1FCFA

Photosystem ii d1 c-terminal processing protease
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
387
structure length
387
Chain Sequence
MVTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the photosystem II D1 C-terminal processing protease.
pubmed doi rcsb
source organism Scenedesmus obliquus
molecule tags Hydrolase
molecule keywords PHOTOSYSTEM II D1 PROTEASE
total genus 112
structure length 387
sequence length 387
ec nomenclature ec 3.4.21.102: C-terminal processing peptidase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1fcfA02
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1fcfA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1fcfA03
4K2NA 2Z9IA 5C9GA 3K1RA 3MH6A 2V1WA 2EEIA 2D8IA 2M0VA 3QREA 1M5ZA 2VRFA 1ON3A 3PE8A 2C8TA 5HJ1A 1XNYA 4IZBA 3QGLA 2JREA 1FCFA 4PQWA 1KWAA 3STJA 3HP0A 5FIFA 4Q2PA 5HEYA 2A7KA 2DLSA 1Q3PA 4JOGA 3OT6A 1HNUA 1WDLA 2PG8A 1P1EA 1NZYA 4ZDCA 4JSBA 3FY5A 1VA8A 3PEAA 3ZWAA 4OLQA 2BYGA 2W7RA 1WHAA 3K8XA 2RCZA 5HFEA 3K82A 2D3TA 3QWDA 2VSUC 4ELXA 1Y8TA 3MT6A 2AWWA 2KOHA 2D90A 4LMMA 2DKRA 2LA8A 1UJVA 2X24A 4KPKA 3STAA 1UJUA 2QQ3A 5DU6A 5JBXA 2M0TA 4I42A 1DCIA 2K1ZA 2VSSA 3SHWA 2OS6A 1OD4A 4H11A 1EY3A 1UFXA 2ENOA 3CH8A 3TT7A 3MH4A 3PV5A 4Q0GA 1WIFA 3NFKA 2BZRA 3HLN1 1WI2A 1UEQA 3GCNA 2JIKA 4F8KA 4ELWA 3WG5A 3K50A 1EF8A 2GTRA 2CS5A 4Q2QA 2EGOA 5HF4A 1Q51A 1RGWA 3OTPA 1V5LA 1PIXA 2KV8A 3IB9A 2KPLA 5EZ0A 2FW2A 3CYYA 2KL1A 5E11A 2ZQQA 2L97A 1X5QA 4FNBA 3RLEA 2ZL4A 3TZ3A 2KOJA 2A7SA 1DUBA 1WI4A 3QK8A 4MPAA 2K20A 2PKTA 4L8NA 4JYJA 4L8KA 1I92A 1X45A 1R6JA 2H2BA 1OBXA 3H0SA 2OCSA 3OU0A 4Z0MA 4JORA 5DZKA 2EV8A 4NXRA 3CC0A 3QO6A 2Q34A 4IC6A 4WYUA 1NZYB 1P1DA 4JOEA 4B3JA 3DJ3A 4UU6A 2IWPA 4OEPA 1W9OA 5C90A 1MFLA 1TP5A 5GLJA 3OC7A 3KTGA 3GDUA 3IBBA 4KFWA 3ST9A 4QIIA 1ZUBA 2EEJA 2EHRA 1K39A 2Q2XA 3MFMA 3ZW8A 1WG6A 1QLCA 1Z87A 4KD6A 1WFVA 3KTHA 3Q0JA 1BE9A 2KRGA 3GJ9A 1XNWA 3WKMA 2FZSA 1QAVA 3NJBA 4FGMA 3KHFA 2EDZA 3O5NA 2DC2A 2ZPMA 4NMOA 3Q0GA 5HFCA 3R0HA 3T8BA 4EMMA 4KWBA 2Z17A 3KTIA 1MFGA 3BPUA 4K76A 4KNPA 2H3MA 1OD2A 1RJNA 2FBMA 3TT6A 4RCNA 1ZOKA 4Q2NA 2KJPA 1IHJA 5DL1A 2PPYA 1NF3C 2O2TA 3I4WA 4GVDA 4HC8A 1RGRA 4R2ZA 1B8QA 3PV2A 5INIA 4O06A 4LK5A 3NJDA 2EEHA 2M0ZA 4YLHA 5DU4A 5HDYA 3SLLA 1EF9A 2VREA 5E0NX 1W9QA 2AINA 2KG2A 3BPPA 3RL8A 2J5IA 3LKEA 4B3HA 2AWUA 3MOYA 4FZWC 5F67A 4JL7A 4EDJA 1ON9A 1N6EA 2PDZA 2W4FA 2G5MB 1L6OA 3CBXA 1SG4A 4YDPA 1SOZA 2V90A 1JXZA 1VCWA 1PDRA 2R4HA 2M0UA 3QYRA 2PBPA 4ZDEA 3AXAA 3H0QA 5HEBA 5HFDA 2FN5A 3QKAA 3PDZA 4ZDDA 3RSTA 2KPKA 2EAQA 3GGEA 4MI2A 5F3XA 2VSUE 4K75A 4WYTA 1TG6A 4EMPA 1UEZA 1TE0A 2OMJA 5G1DA 2KA9A 1KEFA 1TP3A 1N6FA 3V5IA 3ID4A 1UYSA 2LOBA 3G64A 3QDOA 3GKBA 1IU0A 3HRXA 4XHVA 2F9IA 4OEOA 3Q7HA 3HPMA 2IWOA 4MXIA 3T8AA 1YG6A 1OBZA 3R68A 4G69A 1N7TA 2QT5A 5I7ZA 4K3WA 3HVQC 5DKPA 1RZXA 2KAWA 1VAEA 3ID2A 1QAVB 2PZDA 3QE1A 3R9TA 1V5QA 2HE2A 5HFFA 4JOPA 1LCYA 3GDSA 1HNOA 1FC6A 3NGHA 2J5GA 3RL7A 2KBSA 2J5SA 3U9TB 2H2CA 2KOMA 2CE3A 4IZDA 4U19A 2VPHA 3I47A 1WF7A 3H0JA 1OZIA 4NEKA 1NTEA 3PZKA 3ID1A 3M6NA 5E21A 4L6WA 3B76A 4JOFA 1VRGA 3E17A 3R69A 2Q9VA 5G1RA 2L4SA 4KFVA 5E0SA 2CSSA 3MH7A 4ZDBA 2HE4A 4JOTA 2DJTA 5DU8A 5CTBA 3PDVA 2UZFA 1VJ6A 5GNDA 2QKVA 3PV4A 1UYVA 4HNKA 4JVTA 3PS4A 4FB8A 2P3WA 2F6QA 4K78A 2PKUA 1WHDA 5EYZA 3N6RB 1UJDA 3DJ1A 2FE5A 3V5EA 1WDMA 5KDRB 3R0OA 2OPGA 5KJPA 2PA1A 3LAOA 2E7KA 2KJKA 3TSVA 2HW5A 3GSLA 4RYFH 5DZKH 3U9SB 4QIJA 3O46A 3WKLA 2DB5A 1GQ5A 4JCRA 1UM7A 3GMAA 3P85A 3R9SA 1WH1A 2UZCA 3KZEA 1FC7A 2ZL3A 2NP9A 2YUBA 5A2PA 4U1AA 4DI1A 1MJ3A 3DORA 2JXOA 3GF3A 4NNLA 5H3JA 5INFA 2QKUA 4FN8A 3KTKA 2ZPLA 2WTBA 4K29A 5G1SA 2I4SA 1N7FA 4FJWD 3HE2A 5FB8C 4Q6HA 4U18A 2G2LA 4B3IA 2LC7A 1WJLA 4FZWA 3DIWA 3VIVA 2W3PA 3ZWBA 5B6LA 1SOTA 2LUIA 2L4TA 2YT8A 2Q3GA 2EDPA 3CBYA 2ZL2A 4Z8JA 2M3MA 2VSSE 1UYTA 4JCTA 2X7ZA 3ISAA 3GF7A 2EXGA 3I18A 2EJ5A 4UU5A 1GM1A 3KZDA 3ID3A 5FUSA 2DUBA 4OG1A 3T88A 2H3LA 3GLMA 4OAJA 2I6VA 1UIYA 2OSGA 2F5YA 2D92A 4WCZA 2F0AA 3QJNA 2KQFA 5E1YA 4NNQA 5CTCA 2YUYA 2LC6A 2VSSF 4JWVA 1XNVA 1MC7A 2YT7A 1IU2A 3IAVA 4RYFA 3NFLA 1XZ9A 1WZ8A 4ELSA 3VQFA 2DEOA 5DUFA 1W2XA 1FC9A 1Y7OA 3TLFA 3TV5A 3QMJA 2AWXA 4NMVA 4Q3HA 3ZWCA 5DTHA 1V1TA 2WL7A 3QXZA 3LNXA 2QG1A 2IWQA 2VZ5A 3EGHC 2J5IB 2MHOA 4I52A 2VSPA 3L4FD 2OQSA 5HF1A 4E35A 3TDCA 2F9IB 1X5RA 2FNEA 1UF1A 2J5II 1GQ4A 3T89A 1OBYA 3SHUA 1Q3OA 3TVWA 4NMQA 4NXPA 2IEXA 1UHPA 4P0CA 4JOJA 5D13A 3VQGA 5JBWA 5KDRA 3BF0A 2JINA 1XX4A 2J5GD 3H0UA 5INGA 3QJMA 4GVCA 3SUZA 2EGNA 1UYRA 2YTWA 4ASIA 1YBOA 2QKTA 5HETA 2JOAA 2HGAA 3T3WA 5HEDA 1UEPA 4JCSA 4G2RA 4U0HA 4FNDA 5IKLB 3H81A 5DTWA 4U0GH 2EGKA 1UM1A 2FCFA 3HPKA 1XO6A 1BFEA 4RI0A 2OZFA 1Q7XA 4GM2A 2DMZA 4F47A 3JU1A 4U0GA 2KJDA 4IZCA 3CS0A 3GCOA 4JJTA 4ZDFA 1TYFA 3L3SA 1X6DA 4WZ8B 3SWXA 2F9YB 4K6YA 2PNTA 2DLUA 2VSUF 1Y7NA 2R3YA 2Q35A 1YG8A 2I1NA 2IWNA 1Q52A 4NMPA 3BEZA 2GZVA 3Q1TA 3I1EA 5E22A 3R6HA 3SFJA 3RSIA 2I04A 2A81A 4N6XA 1G9OA 1D5GA 3HINA 1VB7A 1UEWA 2ZQRA 2F9YA 4EMLA 3QXIA 1WF8A 2KYLA 4K72A 3ZRTA 5FHTA 4AMHA 4HOPA 4QFEA 3P5MA 1X5NA 4JCQA 4E3BA 4Q1IA 1RJMA 1U3BA 4NNMA 4P2AB 3TVUA 1QAUA 1HZDA 3JXTA 3TSWA 3EGGC 1U37A 5E6PB 3H02A 1SZOA 2EJYA 5E0SH 3GDVA 2DAZA 1Z86A 4NMTA 3M6MA 1W9EA 3U9RB 2MX6A 1WFGA 5DTPA 1T2MA 3TRRA 4HOPB 2OGPA 3MYBA 3P2LA 3TMHA 2VX2A 1TQ3A 2DM8A 3KQFA 2EDVA 4Q6SA 1I16A 2CSJA 3FDUA 3FF6A 2I0IA 2I0LA 3CBZA 2M10A 2CBYA 1RY4A 4JOKA 3DJAA 1J7XA 1PJHA 2VSUA 4OMRA 1UITA 2JILA 2REYA 4JFCA 3QIKA 2EEGA 1V62A 2VWRA 1U39A 2RRMA 5G1QA 2VSVA 2JWEA 4GHNA 4MOUA 4FN7A 1N6DA 2ZL0A 1X0UA 1U38A 4JOHA 4I4ZA 3SOEA 3LNYA 4NXQA 1WDKA 1KY9A 3ZW9A 2QBWA 4WYOB 4NMSA 5G1EA 3R9QA 1N99A 3TSZA 2F6IA 4YYXA 3RRVA 1X8SA 1K32A 1N7EA 4ZU2A 1V6BA 2X58A 3KTJA 5HFBA 4REYA 4Q2OA 5DUCA 4NMRA 1O8UA 4Z33A 4E34A 3PGQA 4JYLA 5MGBA 5JXBA 3OMEA
