZFA 2BYGA 3I4WA 3PDZA 3OMEA 1TYFA 4LK5A 1W9OA 2Q9VA 3R69A 2BZRA 1OBXA 5F3XA 2EEGA 3GMAA 2LC7A 2KL1A 4GM2A 2LA8A 3H0JA 3K82A 1Q7XA 4FZWC 5A2PA 3GLMA 1TQ3A 4NMPA 4IZBA 3GJ9A 3SUZA 5DZKA 3SLLA 3QMJA 5HF1A 3MOGA 4R2ZA 5KJPA 3TT7A 2DJTA 2FZSA 3STAA 3QYRA 2J5GD 4NNLA 3LNYA 3KQFA 2K20A 4FN7A 2J5IB 2G2LA 1ZOKA 3QO6A 5FIFA 3HINA 1DUBA 2FBMA 2J5GA 4KPKA 4ZDFA 3ID2A 2W3PA 2P3WA 3QJNA 2L4SA 3R6HA 1WH1A 3QKAA 1K32A 3E17A 4Q2NA 3QIKA 4UU5A 3T89A 4B3HA 2VPHA 5E22A 3GCOA 4K72A 3SOEA 1G9OA 2QT5A 4NMTA 2VSUF 2EHRA 4Z33A 4ZDEA 4JCRA 3T8BA 5HFFA 4YLHA 2C8TA 1X8SA 5G1RA 3MT6A 2KYLA 3H02A 1N6DA 3L4FD 1HNUA 1UF1A 3SHUA 2REYA 5CTCA 4OMRA 1WJLA 3OC7A 4NNMA 3VQFA 1Y7OA 2PBPA 1UM7A 2KJKA 3DUPA 4AMHA 2M0ZA 2KJDA 1RJMA 4IZDA 5IKLB 2KAWA 2JXOA 4QIIA 2KJPA 2EAQA 2PKTA 5G1DA 1ON3A 3RRVA 2EGKA 3CBXA 4JORA 4F47A 3KTHA 2G5MB 3U9RB 4DI1A 5DZKH 1V5LA 2HGAA 4FGMA 5HF4A 3GF7A 4FNDA 3ZWBA 4U0GH 3CBYA 1SZOA 5E1YA 4L8KA 3RSIA 2E7KA 2Z9IA 2I4SA 4KWBA 1WHDA 2H3LA 5G1EA 4EDJA 2CS5A 4K29A 3JU1A 1FC9A 4OEOA 3DJAA 4HOPB 1WDKA 1V1TA 5DTHA 1MJ3A 1X5RA 4AE2A 3TRRA 3MH7A 4JJ3A 2AWUA 1ON9A 4L8NA 4JCQA 4Q1IA 1EF9A 5INIA 4B3JA 1BPLA 2HE4A 5IL9A 3MOYA 4ZDCA 2JIKA 4KNPA 5G1QA 2I0LA 2IWOA 1NTEA 3T8AA 1V62A 2DAZA 2J5II 1XZ9A 2Q3GA 4NMRA 2EV8A 2CSSA 3TLFA 4NARA 3QDOA 5I7ZA 1MFGA 3P85A 3PZKA 1N6EA 2Z17A 4JVTA 5C90A 1TP3A 2D92A 2F9IB 1X45A 5H3JA 3NJBA 3VIVA 4MI2A 5HUQA 4JOKA 3OU0A 4E34A 3K50A 3Q1TA 5C9GA 3I18A 4FZWA 1U38A 5E0SH 3KHFA 3CC0A 2OPGA 4NMOA 3SHWA 1XNWA 2ZQRA 4Q3HA 4JOGA 3TT6A 3NFLA 3R9SA 3QXZA 2KG2A 1X5QA 2FNEA 2VZ5A 5HETA 4JJTA 2EJYA 2VSPA 1YG8A 3L3SA 4KD6A 1GM1A 4NNQA 2DKRA 2A7KA 3IBBA 2EEIA 2AWWA 3FY5A 1XNVA 1PIXA 2M0VA 2X58A 1SOZA 3GSLA 4GVDA 3QWDA 4HC8A 3ZWCA 1D5GA 2FN5A 5GLJA 4MOUA 2OCSA 4YDPA 3PEAA 1N99A 4ZU2A 2I0IA 4FNBA 2KPKA 1U39A 2EJ5A 1K39A 2IWNA 2GEFA 4JOFA 2VSSE 2AWXA 1X9ZA 2YUBA 2O2TA 4QFEA 4NMQA 4AEJA 2D3TA 5FUSA 3R0HA 1XO6A 2ZL3A 1KEFA 4F8KA 1X0UA 3DIWA 3P2LA 5JBWA 1P1EA 1EF8A 2LC6A 4U0HA 3R9QA 2VSSF 2CE3A 2ZO9B 4GHNA 2YJGA 1WFGA 1IU2A 5HEBA 1NZYA 1UJUA 4OAJA 1SG4A 2X7ZA 2KBSA 3CYYA 1WDLA 3M6NA 1RGRA 4WYOB 1Q3OA 3TZ3A 3HLN1 3ZWAA 2X24A 3ZW9A 2Q2XA 3ID3A 5HFCA 4WCZA 5E0SA 2H2BA 1V5QA 2QKVA 1RJNA 4JC0A 5DKPA 2EGNA 2WTBA 2QBWA 2YTWA 2RRMA 3GDSA 2DMZA 4WYUA 3HP0A 5INFA 4Q2PA 1WG6A 2PA1A 5DU6A 1Q51A 1OD4A 3GKBA 5DUCA 5E0NX 1V6BA 3Q0JA 4OLQA 1DCIA 4ELWA 1N6FA 1BFEA 1PDRA 2ZL0A 4GVCA 2MX6A 4L1CA 4EMMA 4NXPA 5HEYA 3HPMA 1GQ5A 2KV8A 2I1NA 2DXLA 3SWXA 5G1SA 1BE9A 3HVQC 2OSGA 1Y7NA 2L4TA 3GCNA 1RY4A 5B6LA 4P2AB 1J7XA 4I52A 2M10A 3VQGA 2F9YB 3V5IA 2EGOA 1N7TA 2Q34A 2HW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E35 A;  4I42 A;  1Z86 A;  2OZF A;  3OTP A;  2DM8 A;  2I04 A;  2VSU A;  3KTG A;  1VA8 A;  2VWR A;  2ENO A;  5DTW A;  3GF3 A;  2V90 A;  4NXR A;  5HED A;  4MXI A;  2V1W A;  4MPA A;  4JOJ A;  4EMP A;  2R3Y A;  5MGB A;  4I4Z A;  2DLU A;  4JOE A;  4JSB A;  4NMV A;  2YT8 A;  5DU4 A;  4ASI A;  2D8I A;  2JOA A;  3R0O A;  3RST A;  3H0Q A;  1IHJ A;  2VX2 A;  3MFM A;  2F6I A;  2F5Y A;  4PQW A;  3HPK A;  4WZ8 B;  3IAV A;  5JBX A;  2DEO A;  4K2N A;  3TDC A;  2PDZ A;  1NZY B;  3SFJ A;  2DC2 A;  3PDV A;  2QQ3 A;  3Q7H A;  1W9E A;  3BPP A;  5KDR B;  4ELX A;  2HE2 A;  2OMJ A;  1VJ6 A;  2EEJ A;  1UEQ A;  1IU0 A;  2DUB A;  3FDU A;  4Q0G A;  4XHV A;  3NGH A;  1QAV B;  1WHA A;  1WI4 A;  2W4F