1FCHA

Crystal structure of the pts1 complexed to the tpr region of human pex5
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
323
structure length
302
Chain Sequence
b'SATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
publication title Peroxisomal targeting signal-1 recognition by the TPR domains of human PEX5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 130
structure length 302
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fchA00
2VQ2A 5ARGA 3GYZA 5FZQA 2PQNA 3CVLA 2VGXA 3PDNA 1ELWA 1ZBPA 5DIZA 1PC2A 3EDTB 5AYWD 3KS2A 3RIBA 3CVPA 1YA0A 4J0UA 1WAO1 3QWWA 3U4TA 3BEEA 2LSVA 4GZ5A 2P58C 2YQ8A 3GW4A 3KAEA 4N39A 4GCNA 4IN3B 4HOQA 5BT1A 5FZRA 4AY6A 2HO1A 4LEUA 4BT8A 5CCLA 4J8EA 4HOUA 3TG4A 2KCKA 2E2EA 4HOSA 2XGSA 3ZPJA 3AS5A 3ASHA 4YNDA 3SZ7A 3ULQA 4YVOA 3QOUA 5D0OD 4O6FA 2V5FA 4HORA 1XNFA 3QWPA 4J8DA 4U04A 5JJ6A 3PE4A 3LY8A 4A1SA 4KYOB 2AVPA 4JA7A 4GZ6A 3UQ3A 4APOA 3IEGA 3K9IA 1E96B 1ZU2A 3JYSA 4XIFA 2Q7FA 5FJYA 2WPVA 4CDRA 4U0ZA 5KJLA 4EQFA 1QZ2A 3RO3A 4ME2A 4G25A 2VSYA 4XI0A 4RG9A 3Q5MA 1ELRA 2PL2A 2JLBA 4U07A 4AY5A 3ZN3A 3QKYA 3AS4A 4G26A 2PZIA 2VGYA 4WNDA 2XGOA 2XCCA 3MA5A 4GA0A 4GYYA 3S7JA 4WNGA 5G05J 3FFLA 5A7DB 5BNWA 2ONDA 2VYIA 1OUVA 2LSUA 3GZ1A 4UI9K 3VTYA 5HI7A 2DBAA 5G05C 2UY1A 3ASGA 2I6HA 1NZNA 3MV3B 1KT0A 4WUYA 2FF4A 5EKQD 2HYZA 4I9CA 2NC9A 4BT9A 3LYAA 3ESKA 4N5CA 4GPKA 4UI9J 2KCVA 2VSNA 1P5QA 4NQ0A 3VTXA 2Y4TA 4GYOA 4JA9A 5DBKA 3ZFWA 3RKVA 1IYGA 2C0MA 4AM9A 3LY7A 1QQEA 4WNEA 4I9EA 5LCWJ 1HXIA 4G24A 3CK7A 4YVQC 5EX3A 2XGMA 3E4BA 3OXLA 4N2QA 3Q15A 3QWVA 4BTBA 4Y6WA 3CVNA 3RJVA 1NA0A 4N3AA 4WNFA 3UUXA 3LY9A 3KD7A 3CK9A 5FZSA 4GCOA 2FI7A 4JL0A 3RO2A 4N3CA 3OXFA 1TJCA 5M72A 2WQHA 4NRHB 3Q4AB 5JJ7A 1FCHA 2GW1A 3AS8A 3MV2B 2C2LA 4H7YA 1A17A 4KBQA 4GZ3A 4GA2A 4UQZA 5D0QD 4BWRA 3FWVA 4G1TA 2YHCA 3CKBA 3HYMB 4XI9A 3PE3A 3S7BA 3CEQA 5HQ8A 3URZA 2OOEA 4AIFA 4GYWA 2KCLA 2XPIA 4J8FA 3SF4A 3GZ2A 4BTAA 3CVQA 5KJNA 5ARFA 4B94A 3TG5A 3LCAA 4U0SA 4UI9C 5BW8C 4I2WA 2KATA 4UQXA 1KT1A 3R9AB 3LKUA 4G2VA 2BUGA 2FEZA 4JHRA 4HOTA 5KJMA 2L6JA 2QFCA 4N3BA 5LCWC 5KJKA 3O48A 2C0LA 3ZHEB 3TGOA 5C1DA 4CGWA 2MHKA 2IFUA 2FO7A 3UPVA 3FP3A 3S7DA 5CHEE 5A6CA 4Y6CA 4U0UA 5G04J 3Q49B 2Y4UA 5FT9A 3TAXA 2VGXB 4H7XA 1W3BA 1HZ4A 3ASFA 4UQYA 4I1AA 5EX0A 3OXGA 4CGVA 5G04C 3CV0A 5JJTA 1KLXA 3LPZA 2UY1B 2IF4A 2J9QA 3Q47B 3N71A 4F3VA 5CCMA 1NA3A 2LNIA 4ABNA 2PQRA 4I2ZA 3CKCA 3NF1A 5FTPA 2FBNA 3RU0A 3ASDA 3MKRA 3ZHEA 4N2SA 3S7FA 1HH8A 3ZGQA 4GA1A 1IHGA 2XCBA 3CK8A 4RG6A 2KC7A 4W9RA 3U3WA 1WM5A 4G23A 3QDNA 4I17A 2UWJG 2HR2A 3WXXA 2R5SA 1Y8MA 2XEVA 1B89A 3MEKA 4KXKB
chains in the Genus database with same CATH superfamily
4DK5A 1O5MA 1IQRA 3IHVA 2WVIA 4AEZC 3E37A 2PQNA 3CVLA 3FU6A 3ABKE 3ZUVB 2A4ZA 1E8XA 2CFUA 3CGHA 2QC9A 2IJGX 3F6QA 4K0RA 3HXFA 3CQGB 4OYSA 5D66A 3KEAA 4JPSA 3BEEA 2LSVA 2P58C 2YQ8A 3PUKA 3GW4A 3J5QB 4IN3B 3W9FA 5ENTD 1H2TC 4CT0A 4DLQA 2ZIRA 3HIZA 5FQ4A 4K03A 3RRUA 4HOSA 3ABLE 3AS5A 4HI9A 3ASHA 3G2VA 3ONLA 4GTRA 3I3NA 3QWPA 4B93B 4C9BB 4LNGA 4C48B 4U04A 4DJAA 5HS0A 3C98A 4I6EA 3AAAC 4MRUA 4GZCA 4CCAA 1Z3XA 4PDXA 4GZ6A 4FC8A 3IEGA 3K9IA 3D9KA 4I6GA 5FJYA 4A55A 4HRMB 1HG2A 3V79K 4BESA 1QZ2A 4ME2A 2P9UG 3FEYA 2VSYA 4RG9A 3SFXA 1ELRA 4AVXA 4G26A 1D8DA 5BV0A 2XCCA 3ML9A 2QYUA 4FULA 4KMOA 4GTMA 3VLDA 5BNWA 1H0AA 2X6KA 1TR4A 2LAIA 4UI9K 3CVXA 5G05C 5CECB 2WQ7A 1UJKA 2IEJA 3FUKA 5EKQD 4I9CA 3G2TA 4N5CA 1DNPA 3TWTA 3RRMB 1TN6A 2WXGA 2VSNA 1P5QA 3VTXA 4GYOA 1OWPA 1TNUA 3ZFWA 3R7RA 4E85A 3UI2A 1MYOA 3S2AA 1IYGA 4AM9A 3VLEA 4U8YD 2PNNA 3TXMA 2EIJE 3PNLB 5AQ7A 5LCWJ 2XQ0A 4BSZB 3UM0A 2OVFA 3MX3A 3FUNA 5AARA 4YVQC 2QY7A 2L0TB 2AJAA 4EHMA 2IOSA 1V55E 4Q96A 4GAAA 3QWVA 2X3MA 2XENA 4U96D 4CT4A 3FUEA 5AENA 3EUVA 1NA0A 4N3AA 3ZNGA 4WNFA 1LTXA 2XZDG 2AXZA 2FI7A 1A5EA 4JL0A 2BF0X 3V30A 4TXRA 5BXOA 2XS8A 1JUQA 1FT2A 4DRXE 