chains in the Genus database with same CATH superfamily
4K2NA 2Z9IA 5C9GA 3K1RA 3MH6A 2V1WA 2EEIA 2D8IA 2M0VA 3QREA 1M5ZA 2VRFA 1ON3A 3PE8A 2C8TA 5HJ1A 1XNYA 4IZBA 3QGLA 2JREA 1FCFA 4PQWA 1KWAA 3STJA 3HP0A 5FIFA 4Q2PA 5HEYA 2A7KA 2DLSA 1Q3PA 4JOGA 3T6OA 1HNUA 1WDLA 2PG8A 3OT6A 1P1EA 1NZYA 1BPLA 1SBOA 3MOGA 3FY5A 4JSBA 1VA8A 3PEAA 4ZDCA 4OLQA 2BYGA 2W7RA 1WHAA 3K8XA 3ZWAA 2RCZA 5HFEA 3K82A 2D3TA 3QWDA 2VSUC 4ELXA 1Y8TA 3MT6A 2AWWA 2KOHA 2D90A 4LMMA 2DKRA 2LA8A 1UJVA 2X24A 5IL9A 4KPKA 3STAA 1UJUA 2RRLA 2QQ3A 5DU6A 5JBXA 2M0TA 4HDTA 4I42A 1DCIA 2K1ZA 2VSSA 3SHWA 2OS6A 1OD4A 4H11A 1EY3A 1UFXA 2ENOA 3CH8A 3TT7A 3MH4A 3PV5A 4Q0GA 1WIFA 3NFKA 2BZRA 3HLN1 1WI2A 1UEQA 3GCNA 2JIKA 4F8KA 4ELWA 3WG5A 3K50A 1EF8A 2GTRA 2CS5A 3JU4A 4Q2QA 2EGOA 5HF4A 1Q51A 1RGWA 3OTPA 1V5LA 1PIXA 2KV8A 3IB9A 2KPLA 5EZ0A 5EZBA 2FW2A 3CYYA 2KL1A 5E11A 5EUWA 2ZQQA 2L97A 1X5QA 5EUXA 3RLEA 2ZL4A 4FNBA 3TZ3A 2KOJA 2A7SA 1DUBA 1WI4A 3QK8A 4MPAA 2K20A 2PKTA 4L8NA 4JYJA 4L8KA 1I92A 1X45A 1R6JA 2H2BA 1OBXA 3LLOA 3H0SA 2OCSA 3OU0A 4Z0MA 4JORA 5DZKA 2EV8A 4NXRA 3CC0A 3IH9A 3QO6A 2Q34A 4IC6A 4WYUA 1NZYB 1P1DA 4JOEA 4B3JA 3DJ3A 4UU6A 2IWPA 4OEPA 1W9OA 5C90A 1MFLA 1TP5A 5GLJA 3OC7A 3KTGA 3GDUA 3IBBA 4KFWA 3ST9A 4QIIA 1ZUBA 4QTPA 2EEJA 2EHRA 1K39A 2Q2XA 3MFMA 1WXWA 3ZW8A 1WG6A 3OIZA 1QLCA 1Z87A 4KD6A 1WFVA 1BUZA 3HINA 3KTHA 3Q0JA 1BE9A 2KRGA 3GJ9A 1XNWA 3WKMA 2FZSA 1QAVA 3NJBA 4FGMA 3KHFA 2EDZA 3O5NA 2DC2A 2ZPMA 3KDKA 4NMOA 3Q0GA 5HFCA 3R0HA 3T8BA 4EMMA 4KWBA 2Z17A 3KTIA 1MFGA 3BPUA 4K76A 4XS5A 4KNPA 2H3MA 1OD2A 1RJNA 2FBMA 3TT6A 4RCNA 1ZOKA 4Q2NA 2KJPA 1IHJA 5DL1A 2PPYA 1NF3C 2O2TA 3I4WA 4GVDA 4HC8A 1RGRA 4R2ZA 1B8QA 3PV2A 5INIA 4O06A 4LK5A 3NJDA 2EEHA 2M0ZA 4YLHA 5DU4A 5HDYA 3SLLA 1EF9A 2VREA 1H4YA 5E0NX 3IF5A 1W9QA 2AINA 2KG2A 3BPPA 3RL8A 2J5IA 3LKEA 4B3HA 2AWUA 3MOYA 3ZXNA 4FZWC 5F67A 4JL7A 3EH7A 4EDJA 1ON9A 1N6EA 2PDZA 2W4FA 2G5MB 1L6OA 3CBXA 1SG4A 3LKLA 4YDPA 1SOZA 1HF2A 2OASA 2V90A 1JXZA 1VCWA 1PDRA 2R4HA 2M0UA 4JJ0A 3C0KA 2PBPA 3QYRA 4ZDEA 3AXAA 3H0QA 5HEBA 5HFDA 3IHAA 2FN5A 3QKAA 3PDZA 4ZDDA 3RSTA 2KPKA 2EAQA 3GGEA 4MI2A 5F3XA 2VSUE 4K75A 4WYTA 3D03A 1TG6A 4EMPA 1UEZA 1TE0A 2OMJA 5G1DA 2KA9A 1KEFA 1TP3A 1N6FA 3V5IA 3ID4A 1UYSA 2LOBA 3G64A 3QDOA 1THNB 3GKBA 1IU0A 3HRXA 4XHVA 3IH8A 4OEOA 2F9IA 3Q7HA 3HPMA 2DXNA 2IWOA 4MXIA 3T8AA 1YG6A 1OBZA 3R68A 4G69A 1N7TA 2QT5A 5I7ZA 4K3WA 3HVQC 5DKPA 1RZXA 2KAWA 1VAEA 3ID2A 1V0EA 1QAVB 2PZDA 3QE1A 3R9TA 1V5QA 4AEJA 2HE2A 2JSNA 5HFFA 4JOPA 1LCYA 3GDSA 1HNOA 1FC6A 3NGHA 2J5GA 3OIRA 3RL7A 2KBSA 2J5SA 3IHBA 3U9TB 2H2CA 2KOMA 2CE3A 4IZDA 4U19A 2VPHA 3I47A 1WF7A 3H0JA 1OZIA 2YJGA 4NEKA 1NTEA 1H4XA 3PZKA 3ID1A 3M6NA 5E21A 4L6WA 3B76A 4JOFA 1VRGA 3E17A 3R69A 2Q9VA 5G1RA 2L4SA 4KFVA 5E0SA 2CSSA 3MH7A 4ZDBA 1T6RA 2HE4A 4JOTA 2DJTA 5DU8A 5CTBA 3PDVA 2UZFA 4L1CA 1VJ6A 5GNDA 2QKVA 3PV4A 1UYVA 4HNKA 4JVTA 3GVJA 3GABA 3PS4A 4FB8A 2P3WA 2F6QA 4K78A 1VC1A 2PKUA 3GVLA 1WHDA 5EYZA 3N6RB 1UJDA 2B78A 2AS0A 3DJ1A 2FE5A 3V5EA 1WDMA 5KDRB 3R0OA 2OPGA 5KJPA 2PA1A 3LAOA 2E7KA 2KJKA 3TSVA 2HW5A 3GSLA 4RYFH 5DZKH 3U9SB 4QIJA 3O46A 3WKLA 2DB5A 1GQ5A 2DXLA 4JCRA 1UM7A 3GMAA 3P85A 4NARA 3R9SA 1WH1A 2UZCA 5HUQA 3KZEA 1FC7A 2ZL3A 2NP9A 2YUBA 5A2PA 4U1AA 4DI1A 1MJ3A 3DORA 2JXOA 3GF3A 4NNLA 5H3JA 5INFA 2QKUA 4FN8A 3KTKA 2ZPLA 2WTBA 4K29A 5G1SA 2I4SA 1N7FA 4FJWD 2KLNA 5FB8C 1V0FA 3AGEA 3HE2A 1TILB 2ZOAA 4Q6HA 4U18A 2G2LA 4B3IA 2LC7A 1WJLA 4FZWA 3DIWA 3VIVA 2CWWA 2W3PA 3ZWBA 5B6LA 4EMLA 1SOTA 2LUIA 2L4TA 3GVKA 4AE2A 2YT8A 2Q3GA 2EDPA 3CBYA 2ZL2A 4Z8JA 2M3MA 2VSSE 1UYTA 4JCTA 2X7ZA 3ISAA 3GF7A 2EXGA 3I18A 2EJ5A 4UU5A 1GM1A 3KZDA 3ID3A 3KDGA 5FUSA 1AUZA 3ZTBA 5EUZA 2DUBA 4OG1A 3T88A 2H3LA 3GLMA 4OAJA 2I6VA 1UIYA 2OSGA 2F5YA 2D92A 4WCZA 5EUSA 2F0AA 3QJNA 2KQFA 5E1YA 4NNQA 5CTCA 2YUYA 2LC6A 1TH8B 2VSSF 4JWVA 4JC0A 1MC7A 2YT7A 1IU2A 3QDQA 4DGHA 1XNVA 3IAVA 4RYFA 3NFLA 1XZ9A 1WZ8A 4ELSA 3VQFA 2DEOA 5DUFA 1W2XA 1FC9A 1Y7OA 3TLFA 3TV5A 3QMJA 2AWXA 4NMVA 4Q3HA 3ZWCA 5DTHA 3V8VA 1V1TA 2WL7A 3QXZA 3LNXA 2QG1A 2IWQA 2VZ5A 3EGHC 2J5IB 2MHOA 4I52A 2VSPA 3L4FD 2OQSA 5HF1A 4E35A 3TDCA 2F9IB 1X5RA 2FNEA 1UF1A 2J5II 1GQ4A 4FLNA 3T89A 1OBYA 3SHUA 1Q3OA 3TVWA 4NMQA 3GMFA 4NXPA 3VSEA 2IEXA 1UHPA 4P0CA 4JOJA 5D13A 3VQGA 5JBWA 5KDRA 3BF0A 2JINA 1XX4A 2J5GD 3H0UA 4J2UA 5INGA 3QJMA 4GVCA 3SUZA 2EGNA 1UYRA 2YTWA 4ASIA 1YBOA 2QKTA 5HETA 2JOAA 2HGAA 3T3WA 5HEDA 1UEPA 1TIDB 4JCSA 4G2RA 4U0HA 4FNDA 5IKLB 3H81A 5DTWA 4U0GH 2EGKA 1UM1A 2FCFA 3HPKA 1XO6A 1BFEA 4RI0A 2OZFA 1Q7XA 4GM2A 2DMZA 