A;  4QIJ A;  2MHO A;  5FHT A;  2ZL4 A;  4ZDD A;  1FC6 A;  3H0S A;  3LNX A;  2J5S A;  3EGG C;  4KFV A;  2OGP A;  4RYF H;  5GND A;  4IC6 A;  3V5E A;  1B8Q A;  1QAV A;  3QJM A;  2JIL A;  2QKU A;  3PV4 A;  4U19 A;  2VRF A;  1GQ4 A;  3H0U A;  2ZPM A;  2VSU C;  3T88 A;  5EYZ A;  4FN8 A;  3TSW A;  2M3M A;  1XNY A;  4Z0M A;  5HDY A;  3ID1 A;  3R68 A;  3BF0 A;  1MC7 A;  1T2M A;  4JOH A;  3MH4 A;  2VRE A;  2RCZ A;  2OQS A;  4JWV A;  3M6M A;  4K75 A;  3WKM A;  3QK8 A;  1UJD A;  3R9T A;  4FB8 A;  1WIF A;  4JFC A;  2ZPL A;  2QG1 A;  2PZD A;  3ISA A;  2AIN A;  1R6J A;  4O06 A;  5EZ0 A;  4JOT A;  2L97 A;  3I1E A;  4NMS A;  4ELS A;  1ZUB A;  1YG6 A;  3PE8 A;  3NJD A;  2PPY A;  3PV5 A;  3WG5 A;  1X6D A;  1W2X A;  4REY A;  4N6X A;  5DTP A;  2OS6 A;  1Q52 A;  1N7E A;  4KFW A;  4LMM A;  1WFV A;  5HFD A;  5D13 A;  2I6V A;  3EGH C;  1UYV A;  2JWE A;  3TSZ A;  3T3W A;  5KDR A;  1EY3 A;  3ST9 A;  1OBY A;  3N6R B;  1TP5 A;  4YYX A;  3QRE A;  1W9Q A;  1WF8 A;  3PGQ A;  1U37 A;  1UYR A;  2J5I A;  4U18 A;  3I47 A;  5ING A;  1TE0 A;  1KY9 A;  3IB9 A;  2DB5 A;  2WL7 A;  3QGL A;  2IWQ A;  4Q2O A;  3MYB A;  3NFK A;  1LCY A;  4Q2Q A;  3TVW A;  2EEH A;  4K76 A;  2JRE A;  2PKU A;  3BPU A;  2KOH A;  3DOR A;  5DUF A;  1UM1 A;  4JYL A;  2D90 A;  4H11 A;  4JL7 A;  2CSJ A;  2H3M A;  1UYS A;  2Q35 A;  2VSS A;  2JIN A;  2KQF A;  1I16 A;  1RZX A;  1UIT A;  1VB7 A;  1I92 A;  3TSV A;  3ZRT A;  3AXA A;  3KZE A;  3OT6 A;  5CTB A;  4Z8J A;  3PV2 A;  1QLC A;  1UHP A;  4JOP A;  3B76 A;  2KPL A;  3Q0G A;  2YUY A;  1VAE A;  4K3W A;  4JCT A;  3GDV A;  2EXG A;  3H81 A;  2CBY A;  1WF7 A;  4P0C A;  1NF3 C;  4U0G A;  1FC7 A;  1YBO A;  1O8U A;  3MH6 A;  2YT7 A;  3TVU A;  4OEP A;  5JXB A;  5E6P B;  3HE2 A;  1QAU A;  1PJH A;  2IEX A;  2F6Q A;  4WYT A;  2ZL2 A;  4L6W A;  5F67 A;  3RL8 A;  4RI0 A;  3TV5 A;  4NXQ A;  4G69 A;  4Q6H A;  4JCS A;  4U1A A;  2ZQQ A;  2LUI A;  3DJ1 A;  4Q6S A;  2A81 A;  3K8X A;  4IZC A;  2KRG A;  1WDM A;  1OZI A;  3JXT A;  5DL1 A;  4RYF A;  3GDU A;  4E3B A;  1OBZ A;  2F9Y A;  3P5M A;  3U9T B;  2NP9 A;  3RLE A;  2GZV A;  2QKT A;  1HNO A;  4ZDB A;  1VCW A;  2PNT A;  1P1D A;  3K1R A;  2R4H A;  4EML A;  1WI2 A;  2IWP A;  3HRX A;  1M5Z A;  3WKL A;  2H2C A;  1RGW A;  3KTK A;  3FF6 A;  3KTJ A;  5HFB A;  3ZW8 A;  3KZD A;  3CH8 A;  1Q3P A;  3GGE A;  5HJ1 A;  4OG1 A;  3QXI A;  2DLS A;  2KOJ A;  5HFE A;  3ID4 A;  2KA9 A;  1L6O A;  2GTR A;  1MFL A;  3RL7 A;  4UU6 A;  2A7S A;  2M0T A;  2FW2 A;  1XX4 A;  5E11 A;  2EDZ A;  3KTI A;  3BEZ A;  1HZD A;  1SOT A;  3DJ3 A;  2VSU E;  2F0A A;  3PS4 A;  4B3I A;  1UIY A;  2M0U A;  1VRG A;  3LAO A;  2LOB A;  1TG6 A;  3STJ A;  1N7F A;  3TMH A;  1KWA A;  3O5N A;  3O46 A;  4K6Y A;  1U3B A;  4G2R A;  3CBZ A;  1FCF A;  4NEK A;  1JXZ A;  5DU8 A;  1WZ8 A;  2FCF A;  2UZC A;  4K78 A;  5FB8 C;  1UJV A;  1UEZ A;  2FE5 A;  5E21 A;  4HOP A;  2KOM A;  3LKE A;  4FJW D;  3G64 A;  4RCN A;  1Z87 A;  4HNK A;  1UEP A;  2F9I A;  3U9S B;  1Y8T A;  4JYJ A;  2VSV A;  2PG8 A;  1UEW A;  2EDP A;  3CS0 A;  1UYT A;  1X5N A;  3QE1 A;  2W7R A;  1UFX A;  1OD2 A;  2K1Z A;  2EDV A;  2UZF A;  2BYG A;  3I4W A;  3PDZ A;  3OME A;  1TYF A;  4LK5 A;  1W9O A;  2Q9V A;  3R69 A;  2BZR A;  1OBX A;  5F3X A;  2EEG A;  3GMA A;  2LC7 A;  2KL1 A;  4GM2 A;  2LA8 A;  3H0J A;  3K82 A;  1Q7X A;  4FZW C;  