4ATZD 1U3DA 4NIKA 2GW1A 2MYOA 2JABA 4GMLA 3TXNA 4GB9A 2IO2C 3MV2B 4BERA 1NFIE 4ANVA 4CDNA 2HE0A 4FHKA 3HRAA 4GZ3A 3QNKA 4UQZA 2NSZA 4I6JA 5ENPD 5E76A 1DCQA 3CHMA 3UMVA 3DSVA 3WG7E 3PZDA 3P2BA 2Y69E 3Q7AA 3S7BA 3CEQA 3L22A 3Q78A 3EJNA 4EZKA 3IXEA 4BTAA 4JB8P 2CG3A 5E75A 2R2LA 2LXMA 2BTDA 1HFAA 4UI9C 2V4HC 2KATA 2F8XK 3I5PA 3R9AB 2KZTB 4U95D 4MLPA 4OVVA 2L6JA 2QFCA 2J4DA 3Q9UC 2ZGDA 5LX8A 3ZHEB 4ACKA 3TGOA 5C1DA 1HF8A 2MHKA 2IFUA 2FO7A 2X6IA 1DCEA 5G04J 4MS6A 5FT9A 3UM2A 2BKGA 3IHYA 1QYMA 3ZYQA 1W3BA 1HZ4A 2F37A 4BETA 3EU9A 3PREA 4FADA 2ETCA 5JJTA 2H6HA 4GTOA 3TWVA 2WB2A 1NA3A 5B3SE 1LD7A 1E8WA 2PQRA 3UKRG 4I2ZA 2J8SD 3APDA 3UXGA 2P9LG 1EDUA 3ASDA 3FHEA 3D9IA 3MKRA 4DLOA 3FTXA 4M7CA 5CRUA 2VSXE 3S7FA 3JQ1A 4TV3A 3DEPA 3LVQE 1JWFA 3QARA 4W9RA 1GW6A 1E8YA 3U3WA 1WM5A 3FUHA 3QDNA 4ANUA 2HR2A 2R5SA 5AQBA 2VGXA 1RZ4A 1DVPA 3CHOA 1BD8A 5FZQA 3PDNA 5G2NA 2B0OE 1PC2A 3PH0C 1BI7B 3Q9NC 3ZYLA 3CVPA 1G3NB 2DIWA 5ENSD 4V3IA 4RVBA 3B7TA 3QWWA 3FUJA 2I1JA 4GZ5A 4B89A 1Q2ZA 3J5PA 4HOQA 5BT1A 3ZYMA 4JD2G 1VDYA 4LEUA 5EDSA 3FH8A 2KCKA 4WWNA 2WXJA 2GRPB 2WXNA 4YNDA 3SZ7A 1TEZA 3FY4A 5B1BE 4O6FA 2DYRE 2V5FA 3UX4A 4G8LA 1D9SA 1IQUA 5T3RA 3DWLG 3LY8A 1UG3A 4HRNA 2WXPA 5AJLA 3PZ3A 5FQ7A 4L23A 4O1PA 3W9GA 1HE8A 3L13A 3LS8A 4APOA 4RQIA 3NBNB 2Q7FA 1H6PA 3FU0A 5T8IA 1OCCE 3ZW3A 2KXPC 1E7VA 4ACLA 2X6JA 2WM9A 1S70B 3P1UA 4LERA 2PL2A 2JLBA 2R05A 3QKYA 2XGOA 3I4RB 5H7PA 5JHBA 4WNGA 4NACA 3MKQA 4PS7A 2Y0BG 3FFLA 5J08A 4L9PA 1S64A 3PZ4A 1OUVA 2LSUA 3GZ1A 4DX7D 3B95A 3C3OA 1OCRE 2RG8A 2I2OA 2UY1A 3MZLB 4O1OA 3ASGA 2L9BA 2QZAA 1NZNA 1BI8B 1KT0A 4AOFA 2FF4A 2NC9A 1YMPA 1EPUA 2OEWA 3ONKA 5T4YA 1MX4A 2WXMA 5JHAA 1AWCB 4APFA 1H19A 3U66A 1MX2A 3JXIA 3RKVA 1QNFA 3TWQA 3LY7A 2H6FA 4WNEA 3LJ3A 4I9EA 1TNOA 2AWIA 3NB2A 4G24A 3CIAA 4GTQA 4ZHBA 3AG3E 3TJPA 5EX3A 2XGMA 2WXFA 3V2XA 5D2MC 3TWUA 1BLXB 4EBAG 2BEDA 4UWFA 2P9KG 5AQAA 1N4PA 3SD5A 3ASOE 3IKOB 4A1GA 2A5UA 4EPZA 4D10C 4HVBA 4Y6WA 4C0EA 4A3TA 1SQMA 3C3QA 3LY9A 3LEWA 3CK9A 4BFRA 5FZSA 2MOWA 4L1BA 4GCOA 3ZEFA 2OV8A 1S0PA 3ZXSA 5ANLA 3SBSA 5BXUA 3FUMA 1K3ZD 2WMOA 4PS8A 3Q4AB 1O1SA 5AAOA 1FCHA 2XEHA 2ETAA 3ASNE 5CERB 1WY6A 3FU3A 3AS8A 4H7YA 5ENNA 4HB5A 4DX2A 2EINE 3NOGD 2JEKA 3CLJA 5IY5E 4KBQA 5ENQD 3EHNA 4K5BA 5AIJA 1WDYA 2IO3C 3RK6A 2X6FA 5B1AE 1IXVA 3UM3A 2P9SG 1OT8A 1Y6IA 4GU5A 1PY1A 3Q73A 5LOZA 1H6KA 2CHWA 4OAVB 1EYHA 5HQ8A 3URZA 3NZSA 2OOEA 1EF1C 4J8FA 3GZ2A 3CVQA 1ZB1A 4GTVA 4Q94A 4JC8A 3DRAA 2F0YA 2XHEA 4JW1A 3LCAA 4U0SA 2CFZA 3B13A 5BW8C 4UQXA 4QQIA 3D9MA 4M3OA 1KT1A 4MBGA 1N4QA 4A3VA 5ENRD 4HOTA 4ANWA 1TJFA 5KJMA 3SGHA 3D9JA 3FULA 4N3BA 5HKPA 4YDYA 1IKND 4ZFHA 4DPRA 3AG1E 4CGWA 2NXPA 4XX5A 3S7DA 5KNGA 5A6CA 1SA4A 2IOLA 4NURA 4U0UA 3T9KA 2WXOA 2ZXWE 2DZOA 1TN8A 4UWHA 2FULA 2DWZA 4OAUC 5EX0A 1JCRA 3OXGA 2GGFA 4LG6A 5G04C 2UY1B 3MYVA 3N71A 1SVXA 3HXDA 4ABNA 1DC2A 5CMWA 3CKCA 4F53A 1JCSA 2CG2A 2BKKB 2RD0A 3ZYKA 3EHMA 3DBSA 3RU0A 5AQ9A 2XEEA 3PZ1A 1ELKA 2KC7A 2GRMA 3L54A 4I17A 2VTBA 2ZGGA 2XEVA 5EIBE 1B89A 3PEUB 1Z3YA 3MEKA 5ARGA 3KEZA 3BQOA 2YINA 4OVUA 2QYJA 3E34A 3LVRE 4FJYA 3LXUX 1Z5SC 3RIBA 2WXHA 3Q79A 1K1AA 1TNZA 3IV0A 3U4TA 3T5VA 3T8MA 3KAEA 4N39A 3SO8A 3KSLA 5FZRA 4AY6A 2NYJA 4BT8A 5CCLA 4K5AB 1TNBA 2X6HA 4KZCA 4KVMA 4J8EA 2XZTG 3TG4A 1OY3D 2XGSA 3ZPJA 4CDMA 3KSQA 4JEHA 3ULQA 4YVOA 3QOUA 4FLBA 2LXLA 4X8QA 1N0QA 1UW4B 4CEMA 4HORA 4JEUA 4KZ0A 1INZA 2IY0C 1V54E 1XNFA 2EIKE 4J8DA 1OCZE 4A1SA 2OVBA 3D9HA 3V31A 3L16A 3FUIA 3UQ3A 4DX1A 3L82A 1E96B 1RW2A 3CVYA 3ABME 4FU3A 2WPVA 4JHKA 2XRZA 4F6RD 3Q7FA 4U0ZA 4EQFA 4FA6A 3U9WA 1BPOA 4G25A 4XI0A 1OXJA 1IHBA 1OWMA 3QAQA 5KNHD 4AV7A 4U07A 4AY5A 3ZN3A 3TWRA 3PRZA 2VGYA 3ULYA 3ENEA 3SNXA 4GA0A 4HLEA 4GYYA 3S7JA 4I1OB 2EQXA 4J6IA 1HU3A 2ONDA 5ITZF 4U7EB 3ZRHA 4A63B 3V2OA 5EILA 5EIDA 1QBQA 1S63A 4LCTA 4UWLA 3VTYA 1Z6TA 3CVUA 2DBAA 5AJDA 3HHMA 2I6HA 2ETBA 