4JJ3A 4F47A 3JU1A 4U0GA 2KJDA 4IZCA 3CS0A 3GCOA 4JJTA 4ZDFA 1TYFA 3L3SA 1X6DA 4WZ8B 3SWXA 2VY9A 2F9YB 4K6YA 2ZO9B 2PNTA 2DLUA 2VSUF 1Y7NA 5EUUA 2R3YA 1H4ZA 2Q35A 1YG8A 2I1NA 2IWNA 3NY7A 1Q52A 4NMPA 4DGFA 2GEFA 2GZVA 3I1EA 3BEZA 3Q1TA 5E22A 3R6HA 3NCVA 3SFJA 2I04A 3D3UA 4N6XA 1G9OA 1D5GA 3MGLA 1VB7A 1UEWA 4DMGA 2A81A 2F9YA 2ZQRA 1WF8A 3QXIA 2KYLA 4K72A 4HIZA 3ZRTA 5FHTA 4AMHA 4HOPA 4QFEA 3P5MA 1X5NA 4JCQA 4E3BA 4Q1IA 3GHFA 1RJMA 1U3BA 4NNMA 4P2AB 3TVUA 1QAUA 1HZDA 3JXTA 5ILBA 3TSWA 3EGGC 1U37A 5E6PB 3LDFA 3H02A 1SZOA 2EJYA 5E0SH 3GDVA 2DAZA 1Z86A 4NMTA 3BPTA 1W9EA 3M6MA 2MX6A 1WFGA 5DTPA 3U9RB 1T2MA 3TRRA 4HOPB 2OGPA 3MYBA 3P2LA 3TMHA 2VX2A 1TQ3A 3F43A 3V97A 2DM8A 3KQFA 2EDVA 1WXXA 4Q6SA 3GK7A 1I16A 2CSJA 3FDUA 3FF6A 2I0IA 2I0LA 3CBZA 2M10A 2CBYA 1RY4A 4JOKA 3DJAA 1J7XA 1PJHA 3AGDA 2VSUA 4OMRA 1UITA 2JILA 2REYA 4JFCA 3QIKA 2EEGA 1V62A 2VWRA 1U39A 2RRMA 5G1QA 1X9ZA 2JWEA 2VSVA 4GHNA 4MOUA 4FN7A 1N6DA 2ZL0A 1X0UA 3RSIA 1U38A 4JOHA 4I4ZA 3SOEA 3LNYA 4NXQA 1WDKA 1KY9A 3ZW9A 2QBWA 4WYOB 5B42A 4NMSA 5G1EA 3R9QA 1N99A 3TSZA 2F6IA 4HYLA 4YYXA 3RRVA 1X8SA 3DUPA 1K32A 1N7EA 4ZU2A 1V6BA 2KA5A 2X58A 3KTJA 5HFBA 4REYA 4Q2OA 5DUCA 4NMRA 1O8UA 4Z33A 4E34A 3PGQA 4JYLA 5MGBA 5JXBA 3OMEA
chains in the Genus database with same CATH topology
4K2NA 2Z9IA 5C9GA 3K1RA 3MH6A 2V1WA 2EEIA 2D8IA 2M0VA 3QREA 1M5ZA 2VRFA 1ON3A 3PE8A 2C8TA 5HJ1A 1XNYA 4IZBA 3QGLA 2JREA 1FCFA 4PQWA 1KWAA 3STJA 3HP0A 5FIFA 4Q2PA 5HEYA 2A7KA 2DLSA 1Q3PA 4JOGA 3OT6A 1HNUA 1WDLA 2PG8A 1P1EA 1NZYA 1BPLA 4ZDCA 3MOGA 3FY5A 4JSBA 1VA8A 3PEAA 3ZWAA 4OLQA 2BYGA 2W7RA 1WHAA 3K8XA 2RCZA 5HFEA 3K82A 2D3TA 3QWDA 2VSUC 4ELXA 1Y8TA 3MT6A 2AWWA 2KOHA 2D90A 4LMMA 2DKRA 2LA8A 1UJVA 2X24A 5IL9A 4KPKA 3STAA 1UJUA 2RRLA 2QQ3A 5DU6A 5JBXA 2M0TA 4HDTA 4I42A 1DCIA 2K1ZA 2VSSA 3SHWA 2OS6A 1OD4A 4H11A 1EY3A 1UFXA 2ENOA 3CH8A 3TT7A 3MH4A 3PV5A 4Q0GA 1WIFA 3NFKA 2BZRA 3HLN1 1WI2A 1UEQA 3GCNA 2JIKA 4F8KA 4ELWA 3WG5A 3K50A 1EF8A 2GTRA 2CS5A 4Q2QA 2EGOA 5HF4A 1Q51A 1RGWA 3OTPA 1V5LA 1PIXA 2KV8A 3IB9A 2KPLA 5EZ0A 2FW2A 3CYYA 2KL1A 5E11A 2ZQQA 2L97A 1X5QA 4FNBA 3RLEA 2ZL4A 3TZ3A 2KOJA 2A7SA 1DUBA 1WI4A 3QK8A 4MPAA 2K20A 2PKTA 4L8NA 4JYJA 4L8KA 1I92A 1X45A 1R6JA 2H2BA 1OBXA 3H0SA 2OCSA 3OU0A 4Z0MA 4JORA 5DZKA 2EV8A 4NXRA 3CC0A 3QO6A 2Q34A 4IC6A 4WYUA 1NZYB 1P1DA 4JOEA 4B3JA 3DJ3A 4UU6A 2IWPA 4OEPA 1W9OA 5C90A 1MFLA 1TP5A 5GLJA 3OC7A 3KTGA 3GDUA 3IBBA 4KFWA 3ST9A 4QIIA 1ZUBA 2EEJA 2EHRA 1K39A 2Q2XA 3MFMA 3ZW8A 1WG6A 1QLCA 1Z87A 4KD6A 1WFVA 3KTHA 3Q0JA 1BE9A 2KRGA 3GJ9A 1XNWA 3WKMA 2FZSA 1QAVA 3NJBA 4FGMA 3KHFA 2EDZA 3O5NA 2DC2A 2ZPMA 3KDKA 4NMOA 3Q0GA 5HFCA 3R0HA 3T8BA 4EMMA 4KWBA 2Z17A 3KTIA 1MFGA 3BPUA 4K76A 4KNPA 2H3MA 1OD2A 1RJNA 2FBMA 3TT6A 4RCNA 1ZOKA 4Q2NA 2KJPA 1IHJA 5DL1A 2PPYA 1NF3C 2O2TA 3I4WA 4GVDA 4HC8A 1RGRA 4R2ZA 1B8QA 3PV2A 5INIA 4O06A 4LK5A 3NJDA 2EEHA 2M0ZA 4YLHA 5DU4A 5HDYA 3SLLA 1EF9A 2VREA 5E0NX 1W9QA 2AINA 2KG2A 3BPPA 3RL8A 2J5IA 3LKEA 4B3HA 2AWUA 3MOYA 4FZWC 5F67A 4JL7A 4EDJA 1ON9A 1N6EA 2PDZA 2W4FA 2G5MB 1L6OA 3CBXA 1SG4A 4YDPA 1SOZA 2V90A 1JXZA 1VCWA 1PDRA 2R4HA 2M0UA 4JJ0A 2PBPA 3QYRA 4ZDEA 3AXAA 3H0QA 5HEBA 5HFDA 2FN5A 3QKAA 3PDZA 4ZDDA 3RSTA 2KPKA 2EAQA 3GGEA 4MI2A 5F3XA 2VSUE 4K75A 4WYTA 3D03A 1TG6A 4EMPA 1UEZA 1TE0A 2OMJA 5G1DA 2KA9A 1KEFA 1TP3A 1N6FA 3V5IA 3ID4A 1UYSA 2LOBA 3G64A 3QDOA 3GKBA 1IU0A 3HRXA 4XHVA 2F9IA 4OEOA 3Q7HA 3HPMA 2DXNA 2IWOA 4MXIA 3T8AA 1YG6A 1OBZA 3R68A 4G69A 1N7TA 2QT5A 5I7ZA 4K3WA 3HVQC 5DKPA 1RZXA 2KAWA 1VAEA 3ID2A 1QAVB 2PZDA 3QE1A 3R9TA 1V5QA 4AEJA 2HE2A 2JSNA 5HFFA 4JOPA 1LCYA 3GDSA 1HNOA 1FC6A 3NGHA 2J5GA 3RL7A 2KBSA 2J5SA 3U9TB 2H2CA 2KOMA 2CE3A 4IZDA 4U19A 2VPHA 3I47A 1WF7A 3H0JA 1OZIA 2YJGA 4NEKA 1NTEA 3PZKA 3ID1A 3M6NA 5E21A 4L6WA 3B76A 4JOFA 1VRGA 3E17A 3R69A 2Q9VA 5G1RA 2L4SA 4KFVA 5E0SA 2CSSA 3MH7A 4ZDBA 2HE4A 4JOTA 2DJTA 5DU8A 5CTBA 3PDVA 2UZFA 4L1CA 1VJ6A 5GNDA 2QKVA 3PV4A 1UYVA 4HNKA 4JVTA 3GABA 3PS4A 4FB8A 2P3WA 2F6QA 4K78A 2PKUA 1WHDA 5EYZA 3N6RB 1UJDA 3DJ1A 2FE5A 3V5EA 1WDMA 5KDRB 3R0OA 2OPGA 5KJPA 2PA1A 3LAOA 2E7KA 2KJKA 3TSVA 2HW5A 3GSLA 4RYFH 5DZKH 3U9SB 4QIJA 3O46A 3WKLA 2DB5A 1GQ5A 2DXLA 4JCRA 1UM7A 3GMAA 3P85A 4NARA 3R9SA 1WH1A 2UZCA 5HUQA 3KZEA 1FC7A 2ZL3A 2NP9A 2YUBA 5A2PA 4U1AA 4DI1A 1MJ3A 3DORA 2JXOA 3GF3A 4NNLA 5H3JA 5INFA 2QKUA 4FN8A 3KTKA 2ZPLA 2WTBA 4K29A 5G1SA 2I4SA 1N7FA 4FJWD 3HE2A 5FB8C 2ZOAA 4Q6HA 4U18A 2G2LA 4B3IA 2LC7A 1WJLA 4FZWA 3DIWA 3VIVA 2W3PA 3ZWBA 5B6LA 1SOTA 2LUIA 2L4TA 4AE2A 2YT8A 2Q3GA 2EDPA 3CBYA 2ZL2A 4Z8JA 2M3MA 2VSSE 1UYTA 4JCTA 2X7ZA 3ISAA 3GF7A 2EXGA 3I18A 2EJ5A 4UU5A 1GM1A 3KZDA 3ID3A 3KDGA 5FUSA 2DUBA 4OG1A 3T88A 2H3LA 3GLMA 4OAJA 2I6VA 1UIYA 2OSGA 2F5YA 2D92A 4WCZA 2F0AA 3QJNA 2KQFA 5E1YA 4NNQA 5CTCA 2YUYA 2LC6A 2VSSF 4JWVA 4JC0A 1MC7A 2YT7A 1IU2A 1XNVA 3IAVA 4RYFA 3NFLA 1XZ9A 1WZ8A 4ELSA 3VQFA 2DEOA 5DUFA 1W2XA 1FC9A 1Y7OA 3TLFA 3TV5A 3QMJA 2AWXA 4NMVA 4Q3HA 3ZWCA 5DTHA 1V1TA 2WL7A 3QXZA 3LNXA 2QG1A 2IWQA 2VZ5A 3EGHC 2J5IB 2MHOA 4I52A 2VSPA 3L4FD 2OQSA 5HF1A 4E35A 3TDCA 2F9IB 1X5RA 2FNEA 1UF1A 2J5II 1GQ4A 4FLNA 3T89A 1OBYA 3SHUA 1Q3OA 3TVWA 4NMQA 3GMFA 4NXPA 2IEXA 1UHPA 4P0CA 4JOJA 