1FCGA

Ectodomain of human fc gamma receptor, fcgriia
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
171
Chain Sequence
APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLFEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human leukocyte Fc receptor, Fc gammaRIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system, membrane protein
molecule keywords PROTEIN (FC RECEPTOR FC(GAMMA)RIIA)
total genus 37
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fcgA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fcgA02
1NLBL 3RIFK 1CFSA 1F6FB 5MEOB 3LKPB 1T04B 1K5NA 5C07B 4RQQB 3ORJA 3S4SB 2KDGA 4JJ5B 1W0WB 3D1MC 1MUJA 5CBAB 3T65A 4G43A 4XTRD 5EBWA 5DK2A 1OSZA 3ZKSD 5HHME 3CJJA 1UH3A 5CD3A 1KELH 1UCTA 4MAYA 3W11C 1B4JL 3AREB 4M4PA 5F9JA 4KY1L 2EKSA 1QSVA 2X9XA 4OSUH 5FA4A 3RAJL 2AEPH 5C7XL 3FT4A 4Z5RB 4ZFFA 1KUMA 1AP2B 2NY7H 3Q6GL 1TTFA 3Q1SH 4PRHA 5I74B 1TVDA 3GMQA 4LCYB 1L4IA 3MYZA 5CGMA 1ES0A 2QADC 4LVNC 1FE8H 2OJZH 3LKRB 3QEUA 3S98A 5IB4A 3EYFA 3VGBA 3L1OH 1P2CA 4NT6B 5EO1A 2GIYA 4WUKH 5JDSA 4DKFH 5FYJL 1BAFH 4ZUTB 2CDFB 3SE3A 4Y0GA 2XWJB 2EEAA 5IF0B 3QNZB 4EDWH 1FPTL 4H25A 3SDXF 1D6EB 1P9MA 4HIHA 3ZTNL 1J12A 2DQIH 3GO1H 4GRMA 1ZSDB 4JRYD 2WWKT 1I1AA 4E41A 4Y4FD 1ZEAL 3FB5A 1VHPA 1INEH 1QFPA 4PGCA 2UWEF 1UZ8A 4A2LA 4L3CB 1RULH 5EA0L 1RY7B 2VR4A 1SBSH 3VI4F 1VEMA 1E28A 3ALWA 4WWKD 1W2KT 3HZYA 4ZOBA 2EXYC 1XIWD 4HD9A 4JPIB 2YKLH 2AEQH 1FHGA 4XCYA 2C9AA 5C08A 4RWHA 4JQIL 3O3BA 1AD9A 2P7TA 2WLZA 3KPTA 5E56A 5I9QB 1GGIH 4C58B 3VDAA 2FYYA 4AEIH 4ZO7A 3BAEL 5J1AA 3FB8A 4G9FD 4DKDC 4FQXC 1OTTC 5B8CC 3VXSA 1U3ZA 1KJVA 5EZJA 1N5YH 4XNUH 2FLBT 1F58L 4PRBB 3MRGA 5TE7H 4U1MB 1T4KB 4LSRL 4P3CL 3VFOB 1OTUD 1TZIA 3B2VH 1LEIB 3BIKB 4AT6A 1I1YB 4P57A 4RFOH 5DHVA 1FZMA 3BGMB 2WWMD 5ADOH 2E7BA 3D69B 4P2RE 5MI0C 4EUPG 1W0YT 1NCTA 2DQFA 4GLRI 5KVMC 2C7UA 1BFOB 1NC4A 3HNTL 4U3CA 2X70B 3U36B 3ZDXF 4N0CC 3WCYA 2QQLH 3BDXA 3C2AH 4PRHE 5FYLE 4OF0A 3IF1B 3NZ8A 5HDBF 2YPKA 2XRAH 3DJ9A 3EZ8A 1S9YA 1OF2B 1L7TL 4J12A 4BQ6A 1S7XA 2QHLA 2P44B 3LKOB 2VXQL 3OF6A 2AXHA 1UM5H 5E8NA 5C9JA 1MCSA 3V4VL 5JOFA 1GIGL 3BO8B 2A38A 1UZ6F 2D0HA 2F53D 4Z7OE 3U0PA 1BGXL 1OGAD 1NGYB 2IAMD 3QB7C 1GGTA 2Z91B 3HUJE 1QSEB 4ODWB 3MX0A 4GAGH 4U1IA 3EFFB 2MKWA 2XTJD 4ZAKA 4GKNA 1S7VB 3LMJL 4KK8D 4OLUL 2ZOKB 4L29A 1MFBH 3B4NA 3FB6A 3QDJA 1LDPH 5I17A 4HUNB 1IAKB 1MI5D 5C0JB 4M02A 5DK2B 1WAAE 2IFGA 2RFXA 4PGEB 4HBCL 3QXVA 1GPOH 1QBMH 3OKEB 4RZCB 4AL8H 4I77L 3GJFH 3OAZH 4EZMA 3RPIB 4NNPH 5JPMB 3OB8A 1WBZB 4L3EA 4PTUA 4TVPE 1NCDH 4H1LA 3IF1A 4R4FL 4G6ML 2GT9B 4C4KO 1D5XA 4LVEA 3MV9A 1EIBA 2NXZC 1XGQA 4AMKH 4NQXA 1T0NA 2AAVA 3TBVA 2WWMC 2AV7A 1DUZB 5CZVL 1L0QA 4X7TB 4Z7UE 1NUNB 1MWAH 3B9DA 5DVKA 3UDWC 1AO7A 4PBWD 3NZHL 3GIVB 4LAJH 5F7EL 3QQ4B 1U8QB 2HVKA 3V0VA 3NPSB 4PJXE 1FC1A 4L4TE 4QHNA 2FJHB 1YQVH 4PJCF 3VFGH 5C09E 3SDYH 1CVSC 3ARWA 3QIBC 4LLDB 4PS4L 1JL8A 4XCEA 2V5TA 4FA8A 5E8OB 1JZ5A 1W0VA 4HEPG 4PGZA 2NX5B 4LARL 5HBBA 3BKCL 3V2AR 4Y16B 4Y4HA 1LP9B 4ELMF 3PWPD 4OLWL 3SCMC 1T5XA 1DL7H 2PTTA 3WN5A 2HT3D 3B83A 5JPMA 5I1HH 2IJ0C 1QFOA 5F1KC 1OGAA 4F7CB 5C86A 1S7RA 4NJ9H 1DQLH 3GSNH 4UTAH 4AENA 3ZDXE 2HJKB 4GS7B 4AG4L 4YBQD 4P23A 2P5WE 4MWFA 1BF8A 3LN5B 1WZ1L 4TN9A 5IFJB 3NTCH 4N90E 5C70A 3BD4A 5E6ZA 3OJVC 5JLZA 1G9MH 3HA0A 1QFWI 3D39B 4PJIE 5FDYA 4GAGL 1G7QB 1I1FA 5DRZA 1U93B 4DKEL 3VD4A 4EN3A 2DQJL 2YXMA 4NC1C 4G9FA 3KDMA 3OR7B 4GRMB 1QG3A 3GJEA 1FO0L 1C7SA 4RMQA 4HKXA 7FABL 4OZ4B 1J0JA 2ATPB 4PLKC 2GY5A 3V7MA 1ZLVK 2HJFA 1MJ8H 5IMKB 4XH2A 3T2QA 4G7VL 3VXRE 4KQ3L 4K71C 5JDJA 4S0SD 4LVOB 5D2LB 4CN6A 4D8PA 4NJAH 4JHWL 1T83A 5KS9E 3BT2H 3MFFA 2F54A 4QRPB 4WWID 4NQEA 4JO2L 4JFHD 1E4XL 1DEEB 1MIEL 4XNZC 3EUUA 1DDHA 1S9VA 1QA9B 1QP1A 1WZLA 3BFOA 3JTSA 3PQYB 3M17B 4Z7OF 4X6CA 3RGVC 3VWKD 4FOMA 2Q1EA 5J6HA 3CX5J 3LKPA 1DBKL 1I1YA 4P57B 3DUUA 3S37H 3MV9E 5IB5A 3QFDA 5TE7L 4DK3A 5MHSD 2IANE 1ZA3B 4OJFL 3ZHDA 3V8CA 2ICWA 4JFED 1N5YL 1CE6A 2IBGA 5EULV 5C0GA 2O93L 4PG9B 4MCYA 1N26A 2F53E 3HI6H 1RUKH 5GGSA 4MDJA 4M61A 4QHKI 3UJIL 1J10A 1UJ3B 2O5ZL 3NAAH 5L2KA 1YNTB 1T22A 2A6IA 2FHCA 4ONFH 1WT5A 2XZZA 2CRYA 3U30B 2OJZL 4H0IA 5E00A 1QSFD 1DVFD 1SYSB 5IMOB 2OP4H 4NBZB 2HFFA 5IBTL 2H26A 1AXIB 4MJIA 1NBVH 3T3ME 1KB5L 1A6AB 1I9IL 2I24N 4IOFD 2ZSVB 1KENH 2LE9A 2EIZA 3CC5B 2NY4C 1M6OB 3ZTNH 1G7MB 3MR9A 5IGXH 4FMKA 4PGDB 3HHRB 1U8MB 5ALBL 5IBLC 5DT1L 2XA8H 1NEZB 4HIIA 4YXKL 4S11A 4PJ7A 1YY9C 3LEVL 2X05A 1CWVA 1XT5A 3GSNA 5BW7A 3P0VL 3GMNA 4XP5H 1FE8L 4FTVB 1HHHB 3LVEA 1JZ3A 5E8DL 3O3UN 3GRWL 5ANMA 3GSOB 1R3JA 5A2FA 5I1KL 2X4UA 3V6OE 1MRFH 5DD5L 3SGDH 1SYSA 2GCYA 1CR9L 3V5HB 1KEGH 1MEXH 4AIZB 4XAKE 4QRRA 2OL3A 1KTLA 1MCFA 3OKMB 1XF5B 1AC0A 5KOMC 4IRSB 2GITA 4UV7L 2NY2D 1JV5A 2A2QT 2X4PA 4OKVB 2I25N 4GUPA 2VE6A 1UCBL 3WHE1 2VZTA 5T3ZD 2VXVL 3REWB 4X80H 4Y19D 2DBLL 2VSDA 2DM4A 4XVTL 4WRLA 3GSXB 4MA8H 4N90D 3MR9B 2J5LB 4BH7A 4MHHI 2Q76A 3HZMB 1PZ5B 4NKDB 4NRXA 2YA0A 4WUUD 1EHXA 5F8RC 1UB5B 2WWKO 5J4MA 1G9NC 5D6CB 2VLLB 2Q8BH 2WINB 5C0JA 5C0CB 4HUKB 2CRMA 4Z0BH 4YE4H 3IAPA 5DR5L 4JB9H 3KAAA 