1OCOE 3RAUA 4BT9A 3LYAA 5FWQA 3EU5A 4UI9J 1N9AA 2KCVA 4PUCA 4RLYA 2Y4TA 3D9LA 5DBKA 3FTSA 4ILIA 3GZSA 1N4SA 2RKKA 3CHQA 2WXKA 2AW6A 1QQEA 4DUIA 3SFZA 2L6BA 1HXIA 3AG4E 3D9PA 4B0ZA 3PZ2A 5HRYA 3UT4A 4F7AA 2V4LA 1SZAA 4GTTA 4N2QA 1KZOA 2Y3AA 2YNQA 3Q15A 4C0MA 4HFGA 3FTYA 4HBDA 3B7RL 3B7SA 4LNUD 3JQ0A 3DEOA 3CHPA 4TXQA 4YDOA 3ZIMA 3KD7A 2DVWA 1NI1A 2H6IA 3I4GA 3RO2A 4DX6D 4FJZA 3DPYA 2OCCE 2WQHA 2LAHA 4FP7A 4JVSA 5EYPF 3ZXPA 3LJNA 1HG5A 5JJ7A 3PNTB 3BG0B 1H2VC 1TYQG 3TWWA 2C2LA 4U63A 2V0PA 3EIJA 2LO6A 1A17A 3D3MA 3FDHA 1O1TA 3C3RA 1HS6A 3HG0D 5D0QD 4J7WA 5KCMA 2XPYA 4FHJA 4BX9A 5FIOA 3ZU7B 4BWRA 3SFYA 4G1TA 5CMYA 1LF8A 1TN7A 1KPSB 4WAFA 3HYMB 4XI9A 4J8SA 3CSTA 4TUUA 5AN8A 5BUZA 2XPZA 4AXHA 3E33A 2P9IG 2KCLA 2XPIA 3SF4A 3UT8A 5KJNA 4TXPA 5ARFA 4B94A 3TG5A 1E90A 4I2WA 2DZNA 3MCXA 2Y1LE 3G2WA 3DXMG 4I1MA 3EIQC 3DSXA 3UKUG 2B6CA 3TWSA 4UUCA 4UWKA 3APFA 3AU5A 5LCWC 5KJKA 4G11A 2C0LA 3BU8A 4BY6A 2VSOE 4E6HA 4Y6CA 2E0IA 3E30A 3G2UA 4JHJA 3SQVA 3TAXA 3NAWA 2VGXB 4H7XA 3EHQA 4G8KA 5LFAA 1X81A 2P9PG 3ASFA 4UQYA 4I1AA 2KM4A 4CRWA 4CGVA 2ILRA 3CV0A 1KLXA 3LDZA 2RFAA 2IF4A 4TUMA 3T5XA 3ZVVA 3Q47B 1JCQA 4F3VA 1LD8A 2LNIA 2KZTA 4BSXA 3L9TA 3DSSA 4IULA 3NF1A 1UOHA 5CEAA 3ULEG 2FBNA 1MQSA 2VJ8A 1FVHA 4QFVA 3ZHEA 4N2SA 4WWOA 1HH8A 2HM8A 3ZGQA 2XCBA 4RG6A 1JWGA 4DI3A 2J49A 3CHRA 2A5EA 3MGBA 5ENOD 2UWJG 4GTSA 1XGWA 3WXXA 1Y8MA 3OAWA 2DYSE 4IYPA 2P9NG 1U2VG 2VQ2A 3GYZA 3CVVA 3JXJA 1N11A 3FTZA 4Q69A 2EILE 1ELWA 1ZBPA 5DIZA 3EDTB 1UN9A 3B7BA 1N54A 3NOCD 3ESLA 5AYWD 3KS2A 4HI8A 3PEVB 1YA0A 4J0UA 1N0RA 1WAO1 3TWXA 4MKTA 4ATGA 3R9MA 3EHRA 3U64A 2J09A 4GMJA 5JA4D 4GCNA 4ILHB 2IQCA 2HO1A 4EECA 4L7TA 1HX8A 4HOUA 3CVWA 2KBXA 4L2YA 2E2EA 2CHZA 3QK0A 3X2QE 3HXCA 5D0OD 4L2LA 3DPDA 3MKQB 4IRUA 5JJ6A 3DSUA 2ZU6B 3PE4A 4KYOB 4EBAA 4DI4A 1UN8A 2AVPA 3AJIA 2J4BA 4CYMD 1FPPA 3CR3A 3IBEA 5ANRA 4JA7A 1K1BA 2V8SE 3UIOC 1ZU2A 3JYSA 1OWNA 4XIFA 1MJ0A 2J07A 3JUIA 4EZLA 4CDRA 2V5QC 2WXRA 3MJWA 2I9CA 5KJLA 5FQ6A 4Z68A 3RO3A 1O1RA 1KZPA 5FINA 3Q5MA 1D8EA 4KVOA 3FU5A 3C5RA 2J08A 3ISMC 3T8KA 4LSZE 2IONA 5A23A 3AS4A 2PZIA 3UINC 1MZCA 4WNDA 1H6OA 4HXIA 3MA5A 2R17C 2L0IA 2DCPA 5G05J 5A7DB 1YYHA 2VYIA 3JCKC 4LUNU 3L17A 3UT7A 3UTMA 2GRLA 1OWOA 4XEIG 1FVFA 1N52A 4HNAD 5HI7A 3C72A 3L08A 2GRRB 3SI5A 3FTUA 2LUHA 2R02A 2FO1E 3MV3B 5C2YA 4WUYA 2HYZA 1X5BA 4HLLA 3RSEG 4XKBA 3ESKA 4JXTA 4GPKA 3HVEA 4GMRA 4NQ0A 4GTPA 4JA9A 1JPLA 3D9OA 5FQ8A 2C0MA 4ANXA 4F1PA 3CSFA 3SY2A 4URKA 3QB2A 5KBAA 4U8VD 2H6GA 4XE0A 2YHEA 3FTVA 5G55A 3CK7A 3G2SA 1U3CA 3SBTB 3E4BA 3OXLA 2M63A 1OWLA 3DSWA 5EN5D 3VLFA 1N4RA 4BX8A 3D9NA 1E8ZA 4HRLA 2PM7A 3B7UX 4BTBA 3UIPC 3BUAA 3CVNA 2I1KA 3AG2E 3RJVA 4YDEA 3R7QA 3O4ZA 1YCSB 3UUXA 4CZ2D 2ZISA 2GRQB 2WXLA 2WXQA 4F1SA 4AJWA 3FUDA 4FLHA 4LNBA 4PS3A 4N3CA 4R7LA 2X38A 3OXFA 1TJCA 5M72A 3SHFA 3CQCB 3JUEA 4NRHB 3DXKG 1SZ9A 3UM1A 2XRYA 2AXVA 3TL5A 4RSYA 3NZUA 4P29A 3FUFA 1N94A 2CHXA 5EYLA 4U8HA 2F8YA 4GA2A 4XKCA 2R59A 3ML8A 4HS2A 1N95A 5JMND 2GROB 3FWVA 4BEPA 2YHCA 2AXUA 3CHSA 3CKBA 3Q75A 5CBNA 1E7UA 3PE3A 3BG1B 4WWPA 3ZKJA 5KWDA 1L5JA 4LRZA 4AIFA 2IU1A 4GYWA 2VGEA 3QJZA 3FEXA 3PVLA 4B8CB 1WG0A 4GPMA 3PUJA 2EIME 2PM6A 3E32A 1HO8A 3HDXA 5LP0A 2MRIA 1UJJA 4JZYA 5J90A 4EZJA 4I43A 3LKUA 4G2VA 2BUGA 1PAQA 2WXIA 3OTNA 2FEZA 1SA5A 2XS1A 4JHRA 2RFMA 2OEVA 4AP2A 5CRVA 1NL4A 4PH4B 3HXEA 5BPPA 3O48A 1K8KG 3FH5A 1MX6A 3RRNB 4HQDA 3UPVA 3FP3A 5CHEE 1TNYA 2WQ6A 3Q49B 2Y4UA 2VTBB 4N5QA 4GZDA 4J8YA 4DX5D 2GRNB 3FH7A 4XZ4A 3FTWA 3APCA 3LPZA 2P2CP 1BU9A 5BV1A 1AP7A 2J9QA 4YDWA 3DSTA 5CCMA 4O60A 5CBOA 1SW6A 1MHQA 4B8AA 3QC1A 5FTPA 3HVEB 3HXBA 4UWGA 3PS6A 4KT6B 4TRQA 3AU4A 4ILGA 3NQPA 4GA1A 1IHGA 3CK8A 2WMNA 1FT1A 4G23A 5CEDB 1NP7A 3L6AA 4K5CA 2R03A 1H2UA 4KXKB
chains in the Genus database with same CATH topology