5D13A 3VQGA 5JBWA 5KDRA 3BF0A 2JINA 1XX4A 2J5GD 3H0UA 4J2UA 5INGA 3QJMA 4GVCA 3SUZA 2EGNA 1UYRA 2YTWA 4ASIA 1YBOA 2QKTA 5HETA 2JOAA 2HGAA 3T3WA 5HEDA 1UEPA 4JCSA 4G2RA 4U0HA 4FNDA 5IKLB 3H81A 5DTWA 4U0GH 2EGKA 1UM1A 2FCFA 3HPKA 1XO6A 1BFEA 4RI0A 2OZFA 1Q7XA 4GM2A 2DMZA 4JJ3A 4F47A 3JU1A 4U0GA 2KJDA 4IZCA 3CS0A 3GCOA 4JJTA 4ZDFA 1TYFA 3L3SA 1X6DA 4WZ8B 3SWXA 2F9YB 4K6YA 2ZO9B 2PNTA 2DLUA 2VSUF 1Y7NA 2R3YA 2Q35A 1YG8A 2I1NA 2IWNA 1Q52A 4NMPA 3BEZA 2GEFA 2GZVA 3I1EA 3Q1TA 5E22A 3R6HA 3NCVA 3SFJA 2I04A 2A81A 4N6XA 1G9OA 1D5GA 3HINA 1VB7A 1UEWA 2ZQRA 2F9YA 4EMLA 3QXIA 1WF8A 2KYLA 4K72A 3ZRTA 5FHTA 4AMHA 4HOPA 4QFEA 3P5MA 1X5NA 4JCQA 4E3BA 4Q1IA 3GHFA 1RJMA 1U3BA 4NNMA 4P2AB 3TVUA 1QAUA 1HZDA 3JXTA 5ILBA 3TSWA 3EGGC 1U37A 5E6PB 3H02A 1SZOA 2EJYA 5E0SH 3GDVA 2DAZA 1Z86A 4NMTA 3BPTA 1W9EA 3M6MA 2MX6A 1WFGA 5DTPA 3U9RB 1T2MA 3TRRA 4HOPB 2OGPA 3MYBA 3P2LA 3TMHA 2VX2A 1TQ3A 2DM8A 3KQFA 2EDVA 4Q6SA 1I16A 2CSJA 3FDUA 3FF6A 2I0IA 2I0LA 3CBZA 2M10A 2CBYA 1RY4A 4JOKA 3DJAA 1J7XA 1PJHA 2VSUA 4OMRA 1UITA 2JILA 2REYA 4JFCA 3QIKA 2EEGA 1V62A 2VWRA 1U39A 2RRMA 5G1QA 1X9ZA 2JWEA 2VSVA 4GHNA 4MOUA 4FN7A 1N6DA 2ZL0A 1X0UA 3RSIA 1U38A 4JOHA 4I4ZA 3SOEA 3LNYA 4NXQA 1WDKA 1KY9A 3ZW9A 2QBWA 4WYOB 5B42A 4NMSA 5G1EA 3R9QA 1N99A 3TSZA 2F6IA 4YYXA 3RRVA 1X8SA 3DUPA 1K32A 1N7EA 4ZU2A 1V6BA 2X58A 3KTJA 5HFBA 4REYA 4Q2OA 5DUCA 4NMRA 1O8UA 4Z33A 4E34A 3PGQA 4JYLA 5MGBA 5JXBA 3OMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2N A;  2Z9I A;  5C9G A;  3K1R A;  3MH6 A;  2V1W A;  2EEI A;  2D8I A;  2M0V A;  3QRE A;  1M5Z A;  2VRF A;  1ON3 A;  3PE8 A;  2C8T A;  5HJ1 A;  1XNY A;  4IZB A;  3QGL A;  2JRE A;  1FCF A;  4PQW A;  1KWA A;  3STJ A;  3HP0 A;  5FIF A;  4Q2P A;  5HEY A;  2A7K A;  2DLS A;  1Q3P A;  4JOG A;  3OT6 A;  1HNU A;  1WDL A;  2PG8 A;  1P1E A;  1NZY A;  4ZDC A;  4JSB A;  3FY5 A;  1VA8 A;  3PEA A;  3ZWA A;  4OLQ A;  2BYG A;  2W7R A;  1WHA A;  3K8X A;  2RCZ A;  5HFE A;  3K82 A;  2D3T A;  3QWD A;  2VSU C;  4ELX A;  1Y8T A;  3MT6 A;  2AWW A;  2KOH A;  2D90 A;  4LMM A;  2DKR A;  2LA8 A;  1UJV A;  2X24 A;  4KPK A;  3STA A;  1UJU A;  2QQ3 A;  5DU6 A;  5JBX A;  2M0T A;  4I42 A;  1DCI A;  2K1Z A;  2VSS A;  3SHW A;  2OS6 A;  1OD4 A;  4H11 A;  1EY3 A;  1UFX A;  2ENO A;  3CH8 A;  3TT7 A;  3MH4 A;  3PV5 A;  4Q0G A;  1WIF A;  3NFK A;  2BZR A;  3HLN 1;  1WI2 A;  1UEQ A;  3GCN A;  2JIK A;  4F8K A;  4ELW A;  3WG5 A;  3K50 A;  1EF8 A;  2GTR A;  2CS5 A;  4Q2Q A;  2EGO A;  5HF4 A;  1Q51 A;  1RGW A;  3OTP A;  1V5L A;  1PIX A;  2KV8 A;  3IB9 A;  2KPL A;  5EZ0 A;  2FW2 A;  3CYY A;  2KL1 A;  5E11 A;  2ZQQ A;  2L97 A;  1X5Q A;  4FNB A;  3RLE A;  2ZL4 A;  3TZ3 A;  2KOJ A;  2A7S A;  1DUB A;  1WI4 A;  3QK8 A;  4MPA A;  2K20 A;  2PKT A;  4L8N A;  4JYJ A;  4L8K A;  1I92 A;  1X45 A;  1R6J A;  2H2B A;  1OBX A;  3H0S A;  2OCS A;  3OU0 A;  4Z0M A;  4JOR A;  5DZK A;  2EV8 A;  4NXR A;  3CC0 A;  3QO6 A;  2Q34 A;  4IC6 A;  4WYU A;  1NZY B;  1P1D A;  4JOE A;  4B3J A;  3DJ3 A;  4UU6 A;  2IWP A;  4OEP A;  1W9O A;  5C90 A;  1MFL A;  1TP5 A;  5GLJ A;  3OC7 A;  3KTG A;  3GDU A;  3IBB A;  4KFW A;  3ST9 A;  4QII A;  1ZUB A;  2EEJ A;  2EHR A;  1K39 A;  2Q2X A;  3MFM A;  3ZW8 A;  1WG6 A;  1QLC A;  1Z87 A;  4KD6 A;  1WFV A;  3KTH A;  3Q0J A;  1BE9 A;  2KRG A;  3GJ9 A;  1XNW A;  3WKM A;  2FZS A;  1QAV A;  3NJB A;  4FGM A;  3KHF A;  2EDZ A;  3O5N A;  2DC2 A;  2ZPM A;  4NMO A;  3Q0G A;  5HFC A;  3R0H A;  3T8B A;  4EMM A;  4KWB A;  2Z17 A;  3KTI A;  1MFG A;  3BPU A;  4K76 A;  4KNP A;  2H3M A;  1OD2 A;  1RJN A;  2FBM A;  3TT6 A;  4RCN A;  1ZOK A;  4Q2N A;  2KJP A;  1IHJ A;  5DL1 A;  2PPY A;  1NF3 C;  2O2T A;  3I4W A;  4GVD A;  4HC8 A;  1RGR A;  4R2Z A;  1B8Q A;  3PV2 A;  5INI A;  4O06 A;  4LK5 A;  3NJD A;  2EEH A;  2M0Z A;  4YLH A;  5DU4 A;  5HDY A;  3SLL A;  1EF9 A;  2VRE A;  5E0N X;  1W9Q A;  2AIN A;  2KG2 A;  3BPP A;  3RL8 A;  2J5I A;  3LKE A;  4B3H A;  2AWU A;  3MOY A;  4FZW C;  5F67 A;  4JL7 A;  4EDJ A;  1ON9 A;  1N6E A;  2PDZ A;  2W4F A;  2G5M B;  1L6O A;  3CBX A;  1SG4 A;  4YDP A;  1SOZ A;  2V90 A;  1JXZ A;  1VCW A;  1PDR A;  2R4H A;  2M0U A;  3QYR A;  2PBP A;  4ZDE A;  3AXA A;  3H0Q A;  5HEB A;  5HFD A;  2FN5 A;  3QKA A;  3PDZ A;  4ZDD A;  3RST A;  2KPK A;  2EAQ A;  3GGE A;  4MI2 A;  5F3X A;  2VSU E;  4K75 A;  4WYT A;  1TG6 A;  4EMP A;  1UEZ A;  1TE0 A;  2OMJ A;  5G1D A;  2KA9 A;  1KEF A;  1TP3 A;  1N6F A;  3V5I A;  3ID4 A;  1UYS A;  2LOB A;  3G64 A;  3QDO A;  3GKB A;  1IU0 A;  3HRX A;  4XHV A;  2F9I A;  4OEO A;  3Q7H A;  3HPM A;  2IWO A;  4MXI A;  3T8A A;  1YG6 A;  1OBZ A;  3R68 A;  4G69 A;  1N7T A;  2QT5 A;  5I7Z A;  4K3W A;  3HVQ C;  5DKP A;  1RZX A;  2KAW A;  1VAE A;  3ID2 A;  1QAV B;  2PZD A;  3QE1 A;  3R9T A;  1V5Q A;  2HE2 A;  5HFF A;  4JOP A;  1LCY A;  3GDS A;  1HNO A;  1FC6 A;  3NGH A;  2J5G A;  3RL7 A;  2KBS A;  2J5S A;  3U9T B;  2H2C A;  2KOM A;  2CE3 A;  4IZD A;  4U19 A;  2VPH A;  3I47 A;  1WF7 A;  3H0J A;  1OZI A;  4NEK A;  1NTE A;  3PZK A;  3ID1 A;  3M6N A;  5E21 A;  4L6W A;  3B76 A;  4JOF A;  1VRG A;  3E17 A;  3R69 A;  2Q9V A;  5G1R A;  2L4S A;  4KFV A;  5E0S A;  