5A2P A;  3GLM A;  1TQ3 A;  4NMP A;  4IZB A;  3GJ9 A;  3SUZ A;  5DZK A;  3SLL A;  3QMJ A;  5HF1 A;  5KJP A;  4R2Z A;  3TT7 A;  2DJT A;  2FZS A;  3STA A;  3QYR A;  2J5G D;  4NNL A;  3LNY A;  3KQF A;  2K20 A;  4FN7 A;  2J5I B;  2G2L A;  1ZOK A;  3QO6 A;  5FIF A;  3HIN A;  1DUB A;  2FBM A;  2J5G A;  4KPK A;  4ZDF A;  3ID2 A;  2W3P A;  2P3W A;  3QJN A;  2L4S A;  3R6H A;  1WH1 A;  3QKA A;  1K32 A;  3E17 A;  4Q2N A;  3QIK A;  4UU5 A;  3T89 A;  4B3H A;  2VPH A;  5E22 A;  3GCO A;  4K72 A;  3SOE A;  1G9O A;  2QT5 A;  4NMT A;  2VSU F;  2EHR A;  4Z33 A;  4ZDE A;  4JCR A;  3T8B A;  5HFF A;  4YLH A;  2C8T A;  1X8S A;  5G1R A;  3MT6 A;  2KYL A;  3H02 A;  1N6D A;  3L4F D;  1HNU A;  1UF1 A;  3SHU A;  2REY A;  5CTC A;  4OMR A;  1WJL A;  3OC7 A;  4NNM A;  3VQF A;  1Y7O A;  2PBP A;  1UM7 A;  2KJK A;  4AMH A;  2M0Z A;  2KJD A;  1RJM A;  4IZD A;  5IKL B;  2KAW A;  2JXO A;  4QII A;  2KJP A;  2EAQ A;  2PKT A;  5G1D A;  1ON3 A;  3RRV A;  2EGK A;  3CBX A;  4JOR A;  4F47 A;  3KTH A;  2G5M B;  3U9R B;  4DI1 A;  5DZK H;  1V5L A;  2HGA A;  4FGM A;  5HF4 A;  3GF7 A;  4FND A;  3ZWB A;  4U0G H;  3CBY A;  1SZO A;  5E1Y A;  4L8K A;  3RSI A;  2E7K A;  2Z9I A;  2I4S A;  4KWB A;  1WHD A;  2H3L A;  5G1E A;  4EDJ A;  2CS5 A;  4K29 A;  3JU1 A;  1FC9 A;  4OEO A;  3DJA A;  4HOP B;  1WDK A;  1V1T A;  5DTH A;  1MJ3 A;  1X5R A;  3TRR A;  3MH7 A;  4JCQ A;  2AWU A;  1ON9 A;  4L8N A;  4Q1I A;  1EF9 A;  5INI A;  4B3J A;  2HE4 A;  3MOY A;  4ZDC A;  2JIK A;  4KNP A;  5G1Q A;  2I0L A;  2IWO A;  1NTE A;  3T8A A;  1V62 A;  2DAZ A;  2J5I I;  1XZ9 A;  2Q3G A;  4NMR A;  2EV8 A;  2CSS A;  3TLF A;  3QDO A;  5I7Z A;  1MFG A;  3P85 A;  3PZK A;  1N6E A;  2Z17 A;  4JVT A;  5C90 A;  1TP3 A;  2D92 A;  2F9I B;  1X45 A;  5H3J A;  3NJB A;  3VIV A;  4MI2 A;  4JOK A;  3OU0 A;  4E34 A;  3K50 A;  3Q1T A;  5C9G A;  3I18 A;  4FZW A;  1U38 A;  5E0S H;  3KHF A;  3CC0 A;  2OPG A;  4NMO A;  3SHW A;  1XNW A;  2ZQR A;  4Q3H A;  4JOG A;  3TT6 A;  3NFL A;  3R9S A;  3QXZ A;  2KG2 A;  1X5Q A;  2FNE A;  2VZ5 A;  5HET A;  4JJT A;  2EJY A;  2VSP A;  1YG8 A;  3L3S A;  4KD6 A;  1GM1 A;  4NNQ A;  2DKR A;  2A7K A;  3IBB A;  2EEI A;  2AWW A;  3FY5 A;  1XNV A;  1PIX A;  2M0V A;  2X58 A;  1SOZ A;  3GSL A;  4GVD A;  3QWD A;  4HC8 A;  3ZWC A;  1D5G A;  2FN5 A;  5GLJ A;  4MOU A;  2OCS A;  4YDP A;  3PEA A;  1N99 A;  4ZU2 A;  2I0I A;  4FNB A;  2KPK A;  1U39 A;  2EJ5 A;  1K39 A;  2IWN A;  4JOF A;  2VSS E;  2AWX A;  2YUB A;  2O2T A;  4QFE A;  4NMQ A;  2D3T A;  5FUS A;  3R0H A;  1XO6 A;  2ZL3 A;  1KEF A;  4F8K A;  1X0U A;  3DIW A;  3P2L A;  5JBW A;  1P1E A;  1EF8 A;  2LC6 A;  4U0H A;  3R9Q A;  2VSS F;  2CE3 A;  4GHN A;  1WFG A;  1IU2 A;  5HEB A;  1NZY A;  1UJU A;  4OAJ A;  1SG4 A;  2X7Z A;  2KBS A;  3CYY A;  1WDL A;  3M6N A;  1RGR A;  4WYO B;  1Q3O A;  3TZ3 A;  3HLN 1;  3ZWA A;  2X24 A;  3ZW9 A;  2Q2X A;  3ID3 A;  5HFC A;  4WCZ A;  5E0S A;  2H2B A;  1V5Q A;  2QKV A;  1RJN A;  5DKP A;  2EGN A;  2WTB A;  2QBW A;  2YTW A;  2RRM A;  3GDS A;  2DMZ A;  4WYU A;  3HP0 A;  5INF A;  4Q2P A;  1WG6 A;  2PA1 A;  5DU6 A;  1Q51 A;  1OD4 A;  3GKB A;  5DUC A;  5E0N X;  1V6B A;  3Q0J A;  4OLQ A;  1DCI A;  4ELW A;  1N6F A;  1BFE A;  1PDR A;  2ZL0 A;  4GVC A;  2MX6 A;  4EMM A;  4NXP A;  5HEY A;  3HPM A;  1GQ5 A;  2KV8 A;  2I1N A;  3SWX A;  5G1S A;  1BE9 A;  3HVQ C;  2OSG A;  1Y7N A;  2L4T A;  3GCN A;  1RY4 A;  5B6L A;  4P2A B;  1J7X A;  4I52 A;  2M10 A;  3VQG A;  2F9Y B;  3V5I A;  2EGO A;  1N7T A;  2Q34 A;  2HW5 A; 