4DK5A 2VQ2A 5ARGA 1IQRA 3GYZA 3CVVA 1DVPA 3CHOA 3KEZA 3IHVA 2WVIA 4AEZC 5FZQA 3FTZA 2PQNA 3CVLA 3FU6A 3PDNA 2YINA 5G2NA 4Q69A 2A4ZA 1ELWA 1E8XA 1ZBPA 2CFUA 3CGHA 4OVUA 5DIZA 1PC2A 1UN9A 3EDTB 3LVRE 1N54A 3LXUX 4FJYA 2IJGX 4K0RA 3ESLA 3CQGB 5AYWD 3PH0C 3KS2A 3RIBA 3CVPA 3ZYLA 4OYSA 2WXHA 2DIWA 3PEVB 1YA0A 4V3IA 4J0UA 4RVBA 3B7TA 1WAO1 3QWWA 3IV0A 4MKTA 3U4TA 4ATGA 3T5VA 3FUJA 4JPSA 2I1JA 3BEEA 2LSVA 4GZ5A 2P58C 2YQ8A 3T8MA 3PUKA 4B89A 3GW4A 3KAEA 3U64A 2J09A 4N39A 4GMJA 4GCNA 4IN3B 4HOQA 4ILHB 2IQCA 5BT1A 1H2TC 3ZYMA 5FZRA 4CT0A 4AY6A 1VDYA 2HO1A 4LEUA 4BT8A 4DLQA 3FH8A 5CCLA 5EDSA 4EECA 4L7TA 3HIZA 2X6HA 5FQ4A 4KZCA 4KVMA 1HX8A 4K03A 4J8EA 4HOUA 3CVWA 3TG4A 2KCKA 3RRUA 4WWNA 4L2YA 2E2EA 2WXJA 2XGSA 4HOSA 2CHZA 3QK0A 3ZPJA 4CDMA 3AS5A 2WXNA 3ASHA 3G2VA 4YNDA 3ONLA 3SZ7A 1TEZA 4JEHA 3ULQA 4YVOA 3QOUA 5D0OD 4FLBA 4L2LA 3FY4A 3DPDA 1UW4B 4O6FA 4CEMA 2V5FA 3I3NA 3UX4A 4JEUA 4HORA 3MKQB 4KZ0A 1INZA 1XNFA 3QWPA 4IRUA 4C9BB 1IQUA 4J8DA 4U04A 4DJAA 5JJ6A 5T3RA 2ZU6B 3PE4A 3LY8A 1UG3A 4A1SA 3C98A 2OVBA 4I6EA 4KYOB 2WXPA 4MRUA 4DI4A 4EBAA 1UN8A 2AVPA 5AJLA 4GZCA 5FQ7A 4CCAA 4L23A 3L16A 1Z3XA 2J4BA 4PDXA 3IBEA 3CR3A 3FUIA 1HE8A 3L13A 5ANRA 3LS8A 4JA7A 4GZ6A 4FC8A 3UQ3A 2V8SE 4APOA 3IEGA 3K9IA 1E96B 1ZU2A 1OWNA 3JYSA 4XIFA 3D9KA 4I6GA 2Q7FA 3CVYA 5FJYA 3FU0A 2J07A 5T8IA 3JUIA 4FU3A 4A55A 2WPVA 4EZLA 4JHKA 3ZW3A 2WXRA 3MJWA 4CDRA 2I9CA 4U0ZA 5KJLA 2XRZA 1HG2A 4EQFA 4FA6A 5FQ6A 1QZ2A 3RO3A 1E7VA 3U9WA 1BPOA 4ACLA 2X6JA 2WM9A 4G25A 4ME2A 3P1UA 3FEYA 2VSYA 4XI0A 4LERA 4RG9A 3Q5MA 1OWMA 3QAQA 4AV7A 1ELRA 2PL2A 2JLBA 3FU5A 2J08A 4KVOA 4U07A 2IONA 4AY5A 3ZN3A 3QKYA 5A23A 3AS4A 3PRZA 4AVXA 4G26A 2PZIA 2VGYA 5BV0A 3ENEA 4WNDA 3SNXA 2XGOA 4HXIA 2XCCA 3MA5A 2R17C 3ML9A 3I4RB 4GA0A 2L0IA 4GYYA 4I1OB 4WNGA 3S7JA 2EQXA 5JHBA 2DCPA 5G05J 4FULA 4NACA 3MKQA 4PS7A 3FFLA 4KMOA 5J08A 3VLDA 5A7DB 5BNWA 4J6IA 1HU3A 2ONDA 2VYIA 3ZRHA 1H0AA 3JCKC 1OUVA 4LUNU 2X6KA 3L17A 2LSUA 3UT7A 2LAIA 3GZ1A 4UI9K 4LCTA 2GRLA 1OWOA 4UWLA 3VTYA 1FVFA 1Z6TA 1N52A 5HI7A 3CVXA 3CVUA 3L08A 2DBAA 2RG8A 5G05C 2I2OA 2UY1A 3MZLB 3SI5A 5AJDA 3HHMA 3ASGA 2L9BA 2I6HA 1NZNA 3FTUA 3MV3B 5C2YA 2WQ7A 1KT0A 4AOFA 1UJKA 4WUYA 2FF4A 3FUKA 2HYZA 5EKQD 4I9CA 1X5BA 2NC9A 4BT9A 3LYAA 1EPUA 3G2TA 4XKBA 5FWQA 3ESKA 4JXTA 4N5CA 1DNPA 4GPKA 3RRMB 2WXGA 4UI9J 3HVEA 2KCVA 3ONKA 2VSNA 1P5QA 4NQ0A 4PUCA 5T4YA 3VTXA 2Y4TA 4GYOA 4JA9A 1JPLA 3D9LA 5DBKA 2WXMA 5JHAA 3FTSA 1H19A 1OWPA 4APFA 3U66A 3ZFWA 3R7RA 3D9OA 4ILIA 3RKVA 4E85A 3GZSA 3MEKA 3S2AA 5FQ8A 2C0MA 4AM9A 4ANXA 1IYGA 1QNFA 3CHQA 2WXKA 3VLEA 2AW6A 3CSFA 1QQEA 3LY7A 4WNEA 3LJ3A 3TXMA 4I9EA 4URKA 3QB2A 3PNLB 2AWIA 5LCWJ 3SFZA 4XE0A 1HXIA 4G24A 2XQ0A 4IYPA 2OVFA 2YHEA 3CIAA 3D9PA 3MX3A 3FUNA 3FTVA 5G55A 4B0ZA 3CK7A 3TJPA 4YVQC 2QY7A 5EX3A 2XGMA 2WXFA 3G2SA 3UT4A 1U3CA 4F7AA 2V4LA 3SBTB 3E4BA 1SZAA 2L0TB 4EBAG 3OXLA 2M63A 1OWLA 4UWFA 2IOSA 4N2QA 4Q96A 2Y3AA 2YNQA 3VLFA 3SD5A 3Q15A 4GAAA 3QWVA 4C0MA 2X3MA 3IKOB 4BX8A 3D9NA 4HFGA 4A1GA 3FTYA 1E8ZA 2A5UA 3B7RL 2PM7A 3B7UX 3B7SA 4EPZA 4D10C 4BTBA 4HVBA 4Y6WA 4C0EA 4CT4A 3CVNA 4A3TA 2I1KA 3FUEA 3JQ0A 5AENA 3RJVA 1NA0A 4N3AA 3R7QA 1SQMA 3CHPA 3O4ZA 3ZIMA 4WNFA 3UUXA 3LY9A 3LEWA 3KD7A 3CK9A 4BFRA 5FZSA 2WXLA 2MOWA 2WXQA 4L1BA 4F1SA 4AJWA 4GCOA 2AXZA 2FI7A 3FUDA 4FLHA 3I4GA 3ZEFA 4PS3A 2OV8A 1S0PA 4JL0A 3RO2A 4N3CA 4R7LA 2BF0X 2X38A 3OXFA 4FJZA 3ZXSA 5ANLA 1TJCA 3SBSA 5M72A 3SHFA 2WQHA 2LAHA 3FUMA 3CQCB 4FP7A 1JUQA 4JVSA 2WMOA 4NRHB 4PS8A 3Q4AB 1HG5A 5JJ7A 3PNTB 1FCHA 1U3DA 1SZ9A 2GW1A 3BG0B 2XRYA 4GMLA 1H2VC 2AXVA 1WY6A 3FU3A 3TXNA 4GB9A 3AS8A 3TL5A 3MV2B 2C2LA 4H7YA 4U63A 4RSYA 3NZUA 4P29A 2V0PA 5ENNA 3EIJA 3FUFA 2CHXA 4ANVA 2JEKA 2LO6A 1A17A 3CLJA 4CDNA 4KBQA 4U8HA 4FHKA 3EHNA 5AIJA 4GZ3A 3D3MA 3QNKA 3FDHA 3RK6A 4GA2A 4UQZA 1HS6A 2X6FA 2NSZA 4I6JA 4XKCA 2R59A 5D0QD 3ML8A 5KCMA 2XPYA 4FHJA 4BX9A 4HS2A 5E76A 4BWRA 3CHMA 3FWVA 4G1TA 5CMYA 1Y6IA 2YHCA 4GU5A 2AXUA 