2CSS A;  3MH7 A;  4ZDB A;  2HE4 A;  4JOT A;  2DJT A;  5DU8 A;  5CTB A;  3PDV A;  2UZF A;  1VJ6 A;  5GND A;  2QKV A;  3PV4 A;  1UYV A;  4HNK A;  4JVT A;  3PS4 A;  4FB8 A;  2P3W A;  2F6Q A;  4K78 A;  2PKU A;  1WHD A;  5EYZ A;  3N6R B;  1UJD A;  3DJ1 A;  2FE5 A;  3V5E A;  1WDM A;  5KDR B;  3R0O A;  2OPG A;  5KJP A;  2PA1 A;  3LAO A;  2E7K A;  2KJK A;  3TSV A;  2HW5 A;  3GSL A;  4RYF H;  5DZK H;  3U9S B;  4QIJ A;  3O46 A;  3WKL A;  2DB5 A;  1GQ5 A;  4JCR A;  1UM7 A;  3GMA A;  3P85 A;  3R9S A;  1WH1 A;  2UZC A;  3KZE A;  1FC7 A;  2ZL3 A;  2NP9 A;  2YUB A;  5A2P A;  4U1A A;  4DI1 A;  1MJ3 A;  3DOR A;  2JXO A;  3GF3 A;  4NNL A;  5H3J A;  5INF A;  2QKU A;  4FN8 A;  3KTK A;  2ZPL A;  2WTB A;  4K29 A;  5G1S A;  2I4S A;  1N7F A;  4FJW D;  3HE2 A;  5FB8 C;  4Q6H A;  4U18 A;  2G2L A;  4B3I A;  2LC7 A;  1WJL A;  4FZW A;  3DIW A;  3VIV A;  2W3P A;  3ZWB A;  5B6L A;  1SOT A;  2LUI A;  2L4T A;  2YT8 A;  2Q3G A;  2EDP A;  3CBY A;  2ZL2 A;  4Z8J A;  2M3M A;  2VSS E;  1UYT A;  4JCT A;  2X7Z A;  3ISA A;  3GF7 A;  2EXG A;  3I18 A;  2EJ5 A;  4UU5 A;  1GM1 A;  3KZD A;  3ID3 A;  5FUS A;  2DUB A;  4OG1 A;  3T88 A;  2H3L A;  3GLM A;  4OAJ A;  2I6V A;  1UIY A;  2OSG A;  2F5Y A;  2D92 A;  4WCZ A;  2F0A A;  3QJN A;  2KQF A;  5E1Y A;  4NNQ A;  5CTC A;  2YUY A;  2LC6 A;  2VSS F;  4JWV A;  1XNV A;  1MC7 A;  2YT7 A;  1IU2 A;  3IAV A;  4RYF A;  3NFL A;  1XZ9 A;  1WZ8 A;  4ELS A;  3VQF A;  2DEO A;  5DUF A;  1W2X A;  1FC9 A;  1Y7O A;  3TLF A;  3TV5 A;  3QMJ A;  2AWX A;  4NMV A;  4Q3H A;  3ZWC A;  5DTH A;  1V1T A;  2WL7 A;  3QXZ A;  3LNX A;  2QG1 A;  2IWQ A;  2VZ5 A;  3EGH C;  2J5I B;  2MHO A;  4I52 A;  2VSP A;  3L4F D;  2OQS A;  5HF1 A;  4E35 A;  3TDC A;  2F9I B;  1X5R A;  2FNE A;  1UF1 A;  2J5I I;  1GQ4 A;  3T89 A;  1OBY A;  3SHU A;  1Q3O A;  3TVW A;  4NMQ A;  4NXP A;  2IEX A;  1UHP A;  4P0C A;  4JOJ A;  5D13 A;  3VQG A;  5JBW A;  5KDR A;  3BF0 A;  2JIN A;  1XX4 A;  2J5G D;  3H0U A;  5ING A;  3QJM A;  4GVC A;  3SUZ A;  2EGN A;  1UYR A;  2YTW A;  4ASI A;  1YBO A;  2QKT A;  5HET A;  2JOA A;  2HGA A;  3T3W A;  5HED A;  1UEP A;  4JCS A;  4G2R A;  4U0H A;  4FND A;  5IKL B;  3H81 A;  5DTW A;  4U0G H;  2EGK A;  1UM1 A;  2FCF A;  3HPK A;  1XO6 A;  1BFE A;  4RI0 A;  2OZF A;  1Q7X A;  4GM2 A;  2DMZ A;  4F47 A;  3JU1 A;  4U0G A;  2KJD A;  4IZC A;  3CS0 A;  3GCO A;  4JJT A;  4ZDF A;  1TYF A;  3L3S A;  1X6D A;  4WZ8 B;  3SWX A;  2F9Y B;  4K6Y A;  2PNT A;  2DLU A;  2VSU F;  1Y7N A;  2R3Y A;  2Q35 A;  1YG8 A;  2I1N A;  2IWN A;  1Q52 A;  4NMP A;  3BEZ A;  2GZV A;  3Q1T A;  3I1E A;  5E22 A;  3R6H A;  3SFJ A;  3RSI A;  2I04 A;  2A81 A;  4N6X A;  1G9O A;  1D5G A;  3HIN A;  1VB7 A;  1UEW A;  2ZQR A;  2F9Y A;  4EML A;  3QXI A;  1WF8 A;  2KYL A;  4K72 A;  3ZRT A;  5FHT A;  4AMH A;  4HOP A;  4QFE A;  3P5M A;  1X5N A;  4JCQ A;  4E3B A;  4Q1I A;  1RJM A;  1U3B A;  4NNM A;  4P2A B;  3TVU A;  1QAU A;  1HZD A;  3JXT A;  3TSW A;  3EGG C;  1U37 A;  5E6P B;  3H02 A;  1SZO A;  2EJY A;  5E0S H;  3GDV A;  2DAZ A;  1Z86 A;  4NMT A;  3M6M A;  1W9E A;  3U9R B;  2MX6 A;  1WFG A;  5DTP A;  1T2M A;  3TRR A;  4HOP B;  2OGP A;  3MYB A;  3P2L A;  3TMH A;  2VX2 A;  1TQ3 A;  2DM8 A;  3KQF A;  2EDV A;  4Q6S A;  1I16 A;  2CSJ A;  3FDU A;  3FF6 A;  2I0I A;  2I0L A;  3CBZ A;  2M10 A;  2CBY A;  1RY4 A;  4JOK A;  3DJA A;  1J7X A;  1PJH A;  2VSU A;  4OMR A;  1UIT A;  2JIL A;  2REY A;  4JFC A;  3QIK A;  2EEG A;  1V62 A;  2VWR A;  1U39 A;  2RRM A;  5G1Q A;  2VSV A;  2JWE A;  4GHN A;  4MOU A;  4FN7 A;  1N6D A;  2ZL0 A;  1X0U A;  1U38 A;  4JOH A;  4I4Z A;  3SOE A;  3LNY A;  4NXQ A;  1WDK A;  1KY9 A;  3ZW9 A;  2QBW A;  4WYO B;  4NMS A;  5G1E A;  3R9Q A;  1N99 A;  3TSZ A;  2F6I A;  4YYX A;  3RRV A;  1X8S A;  1K32 A;  1N7E A;  4ZU2 A;  1V6B A;  2X58 A;  3KTJ A;  5HFB A;  4REY A;  4Q2O A;  5DUC A;  4NMR A;  1O8U A;  4Z33 A;  4E34 A;  3PGQ A;  4JYL A;  5MGB A;  5JXB A;  3OME A; 
#chains in the Genus database with same CATH topology
 4K2N A;  2Z9I A;  5C9G A;  3K1R A;  3MH6 A;  2V1W A;  2EEI A;  2D8I A;  2M0V A;  3QRE A;  1M5Z A;  2VRF A;  1ON3 A;  3PE8 A;  2C8T A;  5HJ1 A;  1XNY A;  4IZB A;  3QGL A;  2JRE A;  1FCF A;  4PQW A;  1KWA A;  3STJ A;  3HP0 A;  5FIF A;  4Q2P A;  5HEY A;  2A7K A;  2DLS A;  1Q3P A;  4JOG A;  3T6O A;  1HNU A;  1WDL A;  2PG8 A;  3OT6 A;  1P1E A;  1NZY A;  1BPL A;  1SBO A;  3MOG A;  3FY5 A;  4JSB A;  1VA8 A;  3PEA A;  4ZDC A;  4OLQ A;  2BYG A;  2W7R A;  1WHA A;  3K8X A;  3ZWA A;  2RCZ A;  5HFE A;  3K82 A;  2D3T A;  3QWD A;  2VSU C;  4ELX A;  1Y8T A;  3MT6 A;  2AWW A;  2KOH A;  2D90 A;  4LMM A;  2DKR A;  2LA8 A;  1UJV A;  2X24 A;  5IL9 A;  4KPK A;  3STA A;  1UJU A;  2RRL A;  2QQ3 A;  5DU6 A;  5JBX A;  2M0T A;  4HDT A;  4I42 A;  1DCI A;  2K1Z A;  2VSS A;  3SHW A;  2OS6 A;  1OD4 A;  4H11 A;  1EY3 A;  1UFX A;  2ENO A;  3CH8 A;  3TT7 A;  3MH4 A;  3PV5 A;  4Q0G A;  1WIF A;  3NFK A;  2BZR A;  3HLN 1;  1WI2 A;  1UEQ A;  3GCN A;  2JIK A;  4F8K A;  4ELW A;  3WG5 A;  3K50 A;  1EF8 A;  2GTR A;  2CS5 A;  3JU4 A;  4Q2Q A;  2EGO A;  5HF4 A;  1Q51 A;  1RGW A;  3OTP A;  1V5L A;  1PIX A;  2KV8 A;  