5FYJD 5B39B 2IQ9L 1TVHA 3RVXC 5T3XD 5ITFA 3MLSL 4OF8A 3MLTA 5IK3A 2G2RA 6CGTA 1U8PA 3CZJA 1FIGL 1Y6NR 5I1KH 3LZFH 3EYUL 3ZKQD 3U9PL 1U0QA 3PWVA 1J18A 3WO3B 2A0LC 4EEEA 2RR3A 5IMKA 4K94H 1R5IB 3SJVD 3HRZA 4JFOB 4HKXB 5IB5B 35C8L 4FRWA 3MBEB 4HWBL 3SHSA 1QLRB 1NH6A 3QZWG 5HYEA 3W11D 1H3GA 4A2MA 5DD1H 1X5KA 5HDQL 5D1QC 1YEGL 2GW5A 1DJSA 4YNYA 5FK9A 3RU8L 3RVXD 4Z0XB 1YYML 3JV0A 4O2CB 4X8JA 3GSVA 1D5IL 1DN0B 3S5LB 3V9FA 5HD8D 3RNQA 1LQSR 2EDDA 2NY3C 5IR1B 4GH7B 3GIZH 3PGFL 4L9DA 2VDQL 1RI8A 1TZHB 3OJDA 5IHUL 1CDIA 1CDJA 3AS1A 5DUPH 4OAWB 5F7UA 2W0PA 1T7XA 5GSVB 3V5KA 5IEKB 4PJ7F 5FB8A 2N4IA 4O58L 3S34H 1RUKL 3ULVD 5BRZD 4O4YL 1A7QL 2NLJB 5A3IC 2BNQD 1FIEA 1JPSH 4L9LB 3DHMA 1OY3B 2CRIA 3AGVA 3MGAA 3QUML 5EH1A 4H8WC 4AH2B 4N0YL 3IDNB 4G7YH 3U7YL 4G8EB 5TQ2L 4LPYA 3DX6B 1Z5LB 5DJDA 3V0VB 2VABA 1DBKH 4XCYB 5DC0A 3WNKA 4BSWB 1MFEL 5MENA 4WU7B 4Z7VF 5DR5H 1SBBA 3O2WL 1FNSL 2HTLC 4W70A 1FFNB 1I1RA 2YPLB 5DQ9B 4Z7QE 1LE9A 2YRPA 3NA9L 1D6VH 2Z93B 5A3ID 3BDYL 1UM4L 4B7LA 1E4WH 4F9LC 3PL6D 4HCRA 2R8SL 1FLRL 3EYUH 4LHQB 3DX7B 4ALAL 2A83B 4NJAL 5JIPA 4EBQH 4OUOA 4E42B 4HV8A 3FCTB 3IT8D 1IKNA 5FHAH 3TFKC 4HC1H 2Q86B 1OARL 5SWSB 2CIKA 1P2CB 1EBPA 5DVOA 3MREA 1IEBB 1M6OA 5CD5D 2E27H 1FNGA 2FO1A 4Y4KB 1PSKL 4AM0B 3P4MA 4PY7A 2W9EH 2CDGB 1DQJA 1WIPA 3C5JB 4D94A 5KZCD 5DJDB 4UMGA 1T7ZA 2DQCH 4KKLD 4JLRB 2Q87A 4B5EA 4YGVB 4GKOA 4IRJA 4H0GA 4GS7C 4S0TD 2NY4B 5HI4C 2ZUYA 5CKGA 4PREB 5D1XA 1GGCL 4OFIA 5E8DH 2HFTA 3HPJA 4XAWL 3T77A 1F90H 3WXVH 2IEPA 1O0VA 3NFSH 3LEYH 4KV5F 2AP2A 1R5VB 1MCWW 3GBLA 5AG9A 2X41A 2W0FA 1SJXA 2VZ1A 5DZOA 1CR9H 5DUBA 1GZPA 3HN3A 1PAMA 1A6WH 1DLHA 3QEHA 1Q9LB 2APVA 5I9QC 4RMRA 1FH5H 3H9SE 3IJSB 4NRZB 3GRWH 1HSAB 4PRAB 1WQVT 3KYAA 3GNML 4ZXBD 2Z8RA 3DV4B 1NKOA 2VDKH 3MA9H 3EYVB 4KVNL 5I75B 1D9KA 1CZ8L 3BIKA 5LGKA 2ARJQ 4WWKC 5CJOH 2YD8A 4UQ2A 5DDHA 5C8JB 4FHBD 3MFFB 5ALBH 1FAIL 2EZ0C 1H0DA 3KYOA 4NQSB 1A1NA 4OD1L 5GRVL 1BVKB 2E9WA 4LLVA 4J3VA 1A64A 4YHML 5JUEH 2J88L 4TSAL 2EDOA 3OL2A 1YEEL 1T0PB 5HHOA 1T1YA 2PETA 5IBTH 1U8PB 4O2EB 1Q0YL 4RAHA 3BXNA 3EGSA 1TVBA 3SJVA 4QLRA 3RI5K 2X6MA 3UBXA 2CDEB 2Z4QA 3QPQC 4RWYH 4IOSD 4FFYL 1RJZA 3GM8A 4XGZA 2G5RA 4OCXH 3NIDE 4X4ME 3MRCA 3N85L 1OAZH 5EBLB 3IXAB 1EEUA 1MCPL 4P3DB 4FABH 1D9KD 3LOWA 3D39A 3U48A 1MVUA 3TVMB 4AT6B 1OM3H 4R3SA 5KS9F 2R4SL 2YK1L 3QDAA 1RIHH 3QIBA 4HFWB 5ICXB 4R7DA 4O9HH 3JWDH 4HJ0C 1N8ZB 3ZKNC 4FQ1L 4GXVL 3HLAB 1BD2D 4JZJB 5DXWA 3UTTB 3G6JA 3HMXL 1AGFA 5I6XB 4ODSH 5TQ0H 2D2OA 4WVRA 5KAQF 2AEWA 3AUVA 2OM5A 4P2OD 4FFZL 1QRKA 2GITB 5JORB 4WIQA 1YEDB 4X9IA 1OAUL 1EMTH 3OPZH 3L6FA 3UPRB 4M62L 4AIZA 4YHYC 1TQCC 4R0LA 2ZCKL 5DO2C 4KRLB 4AH2A 1CL7I 3TBVB 4PRPD 1C5BL 3RDTB 3ZE2E 3NIFE 4MJ2A 4JFEA 3ARRA 1KLUA 4Z8FH 1AGEA 2G5BA 3RVWC 3WJLC 5DD0L 4KKCC 2VLME 1ZVSB 3EOBA 2ADJB 3RGHA 3EJZC 1YJDH 1IL1A 4I8DA 4KQ3H 1NUFA 1BBJB 1I75A 3BSZL 4Q6IC 4BQCA 1H3TA 4UTAL 4M93C 4KGJA 2O61B 4HAFA 2PCPA 3OKEA 4OKDA 1NEZG 1YEJH 4FQ1H 4LLQA 2BSRA 5E70A 2DB8A 3JWDL 2YD5A 3D3VB 1KOAA 4ISVB 4XXCA 1MCNA 1QACA 4JY6B 4DKEH 4YWGH 1TQBC 2NX5D 4NWTL 1DN0A 2JE8A 2UZIL 4WU5A 3RIAF 4V2CB 1ULVA 3KLHD 1OVZA 2HFFB 4JQIH 4NQDB 3OR6A 3FO9B 4Y1AE 4Z7UF 5DD3L 4Y4HD 3L3KA 2CMRH 1MCPH 1PKOA 4OZIB 2C3WA 4PJCE 1I85A 2I27N 2NPLX 3BQUB 3EFFA 2P4AB 3IFOB 4MD0B 4DAGH 4X6FB 3LKOA 2OMBA 5EA0H 1F45A 1KCVH 1LO5B 5AZEL 3ULVF 4H0HB 4MDJB 3VFWA 5D7SH 3PL6C 1S8DA 3WJJA 2QSQA 3EJYC 5BO1L 2OK0H 5EO9B 4X6DE 2PYED 5JOEA 2V5YA 4Z76A 5GPRA 3TEUA 4OZHA 3ARBD 4PJXA 3VG9C 4M9OA 3C60A 5F7EH 3NZ8B 4X7DC 3KPSE 2ZUUA 2C3VA 3WLBA 1GL4B 1NL0L 2VZOA 1AY1H 3O0RL 4ZPVB 1OGTA 1U8KB 3PWPA 4L8CB 1Q0YH 2Y07L 4LVHC 5M95B 1QKZL 3O4LE 4IHOB 1ZKAA 2IPKA 3MJ7B 5L2JB 1NCCH 1SY6H 5H35B 3DTXB 4KWUA 4EI6B 3U82B 4DOHB 4NZUL 5F72S 3VWKB 1KCVL 2VE6B 3N06B 2J8UB 1LEKB 2HP4A 4R9HA 1LO2H 1MWAA 4ZTPH 3VWJC 1IRAY 3DROA 1U95A 2YC1A 4HUXB 3QFJE 4K07A 1RHHA 4LSDA 3H3PH 1RIUL 3B8YA 1E27B 1Z9SA 3PHOB 5T1KD 3ROOA 4CN4A 5HHNA 1J1PH 3KYNA 3TA3D 1GGCH 1J8HB 4LRIA 2GCYB 3HC0B 5ERWA 4R90H 3KPRE 4DK6A 4MJ6A 1B3JA 2PYEA 5GS0D 2XPGA 4HJGB 4L8CA 4CNIB 3EO1B 4MB4A 2Z92B 2HH0H 4ZPVA 2YWZA 2Y4SA 3HNTH 3ILPB 3CSYB 1PEZA 4KRPB 2XA3A 3CVIL 4M6ML 1NC2A 3IS1X 1YEJL 3KPPB 3F7YB 4PJCA 4J3XA 2RB8A 2EDTA 4ZSOB 4GQ9L 1FL6B 2CUMA 3P4NA 1ZSDA 1FBIH 2P5WD 3CLFH 5IVZB 3MBXL 1SEBB 3SDAA 4U2YA 5GGRY 2DQCL 4JFZL 3TA3A 5HHPB 4GMTH 2IH3A 4AEIL 2Y6SC 1NAMA 1E4WL 2C4FU 5JW4N 4UDTA 3VGEA 4FQJL 3KR3H 3QHZL 4MLSA 4YDKH 1I1CA 4HSQA 2E6QA 4PJAB 3MXWL 1DQTA 4MAYB 3L9RB 3O2WH 1EH9A 2ZSWA 3MLYH 2AI0H 3RWIA 1IARB 3FONA 1CFVH 5L2KB 4P2QD 4XWOC 1LHZA 4CVXB 1IM3B 1N64H 3L5JA 2DJUA 1ACZA 1QYGH 4M3JA 3WLWD 2DQTH 3MRNA 3A6CL 5DUBB 1JPSL 2ZG2A 1FAKT 5F71A 1QLEH 1FLRH 5LQBH 2K1MA 4CUCA 1M7DB 3L3HB 4X7SL 1FV1A 5HHVL 3KXFE 1DQDL 1P7KB 4OLZL 4RFEB 4ZTOH 4P23D 1KFAL 2CKBL 2ZOLB 5DURB 2VDMH 4XC1H 3WBDA 1Z9OA 5F6IB 4IOFC 4MD0A 3FOMA 5GZOD 1M05A 3X12A 4PJDE 3I2CL 2DICA 3B6SB 5BRZA 1EJOH 5ESQB 2VQUA 4EDXA 4M7JH 3N50A 4NFCA 2EEBA 3TT3H 4YIQA 5DC4B 3RWDB 2VZUA 1NANH 3L7EB 1T21B 1ZGLM 3SE9L 4MA7H 1XGPA 3BDBA 2X4UB 3LN4B 1DQQA 4GAJL 