3UMVA 1LF8A 3CHSA 3CKBA 4WAFA 3PZDA 1PY1A 3P2BA 5LOZA 1E7UA 3HYMB 4XI9A 1H6KA 3PE3A 4J8SA 2CHWA 3BG1B 4WWPA 3S7BA 1EYHA 3CEQA 3CSTA 3L22A 3URZA 1L5JA 3NZSA 4LRZA 4TUUA 5HQ8A 5BUZA 2XPZA 2OOEA 4AIFA 4AXHA 2IU1A 4GYWA 3EJNA 1EF1C 2KCLA 2XPIA 4J8FA 4EZKA 3SF4A 3QJZA 3GZ2A 4BTAA 3CVQA 3FEXA 3PVLA 4B8CB 3UT8A 2CG3A 5E75A 4Q94A 5KJNA 2BTDA 3PUJA 4JC8A 5ARFA 3TG5A 4B94A 2PM6A 1HFAA 2XHEA 4JW1A 3LCAA 4U0SA 4UI9C 1E90A 1HO8A 2CFZA 3B13A 3HDXA 4I2WA 5BW8C 5LP0A 2KATA 4UQXA 2MRIA 1UJJA 3MCXA 4JZYA 5J90A 3D9MA 3G2WA 4M3OA 3I5PA 1KT1A 4I1MA 4EZJA 4I43A 3LKUA 2KZTB 4G2VA 3R9AB 3EIQC 2BUGA 1PAQA 2WXIA 3OTNA 2FEZA 4JHRA 4MLPA 4A3VA 4HOTA 4OVVA 4HLEA 4UWKA 4ANWA 1TJFA 5KJMA 4AP2A 2L6JA 3APFA 2QFCA 3SGHA 4PH4B 2J4DA 3D9JA 3FULA 4N3BA 3AU5A 5BPPA 5LCWC 5KJKA 4G11A 3O48A 5LX8A 2C0LA 3ZHEB 4ACKA 4DI3A 4DPRA 4BY6A 3TGOA 5C1DA 3FH5A 1HF8A 2MHKA 4CGWA 2IFUA 2NXPA 2FO7A 2VSOE 3RRNB 2X6IA 3UPVA 3FP3A 4XX5A 3S7DA 5CHEE 4E6HA 5A6CA 4Y6CA 4U0UA 2E0IA 2IOLA 4NURA 5G04J 2WQ6A 3Q49B 2Y4UA 4MS6A 5FT9A 2VTBB 2WXOA 3G2UA 4JHJA 3TAXA 2VGXB 4H7XA 3IHYA 3ZYQA 5LFAA 4GZDA 4UWHA 1W3BA 2FULA 1HZ4A 3ASFA 4UQYA 3PREA 4I1AA 3FH7A 2KM4A 4XZ4A 3OXGA 5EX0A 3FTWA 2GGFA 4FADA 4CRWA 4CGVA 5G04C 2ILRA 3CV0A 5JJTA 3APCA 1KLXA 3LPZA 3LDZA 2UY1B 2IF4A 3T5XA 3MYVA 5BV1A 3ZVVA 2J9QA 3Q47B 3N71A 4F3VA 5CCMA 1NA3A 2WB2A 2LNIA 4B8AA 1MHQA 2KZTA 1E8WA 2PQRA 4ABNA 4BSXA 5CMWA 4IULA 4I2ZA 3QC1A 3CKCA 3NF1A 5FTPA 3APDA 3HVEB 4F53A 4UWGA 3PS6A 4KT6B 2CG2A 2FBNA 2RD0A 3ZYKA 1MQSA 3EHMA 2VJ8A 1FVHA 1EDUA 3DBSA 3ASDA 3FHEA 4QFVA 4TRQA 3AU4A 3RU0A 3D9IA 3MKRA 3ZHEA 4DLOA 4ILGA 4WWOA 3FTXA 4N2SA 2VSXE 3S7FA 3NQPA 1HH8A 2HM8A 3ZGQA 3JQ1A 1ELKA 4TV3A 4GA1A 1IHGA 2XCBA 3CK8A 1JWGA 1JWFA 2KC7A 3LVQE 4RG6A 2GRMA 3QARA 1GW6A 2WMNA 1E8YA 2J49A 1WM5A 4W9RA 3U3WA 3CHRA 4G23A 3FUHA 3L54A 3MGBA 1NP7A 3L6AA 3QDNA 4I17A 2UWJG 4ANUA 1XGWA 2HR2A 3WXXA 2VTBA 2R5SA 1Y8MA 2XEVA 3OAWA 1B89A 3PEUB 1Z3YA 1H2UA 2VGXA 4KXKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQ2 A;  5ARG A;  3GYZ A;  5FZQ A;  2PQN A;  3CVL A;  2VGX A;  3PDN A;  1ELW A;  1ZBP A;  5DIZ A;  1PC2 A;  3EDT B;  5AYW D;  3KS2 A;  3RIB A;  3CVP A;  1YA0 A;  4J0U A;  1WAO 1;  3QWW A;  3U4T A;  3BEE A;  2LSV A;  4GZ5 A;  2P58 C;  2YQ8 A;  3GW4 A;  3KAE A;  4N39 A;  4GCN A;  4IN3 B;  4HOQ A;  5BT1 A;  5FZR A;  4AY6 A;  2HO1 A;  4LEU A;  4BT8 A;  5CCL A;  4J8E A;  4HOU A;  3TG4 A;  2KCK A;  2E2E A;  4HOS A;  2XGS A;  3ZPJ A;  3AS5 A;  3ASH A;  4YND A;  3SZ7 A;  3ULQ A;  4YVO A;  3QOU A;  5D0O D;  4O6F A;  2V5F A;  4HOR A;  1XNF A;  3QWP A;  4J8D A;  4U04 A;  5JJ6 A;  3PE4 A;  3LY8 A;  4A1S A;  4KYO B;  2AVP A;  4JA7 A;  4GZ6 A;  3UQ3 A;  4APO A;  3IEG A;  3K9I A;  1E96 B;  1ZU2 A;  3JYS A;  4XIF A;  2Q7F A;  5FJY A;  2WPV A;  4CDR A;  4U0Z A;  5KJL A;  4EQF A;  1QZ2 A;  3RO3 A;  4ME2 A;  4G25 A;  2VSY A;  4XI0 A;  4RG9 A;  3Q5M A;  1ELR A;  2PL2 A;  2JLB A;  4U07 A;  4AY5 A;  3ZN3 A;  3QKY A;  3AS4 A;  4G26 A;  2PZI A;  2VGY A;  4WND A;  2XGO A;  2XCC A;  3MA5 A;  4GA0 A;  4GYY A;  3S7J A;  4WNG A;  5G05 J;  3FFL A;  5A7D B;  5BNW A;  2OND A;  2VYI A;  1OUV A;  2LSU A;  3GZ1 A;  4UI9 K;  3VTY A;  5HI7 A;  2DBA A;  5G05 C;  2UY1 A;  3ASG A;  2I6H A;  1NZN A;  3MV3 B;  1KT0 A;  4WUY A;  2FF4 A;  5EKQ D;  2HYZ A;  4I9C A;  2NC9 A;  4BT9 A;  3LYA A;  3ESK A;  4N5C A;  4GPK A;  4UI9 J;  2KCV A;  2VSN A;  1P5Q A;  4NQ0 A;  3VTX A;  2Y4T A;  4GYO A;  4JA9 A;  5DBK A;  3ZFW A;  3RKV A;  1IYG A;  2C0M A;  4AM9 A;  3LY7 A;  1QQE A;  4WNE A;  4I9E A;  5LCW J;  1HXI A;  4G24 A;  3CK7 A;  4YVQ C;  5EX3 A;  2XGM A;  3E4B A;  3OXL A;  4N2Q A;  3Q15 A;  3QWV A;  4BTB A;  4Y6W A;  3CVN A;  3RJV A;  1NA0 A;  4N3A A;  4WNF A;  3UUX A;  3LY9 A;  3KD7 A;  3CK9 A;  5FZS A;  4GCO A;  2FI7 A;  4JL0 A;  3RO2 A;  4N3C A;  3OXF A;  1TJC A;  5M72 A;  