3IB9 A;  2KPL A;  5EZ0 A;  5EZB A;  2FW2 A;  3CYY A;  2KL1 A;  5E11 A;  5EUW A;  2ZQQ A;  2L97 A;  1X5Q A;  5EUX A;  3RLE A;  2ZL4 A;  4FNB A;  3TZ3 A;  2KOJ A;  2A7S A;  1DUB A;  1WI4 A;  3QK8 A;  4MPA A;  2K20 A;  2PKT A;  4L8N A;  4JYJ A;  4L8K A;  1I92 A;  1X45 A;  1R6J A;  2H2B A;  1OBX A;  3LLO A;  3H0S A;  2OCS A;  3OU0 A;  4Z0M A;  4JOR A;  5DZK A;  2EV8 A;  4NXR A;  3CC0 A;  3IH9 A;  3QO6 A;  2Q34 A;  4IC6 A;  4WYU A;  1NZY B;  1P1D A;  4JOE A;  4B3J A;  3DJ3 A;  4UU6 A;  2IWP A;  4OEP A;  1W9O A;  5C90 A;  1MFL A;  1TP5 A;  5GLJ A;  3OC7 A;  3KTG A;  3GDU A;  3IBB A;  4KFW A;  3ST9 A;  4QII A;  1ZUB A;  4QTP A;  2EEJ A;  2EHR A;  1K39 A;  2Q2X A;  3MFM A;  1WXW A;  3ZW8 A;  1WG6 A;  3OIZ A;  1QLC A;  1Z87 A;  4KD6 A;  1WFV A;  1BUZ A;  3HIN A;  3KTH A;  3Q0J A;  1BE9 A;  2KRG A;  3GJ9 A;  1XNW A;  3WKM A;  2FZS A;  1QAV A;  3NJB A;  4FGM A;  3KHF A;  2EDZ A;  3O5N A;  2DC2 A;  2ZPM A;  3KDK A;  4NMO A;  3Q0G A;  5HFC A;  3R0H A;  3T8B A;  4EMM A;  4KWB A;  2Z17 A;  3KTI A;  1MFG A;  3BPU A;  4K76 A;  4XS5 A;  4KNP A;  2H3M A;  1OD2 A;  1RJN A;  2FBM A;  3TT6 A;  4RCN A;  1ZOK A;  4Q2N A;  2KJP A;  1IHJ A;  5DL1 A;  2PPY A;  1NF3 C;  2O2T A;  3I4W A;  4GVD A;  4HC8 A;  1RGR A;  4R2Z A;  1B8Q A;  3PV2 A;  5INI A;  4O06 A;  4LK5 A;  3NJD A;  2EEH A;  2M0Z A;  4YLH A;  5DU4 A;  5HDY A;  3SLL A;  1EF9 A;  2VRE A;  1H4Y A;  5E0N X;  3IF5 A;  1W9Q A;  2AIN A;  2KG2 A;  3BPP A;  3RL8 A;  2J5I A;  3LKE A;  4B3H A;  2AWU A;  3MOY A;  3ZXN A;  4FZW C;  5F67 A;  4JL7 A;  3EH7 A;  4EDJ A;  1ON9 A;  1N6E A;  2PDZ A;  2W4F A;  2G5M B;  1L6O A;  3CBX A;  1SG4 A;  3LKL A;  4YDP A;  1SOZ A;  1HF2 A;  2OAS A;  2V90 A;  1JXZ A;  1VCW A;  1PDR A;  2R4H A;  2M0U A;  4JJ0 A;  3C0K A;  2PBP A;  3QYR A;  4ZDE A;  3AXA A;  3H0Q A;  5HEB A;  5HFD A;  3IHA A;  2FN5 A;  3QKA A;  3PDZ A;  4ZDD A;  3RST A;  2KPK A;  2EAQ A;  3GGE A;  4MI2 A;  5F3X A;  2VSU E;  4K75 A;  4WYT A;  3D03 A;  1TG6 A;  4EMP A;  1UEZ A;  1TE0 A;  2OMJ A;  5G1D A;  2KA9 A;  1KEF A;  1TP3 A;  1N6F A;  3V5I A;  3ID4 A;  1UYS A;  2LOB A;  3G64 A;  3QDO A;  1THN B;  3GKB A;  1IU0 A;  3HRX A;  4XHV A;  3IH8 A;  4OEO A;  2F9I A;  3Q7H A;  3HPM A;  2DXN A;  2IWO A;  4MXI A;  3T8A A;  1YG6 A;  1OBZ A;  3R68 A;  4G69 A;  1N7T A;  2QT5 A;  5I7Z A;  4K3W A;  3HVQ C;  5DKP A;  1RZX A;  2KAW A;  1VAE A;  3ID2 A;  1V0E A;  1QAV B;  2PZD A;  3QE1 A;  3R9T A;  1V5Q A;  4AEJ A;  2HE2 A;  2JSN A;  5HFF A;  4JOP A;  1LCY A;  3GDS A;  1HNO A;  1FC6 A;  3NGH A;  2J5G A;  3OIR A;  3RL7 A;  2KBS A;  2J5S A;  3IHB A;  3U9T B;  2H2C A;  2KOM A;  2CE3 A;  4IZD A;  4U19 A;  2VPH A;  3I47 A;  1WF7 A;  3H0J A;  1OZI A;  2YJG A;  4NEK A;  1NTE A;  1H4X A;  3PZK A;  3ID1 A;  3M6N A;  5E21 A;  4L6W A;  3B76 A;  4JOF A;  1VRG A;  3E17 A;  3R69 A;  2Q9V A;  5G1R A;  2L4S A;  4KFV A;  5E0S A;  2CSS A;  3MH7 A;  4ZDB A;  1T6R A;  2HE4 A;  4JOT A;  2DJT A;  5DU8 A;  5CTB A;  3PDV A;  2UZF A;  4L1C A;  1VJ6 A;  5GND A;  2QKV A;  3PV4 A;  1UYV A;  4HNK A;  4JVT A;  3GVJ A;  3GAB A;  3PS4 A;  4FB8 A;  2P3W A;  2F6Q A;  4K78 A;  1VC1 A;  2PKU A;  3GVL A;  1WHD A;  5EYZ A;  3N6R B;  1UJD A;  2B78 A;  2AS0 A;  3DJ1 A;  2FE5 A;  3V5E A;  1WDM A;  5KDR B;  3R0O A;  2OPG A;  5KJP A;  2PA1 A;  3LAO A;  2E7K A;  2KJK A;  3TSV A;  2HW5 A;  3GSL A;  4RYF H;  5DZK H;  3U9S B;  4QIJ A;  3O46 A;  3WKL A;  2DB5 A;  1GQ5 A;  2DXL A;  4JCR A;  1UM7 A;  3GMA A;  3P85 A;  4NAR A;  3R9S A;  1WH1 A;  2UZC A;  5HUQ A;  3KZE A;  1FC7 A;  2ZL3 A;  2NP9 A;  2YUB A;  5A2P A;  4U1A A;  4DI1 A;  1MJ3 A;  3DOR A;  2JXO A;  3GF3 A;  4NNL A;  5H3J A;  5INF A;  2QKU A;  4FN8 A;  3KTK A;  2ZPL A;  2WTB A;  4K29 A;  5G1S A;  2I4S A;  1N7F A;  4FJW D;  2KLN A;  5FB8 C;  1V0F A;  3AGE A;  3HE2 A;  1TIL B;  2ZOA A;  4Q6H A;  4U18 A;  2G2L A;  4B3I A;  2LC7 A;  1WJL A;  4FZW A;  3DIW A;  3VIV A;  2CWW A;  2W3P A;  3ZWB A;  5B6L A;  4EML A;  1SOT A;  2LUI A;  2L4T A;  3GVK A;  4AE2 A;  2YT8 A;  2Q3G A;  2EDP A;  3CBY A;  2ZL2 A;  4Z8J A;  2M3M A;  2VSS E;  1UYT A;  4JCT A;  2X7Z A;  3ISA A;  3GF7 A;  2EXG A;  3I18 A;  2EJ5 A;  4UU5 A;  1GM1 A;  3KZD A;  3ID3 A;  3KDG A;  5FUS A;  1AUZ A;  3ZTB A;  5EUZ A;  2DUB A;  4OG1 A;  3T88 A;  2H3L A;  3GLM A;  4OAJ A;  2I6V A;  1UIY A;  2OSG A;  2F5Y A;  2D92 A;  4WCZ A;  5EUS A;  2F0A A;  3QJN A;  2KQF A;  5E1Y A;  4NNQ A;  5CTC A;  2YUY A;  2LC6 A;  1TH8 B;  2VSS F;  4JWV A;  4JC0 A;  1MC7 A;  2YT7 A;  1IU2 A;  3QDQ A;  4DGH A;  1XNV A;  3IAV A;  4RYF A;  3NFL A;  1XZ9 A;  1WZ8 A;  4ELS A;  3VQF A;  2DEO A;  5DUF A;  1W2X A;  1FC9 A;  1Y7O A;  3TLF A;  3TV5 A;  3QMJ A;  2AWX A;  4NMV A;  4Q3H A;  3ZWC A;  5DTH A;  3V8V A;  1V1T A;  2WL7 A;  3QXZ A;  3LNX A;  2QG1 A;  2IWQ A;  2VZ5 A;  3EGH C;  2J5I B;  2MHO A;  4I52 A;  2VSP A;  3L4F D;  2OQS A;  5HF1 A;  4E35 A;  3TDC A;  2F9I B;  1X5R A;  2FNE A;  1UF1 A;  2J5I I;  1GQ4 A;  4FLN A;  3T89 A;  1OBY A;  3SHU A;  1Q3O A;  3TVW A;  4NMQ A;  3GMF A;  4NXP A;  3VSE A;  2IEX A;  1UHP A;  4P0C A;  4JOJ A;  5D13 A;  3VQG A;  5JBW A;  5KDR A;  3BF0 