#chains in the Genus database with same CATH topology
 4E35 A;  4I42 A;  1Z86 A;  2OZF A;  3OTP A;  2DM8 A;  2I04 A;  2VSU A;  3KTG A;  1VA8 A;  3AGD A;  2VWR A;  2ENO A;  5DTW A;  3GF3 A;  2V90 A;  4NXR A;  5HED A;  3IH9 A;  2V1W A;  4MXI A;  4MPA A;  4JOJ A;  4EMP A;  2R3Y A;  5MGB A;  4I4Z A;  2DLU A;  4JOE A;  4JSB A;  4NMV A;  2YT8 A;  5DU4 A;  4ASI A;  2D8I A;  2JOA A;  3R0O A;  3RST A;  3H0Q A;  1IHJ A;  2VX2 A;  3MFM A;  2F6I A;  3BPT A;  2F5Y A;  4PQW A;  3HPK A;  4WZ8 B;  4QTP A;  3IAV A;  5JBX A;  3NY7 A;  2DEO A;  4K2N A;  5ILB A;  3TDC A;  2PDZ A;  1NZY B;  3SFJ A;  2DC2 A;  3PDV A;  2QQ3 A;  3Q7H A;  1W9E A;  3BPP A;  5KDR B;  4ELX A;  2HE2 A;  2OMJ A;  1VJ6 A;  2EEJ A;  1UEQ A;  1IU0 A;  2DUB A;  3FDU A;  4Q0G A;  4XHV A;  3NGH A;  1QAV B;  1WHA A;  1WI4 A;  2W4F A;  3V8V A;  2MHO A;  4QIJ A;  5FHT A;  3EH7 A;  3F43 A;  2ZL4 A;  4ZDD A;  1FC6 A;  3H0S A;  3LNX A;  2J5S A;  3EGG C;  4KFV A;  2OGP A;  4RYF H;  5GND A;  4IC6 A;  3V5E A;  1B8Q A;  1QAV A;  3GAB A;  2JIL A;  3QJM A;  2QKU A;  3PV4 A;  4U19 A;  2VRF A;  1GQ4 A;  3H0U A;  2ZPM A;  2VSU C;  3T88 A;  5EYZ A;  4FN8 A;  3TSW A;  2M3M A;  1XNY A;  4Z0M A;  5HDY A;  3ID1 A;  3R68 A;  3BF0 A;  3KDG A;  1MC7 A;  1T2M A;  4JOH A;  3MH4 A;  2VRE A;  2RCZ A;  2OQS A;  4JWV A;  3M6M A;  4K75 A;  3WKM A;  3QK8 A;  1UJD A;  3R9T A;  4FB8 A;  1WIF A;  3KDK A;  4JFC A;  2ZPL A;  2QG1 A;  2PZD A;  3ISA A;  2AIN A;  1R6J A;  4O06 A;  5EZ0 A;  4JOT A;  2ZOA A;  2L97 A;  3I1E A;  4NMS A;  4ELS A;  1ZUB A;  1YG6 A;  3PE8 A;  3NJD A;  2PPY A;  3PV5 A;  3WG5 A;  1X6D A;  1W2X A;  4REY A;  4N6X A;  5DTP A;  2OS6 A;  1Q52 A;  1N7E A;  4KFW A;  4LMM A;  1SBO A;  1WFV A;  5HFD A;  5D13 A;  2I6V A;  3EGH C;  1UYV A;  2JWE A;  3TSZ A;  3T3W A;  1H4X A;  5KDR A;  1EY3 A;  3ST9 A;  1OBY A;  3N6R B;  1TP5 A;  4YYX A;  3QRE A;  1W9Q A;  1WF8 A;  3PGQ A;  1U37 A;  1UYR A;  2J5I A;  4U18 A;  3I47 A;  5ING A;  1TE0 A;  3T6O A;  1KY9 A;  3IB9 A;  2DB5 A;  2WL7 A;  3QGL A;  2IWQ A;  4Q2O A;  5EUZ A;  3MYB A;  3NFK A;  1LCY A;  4Q2Q A;  3D3U A;  3TVW A;  5EUW A;  2AS0 A;  2EEH A;  4K76 A;  2JRE A;  2PKU A;  3BPU A;  2KOH A;  3DOR A;  5DUF A;  1UM1 A;  4JYL A;  2D90 A;  4H11 A;  4JL7 A;  2CSJ A;  2H3M A;  3D03 A;  1UYS A;  3NCV A;  2Q35 A;  1THN B;  2VSS A;  5EUU A;  2JIN A;  2KQF A;  1I16 A;  1RZX A;  1UIT A;  1VB7 A;  1I92 A;  3TSV A;  3ZRT A;  3OIZ A;  3ZTB A;  3AXA A;  3KZE A;  3OT6 A;  5CTB A;  4Z8J A;  3PV2 A;  1QLC A;  1UHP A;  4JOP A;  3B76 A;  2KPL A;  3Q0G A;  2YUY A;  1VAE A;  4K3W A;  4JCT A;  3GDV A;  2EXG A;  3H81 A;  2CBY A;  1WF7 A;  4P0C A;  1NF3 C;  4U0G A;  1FC7 A;  1YBO A;  1O8U A;  3MH6 A;  2YT7 A;  3V97 A;  3TVU A;  4OEP A;  5JXB A;  4JJ0 A;  5E6P B;  1QAU A;  2KA5 A;  1PJH A;  2F6Q A;  4WYT A;  2IEX A;  2ZL2 A;  4L6W A;  5F67 A;  3RL8 A;  4RI0 A;  3TV5 A;  1H4Y A;  4NXQ A;  4G69 A;  4Q6H A;  4JCS A;  4U1A A;  2ZQQ A;  2LUI A;  3DJ1 A;  4Q6S A;  1T6R A;  2A81 A;  3K8X A;  4IZC A;  2KRG A;  1WDM A;  1OZI A;  3JXT A;  5DL1 A;  4RYF A;  3GDU A;  4E3B A;  3LLO A;  1OBZ A;  2F9Y A;  3P5M A;  3U9T B;  2NP9 A;  3RLE A;  2GZV A;  2QKT A;  1HNO