2WQH A;  4NRH B;  3Q4A B;  5JJ7 A;  1FCH A;  2GW1 A;  3AS8 A;  3MV2 B;  2C2L A;  4H7Y A;  1A17 A;  4KBQ A;  4GZ3 A;  4GA2 A;  4UQZ A;  5D0Q D;  4BWR A;  3FWV A;  4G1T A;  2YHC A;  3CKB A;  3HYM B;  4XI9 A;  3PE3 A;  3S7B A;  3CEQ A;  5HQ8 A;  3URZ A;  2OOE A;  4AIF A;  4GYW A;  2KCL A;  2XPI A;  4J8F A;  3SF4 A;  3GZ2 A;  4BTA A;  3CVQ A;  5KJN A;  5ARF A;  4B94 A;  3TG5 A;  3LCA A;  4U0S A;  4UI9 C;  5BW8 C;  4I2W A;  2KAT A;  4UQX A;  1KT1 A;  3R9A B;  3LKU A;  4G2V A;  2BUG A;  2FEZ A;  4JHR A;  4HOT A;  5KJM A;  2L6J A;  2QFC A;  4N3B A;  5LCW C;  5KJK A;  3O48 A;  2C0L A;  3ZHE B;  3TGO A;  5C1D A;  4CGW A;  2MHK A;  2IFU A;  2FO7 A;  3UPV A;  3FP3 A;  3S7D A;  5CHE E;  5A6C A;  4Y6C A;  4U0U A;  5G04 J;  3Q49 B;  2Y4U A;  5FT9 A;  3TAX A;  2VGX B;  4H7X A;  1W3B A;  1HZ4 A;  3ASF A;  4UQY A;  4I1A A;  5EX0 A;  3OXG A;  4CGV A;  5G04 C;  3CV0 A;  5JJT A;  1KLX A;  3LPZ A;  2UY1 B;  2IF4 A;  2J9Q A;  3Q47 B;  3N71 A;  4F3V A;  5CCM A;  1NA3 A;  2LNI A;  4ABN A;  2PQR A;  4I2Z A;  3CKC A;  3NF1 A;  5FTP A;  2FBN A;  3RU0 A;  3ASD A;  3MKR A;  3ZHE A;  4N2S A;  3S7F A;  1HH8 A;  3ZGQ A;  4GA1 A;  1IHG A;  2XCB A;  3CK8 A;  4RG6 A;  2KC7 A;  4W9R A;  3U3W A;  1WM5 A;  4G23 A;  3QDN A;  4I17 A;  2UWJ G;  2HR2 A;  3WXX A;  2R5S A;  1Y8M A;  2XEV A;  1B89 A;  3MEK A;  4KXK B; 
#chains in the Genus database with same CATH topology
 4DK5 A;  1O5M A;  1IQR A;  3IHV A;  2WVI A;  4AEZ C;  3E37 A;  2PQN A;  3CVL A;  3FU6 A;  3ABK E;  3ZUV B;  2A4Z A;  1E8X A;  2CFU A;  3CGH A;  2QC9 A;  2IJG X;  3F6Q A;  4K0R A;  3HXF A;  3CQG B;  4OYS A;  5D66 A;  3KEA A;  4JPS A;  3BEE A;  2LSV A;  2P58 C;  2YQ8 A;  3PUK A;  3GW4 A;  3J5Q B;  4IN3 B;  3W9F A;  5ENT D;  1H2T C;  4CT0 A;  4DLQ A;  2ZIR A;  3HIZ A;  5FQ4 A;  4K03 A;  3RRU A;  4HOS A;  3ABL E;  3AS5 A;  4HI9 A;  3ASH A;  3G2V A;  3ONL A;  4GTR A;  3I3N A;  3QWP A;  4B93 B;  4C9B B;  4LNG A;  4C48 B;  4U04 A;  4DJA A;  5HS0 A;  3C98 A;  4I6E A;  3AAA C;  4MRU A;  4GZC A;  4CCA A;  1Z3X A;  4PDX A;  4GZ6 A;  4FC8 A;  3IEG A;  3K9I A;  3D9K A;  4I6G A;  5FJY A;  4A55 A;  4HRM B;  1HG2 A;  3V79 K;  4BES A;  1QZ2 A;  4ME2 A;  2P9U G;  3FEY A;  2VSY A;  4RG9 A;  3SFX A;  1ELR A;  4AVX A;  4G26 A;  1D8D A;  5BV0 A;  2XCC A;  3ML9 A;  2QYU A;  4FUL A;  4KMO A;  4GTM A;  3VLD A;  5BNW A;  1H0A A;  2X6K A;  1TR4 A;  2LAI A;  4UI9 K;  3CVX A;  5G05 C;  5CEC B;  2WQ7 A;  1UJK A;  2IEJ A;  3FUK A;  5EKQ D;  4I9C A;  3G2T A;  4N5C A;  1DNP A;  3TWT A;  3RRM B;  1TN6 A;  2WXG A;  2VSN A;  1P5Q A;  3VTX A;  4GYO A;  1OWP A;  1TNU A;  3ZFW A;  3R7R A;  4E85 A;  3UI2 A;  1MYO A;  3S2A A;  1IYG A;  4AM9 A;  3VLE A;  4U8Y D;  2PNN A;  3TXM A;  2EIJ E;  3PNL B;  5AQ7 A;  5LCW J;  2XQ0 A;  4BSZ B;  3UM0 A;  2OVF A;  3MX3 A;  3FUN A;  5AAR A;  4YVQ C;  2QY7 A;  2L0T B;  2AJA A;  4EHM A;  2IOS A;  1V55 E;  4Q96 A;  4GAA A;  3QWV A;  2X3M A;  2XEN A;  4U96 D;  4CT4 A;  3FUE A;  5AEN A;  3EUV A;  1NA0 A;  4N3A A;  3ZNG A;  4WNF A;  1LTX A;  2XZD G;  2AXZ A;  2FI7 A;  1A5E A;  4JL0 A;  2BF0 X;  3V30 A;  4TXR A;  5BXO A;  2XS8 A;  1JUQ A;  1FT2 A;  4DRX E;  4ATZ D;  1U3D A;  4NIK A;  2GW1 A;  2MYO A;  2JAB A;  4GML A;  3TXN A;  4GB9 A;  2IO2 C;  3MV2 B;  4BER A;  1NFI E;  4ANV A;  4CDN A;  2HE0 A;  4FHK A;  3HRA A;  4GZ3 A;  3QNK A;  4UQZ A;  2NSZ A;  4I6J A;  5ENP D;  5E76 A;  1DCQ A;  3CHM A;  3UMV A;  3DSV A;  3WG7 E;  3PZD A;  3P2B A;  2Y69 E;  3Q7A A;  3S7B A;  3CEQ A;  3L22 A;  3Q78 A;  3EJN A;  4EZK A;  3IXE A;  4BTA A;  4JB8 P;  2CG3 A;  5E75 A;  2R2L A;  2LXM A;  2BTD A;  1HFA A;  4UI9 C;  2V4H C;  2KAT A;  2F8X K;  3I5P A;  3R9A B;  2KZT B;  4U95 D;  4MLP A;  4OVV A;  2L6J A;  2QFC A;  2J4D A;  3Q9U C;  2ZGD A;  5LX8 A;  3ZHE B;  4ACK A;  3TGO A;  5C1D A;  1HF8 A;  2MHK A;  2IFU A;  