A;  2JIN A;  1XX4 A;  2J5G D;  3H0U A;  4J2U A;  5ING A;  3QJM A;  4GVC A;  3SUZ A;  2EGN A;  1UYR A;  2YTW A;  4ASI A;  1YBO A;  2QKT A;  5HET A;  2JOA A;  2HGA A;  3T3W A;  5HED A;  1UEP A;  1TID B;  4JCS A;  4G2R A;  4U0H A;  4FND A;  5IKL B;  3H81 A;  5DTW A;  4U0G H;  2EGK A;  1UM1 A;  2FCF A;  3HPK A;  1XO6 A;  1BFE A;  4RI0 A;  2OZF A;  1Q7X A;  4GM2 A;  2DMZ A;  4JJ3 A;  4F47 A;  3JU1 A;  4U0G A;  2KJD A;  4IZC A;  3CS0 A;  3GCO A;  4JJT A;  4ZDF A;  1TYF A;  3L3S A;  1X6D A;  4WZ8 B;  3SWX A;  2VY9 A;  2F9Y B;  4K6Y A;  2ZO9 B;  2PNT A;  2DLU A;  2VSU F;  1Y7N A;  5EUU A;  2R3Y A;  1H4Z A;  2Q35 A;  1YG8 A;  2I1N A;  2IWN A;  3NY7 A;  1Q52 A;  4NMP A;  4DGF A;  2GEF A;  2GZV A;  3I1E A;  3BEZ A;  3Q1T A;  5E22 A;  3R6H A;  3NCV A;  3SFJ A;  2I04 A;  3D3U A;  4N6X A;  1G9O A;  1D5G A;  3MGL A;  1VB7 A;  1UEW A;  4DMG A;  2A81 A;  2F9Y A;  2ZQR A;  1WF8 A;  3QXI A;  2KYL A;  4K72 A;  4HIZ A;  3ZRT A;  5FHT A;  4AMH A;  4HOP A;  4QFE A;  3P5M A;  1X5N A;  4JCQ A;  4E3B A;  4Q1I A;  3GHF A;  1RJM A;  1U3B A;  4NNM A;  4P2A B;  3TVU A;  1QAU A;  1HZD A;  3JXT A;  5ILB A;  3TSW A;  3EGG C;  1U37 A;  5E6P B;  3LDF A;  3H02 A;  1SZO A;  2EJY A;  5E0S H;  3GDV A;  2DAZ A;  1Z86 A;  4NMT A;  3BPT A;  1W9E A;  3M6M A;  2MX6 A;  1WFG A;  5DTP A;  3U9R B;  1T2M A;  3TRR A;  4HOP B;  2OGP A;  3MYB A;  3P2L A;  3TMH A;  2VX2 A;  1TQ3 A;  3F43 A;  3V97 A;  2DM8 A;  3KQF A;  2EDV A;  1WXX A;  4Q6S A;  3GK7 A;  1I16 A;  2CSJ A;  3FDU A;  3FF6 A;  2I0I A;  2I0L A;  3CBZ A;  2M10 A;  2CBY A;  1RY4 A;  4JOK A;  3DJA A;  1J7X A;  1PJH A;  3AGD A;  2VSU A;  4OMR A;  1UIT A;  2JIL A;  2REY A;  4JFC A;  3QIK A;  2EEG A;  1V62 A;  2VWR A;  1U39 A;  2RRM A;  5G1Q A;  1X9Z A;  2JWE A;  2VSV A;  4GHN A;  4MOU A;  4FN7 A;  1N6D A;  2ZL0 A;  1X0U A;  3RSI A;  1U38 A;  4JOH A;  4I4Z A;  3SOE A;  3LNY A;  4NXQ A;  1WDK A;  1KY9 A;  3ZW9 A;  2QBW A;  4WYO B;  5B42 A;  4NMS A;  5G1E A;  3R9Q A;  1N99 A;  3TSZ A;  2F6I A;  4HYL A;  4YYX A;  3RRV A;  1X8S A;  3DUP A;  1K32 A;  1N7E A;  4ZU2 A;  1V6B A;  2KA5 A;  2X58 A;  3KTJ A;  5HFB A;  4REY A;  4Q2O A;  5DUC A;  4NMR A;  1O8U A;  4Z33 A;  4E34 A;  3PGQ A;  4JYL A;  5MGB A;  5JXB A;  3OME A; 
#chains in the Genus database with same CATH homology
 4K2N A;  2Z9I A;  5C9G A;  3K1R A;  3MH6 A;  2V1W A;  2EEI A;  2D8I A;  2M0V A;  3QRE A;  1M5Z A;  2VRF A;  1ON3 A;  3PE8 A;  2C8T A;  5HJ1 A;  1XNY A;  4IZB A;  3QGL A;  2JRE A;  1FCF A;  4PQW A;  1KWA A;  3STJ A;  3HP0 A;  5FIF A;  4Q2P A;  5HEY A;  2A7K A;  2DLS A;  1Q3P A;  4JOG A;  3OT6 A;  1HNU A;  1WDL A;  2PG8 A;  1P1E A;  1NZY A;  1BPL A;  4ZDC A;  3MOG A;  3FY5 A;  4JSB A;  1VA8 A;  3PEA A;  3ZWA A;  4OLQ A;  2BYG A;  2W7R A;  1WHA A;  3K8X A;  2RCZ A;  5HFE A;  3K82 A;  2D3T A;  3QWD A;  2VSU C;  4ELX A;  1Y8T A;  3MT6 A;  2AWW A;  2KOH A;  2D90 A;  4LMM A;  2DKR A;  2LA8 A;  1UJV A;  2X24 A;  5IL9 A;  4KPK A;  3STA A;  1UJU A;  2RRL A;  2QQ3 A;  5DU6 A;  5JBX A;  2M0T A;  4HDT A;  4I42 A;  1DCI A;  2K1Z A;  2VSS A;  3SHW A;  2OS6 A;  1OD4 A;  4H11 A;  1EY3 A;  1UFX A;  2ENO A;  3CH8 A;  3TT7 A;  3MH4 A;  3PV5 A;  4Q0G A;  1WIF A;  3NFK A;  2BZR A;  3HLN 1;  1WI2 A;  1UEQ A;  3GCN A;  2JIK A;  4F8K A;  4ELW A;  3WG5 A;  3K50 A;  1EF8 A;  2GTR A;  2CS5 A;  4Q2Q A;  2EGO A;  5HF4 A;  1Q51 A;  1RGW A;  3OTP A;  1V5L A;  1PIX A;  2KV8 A;  3IB9 A;  2KPL A;  5EZ0 A;  2FW2 A;  3CYY A;  2KL1 A;  5E11 A;  2ZQQ A;  2L97 A;  1X5Q A;  4FNB A;  3RLE A;  2ZL4 A;  3TZ3 A;  2KOJ A;  2A7S A;  1DUB A;  1WI4 A;  3QK8 A;  4MPA A;  2K20 A;  2PKT A;  4L8N A;  4JYJ A;  4L8K A;  1I92 A;  1X45 A;  1R6J A;  2H2B A;  1OBX A;  3H0S A;  2OCS A;  3OU0 A;  4Z0M A;  4JOR A;  5DZK A;  2EV8 A;  4NXR A;  3CC0 A;  3QO6 A;  2Q34 A;  4IC6 A;  4WYU A;  1NZY B;  1P1D A;  4JOE A;  4B3J A;  3DJ3 A;  4UU6 A;  2IWP A;  4OEP A;  1W9O A;  5C90 A;  1MFL A;  1TP5 A;  5GLJ A;  3OC7 A;  3KTG A;  3GDU A;  3IBB A;  4KFW A;  3ST9 A;  4QII A;  1ZUB A;  2EEJ A;  2EHR A;  1K39 A;  2Q2X A;  3MFM A;  3ZW8 A;  1WG6 A;  1QLC A;  1Z87 A;  4KD6 A;  1WFV A;  3KTH A;  3Q0J A;  1BE9 A;  2KRG A;  3GJ9 A;  1XNW A;  3WKM A;  2FZS A;  1QAV A;  3NJB A;  4FGM A;  3KHF A;  2EDZ A;  3O5N A;  2DC2 A;  2ZPM A;  3KDK A;  4NMO A;  3Q0G A;  5HFC A;  3R0H A;  3T8B A;  4EMM A;  4KWB A;  2Z17 A;  3KTI A;  1MFG A;  3BPU A;  4K76 A;  4KNP A;  2H3M A;  1OD2 A;  1RJN A;  2FBM A;  3TT6 A;  4RCN A;  1ZOK A;  4Q2N A;  2KJP A;  1IHJ A;  5DL1 A;  2PPY A;  1NF3 C;  2O2T A;  3I4W A;  4GVD A;  4HC8 A;  1RGR A;  4R2Z A;  1B8Q A;  3PV2 A;  5INI A;  4O06 A;  4LK5 A;  3NJD A;  2EEH A;  2M0Z A;  4YLH A;  5DU4 A;  5HDY A;  3SLL A;  1EF9 A;  2VRE A;  5E0N X;  1W9Q A;  2AIN A;  2KG2 A;  3BPP A;  3RL8 A;  2J5I A;  3LKE A;  4B3H A;  2AWU A;  3MOY A;  4FZW C;  5F67 A;  4JL7 A;  4EDJ A;  1ON9 A;  1N6E A;  2PDZ A;  2W4F A;  2G5M B;  1L6O A;  3CBX A;  1SG4 A;  4YDP A;  1SOZ A;  2V90 A;  1JXZ A;  1VCW A;  1PDR A;  2R4H A;  2M0U A;  4JJ0 A;  2PBP A;  3QYR A;  4ZDE A;  3AXA A;  3H0Q A;  5HEB A;  5HFD A;  2FN5 A;  3QKA A;  3PDZ A;  4ZDD A;  