A;  4ZDB A;  3GMF A;  1VCW A;  2PNT A;  1P1D A;  3K1R A;  2R4H A;  4EML A;  1WI2 A;  1VC1 A;  3MGL A;  2IWP A;  3HE2 A;  5B42 A;  3HRX A;  1M5Z A;  3WKL A;  2H2C A;  1RGW A;  3KTK A;  3FF6 A;  3KTJ A;  3GHF A;  5HFB A;  3ZW8 A;  4FLN A;  3KZD A;  3IHA A;  3CH8 A;  1Q3P A;  3GGE A;  5HJ1 A;  4OG1 A;  3QXI A;  2DLS A;  2KOJ A;  5HFE A;  3ID4 A;  2KA9 A;  1L6O A;  2GTR A;  1MFL A;  2RRL A;  3RL7 A;  4UU6 A;  2A7S A;  2M0T A;  2FW2 A;  3LKL A;  1XX4 A;  5E11 A;  2EDZ A;  3KTI A;  3BEZ A;  1HZD A;  1SOT A;  3DJ3 A;  2VSU E;  2F0A A;  3PS4 A;  4B3I A;  1WXW A;  1UIY A;  2M0U A;  3IF5 A;  1VRG A;  3LAO A;  2LOB A;  1TG6 A;  3STJ A;  1N7F A;  3TMH A;  1BUZ A;  1KWA A;  3O5N A;  3O46 A;  4K6Y A;  1U3B A;  3IH8 A;  3CBZ A;  4G2R A;  1FCF A;  4NEK A;  1JXZ A;  5DU8 A;  1WZ8 A;  2FCF A;  2UZC A;  4K78 A;  5FB8 C;  1UJV A;  1UEZ A;  2FE5 A;  5E21 A;  4HOP A;  2KOM A;  3LKE A;  4FJW D;  4HDT A;  3G64 A;  4RCN A;  1Z87 A;  4HNK A;  2DXN A;  1UEP A;  2F9I A;  3U9S B;  1Y8T A;  4JYJ A;  4J2U A;  2VSV A;  2PG8 A;  1UEW A;  2EDP A;  3CS0 A;  1TH8 B;  1UYT A;  1X5N A;  2JSN A;  3QE1 A;  2W7R A;  1UFX A;  1OD2 A;  2K1Z A;  2EDV A;  2UZF A;  2BYG A;  3I4W A;  3PDZ A;  1V0F A;  3AGE A;  1TYF A;  1W9O A;  3OME A;  4LK5 A;  2Q9V A;  3R69 A;  3GVJ A;  2BZR A;  1OBX A;  5F3X A;  2EEG A;  3GMA A;  2LC7 A;  2KL1 A;  4GM2 A;  2LA8 A;  3H0J A;  3K82 A;  1Q7X A;  4FZW C;  5A2P A;  3GLM A;  1TQ3 A;  4NMP A;  4IZB A;  3GJ9 A;  3SUZ A;  5DZK A;  3SLL A;  3QMJ A;  5HF1 A;  3MOG A;  4R2Z A;  5KJP A;  3TT7 A;  2DJT A;  2FZS A;  3STA A;  3QYR A;  2J5G D;  4NNL A;  3LNY A;  3KQF A;  2K20 A;  4FN7 A;  2J5I B;  2G2L A;  1ZOK A;  3QO6 A;  5FIF A;  3HIN A;  1DUB A;  2FBM A;  2J5G A;  4KPK A;  4ZDF A;  3ID2 A;  2W3P A;  2P3W A;  4DGH A;  3QJN A;  2L4S A;  3R6H A;  1WH1 A;  3QKA A;  1K32 A;  3E17 A;  4Q2N A;  3QIK A;  4UU5 A;  3T89 A;  4B3H A;  4HIZ A;  2VPH A;  5E22 A;  3GCO A;  4K72 A;  2OAS A;  3SOE A;  1G9O A;  2QT5 A;  4NMT A;  2VSU F;  2B78 A;  2EHR A;  4Z33 A;  4ZDE A;  4JCR A;  3T8B A;  5HFF A;  4YLH A;  2C8T A;  1X8S A;  5G1R A;  3MT6 A;  2KYL A;  3H02 A;  1N6D A;  3L4F D;  1HNU A;  1UF1 A;  3SHU A;  2REY A;  5CTC A;  4OMR A;  1WJL A;  3OC7 A;  4NNM A;  3VQF A;  1Y7O A;  2PBP A;  1UM7 A;  2KJK A;  3DUP A;  1HF2 A;  4AMH A;  2M0Z A;  2KJD A;  1RJM A;  4IZD A;  5IKL B;  2KAW A;  4HYL A;  2JXO A;  4QII A;  2KJP A;  2EAQ A;  2PKT A;  5G1D A;  1ON3 A;  3RRV A;  2EGK A;  3CBX A;  4JOR A;  4DMG A;  4F47 A;  3KTH A;  2G5M B;  3U9R B;  4DI1 A;  5DZK H;  1V5L A;  2HGA A;  4FGM A;  5HF4 A;  3GF7 A;  4FND A;  3ZWB A;  4U0G H;  3CBY A;  1SZO A;  5E1Y A;  4L8K A;  3RSI A;  2E7K A;  2Z9I A;  2I4S A;  4KWB A;  1WHD A;  2H3L A;  5G1E A;  4EDJ A;  2CS5 A;  4K29 A;  3JU1 A;  1FC9 A;  4OEO A;  3DJA A;  4HOP B;  1WDK A;  1V1T A;  5DTH A;  1MJ3 A;  1X5R A;  3GVL A;  4AE2 A;  3TRR A;  3MH7 A;  4JJ3 A;  2AWU A;  1ON9 A;  4L8N A;  4JCQ A;  4Q1I A;  1EF9 A;  5INI A;  4B3J A;  1BPL A;  2HE4 A;  5IL9 A;  3VSE A;  3MOY A;  1H4Z A;  4ZDC A;  2JIK A;  4KNP A;  2VY9 A;  5G1Q A;  2I0L A;  3QDQ A;  3C0K A;  2IWO A;  1NTE A;  3T8A A;  1V62 A;  2DAZ A;  4XS5 A;  1XZ9 A;  2J5I I;  2Q3G A;  4NMR A;  2EV8 A;  2CSS A;  3TLF A;  4DGF A;  4NAR A;  3QDO A;  5I7Z A;  1MFG A;  3P85 A;  3ZXN A;  3PZK A;  1N6E A;  1V0E A;  