3LH2H 4OUUB 2CK0L 4Z7VB 2V9QA 4CBPA 4WI5A 5E5RB 4PLNC 5B22A 3VFSB 4NNXA 3WD5H 4B50A 1ERNA 2BVEA 1KFAH 2CKBH 2P8PB 1G9NH 5L9DH 4KDWA 1OW0C 4XZUA 5EN2B 4ZO9A 4FZEL 1HOCA 4XP6L 1V3JA 4OCRL 5CUSL 4DN3L 4KRNA 1JTTA 3LZFL 3WKNA 3W0WD 3MJ7A 4KGLA 1Q9WB 4JN1L 3ECBA 3EFDL 4XVUD 4QTIL 4JGJA 2NY0B 4LCCA 3WSQH 4NUJB 4X0KA 4NM8H 3QQNA 4WI8A 3ZYIA 3MLYL 4Y19A 5D1ZD 2GFBA 4JHZA 4HWBH 1HINL 3UZVB 1CDYA 2OTUA 1ZV5A 4WUUE 4EUPB 5IKCB 4MS8C 5D1XD 5DJ0A 3ROOB 1GC1H 2EE9A 4X6EA 1EGJH 2A6IB 3DBXA 5DTFA 3UAJD 3V7AE 3FHQA 1F2QA 4MA3B 4DGYH 3F12A 5GRJH 3G6JB 2ADFH 3SGJC 3FT2A 3IYLW 5L6YH 4JKPH 1JRHL 2VDNH 3EJYD 4Q74A 5DJXA 3MRBA 2W9LA 4YZFF 4TYUA 3OV6A 2EO1A 1SY6A 5TE6L 1KCUH 1TMCB 1INQA 3NCEB 1FNEA 4XPGL 2ESVE 2AJUH 2IF7A 4HPOL 1WCBA 5D93B 4NDMA 5IT2H 2CLZB 3V4UL 4G5ZH 4JRYB 2BNQB 5E6IC 4Y4FB 2H32H 4XC3H 4NFDA 1HEZA 2BVQA 1FN4B 4U6YA 4J2XA 3QUMA 1IGJA 4EBQL 5DQJA 3OG6B 4NGHH 1H3PH 2NY5H 4WNQA 4XP5L 2MOVA 1E6JH 3H3PL 2NXYC 3W39B 2RBLA 4QRRD 5MP6H 1X5YA 3ZDYF 1J9CT 5CUSH 4OCWL 1MRCH 2HKFH 2EC9U 5DVMA 5F7WC 3S36L 4XCNB 3BPOC 4L5FL 2W0LA 4YUEH 1GC1L 4GFTB 2FWOA 3NCJL 4YK4B 1MEXL 4Y2DD 5GGRB 4M8QB 5CBEB 4G9FB 1MF2H 1VGEH 4U1IB 43CAB 4PJ8A 3U7YH 2Z91A 3M1BA 3SOBL 5CBEA 2IH1B 3BW9A 1N0XH 3U0PB 4FFVD 5F3BB 4MQXC 1BFSA 2Q86A 4DUWA 3QXTA 3NACL 4OCRH 4Y4KD 3ESVF 3B9KB 3SCMD 4GBXD 1QFWM 4TVPL 4OTXL 5FUOL 3TPUB 1IGML 5TGBB 4F9PC 5A40E 1PZ5A 4ERSL 3SE3C 2ZJSH 1OQOA 4MDIB 4FQQB 3WD5L 3R1GH 2X5PA 4OM1H 4CMMA 1AXSA 2I60L 2JF1A 4JFXA 1WCQA 3P9MB 2XKNA 1KB5H 5GGTA 1XCQB 5ACLA 2YOCA 4HF5L 3NH7H 5SWZE 3RTQD 5EUOB 3TFKD 2F54E 4QKXB 2JB5H 4OZIF 2AV1A 1EO7A 1QR1A 3EO0A 5TH2A 4ELKB 1OOAA 4N8PA 3K1DA 1ZT1B 1A02N 2AJSL 1MHEA 4ZOEA 3TZVC 4HK0B 4JANA 1N59A 1KCSL 4ZTOL 4G9DA 3H9SA 3MYJA 1RZJC 2CO7B 4M1GH 4Q9BA 2B1AL 2D7TH 1EVUA 3RNKB 3OGCB 1CXLA 3VXOB 4HS6B 4K2UH 4M6AA 4N9GB 1CFQA 4NQCA 3ARDB 1YZZA 3D85D 1CCZA 2RJMA 4PB0L 4X6EB 2FB4H 3EYVA 1YQ2A 3FOLA 3X3FH 1TZHA 2D7MA 1J1XH 5IKCA 7FABH 5IW6B 2M26A 1B90A 1FFNA 4QOKB 1CG9B 3Q0HA 4YE4L 3HI5L 4BZYA 3CVIH 1C5DB 1NDMB 3N9GH 4IRZL 5EORL 3RWEA 3CU1A 3HC4L 3LPWA 1FFQA 1G9ML 1GZPB 1R3LA 2W0FB 1K2DB 2V17L 3E8UL 2H9GA 5GJTH 2ZZUT 4O00A 4AEFA 3NFNA 2FIRT 3P2TA 1J1PL 1FL3A 4MXWH 3GSNL 3U1SH 5BJTA 3V95A 4V1DB 2XTJE 2YD4A 5CSZB 3V6FB 4K3EH 3VA2C 4HWNA 5MEND 3UEZA 5D7LE 1YPZA 5DDHB 3M07A 4NRYB 4XNMB 1BF2A 1LO2L 4TUKH 3K4ZA 3TVMD 3UYOD 1E4KA 3ARGD 1GYAA 3BPLB 3HZVA 3I6KB 1HYSD 3WIFB 3IDYB 3C6LB 3QDMA 3ZKXC 2AABL 3CFEA 4LHJB 1ZVHA 4R7NB 3BKCH 2XQBH 4Q0XH 4UQ2B 5C8JA 4K7PL 2E5EA 4U1LA 1MCHA 3BEWB 2BNRB 1CYGA 5I0ZA 4MJ5A 3HE7D 1QFHA 4NQVA 4OZGB 5F7YC 4X6CB 3DETD 3FRUA 1U6AL 1VFBA 1UZ6E 4M1DH 2QR0A 3FCTA 4P2RA 5DYOA 3WFBH 1S9VB 2Y7QB 3LEVH 3LHPL 3DX9A 3L3IB 1RJYB 5J9PB 4M4RA 1MI5A 3AMKA 1FV1B 1V3KA 5FOJA 2Z35B 1JHTA 3E3QC 5GS0C 4JVPA 3LKSA 4H88L 1PZUB 4LU5L 3PWVB 3RUGF 1EO8H 3OKYA 1NGZB 1NUGA 4RGNC 3DYPA 3GSRA 4OCSH 3QHFL 2DMCA 4W6WB 1I4FA 3DRQB 1MLCB 2V6HA 5HYJA 4PREA 1X5FA 4P59H 3QSKB 4DAGL 1DFBH 3KLAB 2W92A 3UAJC 3ME0A 3QNXA 3UTOA 3PUCA 1YEIL 1XMWA 3HI1B 5D7JB 2QBWA 1IC5H 3D3VD 1FH5L 5FKPA 4RMWA 4Y4FC 3ARFC 3KGRA 3CFBB 3KPOB 3UO1H 1WBXB 3FMGL 2AEIT 4CU6A 3HI6L 3QRGL 4QXGH 4JHAL 4Z7NE 3RWCA 2VXQH 3IDMB 2PXYC 1CICD 5E9DA 2XN9B 2BDNH 4GO6B 2BSTA 1ZS8A 1KB9K 3DO7A 4ZSOA 1ZLWK 1UM5L 2P5EB 2JTDA 3I84A 4HKZA 2DLTA 1R0AL 4LKXA 3U6RA 4O51A 4QHLB 2L0DA 1A7PH 5EWIL 4OI8A 4HX1A 3RNQB 2HLAA 2VITA 3TBTB 1C1EH 4QNPE 3H42H 1BJ8A 1QFUL 3MYJB 2MCG1 5T1LB 2PYEB 4WFHE 4JO2H 1P69B 4R96A 1RQ5A 2ARJA 3BN9D 2A6DB 1V5JA 3W5NA 3MTRA 3UBXG 1EAJA 5T1LA 3STZA 4M6NH 1U2HA 4M48L 3LPFA 3QYCA 1IC4L 4CVZA 1OCWH 4TNWK 2NTFA 2A0LD 4QRTA 4I18C 1NFDE 3FRPG 1IAIL 5E99L 4PJGE 3AC0A 3HCVB 4D2NA 4XNUL 1SJEB 5IESH 4NN5B 1D5XB 1GGYA 4RRPA 4L8SC 1KACB 2DQEH 4HK3N 1JGDA 4LF3B 5FGSA 4ZMAT 5HYSB 3CLEL 1JP5A 1K4DA 4HIEA 3CC5A 3BAEH 3MUZ1 4R3SB 4H26A 3K8MA 3I3EA 2WQ8A 4JRYA 4IDJH 3WDIA 5CP3A 2VDOL 2AJSH 3MRRB 3EHBC 2RFXB 4Y4KC 1WZ1H 3A6BH 3BHBB 4JRXE 4S10A 4FQLL 4U1KB 3QNXB 1A2YB 2DAVA 4XWOD 1OGAE 1NAML 2BRRL 3UTQB 2BHUA 1A0QL 5B38A 3CX2A 5HHOB 2BSED 3HMXH 3PHQB 5E5MA 2I07B 2Y23A 3CSBA 1SMAA 1NCWL 4O58H 3UTSA 2ZJSL 3RWFA 1HDMB 4M7KL 3RWHA 2NY2B 5SV3A 3VXTB 5CIPH 1FAIH 3MROA 5CSZA 3V6FA 5CIPB 1SJHA 3DLQR 3QUXB 3LRGA 2F74A 3PJSB 2RIKA 2ENYA 2P49B 4UT9H 2D31B 1LD9B 1Y18B 2APFA 4NM4H 3EZJB 4Y19B 3ARQA 1NDGB 2OTWA 3RX5A 4MXQD 4WGVB 3HUJF 4JY6A 1I7TA 5I75C 4KJWC 4JM2D 2HT4C 5FYJH 3IFPA 3MRDA 4KTDH 5LGJA 1MAKA 1WUNT 3QIUD 2Z31A 3BRFA 4OKVA 5I8OH 4P46B 1LDPL 1AGEB 1XF5A 1NGXB 3WIIH 4G9DB 1P4IH 2CGRH 2R1YB 3TBWA 3U4AA 2R1WB 4EN3B 3UTSD 1KN2L 5CGTA 5TDPB 4BH8B 4UILL 5BQ7B 3VWJA 5LGHL 1CK0L 5BVPH 1XGUA 4FTVA 3QDGE 4QHLA 3T0EC 1F4YL 2X1OA 3OHXB 1KYOK 5B3NA 1F11A 1HYSC 3IGAA 5GGSB 1L7TH 1F90L 3O6LL 3WXVL 5J57B 2B1HL 4JDTL 2VXSH 3SE4C 3GJFB 4YBLB 4FQXB 4X8XA 3WUWB 3D5OF 5KVEH 1DQMH 1T5WA 4L4VA 4WEBL 5LBSL 5I1GH 4XZUB 4JVWA 1EHLH 4KKAD 4P5TD 4YDJB 3IXAA 2JIXD 2VZ3A 1L9MA 2H26B 3KPLB 1EGJL 1NBZB 3FFDB 4JFYA 3O9WD 1R6VA 1U92B 3BPNB 5C0AE 1KEGL 3RGVB 2ITCB 3DIFB 3OKLA 5ADPH 5DMJB 3GKWL 4J23A 4ODBD 4LL9A 3X3GL 