3RST A;  2KPK A;  2EAQ A;  3GGE A;  4MI2 A;  5F3X A;  2VSU E;  4K75 A;  4WYT A;  3D03 A;  1TG6 A;  4EMP A;  1UEZ A;  1TE0 A;  2OMJ A;  5G1D A;  2KA9 A;  1KEF A;  1TP3 A;  1N6F A;  3V5I A;  3ID4 A;  1UYS A;  2LOB A;  3G64 A;  3QDO A;  3GKB A;  1IU0 A;  3HRX A;  4XHV A;  2F9I A;  4OEO A;  3Q7H A;  3HPM A;  2DXN A;  2IWO A;  4MXI A;  3T8A A;  1YG6 A;  1OBZ A;  3R68 A;  4G69 A;  1N7T A;  2QT5 A;  5I7Z A;  4K3W A;  3HVQ C;  5DKP A;  1RZX A;  2KAW A;  1VAE A;  3ID2 A;  1QAV B;  2PZD A;  3QE1 A;  3R9T A;  1V5Q A;  4AEJ A;  2HE2 A;  2JSN A;  5HFF A;  4JOP A;  1LCY A;  3GDS A;  1HNO A;  1FC6 A;  3NGH A;  2J5G A;  3RL7 A;  2KBS A;  2J5S A;  3U9T B;  2H2C A;  2KOM A;  2CE3 A;  4IZD A;  4U19 A;  2VPH A;  3I47 A;  1WF7 A;  3H0J A;  1OZI A;  2YJG A;  4NEK A;  1NTE A;  3PZK A;  3ID1 A;  3M6N A;  5E21 A;  4L6W A;  3B76 A;  4JOF A;  1VRG A;  3E17 A;  3R69 A;  2Q9V A;  5G1R A;  2L4S A;  4KFV A;  5E0S A;  2CSS A;  3MH7 A;  4ZDB A;  2HE4 A;  4JOT A;  2DJT A;  5DU8 A;  5CTB A;  3PDV A;  2UZF A;  4L1C A;  1VJ6 A;  5GND A;  2QKV A;  3PV4 A;  1UYV A;  4HNK A;  4JVT A;  3GAB A;  3PS4 A;  4FB8 A;  2P3W A;  2F6Q A;  4K78 A;  2PKU A;  1WHD A;  5EYZ A;  3N6R B;  1UJD A;  3DJ1 A;  2FE5 A;  3V5E A;  1WDM A;  5KDR B;  3R0O A;  2OPG A;  5KJP A;  2PA1 A;  3LAO A;  2E7K A;  2KJK A;  3TSV A;  2HW5 A;  3GSL A;  4RYF H;  5DZK H;  3U9S B;  4QIJ A;  3O46 A;  3WKL A;  2DB5 A;  1GQ5 A;  2DXL A;  4JCR A;  1UM7 A;  3GMA A;  3P85 A;  4NAR A;  3R9S A;  1WH1 A;  2UZC A;  5HUQ A;  3KZE A;  1FC7 A;  2ZL3 A;  2NP9 A;  2YUB A;  5A2P A;  4U1A A;  4DI1 A;  1MJ3 A;  3DOR A;  2JXO A;  3GF3 A;  4NNL A;  5H3J A;  5INF A;  2QKU A;  4FN8 A;  3KTK A;  2ZPL A;  2WTB A;  4K29 A;  5G1S A;  2I4S A;  1N7F A;  4FJW D;  3HE2 A;  5FB8 C;  2ZOA A;  4Q6H A;  4U18 A;  2G2L A;  4B3I A;  2LC7 A;  1WJL A;  4FZW A;  3DIW A;  3VIV A;  2W3P A;  3ZWB A;  5B6L A;  1SOT A;  2LUI A;  2L4T A;  4AE2 A;  2YT8 A;  2Q3G A;  2EDP A;  3CBY A;  2ZL2 A;  4Z8J A;  2M3M A;  2VSS E;  1UYT A;  4JCT A;  2X7Z A;  3ISA A;  3GF7 A;  2EXG A;  3I18 A;  2EJ5 A;  4UU5 A;  1GM1 A;  3KZD A;  3ID3 A;  3KDG A;  5FUS A;  2DUB A;  4OG1 A;  3T88 A;  2H3L A;  3GLM A;  4OAJ A;  2I6V A;  1UIY A;  2OSG A;  2F5Y A;  2D92 A;  4WCZ A;  2F0A A;  3QJN A;  2KQF A;  5E1Y A;  4NNQ A;  5CTC A;  2YUY A;  2LC6 A;  2VSS F;  4JWV A;  4JC0 A;  1MC7 A;  2YT7 A;  1IU2 A;  1XNV A;  3IAV A;  4RYF A;  3NFL A;  1XZ9 A;  1WZ8 A;  4ELS A;  3VQF A;  2DEO A;  5DUF A;  1W2X A;  1FC9 A;  1Y7O A;  3TLF A;  3TV5 A;  3QMJ A;  2AWX A;  4NMV A;  4Q3H A;  3ZWC A;  5DTH A;  1V1T A;  2WL7 A;  3QXZ A;  3LNX A;  2QG1 A;  2IWQ A;  2VZ5 A;  3EGH C;  2J5I B;  2MHO A;  4I52 A;  2VSP A;  3L4F D;  2OQS A;  5HF1 A;  4E35 A;  3TDC A;  2F9I B;  1X5R A;  2FNE A;  1UF1 A;  2J5I I;  1GQ4 A;  4FLN A;  3T89 A;  1OBY A;  3SHU A;  1Q3O A;  3TVW A;  4NMQ A;  3GMF A;  4NXP A;  2IEX A;  1UHP A;  4P0C A;  4JOJ A;  5D13 A;  3VQG A;  5JBW A;  5KDR A;  3BF0 A;  2JIN A;  1XX4 A;  2J5G D;  3H0U A;  4J2U A;  5ING A;  3QJM A;  4GVC A;  3SUZ A;  2EGN A;  1UYR A;  2YTW A;  4ASI A;  1YBO A;  2QKT A;  5HET A;  2JOA A;  2HGA A;  3T3W A;  5HED A;  1UEP A;  4JCS A;  4G2R A;  4U0H A;  4FND A;  5IKL B;  3H81 A;  5DTW A;  4U0G H;  2EGK A;  1UM1 A;  2FCF A;  3HPK A;  1XO6 A;  1BFE A;  4RI0 A;  2OZF A;  1Q7X A;  4GM2 A;  2DMZ A;  4JJ3 A;  4F47 A;  3JU1 A;  4U0G A;  2KJD A;  4IZC A;  3CS0 A;  3GCO A;  4JJT A;  4ZDF A;  1TYF A;  3L3S A;  1X6D A;  4WZ8 B;  3SWX A;  2F9Y B;  4K6Y A;  2ZO9 B;  2PNT A;  2DLU A;  2VSU F;  1Y7N A;  2R3Y A;  2Q35 A;  1YG8 A;  2I1N A;  2IWN A;  1Q52 A;  4NMP A;  3BEZ A;  2GEF A;  2GZV A;  3I1E A;  3Q1T A;  5E22 A;  3R6H A;  3NCV A;  3SFJ A;  2I04 A;  2A81 A;  4N6X A;  1G9O A;  1D5G A;  3HIN A;  1VB7 A;  1UEW A;  2ZQR A;  2F9Y A;  4EML A;  3QXI A;  1WF8 A;  2KYL A;  4K72 A;  3ZRT A;  5FHT A;  4AMH A;  4HOP A;  4QFE A;  3P5M A;  1X5N A;  4JCQ A;  4E3B A;  4Q1I A;  3GHF A;  1RJM A;  1U3B A;  4NNM A;  4P2A B;  3TVU A;  1QAU A;  1HZD A;  3JXT A;  5ILB A;  3TSW A;  3EGG C;  1U37 A;  5E6P B;  3H02 A;  1SZO A;  2EJY A;  5E0S H;  3GDV A;  2DAZ A;  1Z86 A;  4NMT A;  3BPT A;  1W9E A;  3M6M A;  2MX6 A;  1WFG A;  5DTP A;  3U9R B;  1T2M A;  3TRR A;  4HOP B;  2OGP A;  3MYB A;  3P2L A;  3TMH A;  2VX2 A;  1TQ3 A;  2DM8 A;  3KQF A;  2EDV A;  4Q6S A;  1I16 A;  2CSJ A;  3FDU A;  3FF6 A;  2I0I A;  2I0L A;  3CBZ A;  2M10 A;  2CBY A;  1RY4 A;  4JOK A;  3DJA A;  1J7X A;  1PJH A;  2VSU A;  4OMR A;  1UIT A;  2JIL A;  2REY A;  4JFC A;  3QIK A;  2EEG A;  1V62 A;  2VWR A;  1U39 A;  2RRM A;  5G1Q A;  1X9Z A;  2JWE A;  2VSV A;  4GHN A;  4MOU A;  4FN7 A;  1N6D A;  2ZL0 A;  1X0U A;  3RSI A;  1U38 A;  4JOH A;  4I4Z A;  3SOE A;  3LNY A;  4NXQ A;  1WDK A;  1KY9 A;  3ZW9 A;  2QBW A;  4WYO B;  5B42 A;  4NMS A;  5G1E A;  3R9Q A;  1N99 A;  3TSZ A;  2F6I A;  4YYX A;  3RRV A;  1X8S A;  3DUP A;  1K32 A;  1N7E A;  4ZU2 A;  1V6B A;  2X58 A;  3KTJ A;  5HFB A;  4REY A;  4Q2O A;  5DUC A;  4NMR A;  1O8U A;  4Z33 A;  4E34 A;  3PGQ A;  4JYL A;  5MGB A;  5JXB A;  3OME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...