2Z17 A;  4JVT A;  5C90 A;  1TP3 A;  2D92 A;  1TIL B;  2F9I B;  1X45 A;  5H3J A;  3NJB A;  3VIV A;  4MI2 A;  5HUQ A;  4JOK A;  3OU0 A;  4E34 A;  3K50 A;  3Q1T A;  5C9G A;  3I18 A;  4FZW A;  1U38 A;  5E0S H;  3KHF A;  3CC0 A;  2OPG A;  4NMO A;  3SHW A;  1XNW A;  2ZQR A;  4Q3H A;  4JOG A;  3TT6 A;  3NFL A;  3R9S A;  3QXZ A;  2KG2 A;  3JU4 A;  1X5Q A;  2FNE A;  2VZ5 A;  5HET A;  4JJT A;  2EJY A;  2VSP A;  1YG8 A;  3L3S A;  4KD6 A;  1GM1 A;  4NNQ A;  2DKR A;  2A7K A;  3IBB A;  2EEI A;  2AWW A;  3FY5 A;  1XNV A;  1PIX A;  2M0V A;  2X58 A;  1SOZ A;  3GSL A;  4GVD A;  3QWD A;  4HC8 A;  3ZWC A;  1D5G A;  2FN5 A;  5GLJ A;  4MOU A;  2OCS A;  4YDP A;  5EUS A;  1N99 A;  3PEA A;  4ZU2 A;  2I0I A;  5EUX A;  4FNB A;  2KPK A;  1U39 A;  2EJ5 A;  1K39 A;  2IWN A;  2GEF A;  4JOF A;  2VSS E;  2AWX A;  1X9Z A;  2KLN A;  2YUB A;  2O2T A;  4QFE A;  4NMQ A;  1TID B;  4AEJ A;  2D3T A;  5FUS A;  3R0H A;  1XO6 A;  2ZL3 A;  1KEF A;  4F8K A;  1X0U A;  3DIW A;  3P2L A;  5JBW A;  1P1E A;  1EF8 A;  2LC6 A;  4U0H A;  3GVK A;  3OIR A;  3R9Q A;  2VSS F;  2CE3 A;  2ZO9 B;  4GHN A;  2YJG A;  1WFG A;  1IU2 A;  5HEB A;  1NZY A;  1UJU A;  4OAJ A;  1SG4 A;  2X7Z A;  2KBS A;  3CYY A;  1WDL A;  3M6N A;  1RGR A;  4WYO B;  1Q3O A;  3TZ3 A;  3HLN 1;  3ZWA A;  2X24 A;  3ZW9 A;  2Q2X A;  3ID3 A;  5HFC A;  4WCZ A;  5E0S A;  2H2B A;  1V5Q A;  2QKV A;  1RJN A;  2CWW A;  4JC0 A;  5DKP A;  2EGN A;  1WXX A;  2WTB A;  2QBW A;  2YTW A;  2RRM A;  3GDS A;  2DMZ A;  3GK7 A;  4WYU A;  3HP0 A;  5INF A;  4Q2P A;  1WG6 A;  2PA1 A;  5DU6 A;  1Q51 A;  1OD4 A;  3GKB A;  5DUC A;  5E0N X;  1V6B A;  3Q0J A;  4OLQ A;  1DCI A;  4ELW A;  1N6F A;  1BFE A;  1PDR A;  2ZL0 A;  4GVC A;  2MX6 A;  4L1C A;  4EMM A;  4NXP A;  5HEY A;  5EZB A;  3HPM A;  1GQ5 A;  2KV8 A;  2I1N A;  2DXL A;  3SWX A;  3IHB A;  5G1S A;  1BE9 A;  3LDF A;  3HVQ C;  2OSG A;  1Y7N A;  2L4T A;  3GCN A;  1RY4 A;  5B6L A;  4P2A B;  1J7X A;  4I52 A;  2M10 A;  3VQG A;  2F9Y B;  3V5I A;  1AUZ A;  2EGO A;  1N7T A;  2Q34 A;  2HW5 A; 
#chains in the Genus database with same CATH homology
 4E35 A;  4I42 A;  1Z86 A;  2OZF A;  3OTP A;  2DM8 A;  2I04 A;  2VSU A;  3KTG A;  1VA8 A;  2VWR A;  2ENO A;  5DTW A;  3GF3 A;  2V90 A;  4NXR A;  5HED A;  4MXI A;  2V1W A;  4MPA A;  4JOJ A;  4EMP A;  2R3Y A;  5MGB A;  4I4Z A;  2DLU A;  4JOE A;  4JSB A;  4NMV A;  2YT8 A;  5DU4 A;  4ASI A;  2D8I A;  2JOA A;  3R0O A;  3RST A;  3H0Q A;  1IHJ A;  2VX2 A;  3MFM A;  2F6I A;  3BPT A;  2F5Y A;  4PQW A;  3HPK A;  4WZ8 B;  3IAV A;  5JBX A;  2DEO A;  4K2N A;  5ILB A;  3TDC A;  2PDZ A;  1NZY B;  3SFJ A;  2DC2 A;  3PDV A;  2QQ3 A;  3Q7H A;  1W9E A;  3BPP A;  5KDR B;  4ELX A;  2HE2 A;  2OMJ A;  1VJ6 A;  2EEJ A;  1UEQ A;  1IU0 A;  2DUB A;  3FDU A;  4Q0G A;  4XHV A;  3NGH A;  1QAV B;  1WHA A;  1WI4 A;  2W4F A;  4QIJ A;  2MHO A;  5FHT A;  2ZL4 A;  4ZDD A;  1FC6 A;  3H0S A;  3LNX A;  2J5S A;  3EGG C;  4KFV A;  2OGP A;  4RYF H;  5GND A;  4IC6 A;  3V5E A;  1B8Q A;  1QAV A;  3GAB A;  2JIL A;  3QJM A;  2QKU A;  3PV4 A;  4U19 A;  2VRF A;  1GQ4 A;  3H0U A;  2ZPM A;  2VSU C;  3T88 A;  5EYZ A;  4FN8 A;  3TSW A;  2M3M A;  1XNY A;  4Z0M A;  5HDY A;  3ID1 A;  3R68 A;  3BF0 A;  3KDG A;  1MC7 A;  1T2M A;  4JOH A;  3MH4 A;  2VRE A;  2RCZ A;  2OQS A;  4JWV A;  3M6M A;  4K75 A;  3WKM A;  3QK8 A;  1UJD A;  3R9T