1UM6H 4LVHB 4YIQB 5B38G 2DKMA 4AY0A 4Q9RH 3UTZB 2NY1C 4P9HC 3C6LA 1AJ7H 5FM4A 4MNQB 3EFDH 2D9CA 1BP3B 1F8TL 3K4AA 4ZS7H 1B0RB 2EXWC 2Z9TA 3S97C 3KLHC 2X9WA 5D1ZB 1FZOA 1YNTA 3JZ7A 3T0AA 3UJTL 4KK8C 3IFPB 4QXTA 1XZ0A 1A2YA 3OJMB 1UVQB 4JRXD 4KXZH 4L9LC 2DWEB 1BPVA 5KG9A 3EDEA 5ID1B 1FCCA 1KB9J 2O5XH 5J6GA 4NQVB 4M6OH 1EDQA 4NO3B 4DZ8B 5D7IE 2ORBH 1KIPA 3QPQD 2UYLB 1FYHB 1NGWB 5E4EC 4GKZB 3MLWL 4PJDF 4P48A 5BCAA 3BGFB 4OLVL 2A6KA 5CJ8A 1J0KA 1PQZA 2KZ1B 4P4KA 5EIVA 1YNKL 3HTLX 3TT1L 4JKMA 1TJHL 1UQSB 3U4EA 3VXUA 3QI9C 5HHMB 1UEYA 2GY7B 4M1CD 1OP5K 3O8XD 3VGGA 4Q9CA 3T2NL 1B88A 2NY4D 3IJYB 3L7FA 2ARJB 4JZNA 3HRPA 2F15A 2UVEA 5FCUH 3DX8B 2QQQA 2YUXA 1TFHA 4KJPD 3HR6A 4NKMB 1ZLVH 5JLZB 4UU9B 5HDQH 1BX2A 3Q6FB 1KPVA 3FFDA 4OFYA 5F44A 3C8DA 4BZ2L 1A3QA 2CIKB 3GRWA 3MV7D 1MY7A 2QQKH 4GG6E 3Q48A 5DO2D 4P4KD 4YX2L 4FQJH 5GSRB 1BEYL 2HJLA 1UKTA 1CXFA 1FRGH 2Y36L 3NIFF 4LU5H 3HE6B 3W9EA 4ACPA 1RZGB 1I8IA 3WFEH 4X4ZA 4ZUWA 4ZXBB 1UXWB 4PRDA 1W0VB 2R4RH 2OTPA 3ARFD 5INCA 4NQSA 4RZCA 1I8LC 3D0VA 1TETH 4PJ5E 1JNLH 5H37G 4G7VH 5T3ZE 1N3NA 1S7QA 2VC2H 5DA0B 4F33A 5SWQB 1ITBB 5CCKH 1VADA 3SN6N 4QHUB 1KLFA 5ESVB 1AXTL 1ZA6A 2YRZA 3F7RA 2FX9L 4JR9L 3VFUA 5IWLA 4XRCA 4YXLL 4RGND 6FABL 4M8QA 2H41A 2GJ6B 3LQAH 4N8VG 3JBG7 5ETUA 4R90L 5C9JB 1TJIH 5IVXB 1I7UA 2AK4B 2CIIB 1ZLSH 3PWNB 3VXNB 5F9OL 5GSVA 4XXDA 3BZ4B 3MOAH 3SGKC 2AXGB 1TITA 4PLJC 2O61A 3L3IA 2PYFA 3HNSL 2XICA 4ELMB 1MIMH 4UT6H 5HVWA 3BQUC 4N8CL 3LKQB 1N6QH 1BZ9A 4WHCA 4LARH 3K46A 2EIBA 5IBUG 2GTZA 1KIQB 1M71B 2NW2B 4PJHB 6FABH 5L7XH 1FRGL 3L95B 3QAZC 4Z0XA 5KAQG 1AE6L 3ARDD 4JDVB 4PRHB 5EU4B 5ESVA 1AR2A 3PV6A 5HYQB 1GRWA 3HI1A 3HR5B 2GTWA 5D7JA 4QHUA 1JGVH 4BZ2H 1X4ZA 3HMWL 2CRZA 1AR1D 3K8LA 2JELH 2FGWL 4ONFL 4PJ9D 5E8NB 4DGIH 4LCIH 5T1DL 2YD7A 3D9AL 2GEEA 1T1XA 5JIKA 4X9FA 4K2UL 3GSRB 3WFEL 3E6HB 3RP1A 3RDTD 2B1AH 4Y88A 4NQUA 2WUCH 4GAYA 4Y5YA 5D2NE 2HFGH 5C0RH 4NNPL 2YN5A 3RL1B 1T2QL 2FO4B 4Q58C 1FN4A 3QFDB 4I4WA 1A21A 2VXUH 4KZDL 3CSGA 4Y4FA 1I9RH 1QQDB 4PUBL 2DQFB 1SM3H 3NOIA 4WU7A 3UYRH 3LMJH 3TYFA 4UDUA 4MX7B 5FCUL 1JRHI 3QI9B 5E6ID 2MHAA 4OLYL 3MLUL 4HXBL 4JE4B 4MJ6B 1CI5A 1EK3A 4HS3A 1T1YB 1KB5B 3MJ6A 3NCCB 3PWUB 4JFFB 3QUZB 1IBGL 2GK2A 2QKIA 3HAEB 1KJVB 2PXYB 2HYMA 5EOQL 1AGDB 4I0PB 4YC2C 5IF0A 4GG6F 2GJJA 1TZIB 1KCRL 2BVOB 1A7NH 3HAEA 4OV5A 1IT9L 5DJ6B 1IC7H 2X7LB 4YHKL 3HE7A 2HT2D 4LCIL 8FABA 5EZJB 3P4NB 4Y2DA 3FQXB 3BUYA 5IIEA 5BXFB 1FL3B 1MAML 3T3PE 5DWUH 1MHCA 3D0LB 3GJEB 5AYQA 1RZJH 1FO0H 5DMKB 1H5BC 3N1QC 3IJSA 4NRZA 3QH3B 1H5BB 4YR6B 3U46B 4CNIA 1WVZA 3OX8A 5I30L 5I1IL 3KYKL 3P9MA 1MJUL 4WV1A 1F6AB 3T4YA 2V5SA 4IRJD 5KW9H 1FGNH 4FXGA 5C0IB 1CQYA 4P2RD 2W60B 4PJEF 4MAUH 1CDGA 1RIVH 4KDTA 4MZ2A 3WMSA 1NEUA 4ZG1A 3DV6B 4P3CH 1HWHB 4UAOB 1V7NL 3KPMB 4WWKB 3FO0L 3P77B 1DUYB 3MOBL 4G8IB 3RWHB 3CH1A 2ZG1A 1ZK9A 2FATH 1DL7L 5IJVB 4JO3L 1YMMA 1MJ7H 4GRWH 1C12B 1EZVY 1WC7A 1AI1H 3DETC 2BP3A 1UM6L 2D03L 2KQNA 3K7UA 1G7LA 2VUOA 3GKWH 5BS0D 2XN9D 3KLDA 5JNYB 1BLNB 5FECB 4NQCD 4LOUC 4X98B 4YFDB 2HA1A 3ZE0F 4J3OC 3PP3K 1CICA 1KNOA 2E7HA 2A77L 3AREA 4ZQKA 3DV4A 1QNZH 4X83A 1Q9OA 5T1KB 5I1GL 1LNUB 4OCYH 4OGYL 1OAKL 4WEBH 4JY5H 1I85C 5E2UH 1WBYA 2J2ZA 1XCQA 1EXUA 2D3VA 4JM2F 3C60B 2E6PA 1KIQA 1M71A 2NW2A 3SDCD 1LK3L 3GO1L 2R39A 4HIXL 5AZ2L 4MQSB 5GRJL 2EDFA 4G8IA 3VDCA 1MI5E 1WIOA 2OR7A 2WBWB 2V2TA 4PS4H 2YD6A 3DUUB 1TPXC 4N68A 1M1SA 3F7QA 1EA9C 1Y6KR 5D7LA 3DXAD 3REVB 4PB9H 1I3RA 5ECJE 2FCBA 2FL5A 1S7SB 3X11B 1RSFA 1MFBL 2O5YH 5L0QC 2OXGA 3O45B 4K8RC 3WN5C 4WENB 1S9KC 3QXUA 5F1NB 1TENA 4ODTL 5DJAA 2APXA 4DVRL 2F53B 3WIFA 2J3SA 4G6MH 1GSMA 1QSED 1X9QA 4R4FH 3GI8L 5EZLA 2B2XH 4ODHH 5C6TL 4XI5C 2EC8A 2EIDA 4PLJD 1UYWH 1Q1JL 1W72B 5CEZH 1Q9KB 4XPFH 1DBJL 4PJ8D 2YPKB 4HBCH 3M45A 1MCCA 2QADB 5ACZB 5GGTL 1KB5A 5M7QA 3EOBB 4OGXH 4NNYB 5HPOA 2AVGA 2QQLL 3MV11 4YHZH 2YBRA 5T3ZL 2UVFA 1T1ZA 1YN7B 3ECBB 2M1KA 5D7IF 1JNHB 4QGYA 4M03A 5F8QC 3GDBA 5DURD 5L88L 2A77H 1SVZA 2P8LB 2XZCH 3A6BL 4YJZL 1A1MB 3QUXD 2XI9A 2WBJA 1A3RH 2BHZA 5HXMA 2AKRA 1RK0B 2Q3ZA 3JWDC 1NCAH 5IUSA 4RFOL 3CDYA 1S7QB 2WLYA 4FXKB 1CFQB 4FTVE 4KPHL 3D0VB 1PYWA 4RRPG 3ETBF 5K9QG 1RJLA 2VIRA 3QISA 3WUWG 2XV6B 2I07A 1XGPB 1A7OH 1EEYB 4K7FB 4N0UA 4JM2B 4X5WB 3EO9H 5CJXC 1JYVA 1AGCB 1IAIH 3LY6A 2AJZA 2YMXH 3BQUA 2COQA 2OR8A 1NAMH 3PWJB 3MLTB 3PWUA 3CVHB 4ORZC 4DZ8A 3KXFD 5EZIL 3JV4B 3IU4H 3PWPB 1RZ8A 4DUVA 3KHOA 4BFEA 4F9PA 5I8CB 1NGWA 5C3LD 4QGTA 2E9IA 4RX4A 5I1IH 1DUZA 1JYWA 3PQYA 1KIPB 4GSDL 2FEDD 3C8HA 2B8OT 1X6NA 4OF3A 4RFEA 4LHUD 1JNJA 5DLML 3FB5B 1HQ4B 4Z9KB 1MAMH 5C08D 1QLRA 3D39D 1J5OH 4QXTB 4U1JB 4OM0H 4J1UA 2J8UF 3MNWB 3O11B 5E4EB 1DBJH 4NZTL 1A9BB 1T7WA 5CEZL 3FRPA 4KHTL 2CO6B 4R26H 2DLFL 1A3RL 5T1KA 4IRSA 3QIWB 4M6NL 1IM9A 4LQ1A 3LQMA 2GJ6A 4LLYB 1ZGLP 5CSBA 2GTWB 4YFLF 1A6ZB 4DVRH 2P46B 1S9WB 4YHZL 4OLYH 3QEGH 3TCXA 5F21B 5D72L 1S7TB 4AM0A 4BSVA 5E2TH 1T03H 2A6JB 5EWIH 1A7PL 3VXUD 4NWUL 4GAFB 4OIAA 2BK8A 3FOMB 2DQIL 5FM8A 1GGBH 2HG5B 1UYWL 2R2EA 3DMMD 3LCYA 5DUML 3C9NB 4XPFL 4M43H 2PCPB 4YHOH 2G60L 1V3MA 1I3VA 3T0BA 1CGXA 