2FO7 A;  2X6I A;  1DCE A;  5G04 J;  4MS6 A;  5FT9 A;  3UM2 A;  2BKG A;  3IHY A;  1QYM A;  3ZYQ A;  1W3B A;  1HZ4 A;  2F37 A;  4BET A;  3EU9 A;  3PRE A;  4FAD A;  2ETC A;  5JJT A;  2H6H A;  4GTO A;  3TWV A;  2WB2 A;  1NA3 A;  5B3S E;  1LD7 A;  1E8W A;  2PQR A;  3UKR G;  4I2Z A;  2J8S D;  3APD A;  3UXG A;  2P9L G;  1EDU A;  3ASD A;  3FHE A;  3D9I A;  3MKR A;  4DLO A;  3FTX A;  4M7C A;  5CRU A;  2VSX E;  3S7F A;  3JQ1 A;  4TV3 A;  3DEP A;  3LVQ E;  1JWF A;  3QAR A;  4W9R A;  1GW6 A;  1E8Y A;  3U3W A;  1WM5 A;  3FUH A;  3QDN A;  4ANU A;  2HR2 A;  2R5S A;  5AQB A;  2VGX A;  1RZ4 A;  1DVP A;  3CHO A;  1BD8 A;  5FZQ A;  3PDN A;  5G2N A;  2B0O E;  1PC2 A;  3PH0 C;  1BI7 B;  3Q9N C;  3ZYL A;  3CVP A;  1G3N B;  2DIW A;  5ENS D;  4V3I A;  4RVB A;  3B7T A;  3QWW A;  3FUJ A;  2I1J A;  4GZ5 A;  4B89 A;  1Q2Z A;  3J5P A;  4HOQ A;  5BT1 A;  3ZYM A;  4JD2 G;  1VDY A;  4LEU A;  5EDS A;  3FH8 A;  2KCK A;  4WWN A;  2WXJ A;  2GRP B;  2WXN A;  4YND A;  3SZ7 A;  1TEZ A;  3FY4 A;  5B1B E;  4O6F A;  2DYR E;  2V5F A;  3UX4 A;  4G8L A;  1D9S A;  1IQU A;  5T3R A;  3DWL G;  3LY8 A;  1UG3 A;  4HRN A;  2WXP A;  5AJL A;  3PZ3 A;  5FQ7 A;  4L23 A;  4O1P A;  3W9G A;  1HE8 A;  3L13 A;  3LS8 A;  4APO A;  4RQI A;  3NBN B;  2Q7F A;  1H6P A;  3FU0 A;  5T8I A;  1OCC E;  3ZW3 A;  2KXP C;  1E7V A;  4ACL A;  2X6J A;  2WM9 A;  1S70 B;  3P1U A;  4LER A;  2PL2 A;  2JLB A;  2R05 A;  3QKY A;  2XGO A;  3I4R B;  5H7P A;  5JHB A;  4WNG A;  4NAC A;  3MKQ A;  4PS7 A;  2Y0B G;  3FFL A;  5J08 A;  4L9P A;  1S64 A;  3PZ4 A;  1OUV A;  2LSU A;  3GZ1 A;  4DX7 D;  3B95 A;  3C3O A;  1OCR E;  2RG8 A;  2I2O A;  2UY1 A;  3MZL B;  4O1O A;  3ASG A;  2L9B A;  2QZA A;  1NZN A;  1BI8 B;  1KT0 A;  4AOF A;  2FF4 A;  2NC9 A;  1YMP A;  1EPU A;  2OEW A;  3ONK A;  5T4Y A;  1MX4 A;  2WXM A;  5JHA A;  1AWC B;  4APF A;  1H19 A;  3U66 A;  1MX2 A;  3JXI A;  3RKV A;  1QNF A;  3TWQ A;  3LY7 A;  2H6F A;  4WNE A;  3LJ3 A;  4I9E A;  1TNO A;  2AWI A;  3NB2 A;  4G24 A;  3CIA A;  4GTQ A;  4ZHB A;  3AG3 E;  3TJP A;  5EX3 A;  2XGM A;  2WXF A;  3V2X A;  5D2M C;  3TWU A;  1BLX B;  4EBA G;  2BED A;  4UWF A;  2P9K G;  5AQA A;  1N4P A;  3SD5 A;  3ASO E;  3IKO B;  4A1G A;  2A5U A;  4EPZ A;  4D10 C;  4HVB A;  4Y6W A;  4C0E A;  4A3T A;  1SQM A;  3C3Q A;  3LY9 A;  3LEW A;  3CK9 A;  4BFR A;  5FZS A;  2MOW A;  4L1B A;  4GCO A;  3ZEF A;  2OV8 A;  1S0P A;  3ZXS A;  5ANL A;  3SBS A;  5BXU A;  3FUM A;  1K3Z D;  2WMO A;  4PS8 A;  3Q4A B;  1O1S A;  5AAO A;  1FCH A;  2XEH A;  2ETA A;  3ASN E;  5CER B;  1WY6 A;  3FU3 A;  3AS8 A;  4H7Y A;  5ENN A;  4HB5 A;  4DX2 A;  2EIN E;  3NOG D;  2JEK A;  3CLJ A;  5IY5 E;  4KBQ A;  5ENQ D;  3EHN A;  4K5B A;  5AIJ A;  1WDY A;  2IO3 C;  3RK6 A;  2X6F A;  5B1A E;  1IXV A;  3UM3 A;  2P9S G;  1OT8 A;  1Y6I A;  4GU5 A;  1PY1 A;  3Q73 A;  5LOZ A;  1H6K A;  2CHW A;  4OAV B;  1EYH A;  5HQ8 A;  3URZ A;  3NZS A;  2OOE A;  1EF1 C;  4J8F A;  3GZ2 A;  3CVQ A;  1ZB1 A;  4GTV A;  4Q94 A;  4JC8 A;  3DRA A;  2F0Y A;  2XHE A;  4JW1 A;  3LCA A;  4U0S A;  2CFZ A;  3B13 A;  5BW8 C;  4UQX A;  4QQI A;  3D9M A;  4M3O A;  1KT1 A;  4MBG A;  1N4Q A;  4A3V A;  5ENR D;  4HOT A;  4ANW A;  1TJF A;  5KJM A;  3SGH A;  3D9J A;  3FUL A;  4N3B A;  5HKP A;  4YDY A;  1IKN D;  4ZFH A;  4DPR A;  3AG1 E;  4CGW A;  2NXP A;  4XX5 A;  3S7D A;  5KNG A;  5A6C A;  1SA4 A;  2IOL A;  4NUR A;  4U0U A;  3T9K A;  2WXO A;  2ZXW E;  2DZO A;  1TN8 A;  4UWH A;  2FUL A;  2DWZ A;  4OAU C;  5EX0 A;  1JCR A;  3OXG A;  2GGF A;  4LG6 A;  5G04 C;  2UY1 B;  3MYV A;  3N71 A;  1SVX A;  3HXD A;  4ABN A;  1DC2 A;  5CMW A;  3CKC A;  4F53 A;  1JCS A;  2CG2 A;  2BKK B;  2RD0 A;  3ZYK A;  3EHM A;  3DBS A;  3RU0 A;  5AQ9 A;  2XEE A;  3PZ1 A;  1ELK A;  2KC7 A;  2GRM A;  3L54 A;  4I17 A;  2VTB A;  2ZGG A;  2XEV A;  5EIB E;  1B89 A;  3PEU B;  1Z3Y A;  