A;  4FB8 A;  1WIF A;  3KDK A;  4JFC A;  2ZPL A;  2QG1 A;  2PZD A;  3ISA A;  2AIN A;  1R6J A;  4O06 A;  5EZ0 A;  4JOT A;  2ZOA A;  2L97 A;  3I1E A;  4NMS A;  4ELS A;  1ZUB A;  1YG6 A;  3PE8 A;  3NJD A;  2PPY A;  3PV5 A;  3WG5 A;  1X6D A;  1W2X A;  4REY A;  4N6X A;  5DTP A;  2OS6 A;  1Q52 A;  1N7E A;  4KFW A;  4LMM A;  1WFV A;  5HFD A;  5D13 A;  2I6V A;  3EGH C;  1UYV A;  2JWE A;  3TSZ A;  3T3W A;  5KDR A;  1EY3 A;  3ST9 A;  1OBY A;  3N6R B;  1TP5 A;  4YYX A;  3QRE A;  1W9Q A;  1WF8 A;  3PGQ A;  1U37 A;  1UYR A;  2J5I A;  4U18 A;  3I47 A;  5ING A;  1TE0 A;  1KY9 A;  3IB9 A;  2DB5 A;  2WL7 A;  3QGL A;  2IWQ A;  4Q2O A;  3MYB A;  3NFK A;  1LCY A;  4Q2Q A;  3TVW A;  2EEH A;  4K76 A;  2JRE A;  2PKU A;  3BPU A;  2KOH A;  3DOR A;  5DUF A;  1UM1 A;  4JYL A;  2D90 A;  4H11 A;  4JL7 A;  2CSJ A;  2H3M A;  3D03 A;  1UYS A;  3NCV A;  2Q35 A;  2VSS A;  2JIN A;  2KQF A;  1I16 A;  1RZX A;  1UIT A;  1VB7 A;  1I92 A;  3TSV A;  3ZRT A;  3AXA A;  3KZE A;  3OT6 A;  5CTB A;  4Z8J A;  3PV2 A;  1QLC A;  1UHP A;  4JOP A;  3B76 A;  2KPL A;  3Q0G A;  2YUY A;  1VAE A;  4K3W A;  4JCT A;  3GDV A;  2EXG A;  3H81 A;  2CBY A;  1WF7 A;  4P0C A;  1NF3 C;  4U0G A;  1FC7 A;  1YBO A;  1O8U A;  3MH6 A;  2YT7 A;  3TVU A;  4OEP A;  5JXB A;  4JJ0 A;  5E6P B;  1QAU A;  1PJH A;  2IEX A;  2F6Q A;  4WYT A;  2ZL2 A;  4L6W A;  5F67 A;  3RL8 A;  4RI0 A;  3TV5 A;  4NXQ A;  4G69 A;  4Q6H A;  4JCS A;  4U1A A;  2ZQQ A;  2LUI A;  3DJ1 A;  4Q6S A;  2A81 A;  3K8X A;  4IZC A;  2KRG A;  1WDM A;  1OZI A;  3JXT A;  5DL1 A;  4RYF A;  3GDU A;  4E3B A;  1OBZ A;  2F9Y A;  3P5M A;  3U9T B;  2NP9 A;  3RLE A;  2GZV A;  2QKT A;  1HNO A;  4ZDB A;  3GMF A;  1VCW A;  2PNT A;  1P1D A;  3K1R A;  2R4H A;  4EML A;  1WI2 A;  2IWP A;  3HE2 A;  5B42 A;  3HRX A;  1M5Z A;  3WKL A;  2H2C A;  1RGW A;  3KTK A;  3FF6 A;  3KTJ A;  3GHF A;  5HFB A;  3ZW8 A;  4FLN A;  3KZD A;  3CH8 A;  1Q3P A;  3GGE A;  5HJ1 A;  4OG1 A;  3QXI A;  2DLS A;  2KOJ A;  5HFE A;  3ID4 A;  2KA9 A;  1L6O A;  2GTR A;  1MFL A;  2RRL A;  3RL7 A;  4UU6 A;  2A7S A;  2M0T A;  2FW2 A;  1XX4 A;  5E11 A;  2EDZ A;  3KTI A;  3BEZ A;  1HZD A;  1SOT A;  3DJ3 A;  2VSU E;  2F0A A;  3PS4 A;  4B3I A;  1UIY A;  2M0U A;  1VRG A;  3LAO A;  2LOB A;  1TG6 A;  3STJ A;  1N7F A;  3TMH A;  1KWA A;  3O5N A;  3O46 A;  4K6Y A;  1U3B A;  4G2R A;  3CBZ A;  1FCF A;  4NEK A;  1JXZ A;  5DU8 A;  1WZ8 A;  2FCF A;  2UZC A;  4K78 A;  5FB8 C;  1UJV A;  1UEZ A;  2FE5 A;  5E21 A;  4HOP A;  2KOM A;  3LKE A;  4FJW D;  4HDT A;  3G64 A;  4RCN A;  1Z87 A;  4HNK A;  2DXN A;  1UEP A;  2F9I A;  3U9S B;  1Y8T A;  4JYJ A;  4J2U A;  2VSV A;  2PG8 A;  1UEW A;  2EDP A;  3CS0 A;  1UYT A;  1X5N A;  2JSN A;  3QE1 A;  2W7R A;  1UFX A;  1OD2 A;  2K1Z A;  2EDV A;  2UZF A;  2BYG A;  3I4W A;  3PDZ A;  3OME A;  1TYF A;  4LK5 A;  1W9O A;  2Q9V A;  3R69 A;  2BZR A;  1OBX A;  5F3X A;  2EEG A;  3GMA A;  2LC7 A;  2KL1 A;  4GM2 A;  2LA8 A;  3H0J A;  3K82 A;  1Q7X A;  4FZW C;  5A2P A;  3GLM A;  1TQ3 A;  4NMP A;  4IZB A;  3GJ9 A;  3SUZ A;  5DZK A;  3SLL A;  3QMJ A;  5HF1 A;  3MOG A;  4R2Z A;  5KJP A;  3TT7 A;  2DJT A;  2FZS A;  3STA A;  3QYR A;  2J5G D;  4NNL A;  3LNY A;  3KQF A;  2K20 A;  4FN7 A;  2J5I B;  2G2L A;  1ZOK A;  3QO6 A;  5FIF A;  3HIN A;  1DUB A;  2FBM A;  2J5G A;  4KPK A;  4ZDF A;  3ID2 A;  2W3P A;  2P3W A;  