2EYRB 2PTTB 1G1CA 4I2XE 3HPJB 3MXVH 1LMKA 2QHRL 4GLRH 3F58L 3VD5A 1U3HA 5JXAL 1AHWC 2H2SC 1DBAL 4U6YB 1NGPH 2HWZL 5B4MD 4MQ7A 4LIQL 4GOSA 3RZCB 4OFPA 5F6HJ 2XYCA 1QZ1A 4PB9L 3VRJB 1OAKH 3HC3H 3UJJH 5E08H 1BX2B 3RWIB 4KY1H 3HMWH 3VFMB 3KJ6H 2OQJA 3EO0B 3UBXB 3VW3H 4GRLC 1U92A 2OBGA 3BXNB 3EGSB 5GHWH 4Y2DB 5EUOA 5EPMA 3JSSA 1X44A 4F7MA 1INQB 4N1HB 3INUL 3TO4C 4KMQA 4Q0XL 5EBMB 1LO4H 2BVOA 4J6RL 4ZUWB 1ZGLA 4APQC 2HVJB 4JQXC 5IM7A 4OT1L 4PJBE 3TJHD 3CFIC 4HFWA 3O41B 3JWOH 3ZDZE 1XIWC 1A8JH 4IMLA 1YY9D 5JXED 1FYTB 4NIKB 4LCUA 5JHDD 4RGOL 3BKJH 1BQHG 1D5MA 4GBXC 2FZ3A 1DSFL 3F7PC 3VFTB 1I7TB 3WXWH 1BQLH 1P7QA 4LDOB 2XFXB 3S5LA 2VDOH 5E1AA 5IWLC 4ZNEA 1FVDB 2VLJB 1ZOXA 4E5XB 1FZKA 4U0RB 4TUJB 3H0TA 4P46C 2AABH 5IMOA 2DWEA 4NC2B 5JZ7D 5IQ9B 4QF1B 1IKFH 3QUXA 1NGXA 3TBSB 4XPHL 2HT4D 1J1XL 3G5YB 5D2NC 4XHJD 1K6QL 4FQCL 2LABA 2E8ZA 4RMSA 3WL9B 4OFYD 1UH2A 1EGJA 4PLOB 3W39A 1NUDA 1QRNB 2WW8A 1DQQB 3U7WL 1C5BH 4P2OA 1G1YA 1ORQB 1ACYH 3ILQC 1KENL 3FN3A 4HH9B 4X5XB 5ITFB 4GW4B 4TOYL 2C3GA 5JW4R 1NJ9A 4LCWB 3KPQA 5JXEC 2FECL 3UP1A 3J7HA 1SJEA 1GH7A 4NQEB 4UQ3B 1VA9A 4PJ8C 1WTGT 3DVNB 4HQQH 5CWSB 2I60H 1MCLA 4BZ1L 1G7JB 4EQ3A 5DJ8A 1LE5B 2D7TL 5DS8B 2DMKA 2VL4A 3P4OB 4UBDC 1SYVB 3SBWC 1JMXA 5F88B 1JGUH 3REWA 3QO0B 1R5WA 1LO5A 5D70L 3UO1L 3W0WA 3H9SB 5J1TC 4YGVA 2X4QB 3K2MC 2DTSA 1MHEB 2ITDA 1S78D 3N85H 4XBPB 5MENB 1GXEA 4XP9L 4PV8B 2ED7A 5HGHB 4OZ4A 3FZUC 2CDGA 5H94B 3FQWA 2VXUL 4KZDH 2VITB 1Q94B 5J12C 4F33B 1BFTA 3HFMH 4ONHB 3SOBH 5ESAA 4F58H 4EIGB 3VXSE 3CAFA 4KHXL 2WUCL 2GUOA 3V6ZA 4TVPD 4PRHD 5FYLD 1T20A 3I75A 5IEKA 3RWCB 4YHMH 2VZVA 1IGYA 5I15H 1D6EA 1TTGA 3U79A 1IGMH 1ODAA 5FUOH 4ZAKD 4N8CH 3IFLL 5GRUH 3DGGB 1VEOA 4ODXA 2DTML 4FQ2H 2CDFA 2XN9A 5IJKA 4HCRL 2ICES 5MP6L 2R2EB 4JDZB 4OD3L 2V9TA 3NCFB 2AXFB 5I19L 1VERA 1CU4H 4KROC 3ARGA 1N0XL 1JCKA 1MSPA 1KTDB 3SDCC 1AC6A 2NMSA 3QDMD 5EOCH 1T21A 3ALPA 4NSKB 1Y0LA 5I66A 4LKCB 1CGUA 2UY7A 3V6BR 3HB3D 4JG0L 1PLGH 3PDDA 4HLZG 3ULUL 1RMFH 4BQBA 1HIML 5HYJB 3O6KL 2AW2A 4S1RH 5CJQL 1DTUA 2Z31B 1FNFA 1T0NB 5CEXA 2KUTA 2V2TB 4L4VE 3PNWA 1P7KA 2WUBL 2Y7QA 5JW3L 2NZIA 4YDVA 3O3EB 5D7JC 5EU6E 2PXYA 4AJ0A 3QXDB 1K85A 1QUNA 4I0PD 1N0LA 5CJBA 5J9PA 1CQKA 5L8LB 1LVEA 3HB3C 1BQLL 2YUVA 3LAFA 3WXWL 3PABA 3SDYL 3ARFA 1Q9LA 1AXTH 5IOPA 4UNUA 3BHBA 3MRCB 1JN6B 1JPFB 3VFNB 1X5HA 1E4KC 4OB5L 4Y89A 3IVKB 5HGBB 1OP3K 4PLKD 1ZMYA 1L7IH 4U1GB 1HSBB 4HWUA 3VXQB 1RUQH 3BEWA 3MO1A 1CDBA 4NKDA 5E0QA 4WCYL 4WW1A 5CZVH 3AM8C 4LASH 2XWBB 4OZHB 3ZTJG 1ORQA 4LFHG 2LTQB 1KBGH 5EIIB 1NBYB 1EEYA 4N0UB 5KVFH 1AIFB 2V7HA 4L8SA 1NSNH 4O02L 5FYLH 1J11A 2ADFL 3F8UB 3KS0J 3UC0H 5H2BA 1P7HL 5CINH 3BIAX 3INUH 1BEYH 4M1GL 4L8SB 1UADC 1R3KA 1S5HB 1A5FH 1U3YA 2OL3H 2Z35A 3IDGB 3DWTA 3U4BL 2ITCA 4OLEA 1KPUB 1HINH 4QRSA 3CDGA 3PIQA 1ZHKB 4JG1H 2J6EH 5J12B 1U8NB 3OSKA 3RUGA 4F37K 1R3IH 4X0KB 2VAAA 1DVFC 2J7LA 2X4OB 2XY2A 1X5ZA 4NRXB 1H5BA 4YR6A 3U46A 4JFEE 4LGSB 3O6FC 5BS0B 2V5RA 2YXFA 1HHGA 2CKNA 2X09A 3QG6B 4NQCB 2XWTB 4GW5B 4LKXB 1C5CL 3VXOA 3E0GA 4HQQL 4XC1L 3E6FB 1T1WB 3RY5A 3L5IA 4YBHA 1ZHLA 3QUKB 3MMEA 4KHTH 5AYUL 3G5ZB 5IHUH 3KPSB 2YPLA 4Y8AA 5ID0A 4F3FB 1T5XB 5DHXB 4PFEA 4WI6A 4LAQH 5ITBL 3QQ3A 3C5SB 4XBGA 3ROLB 3EYSH 2B7DT 1W8NA 4E9LA 2GUOB 1ZT7B 3SE8H 4Z7VA 4U7MA 5LCVL 5J1AB 2K7QA 5GRYA 3LQZB 3MRQB 5F6HI 2VJXA 2DQUL 1K2DA 1DE4B 3DUSB 3SDCA 4AEHL 3K3QA 3SDDC 5F1SA 4HBQA 1G6VK 5EZOL 3C5JA 3MNZA 1J86A 4Y4KA 5I76A 4PV8A 2NLJA 35C8H 3DXAB 1EJ6A 1KPRA 2APBA 3V7AG 3LSOB 3UJTH 4NZTH 4UNVA 5D93C 5C07A 1CF8L 5I71B 5A16B 5JQ6H 3UPAA 1WJ3A 3HLAA 4JZJA 5IFAH 4X7SH 2HFEA 1QLEL 1I8IB 4Z76B 1J8HE 3VD3A 3TGXA 2XWTA 4GW5A 4NGHL 4P5TA 1CGSH 4G6KH 1FFOA 1HHKA 1UG9A 5DYOB 1I7RB 2IQ9H 2MQCA 3Q3GA 4G6JL 4JEGB 4X4XB 4Q97A 2AI0L 3FRUB 1F4XL 1NJ9B 1F2XK 2P8MB 3CIQA 2AQ2A 3PIQB 3WNNA 4ELKA 1QA9A 5JOPD 2ADGB 5IT2L 3S5LG 3HRZB 1RPQA 1SJHB 4O2EA 3RIFF 3X14A 3MRHA 4JFZH 2IG2L 1IKNC 1NQBA 4I3SH 4IM8A 3B9KC 4JPKH 4X9BA 1MELA 2R9HD 3DVGB 4PBVC 2G75A 1UWGL 5EC2B 3VD9A 2MSPA 4PJ5D 3BJ91 3ZLQC 2FX8H 3MRIB 4APQB 3SDXB 1ZWIA 1MCKA 3O4OB 4PRPB 1F4YH 3ZT6A 1WWBX 1UKQA 2ICWB 4G80A 3WNOA 5CP7A 2BVQB 3MO1B 1JWSA 1OAQL 4MQXD 4QXGL 2HH0L 1JF1A 4TUJA 2WINA 4PRIE 1K9TA 4J3SA 3M17A 4Z7WA 3P0YH 2DLEA 4FQXD 4F7PB 1J8KA 2CGRL 5HDLA 5DJCB 2BNRA 1KN2H 1S7UB 1IE5A 4HUMB 1A4KB 1EV2E 3RVVD 2Y07H 1GOGA 3ZHKA 4Z7WB 1HH9B 2NYYD 2GHWB 1KLGA 2HJKA 3LIZL 1N2RA 2B0SH 5JXAH 4OSUL 1Z3GH 2CLZA 3P0VH 3KXFB 4J8RA 2QSCH 1B4JH 1CL7H 3BOVA 4DN3H 4KK5D 2BOBA 4Z95H 1H8SA 1R5IA 4GXUN 1MWAB 3MRGB 5CLTA 1U8JB 2LAGB 2FSEB 2PR4L 5KSUA 4EJ1C 5FUCE 1ADQH 3IJHB 4LHUB 4MNQD 1CT8B 4H88H 1TZGL 4JKWA 4LLDA 4UTBH 1HHIA 4ZS6C 4LKCA 3W2DH 3L3GB 3SDDB 5KS9A 4PJEB 1HCVA 5IK3B 4XNXH 3TT3L 4GBXA 4UDUB 1H8OA 4UT9L 3VFMA 2XFXA 5BZDA 1FVCB 1UXSB 4LVOC 5LXGH 5IB2B 1D9KC 2A1WH 3GBMH 3VRLF 2VKWA 5GQBA 1EO5A 1X5LA 2R0LL 1DCLA 1HOCB 3RBGA 1EVTC 1MHHA 1Q38A 2DYPD 1J5OL 1O7VA 1UC6A 1BJ1H 5FO9A 3QNYB 1S7WB 3O3AB 5E2UL 5TGBA 5K33A 1NGQH 2MQ3A 3P73A 1A6TA 3BZEA 3R06A 3SGKA 2NCMA 2F53A 3JUZA 5IFAL 4K3HA 1N64L 3OHXA 1P7QD 1RUPH 1CF8H 1XF3B 4K9EC 2VN4A 1KPRB 3TNNB 1PX3A 2CMRL 1UGNA 2BFVH 3GSWA 1ED3B 1OAYL 5DEGB 3AMLA 1VGKB 1VB9A 2XQYK 4HC1A 1S7UA 1JFQL 3BT2L 3H42L 2FATL 4L9LA 3RJQB 4CU8A 3C6SB 4P2QA 5IHZA 2YA2A 2X44D 1MVFA 1G7JA 5EU5A 3GSUB 4DVBB 2H32A 5I1CL 5ISZE 3DVIA 1CFSB 3QCVL 3QWQB 4H25B 3QG7L 1ZT4A 3BSZH 3BD3A 3BZ4A 3EIFA 4WUUA 5DI8B 2H32B 1RZKC 2CIIA 1A7NL 4YK4C 5DQJB 4YPGB 1C7TA 1ZVSA 1AFVL 3MJ8A 3IAGC 1CGTA 2BXYA 2XQYG 2IFFH 5DRWA 2N7AA 3IRZA 3LN4A 4HH9A 5E03A 4M00A 4S1SH 4X98A 3G5VA 3FONB 3L7EA 4JFPA 2FR4B 1MCQA 4I0CC 4KH2A 4R7NA 4AG4H 3MACL 2IBZX 4L3EE 1W8OA 4QEGA 3IFNH 3DO3A 2EDQA 5IMMB 2R0ZL 3BD5A 4PR5B 1N3NB 3MUGA 4WW2B 1AGCA 1VSCA 1I9RL 4URTB 3ZO0A 2OL3L 3GMOA 5C0CD 4R6UA 1LK2A 3LB6C 3RY6C 1ZLWH 5BJTB 3H7BB 3W81A 3GI8H 1XF4B 1D5ZB 1DLFH 5IB3A 1EO8L 3MNVB 1A6VH 2HLFC 4Q2ZB 1CLOL 1KBGL 3H6JA 3QIWC 5I8KL 4EVNB 5CJOL 5GSRA 1B2WL 2FECI 1D3CA 3P30L 3EOTH 4MMZC 1NCBL 3LSOA 5J13C 1DFBL 3EO1A 5B8CA 1IJ9A 1UZ8B 4WJ5B 1P5UA 4HFUL 1EFQA 3MBED 3RI5F 1EEZA 2BC4B 5CS7A 5MEQB 2R9HC 4RNRA 1G7IB 3T04D 1NSNL 2YUZA 3JTTB 3GUTB 4ZUTA 1RFDH 1AGDA 4LCWD 3LEYL 4POYA 4MZ3A 2Z0BA 4S1QH 5E1HB 5JQHC 1I3GH 4RAUA 2FGWH 4GUPB 3EYFB 4HH8A 4M1DL 1MQ8A 1KJ2B 3GUTA 5MEPB 4NQED 1K8DA 2UV3A 5GIRB 4OB5H 1HIMH 3STBA 2ZUQC 3L3OA 3F5WA 1YEHL 2VQTA 3BP6A 1FO0B 3MCKB 4PY8J 1HXYA 4LLAA 4M7LT 1YN7A 3QEQA 4L3CA 2LV4A 5BRZB 4TTDC 1CGYA 1LO3H 3VA6A 2WP3T 2ZNWA 5HHQB 3PL6A 2C3VB 3WLBB 3P3YA 5GRXG 1HILB 1J0YA 2DD8H 2A9NL 32C2A 1UVQA 5E24E 4R2GC 3MV8D 2ED9A 3RIAK 3LEXB 1FZJB 5CP7B 1F3DH 4X4YA 2AGJL 4WW2F 2Q7YB 1NMCC 1T66C 4XHQA 1CIUA 1G6RA 4QOKE 1HDMA 2P8PA 5D1XB 1J05A 2VWEE 4ENED 1T20B 2EIEA 4IIQC 5DD6A 3VGAC 1IGFL 4LGRB 5DSCA 2BJMH 4NC0B 1MREL 3KJ4B 5I73C 3R4DA 2CPCA 3N9GL 5EFIB 4HLJA 3ARDC 1F4WH 2IANA 2XACC 4JJHA 2FJFA 3AB0C 4JQVC 2CUHA 3A6OA 4V1DE 3TH2T 4HUWA 2EH8L 4YPGA 1JWMA 5D6CA 1W0WA 4LLQB 5F96L 3GI9H 4ZYKA 3VXRD 1T04A 3CFCH 3NCMA 1CLOH 4YHIA 1CVRA 1XH3A 2C1OB 1H3VA 1SJVA 1CBVH 1JVKA 2OJEA 4JFDB 1T0MB 1UM4H 5J06A 1DBBL 2EEDA 2R4SH 4N9OB 5CP3H 5HYJD 4BFBD 4ERSH 3MLUH 4HXBH 4JREB 1E4XI 4NHCH 3IDJB 4X6CE 3VFUB 1CICC 1MPAH 1F42A 3T1FA 1YEFL 4KVCH 1F13A 2BVYA 2G5BB 2PW1A 4M7ZB 4OLVH 3ES6B 1FZMB 2BNUB 5CHNB 4RWYL 1WCBB 1WSST 4CAGA 2C1PA 5FIEA 3MLRL 1T2QH 1F4WL 4F15C 2UWEE 4M7JL 2DRUA 1YA5A 4UIMB 1QSEA 5GZND 1RUAL 4M6OL 2VYRE 3GSOA 1QRNA 1MREH 1KTDA 4OM1L 1G7HA 4XMPL 3ZL4H 4ZXBA 3FQNB 4XXCC 5CSGA 4C55A 2LU3A 2OI9B 3D3VA 3F12B 3QQ3B 3M8OH 5E95B 1RZIB 3PGCB 5BZWB 4CW1B 5C0FA 1U91A 2ZCLL 4XB7A 3ARUA 3NPSC 2VLKB 3KPPA 4I9WE 1IGYB 4KVNH 2QKIB 3C60D 3WE6B 2IAMA 3CMOL 4POUB 3SDAC 3B9KD 2WNGA 4IIQA 3SBWA 1FG2A 3Q6GH 2EICA 4IHOA 5FUCC 2G9HB 3WJJC 5HGAA 2CDEA 2YBRB 2Z4QB 5EU6D 1UACL 2E3VA 3RL2A 1XFPA 4MJIB 3QJHB 4QO1A 3SKJH 4PGCB 5C09A 4I1NB 5DMKA 1IZJA 4HDIB 3EDDA 3D18A 1A22B 2VERN 1Q8MA 1QFWL 5J8OA 4G6FB 5IB1B 4ZOCA 3W82A 1MRCL 2HKFL 3S8WA 5E8EB 5GS0L 4RGNE 3MRIA 4G8GB 1KTKE 4D0DB 4S1QL 1CD8A 3FQNA 2AQ1A 4MA8L 4PPTA 1ZGLB 2ADIB 1MLBB 1D9KB 4N5UA 4LLMA 2PYEE 5L6YL 3O2DA 5DJAB 3MRKA 1A3LH 2VN7A 1LO4L 4BK5A 5K9KB 4F80A 2FX9H 2HTLD 2I26N 5JMOC 2HN7A 3OGOE 4XAKD 3KPSD 1CE1H 3ZYOA 5LXGL 1BD2B 3D85B 1KLGB 4ZFOL 1QTYT 5A2JH 3C5ZD 1VEPA 4LSQL 3ARYA 3MV8E 5D5ME 2XNAA 2ZOLA 4PJGB 3KWWA 1DDHB 3QJFA 4FN0A 4LRIC 4ETQB 2R2BA 4HIJA 4QOKD 1JRHH 3PP4H 4A6YB 3S3JA 4PRPA 4MHHG 3VMPA 2VLRD 4RMUA 4ALAH 3S4SG 3L5WA 4PV9B 4PRNA 5E6YA 2VXVH 1OP5H 5C6WH 4LEOB 5HY9B 1WBYB 1WFTA 4HWZB 2YD2A 5E6IA 4G80B 5JHDE 5I8OL 1TPXB 4XMKL 2I9TB 3U2SA 1V05A 4XH2B 2VH5L 3ARZA 3L9RA 1B0RA 3TIDA 1IQDB 4NFBA 3WSQL 1TLKA 3RZWA 2ZUWA 1UACH 3L3KB 1NCUA 4TPRL 3LH2L 8CGTA 1S9WA 4JN1H 2XOTA 4U3XA 1NANI 4UBDD 3FQTA 2OP4L 4CJ0A 3CVHH 4RAVB 3FQRA 4XNYH 5JORA 1HNGA 5HI5C 2HKHH 2ZCLH 5ENWA 5FA3B 2DLFH 3K80A 3RTQC 3H8NA 3ULSB 1DUYA 4RQQA 2FJGB 1JE6A 4YHOL 1DBMH 3P73B 2UY6A 3VWKC 2X4TA 3UJIH 2JCCB 4LSPL 1B0GB 5FO7A 3C5ZC 4WHYG 3ULSA 4XXDB 3ZKXB 4GAJH 5F3HA 5HHVH 4WNQB 3CX5K 2AJXH 4RFNB 3PHSA 3G6AA 4LP4A 3TIEA 4I5BA 5E2TL 5DLMH 4HW6A 1J88A 2Z93A 2I5YH 4ETYA 2BZDA 1JIBA 1NBVL 2EDWA 4APQD 4IRJC 3LPGA 2P42B 1LDSA 1E0OB 4HJ0D 4JLRA 3AFLA 4WHTB 4D0BA 1OSPL 2EE3A 3MRMB 4H5SA 1YEGH 5BZDB 2H8PB 1FSKB 1U8IA 4N1EA 5HSFA 1O5DT 3VMOA 2DQHL 1NMAH 3QIWD 1OL0A 3CVHA 3L5XL 3DX8A 3G6DL 1AKJA 1OW0A 3PWJA 1H8NA 3C5SA 2GJZA 3IKKA 1CGSL 3ELAT 5D7IA 5GJSH 1R5WB 1KN4L 1H9VA 4YWGL 2LFGA 3B43A 4ENEC 4JHWH 3VXUB 2ZCHH 2GSGB 3CXDH 5EU6A 4L4TA 1CFVL 1HHGB 1RJYA 4IJ3C 2WMPA 3DMMB 3VXQA 1S9XA 4DCQB 4X8JB 4WJ5A 4M5ZH 5DMIH 5F1OB 5E8PB 1ZLUH 3KLSA 2DLHA 4YNYB 4LPWA 3QDGB 1IZKA 4D9QD 1MFDL 3GBML 1IC4H 1PKQA 3HS0B 1P4BL 3GMLA 3L5XH 4MS8D 2P5ED 3OZ9L 3QXAA 5D1XC 5ICYB 3T0WA 4LSVH 1H15A 2EYTA 4O2CA 2VOTA 3TZVB 2YEZB 5KSAC 4BA8A 3L3GA 2VR9A 3SDDA 3BKMH 3CFDA 1YDPB 3MUHL 1J8HD 1MCOH 3WE6A 3S35X 1WK0A 3MBXH 5IESL 3SE8L 12E8H 1IM9B 2N7BA 1FBIL 1LK2B 5B3JF 5AWNL 1KIUA 1ETZA 1YPZE 5KANI 1MFCL 1U8JA 1WZKA 1MRDL 15C8H 4BKLB 4NZUH 1JZ6A 2BDNL 4ZNCD 1C5CH 4YHNA 3O6FB 2FD6L 2JJSA 4O9HL 2BMKB 4RGMC 5JW4Q 3IB4A 1IGJB 1JN6A 3ZYJA 5HPMA 1QFUH 2F8VA 3SQBA 3CSPA 4H20H 1P7QB 3QDHA 3B9AA 3NZHH 4HPYL 4PJAF 