3QJN A;  2L4S A;  3R6H A;  1WH1 A;  3QKA A;  1K32 A;  3E17 A;  4Q2N A;  3QIK A;  4UU5 A;  3T89 A;  4B3H A;  2VPH A;  5E22 A;  3GCO A;  4K72 A;  3SOE A;  1G9O A;  2QT5 A;  4NMT A;  2VSU F;  2EHR A;  4Z33 A;  4ZDE A;  4JCR A;  3T8B A;  5HFF A;  4YLH A;  2C8T A;  1X8S A;  5G1R A;  3MT6 A;  2KYL A;  3H02 A;  1N6D A;  3L4F D;  1HNU A;  1UF1 A;  3SHU A;  2REY A;  5CTC A;  4OMR A;  1WJL A;  3OC7 A;  4NNM A;  3VQF A;  1Y7O A;  2PBP A;  1UM7 A;  2KJK A;  3DUP A;  4AMH A;  2M0Z A;  2KJD A;  1RJM A;  4IZD A;  5IKL B;  2KAW A;  2JXO A;  4QII A;  2KJP A;  2EAQ A;  2PKT A;  5G1D A;  1ON3 A;  3RRV A;  2EGK A;  3CBX A;  4JOR A;  4F47 A;  3KTH A;  2G5M B;  3U9R B;  4DI1 A;  5DZK H;  1V5L A;  2HGA A;  4FGM A;  5HF4 A;  3GF7 A;  4FND A;  3ZWB A;  4U0G H;  3CBY A;  1SZO A;  5E1Y A;  4L8K A;  3RSI A;  2E7K A;  2Z9I A;  2I4S A;  4KWB A;  1WHD A;  2H3L A;  5G1E A;  4EDJ A;  2CS5 A;  4K29 A;  3JU1 A;  1FC9 A;  4OEO A;  3DJA A;  4HOP B;  1WDK A;  1V1T A;  5DTH A;  1MJ3 A;  1X5R A;  4AE2 A;  3TRR A;  3MH7 A;  4JJ3 A;  2AWU A;  1ON9 A;  4L8N A;  4JCQ A;  4Q1I A;  1EF9 A;  5INI A;  4B3J A;  1BPL A;  2HE4 A;  5IL9 A;  3MOY A;  4ZDC A;  2JIK A;  4KNP A;  5G1Q A;  2I0L A;  2IWO A;  1NTE A;  3T8A A;  1V62 A;  2DAZ A;  2J5I I;  1XZ9 A;  2Q3G A;  4NMR A;  2EV8 A;  2CSS A;  3TLF A;  4NAR A;  3QDO A;  5I7Z A;  1MFG A;  3P85 A;  3PZK A;  1N6E A;  2Z17 A;  4JVT A;  5C90 A;  1TP3 A;  2D92 A;  2F9I B;  1X45 A;  5H3J A;  3NJB A;  3VIV A;  4MI2 A;  5HUQ A;  4JOK A;  3OU0 A;  4E34 A;  3K50 A;  3Q1T A;  5C9G A;  3I18 A;  4FZW A;  1U38 A;  5E0S H;  3KHF A;  3CC0 A;  2OPG A;  4NMO A;  3SHW A;  1XNW A;  2ZQR A;  4Q3H A;  4JOG A;  3TT6 A;  3NFL A;  3R9S A;  3QXZ A;  2KG2 A;  1X5Q A;  2FNE A;  2VZ5 A;  5HET A;  4JJT A;  2EJY A;  2VSP A;  1YG8 A;  3L3S A;  4KD6 A;  1GM1 A;  4NNQ A;  2DKR A;  2A7K A;  3IBB A;  2EEI A;  2AWW A;  3FY5 A;  1XNV A;  1PIX A;  2M0V A;  2X58 A;  1SOZ A;  3GSL A;  4GVD A;  3QWD A;  4HC8 A;  3ZWC A;  1D5G A;  2FN5 A;  5GLJ A;  4MOU A;  2OCS A;  4YDP A;  3PEA A;  1N99 A;  4ZU2 A;  2I0I A;  4FNB A;  2KPK A;  1U39 A;  2EJ5 A;  1K39 A;  2IWN A;  2GEF A;  4JOF A;  2VSS E;  2AWX A;  1X9Z A;  2YUB A;  2O2T A;  4QFE A;  4NMQ A;  4AEJ A;  2D3T A;  5FUS A;  3R0H A;  1XO6 A;  2ZL3 A;  1KEF A;  4F8K A;  1X0U A;  3DIW A;  3P2L A;  5JBW A;  1P1E A;  1EF8 A;  2LC6 A;  4U0H A;  3R9Q A;  2VSS F;  2CE3 A;  2ZO9 B;  4GHN A;  2YJG A;  1WFG A;  1IU2 A;  5HEB A;  1NZY A;  1UJU A;  4OAJ A;  1SG4 A;  2X7Z A;  2KBS A;  3CYY A;  1WDL A;  3M6N A;  1RGR A;  4WYO B;  1Q3O A;  3TZ3 A;  3HLN 1;  3ZWA A;  2X24 A;  3ZW9 A;  2Q2X A;  3ID3 A;  5HFC A;  4WCZ A;  5E0S A;  2H2B A;  1V5Q A;  2QKV A;  1RJN A;  4JC0 A;  5DKP A;  2EGN A;  2WTB A;  2QBW A;  2YTW A;  2RRM A;  3GDS A;  2DMZ A;  4WYU A;  3HP0 A;  5INF A;  4Q2P A;  1WG6 A;  2PA1 A;  5DU6 A;  1Q51 A;  1OD4 A;  3GKB A;  5DUC A;  5E0N X;  1V6B A;  3Q0J A;  4OLQ A;  1DCI A;  4ELW A;  1N6F A;  1BFE A;  1PDR A;  2ZL0 A;  4GVC A;  2MX6 A;  4L1C A;  4EMM A;  4NXP A;  5HEY A;  3HPM A;  1GQ5 A;  2KV8 A;  2I1N A;  2DXL A;  3SWX A;  5G1S A;  1BE9 A;  3HVQ C;  2OSG A;  1Y7N A;  2L4T A;  3GCN A;  1RY4 A;  5B6L A;  4P2A B;  1J7X A;  4I52 A;  2M10 A;  3VQG A;  2F9Y B;  3V5I A;  2EGO A;  1N7T A;  2Q34 A;  2HW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...