5K59F 4OCXL 3CMGA 5C0CA 1CG9A 1GHFH 2Y5TA 3QDGA 1DQLL 1ZTXL 4UIKL 1I7RA 4I18B 2XKSA 2HN7B 4CW1A 5C0FB 5GXBB 4MXVE 4KJYA 2P24A 3QAZB 4L8DA 4Y5XC 3I50H 3BPCA 2CJUH 1M7DA 3L3HA 4GRLB 4HXAL 3I75B 3DYOA 4JPWH 3MOQA 4F9LA 3C6SA 4P2QB 5HJ3B 1NCCL 3DUHA 2PW2A 1EBAA 4G8FA 5BO1H 1I1AC 1YEKH 2FBOJ 5KVFL 1E4JA 5I16A 4JY5L 4J4PD 5EPMB 1QBML 4PJHF 4YQXH 3MCKA 1NCBH 3O8XA 3L3OB 5D4QA 3PWLA 1A1MA 1B2WH 3V52L 1WV7T 3MCLL 2ICEA 3U9UA 1BJ1J 2R2HB 1N5AA 2AJ3A 3IU3B 1NMBH 1NCNA 1CFBA 4S1DD 4ZFZA 4NKOB 5I1LB 4PJ9A 1A7RL 1A14H 2XKNB 1R3HB 4DWHA 4I5BB 4HXAH 1ZLUK 3GMNB 4OLXH 4HG4K 3OKOA 5K9QI 5K9OB 2DM7A 2VLKA 2P24B 2WIIB 3T8XA 4ODXB 2X4NB 5C9KA 3WFHB 2FJGA 4QWWD 3MJ9L 2NR6D 2NTSP 1WT5C 4X4MA 5FA3A 4FQLH 4MAUL 4GG6B 4OLUH 2GYSA 1XGRB 4FP8L 1J0ZA 5GJTL 4KDVA 1K4CA 2VABB 5F1NA 1QSEE 2NY3B 3DRQA 4HGMA 3ZMRA 2P45B 1F3JA 4PP1D 2W9EL 3O45A 3PJSA 3W0WB 4LHUA 5HGGS 3B6SA 2VDRL 4HJJH 1MRDH 2BSSA 3OPZL 2RCSH 3TV3L 4XBPA 3VH8A 1HHHA 3L5HA 2MTPA 1V7NH 1EZVX 1A9BA 4OF7A 2XRAL 5HHXH 1PDKA 3MGTB 5IJKC 1S9YB 1TQCB 4PGBB 3T0XA 1CXEA 5DFTA 3RVTC 4GXVH 2V17H 4I0PA 4J3UA 3BKML 3CUPA 2VDLL 3T2OA 5BMFL 2R2CA 1XF2A 4KI5C 3QRFM 3AXLA 4JCLA 3QPXL 5HI5D 1CLZL 2GJ6E 5SX5H 2IBZY 1A6AA 4Y8DC 2OI9C 1XF1A 5CD5C 1JPFA 3IS0X 5FDWB 5I8CA 1EMTL 25C8H 1T6VN 1TTUA 5F9WC 1SBSL 3VG0H 5EU7C 2NR6C 5MEPA 3PP3H 2Y9RT 4HIEB 1KF9B 3RX8A 4BKLA 4PJXB 4Q6IA 1NGQL 4HK3J 2W38A 5C0NC 1OLZA 5C0RL 3PGDB 1JGUL 3MGOA 1SEQH 1DBBH 5GRWA 1QSFA 4PJHE 3MLZL 4Y5YC 1XGTB 4HGWA 2J88H 3VI3F 1HH6B 2R0LH 2CXKA 1AIFA 2WM0A 4F2MA 5INDA 5DUPL 1KCLA 3VFGL 1VGKA 3HUJA 3DMMC 2YKLL 3L1OL 5IMMA 3V52H 4OIIH 4WCYH 2ADGA 1X5AA 4QRRB 1OSPH 4Y1AA 3LS4L 4CL7A 5F9DC 5GGQL 2EH8H 4QTHB 3T0VA 1JGVL 2FHBA 1U93A 2F19H 2XZAH 5IOPB 5B21A 2FLRT 4KUZH 4OFKA 4CMHB 1CXKA 4U1NB 3SCMA 3FL7A 4C54A 3BZEB 3QEQB 3D39E 1ZEAH 5C2UB 2HFGL 4KJQC 5KSBB 3MJ8B 1DEDA 4Z78A 5HYSA 4JDZA 2IQAB 4OD1H 1LP9A 1B0GA 5JUEL 5M94B 1FSKC 4PJ7B 4ELMA 3BWAA 2PTVA 4NO5B 1TNMA 2XTJC 3WN5B 4CVUA 1EUUA 2PNDA 1IC1A 2QSCL 2R29L 3VXRB 1RAMA 1GPOL 4PR5A 7CGTA 3U9UB 1I8KA 4XTRC 2JIXA 3JTTA 3LKRA 4H1LG 1JHLH 3QEUB 3MA9L 3BMVA 4UUJB 4XPHH 3I85A 5D2LE 3FQRB 4GBXB 3HAEH 4QCIA 1RMFL 4RA3A 5KOVC 3WNLA 3BGAA 3TP4A 3TM6A 3UTPE 1IEHA 1ZVYA 1CGWA 5KS9B 5B3JE 3WKML 4JFFE 4TPRH 5C7XH 4JFFA 4KK6C 4QRPE 4Y5VB 3DSNA 2ZUVA 3TJHC 3B2UC 1HKFA 1ND0A 5HVGB 1X6LA 1OPGH 3T1FB 1N6QL 3PQYE 3EOAA 1M7IA 1YEHH 3IDJA 4P5KB 3MLXL 3U6RB 4XAWH 3C5ZA 3RTQB 4NOBA 1BQUA 1JI2A 2JKXA 3B5GA 5FHAL 3ARVA 5AWNH 2IGFL 4X9GA 3WHE0 3ULVH 1I3GL 3C9NA 3QNYA 4U1HB 1II4E 4NPYA 1MFNA 4I3SL 4WDIB 3V0AC 3BRGC 4DEPB 2VDNL 3QIBB 5ICXA 1RURH 5BS0A 3C2AL 4MA1C 2WV3A 3WFZA 4P5MA 4UNTA 5ANME 4CVXA 4ZFZB 4ZS6D 3HE6D 3STLB 1OTUC 3GM0A 1MOEA 2Y5TB 1K8IA 4KV5E 1YMMD 3SE4A 1FNSH 3HFML 1UWXK 5DEGA 1F4XH 3NCYS 1FFPB 5E2WH 3SJVE 3ZE1E 4NKMA 3X3FL 3S37X 3HC3L 4U1LB 3UJJL 4N5EC 1R24B 1MCIA 1GAFH 1JNLL 5CILH 4K8RD 4ODWA 1S7XB 4OF5A 3PDOA 5I71C 4QTIH 2NNAB 3R06B 4JKPL 4U2ZA 3X13A 2NW3A 5KVGL 5DSCB 4U1SB 3T2NH 1C12A 1WC7B 4MJID 4IOIA 1BVLA 1MCRA 5EDXA 3P4OA 4PRNB 4O5LL 1YNLL 2NNAA 4U6XB 2Y36H 4W68A 5A2IH 3UZEA 3U4EB 1YUHA 4LPUA 5JHLH 4FZEH 1EAPB 2ATPA 1NAKH 4J1UB 5A2LH 3RPIA 3WO4C 1UKSA 2EYSB 2Q8AH 4PJDA 1YNKH 2DQHH 2W91A 1HQ4A 5D71L 4F57H 5JTWA 3GIZL 2QTEA 2DQUH 3JV4A 2VLMD 3SE9H 3QUMH 4K9EH 5GGVL 1OAXL 1U58B 4F7PA 4N0YH 2ZKHL 2BERA 2AK1H 5E94A 2FBJH 3G5XB 3T4AB 3ISWA 4NYLB 5JW5A 3U7WH 3K2UL 3B5TA 5AYUH 1LEIA 1ZXQA 3FQXA 2BNRD 3R0NA 3RKPA 4OTXH 5DFVC 5C07E 3C5ZB 3HE7B 3RTQA 4ZO8A 4HUVA 1U41A 4K3JH 3G9AB 1GGUA 2BOBB 4WO4C 1KJ3L 4RFNC 4APQA 5INCB 1G7HB 4N0CD 2XG5A 5IB1A 1DQDH 5DEFB 4KRPC 1S7WA 5AAMA 5AD0B 1RZGA 5C0BA 1F8TH 2VLRB 4MA3A 3HG1A 4D0BB 4OJFH 5BOPA 1QPPA 4L3ED 3DBXB 1Y0LB 2V5MA 1IFHH 1JK8A 2DWDB 3I2CH 3QI9A 4JG1L 3G04A 3BH9A 3IETA 4JPIA 5SX4I 3RAJH 1U8IB 3TBTA 1D5BB 1UFUA 5C1MB 4JN2B 1FG2B 1WFNA 3ZE1F 1PKQB 3HS0A 2H6PA 4P4KC 5ACZA 4BQ8A 1A5FL 1MIEH 2I9LB 1FCGA 2L4OA 3QULB 3U9PH 4HULB 4NO0A 1V7ML 2BSTB 3H9HA 4H1LH 3NIGF 3UC0L 2WIIA 5JDSB 4O5LH 1K3ZA 1E6JL 5D7JD 3BE1L 4HT1L 1BOYA 3GI9L 4QRQB 4JFFD 3RY4A 3MLSH 1G7PA 1KTRL 5D96B 4OZFH 2J4WH 3RWDA 1N5AB 1WTLA 4ZUUA 3OWEA 5E2WL 3FFCD 4POZC 1CICB 2AJVH 3TIDB 3MLPA 4JY4B 5F7MC 3HZYB 1FORH 3TVMC 5LBSH 4PJGF 4XNXL 4UT7H 4IS6A 3DI3B 1KGCD 4XVTH 5ELIA 2WUBH 1BZ7B 5C71A 4WO4A 5T1LD 3TCLA 4GRLA 3C09C 3VH8G 2Y5EA 2HLFD 4F3FA 4P9MH 5CGYD 4HIJB 1ZT4B 4KJYB 3TO2A 3QWOA 3FO1A 3LB6D 2NY6C 2MMXA 2DD8L 2MPAL 3PWPE 3WFCL 1BBJA 2DM2A 3HG1D 4P2RB 3C08L 4WW2C 1M7IB 4UOW1 2HMID 1CK0H 5BVPL 5IEHA 1ZWIB 4DQOL 3MNZB 4TULL 3SO5A 1KNOB 4EUPH 1MRFL 4MNQA 2BY0A 5DD5H 3GSVB 1SY6L 4UDTB 2A74A 2BNQA 4YXHH 4KK6D 4OZFB 5FK9B 3X17A 3RVTD 4FQIH 4LSUL 5B39G 3CMOH 3TN0B 1JHLL 4PGJA 4LLMB 1FL5A 4IDLA 3RJDA 3TWCH 5F9JB 1NL0H 4YXKH 1J05B 1RFDL 1JHKH 3G5ZA 1G9NL 4AMKL 4EI5A 2Q3AA 5L9DL 5DJXB 2X1WL 3G5YA 1ZHNB 4RNRB 3C6LC 5CEZD 2A83A 4NQTA 5CLWA 1I1AD 4PP2A 1I9IH 4PJFA 1YDPA 5GZNC 4U0QB 5HHOD 4DTGH 1MCWM 1OD7A 3MLRH 3VFPA 1MVUB 2FDBP 1PD6A 1CGVA 5F89A 5A16A 4EKXA 4WFGE 4J3TA 4HWEL 3IVKA 4GG6A 3RY6A 3HZKA 1P84K 1JNHA 4JGMA 3VWJB 4XPAH 3U7AA 1IAMA 1J87A 4LEXL 5GZOC 3RL1A 4XVSH 2IWGA 2JJVA 4JREC 3O41A 4NP4L 5K9KA 1J8HA 3QCTH 3CLEH 4M1CC 4IBLT 1KV3A 4PD4K 4ZPTB 3MLZH 3W9DA 3R8QA 1RJLB 1U91B 5FO8B 4OCLC 3K0WA 4ZPTA 2BC4A 2LU4A 4X6BA 5E7BA 4Y5XA 3DGCR 4CVZB 2D7OA 5EO0A 2CR6A 25C8L 4Z7UA 3TLRA 5FDWA 3SQOL 5C09B 2Q20A 5DVLA 3THML 5I16B 5ESQA 3LKNB 2QADD 4P46D 2GTZB 2NX5E 2OZ4L 2VDLH 2WZPD 5J1SC 3T65B 4OGXL 1LP9E 5CMAA 4LMQE 3A67L 1OAUH 3EKCA 4EN3D 5IP4A 3KYMB 3VXPA 4XMLL 4KROD 1JGLL 1T66D 3TPUA 2MCPL 1QBBA 2AGJH 3RKDC 1F58H 4OF6A 2Y72A 1PG7L 1T7VA 1R3KB 2EKJA 1XH3B 4JGUA 2VSCA 4XVUC 3H3BC 3KNBB 3G08A 5C0EA 2ZSVA 5JPNB 1S7TA 3QCTL 4HKJB 1P4LB 3SKMB 4XWGH 3UBXI 3ZT7A 4D9LH 1KJ2H 1OM3L 4E41D 2JJWA 1DSFH 2YSSB 3VD7A 1WICA 2WSKA 2QEJA 1PGRB 4FFZH 5GGRA 1VFAA 2HT3C 4X6CF 3L3JA 2FL5B 4JFYB 2DOCA 1RIUH 4PUBH 4R4NC 1LILA 2J6EL 4G43B 5EBWB 1HQRB 5D8JL 2IH3B 4QWWC 5FV2A 3AAZA 4FQHB 1S5IH 4ZFGH 3SPVB 3MNWA 3O11A 1FJ1A 3O9WB 4W81A 3FT3B 4XPBL 1L6XA 1QRNE 3K1KC 1I8MB 1G9EA 3KG5A 3QRGH 5AUMB 4JFDA 3RDTC 4TSAH 3QUMB 4HIXH 4W6XB 5AZ2H 2H2PD 3MRNB 4NO2B 4FABL 2YEZA 3OG4B 4K23L 2DDQH 4NKOA 4K94C 4PJFF 4F8QA 4DKFL 3PXHA 1A1OB 5T1DH 1NMBL 5ICYA 5JO5A 1N6UA 1XR9A 4LLUA 2XNAB 5IB2A 1L0YA 2X4PB 5I1EH 1L7IL 4L8BB 3L6FB 4OCNC 5ETUB 5FHBH 2BXZA 1Q0XH 1MWAL 1P1ZA 3L3DB 3OAUH 4LSUH 3RDTA 4NQEE 5K59E 2IANB 4FQIL 2P43B 2X2YA 4G8EA 5I8KH 2AEPL 4M8VA 4QXWA 3EAKA 5GGVY 2HVJA 1NPUA 4A6YL 1E27A 1A6TB 1K8DB 3D2UD 1JF5A 4TNVK 5GIRA 3VE0B 4KJWD 2BCKB 4JO3H 3ARXA 4QHMA 5JW3H 3NFSL 3ZTJH 1UB6B 1QHOA 2B0SL 3AU1A 2FNBA 1GHFL 4NKIL 1TJIL 3VRJA 4HPYH 2PO6D 4YFLI 3D3VE 4D9LL 4I0PC 3V6ZB 4JFDD 4GW4A 1C08B 4GRWF 4PBXA 2KPNA 2G9HA 3HC4H 3K4DA 3MRFA 3MV8A 4MCZB 4IIQB 3VGAB 1Z2KA 1P4BH 4NQDE 4KTEH 4Y1AB 1RZKL 3RZCD 4CU7A 3DVFA 5A2KH 4OZIE 4KMTL 5I18H 4TSCH 2DQDL 5I19H 2NY0C 3Q5YA 1EEQA 4PB0H 2QLVB 3VXTA 4L3AA 4PIRF 5I1CH 5KANG 3MNVA 4ODUA 5IVNA 2NX5A 4IOIB 1IMHC 4JPKL 3LD8B 1PQZB 4P4KB 3FN9A 1A1NB 2F54D 1QD0A 4X6DB 1KN4H 1LO0L 1UQSA 2CLVB 2KL6A 2BY1A 4J4PC 2VMFA 3G5VB 3MUGB 1IEAA 4WW2A 3N1MC 2JB6A 5H8DA 3VFRB 4XVSL 1SQ2N 5B8CB 4NCDA 3GMLB 1QR1B 4NQDA 3P9WB 5C3TA 2BY3A 4WFED 2AXJA 2OR9H 1G6RH 1FYTD 2Z8VC 2FH8A 5H37H 4NQXB 1FLTX 4P2OC 5EBGA 1FG9C 5A43C 3O4LB 5TQ2H 3BJLA 5EU6B 1XF2B 4ORGB 4IEFB 4UINH 2R8SH 4BSJA 3R1GL 1KEML 5C0BE 1LWRA 4OGAD 5HVHC 5LAXA 1RIHL 3RBSA 2VLJD 2XZQH 3E6HA 3EDFA 4K3DL 1NCAL 1FP5A 4ZD3H 1MFAH 1ZHBA 1AD0B 3EYQD 1TJHH 4U49A 4C56A 2J8UE 1X5GA 5F1IA 1FZOB 5C0CE 1OAZL 5FGBA 1X3DA 1YC7A 2R23B 3QFJB 3N0PB 3CU7A 3QZWA 4LP5A 3IDXL 4G8GD 2VDPH 4IS6B 3C09B 4P0DA 4AEHH 3TWCL 3HMXA 1M4KA 4G7YL 3TNNA 1F3DJ 1NBQA 4R96B 1FDLH 1OAXH 4JFPB 2FR4A 4EQ2A 3NBNA 1PY4A 4LCCC 1N4XL 1X5XA 1YEDA 1CTNA 4WU5B 3KNBA 5E1AB 5C0EB 2X89D 1A4JA 5FYJU 5IFJA 3QBTB 4XBGB 4LPXA 1YMMB 1G0XA 1RK1B 3WUWA 1BAFL 2VH5H 5KTEH 2Q8AL 5C6PB 3S36H 2OXHA 5EOCJ 2B39A 2X4TB 1NFKA 3MPCA 3QULA 2Z31C 4HIIB 3O3AA 3RVUC 2NY2C 4Y4HC 1RU9L 4ZSOE 3HNSH 3WIHH 2F5BL 4YZFE 2XTLA 4FQCH 1T7YA 2E7LA 3QG6A 3EOAB 3NGBB 1KT2A 4ZS7L 3P11L 5C0DA 5HHQA 1AGBB 4XNYL 5EUOF 5KVGH 5E8OA 5I1JL 2KQMA 4HS8L 1BMGA 1R3IL 3RWGA 4MD4B 1BFOA 2H6PB 1OTSD 3BPNC 4KK5C 2R2HA 3WEXA 3TNMA 2KBGA 1F4AA 2IMMA 4AZ8A 1T3FA 4PYHA 4LPTA 3QZWB 4YUEL 1Q9KA 1MCJA 4R4ND 2KZWA 4WY7L 3ROLA 5INDB 2SEBA 5IV2A 3VJ6A 5L2KE 1DP0A 3F62A 4OV5B 5D1QD 1I9JL 3GHEH 4AK1A 3BX7C 4XNQB 4DZBB 1JNNH 1BFVL 4NYLA 5JW5B 4YPJA 3NFPB 4UT7L 4Z77B 3DVNA 5CWSA 1MCBA 5E94B 3GFUA 4Z78B 2B4CL 5DJ2B 2GQHA 2DQGH 1IGIH 2PXYD 4PJBF 5CZKA 2X1PA 4G5ZL 4MNGB 3DXAE 4GKZA 5JR1L 2VAAB 3BPLC 2YPLE 2ZOKA 4NM8L 4PJDB 2MNUA 3S88L 4WO4D 4GMSL 4I4WB 2Y06H 5KVDH 1KCUL 4QY8B 4HT1H 2CLVA 4QRPA 1BFVH 1T0MA 2APTA 1MJ7L 4K7FA 1BOGB 3RFZC 3QDMB 3MOBH 3C8KA 5IROC 1AH1A 3EJZD 4DGYL 2R56L 5CGYC 3LS5L 2XWJA 1T1XB 2NTFB 1FFRA 4QRTB 5E5MB 2NY6D 3JVGC 4UV7H 4LDLB 1A6PA 4OV6F 4GG8A 5MERA 2VZSA 5E2JA 2X42A 4V1DA 2VL5B 5KW9L 4JG0H 4YHLH 1OHQA 1GOFA 1RHFA 3DVGA 4OZIA 2K3TA 3LQAC 1RZFH 1F3JB 1IAOA 2WK2A 1BLNA 3BKYH 3MRHB 4NWUH 3QJHA 2FBJL 3ARSA 1UB5A 5T3XH 3U36A 4OZFG 2XG4A 3VRIB 4HHAA 3BP4B 3FTGA 4PJHA 1NC4B 5TJWK 5IVOA 2F19L 4Z18A 5IG7B 4P9HL 3SDXE 2DJ4A 3RA7L 3EYSL 3FFCB 3WIHL 4PRPE 2BSRB 4F57L 4FQ2L 5D71H 5E8PA 4OQ1A 1FYTA 1QEWA 5A1AA 1JWSB 2Z8SA 4B53A 5CJXA 2EDRA 4EI5C 3HCVA 2XZQL 4QYOA 4KC3B 4JKLA 5JHLL 4WI4A 4W4OA 4JZOB 4OM0L 1JBJA 2AK1L 1BZ7A 4KHXH 3KPOA 2AERT 3RRQA 2Q6WB 2DQTL 1MJJA 2ZUSA 4Z7NF 2C26A 3E2HC 1CLYL 5D6DA 4U0RC 1IM9D 4Z7WE 5EC1B 4OI7A 1T80A 4IMKC 4P5KA 3SDCB 4GRWB 1AQDB 4PJ9C 1JV5B 3X3GH 1IGCL 2ICWJ 5FOBB 5HVHB 5TH2B 1S7SA 3X11A 4GSDH 5FEBA 1XCTB 2OMNA 1PG7W 4M7LH 5GISL 1XGRA 4D9RE 1FNGB 1URLA 3KR3L 3QHZH 4ZUUB 3GMPA 2UZYB 5HI3D 1I4FB 4O51B 3ULVE 3MBEC 4POZD 4YDLC 2BNQE 5EZIH 1E4XH 1JTOA 1R3JB 3JVGA 1EFXB 4YHYB 2YUWA 4YDLB 4LFHD 2ATKA 4Y5VC 1AGBA 2FEEL 5LQBL 4KKLC 2ZUTA 2DQEL 5GGUA 3QUZA 3TN0D 3SKNA 4R97C 1KULA 1EEZB 3BN9C 4NO5A 4NO0B 4PJIA 5T5NF 1QEWB 1JPGB 3CFBA 3ARGC 3VI3E 1CDHA 3S88H 5DEZA 5IW3A 3GKZA 1MY5A 4KTYA 4M5YH 5FXCH 2Q8BL 5KSBA 4GRLD 4MD5A 3TYGH 3BZFB 1RZKH 3P0GB 2YN3A 1KPUA 43C9A 4F15B 5BQ7A 1KC5L 4PJ8B 4G9FE