3MEK A;  5ARG A;  3KEZ A;  3BQO A;  2YIN A;  4OVU A;  2QYJ A;  3E34 A;  3LVR E;  4FJY A;  3LXU X;  1Z5S C;  3RIB A;  2WXH A;  3Q79 A;  1K1A A;  1TNZ A;  3IV0 A;  3U4T A;  3T5V A;  3T8M A;  3KAE A;  4N39 A;  3SO8 A;  3KSL A;  5FZR A;  4AY6 A;  2NYJ A;  4BT8 A;  5CCL A;  4K5A B;  1TNB A;  2X6H A;  4KZC A;  4KVM A;  4J8E A;  2XZT G;  3TG4 A;  1OY3 D;  2XGS A;  3ZPJ A;  4CDM A;  3KSQ A;  4JEH A;  3ULQ A;  4YVO A;  3QOU A;  4FLB A;  2LXL A;  4X8Q A;  1N0Q A;  1UW4 B;  4CEM A;  4HOR A;  4JEU A;  4KZ0 A;  1INZ A;  2IY0 C;  1V54 E;  1XNF A;  2EIK E;  4J8D A;  1OCZ E;  4A1S A;  2OVB A;  3D9H A;  3V31 A;  3L16 A;  3FUI A;  3UQ3 A;  4DX1 A;  3L82 A;  1E96 B;  1RW2 A;  3CVY A;  3ABM E;  4FU3 A;  2WPV A;  4JHK A;  2XRZ A;  4F6R D;  3Q7F A;  4U0Z A;  4EQF A;  4FA6 A;  3U9W A;  1BPO A;  4G25 A;  4XI0 A;  1OXJ A;  1IHB A;  1OWM A;  3QAQ A;  5KNH D;  4AV7 A;  4U07 A;  4AY5 A;  3ZN3 A;  3TWR A;  3PRZ A;  2VGY A;  3ULY A;  3ENE A;  3SNX A;  4GA0 A;  4HLE A;  4GYY A;  3S7J A;  4I1O B;  2EQX A;  4J6I A;  1HU3 A;  2OND A;  5ITZ F;  4U7E B;  3ZRH A;  4A63 B;  3V2O A;  5EIL A;  5EID A;  1QBQ A;  1S63 A;  4LCT A;  4UWL A;  3VTY A;  1Z6T A;  3CVU A;  2DBA A;  5AJD A;  3HHM A;  2I6H A;  2ETB A;  1OCO E;  3RAU A;  4BT9 A;  3LYA A;  5FWQ A;  3EU5 A;  4UI9 J;  1N9A A;  2KCV A;  4PUC A;  4RLY A;  2Y4T A;  3D9L A;  5DBK A;  3FTS A;  4ILI A;  3GZS A;  1N4S A;  2RKK A;  3CHQ A;  2WXK A;  2AW6 A;  1QQE A;  4DUI A;  3SFZ A;  2L6B A;  1HXI A;  3AG4 E;  3D9P A;  4B0Z A;  3PZ2 A;  5HRY A;  3UT4 A;  4F7A A;  2V4L A;  1SZA A;  4GTT A;  4N2Q A;  1KZO A;  2Y3A A;  2YNQ A;  3Q15 A;  4C0M A;  4HFG A;  3FTY A;  4HBD A;  3B7R L;  3B7S A;  4LNU D;  3JQ0 A;  3DEO A;  3CHP A;  4TXQ A;  4YDO A;  3ZIM A;  3KD7 A;  2DVW A;  1NI1 A;  2H6I A;  3I4G A;  3RO2 A;  4DX6 D;  4FJZ A;  3DPY A;  2OCC E;  2WQH A;  2LAH A;  4FP7 A;  4JVS A;  5EYP F;  3ZXP A;  3LJN A;  1HG5 A;  5JJ7 A;  3PNT B;  3BG0 B;  1H2V C;  1TYQ G;  3TWW A;  2C2L A;  4U63 A;  2V0P A;  3EIJ A;  2LO6 A;  1A17 A;  3D3M A;  3FDH A;  1O1T A;  3C3R A;  1HS6 A;  3HG0 D;  5D0Q D;  4J7W A;  5KCM A;  2XPY A;  4FHJ A;  4BX9 A;  5FIO A;  3ZU7 B;  4BWR A;  3SFY A;  4G1T A;  5CMY A;  1LF8 A;  1TN7 A;  1KPS B;  4WAF A;  3HYM B;  4XI9 A;  4J8S A;  3CST A;  4TUU A;  5AN8 A;  5BUZ A;  2XPZ A;  4AXH A;  3E33 A;  2P9I G;  2KCL A;  2XPI A;  3SF4 A;  3UT8 A;  5KJN A;  4TXP A;  5ARF A;  4B94 A;  3TG5 A;  1E90 A;  4I2W A;  2DZN A;  3MCX A;  2Y1L E;  3G2W A;  3DXM G;  4I1M A;  3EIQ C;  3DSX A;  3UKU G;  2B6C A;  3TWS A;  4UUC A;  4UWK A;  3APF A;  3AU5 A;  5LCW C;  5KJK A;  4G11 A;  2C0L A;  3BU8 A;  4BY6 A;  2VSO E;  4E6H A;  4Y6C A;  2E0I A;  3E30 A;  3G2U A;  4JHJ A;  3SQV A;  3TAX A;  3NAW A;  2VGX B;  4H7X A;  3EHQ A;  4G8K A;  5LFA A;  1X81 A;  2P9P G;  3ASF A;  4UQY A;  4I1A A;  2KM4 A;  4CRW A;  4CGV A;  2ILR A;  3CV0 A;  1KLX A;  3LDZ A;  2RFA A;  2IF4 A;  4TUM A;  3T5X A;  3ZVV A;  3Q47 B;  1JCQ A;  4F3V A;  1LD8 A;  2LNI A;  2KZT A;  4BSX A;  3L9T A;  3DSS A;  4IUL A;  3NF1 A;  1UOH A;  5CEA A;  3ULE G;  2FBN A;  1MQS A;  2VJ8 A;  1FVH A;  4QFV A;  3ZHE A;  4N2S A;  4WWO A;  1HH8 A;  2HM8 A;  3ZGQ A;  2XCB A;  4RG6 A;  1JWG A;  4DI3 A;  2J49 A;  3CHR A;  2A5E A;  3MGB A;  5ENO D;  2UWJ G;  4GTS A;  1XGW A;  3WXX A;  1Y8M A;  3OAW A;  2DYS E;  4IYP A;  2P9N G;  1U2V G;  2VQ2 A;  3GYZ A;  3CVV A;  3JXJ A;  1N11 A;  3FTZ A;  4Q69 A;  2EIL E;  1ELW A;  1ZBP A;  5DIZ A;  3EDT B;  1UN9 A;  3B7B A;  1N54 A;  3NOC D;  3ESL A;  5AYW D;  3KS2 A;  4HI8 A;  3PEV B;  1YA0 A;  4J0U A;  1N0R A;  1WAO 1;  3TWX A;  4MKT A;  4ATG A;  3R9M A;  3EHR A;  3U64 A;  2J09 A;  4GMJ A;  5JA4 D;  4GCN A;  4ILH B;  2IQC A;  2HO1 A;  4EEC A;  4L7T A;  1HX8 A;  4HOU A;  3CVW A;  2KBX A;  4L2Y A;  2E2E A;  2CHZ A;  3QK0 A;  3X2Q E;  3HXC A;  5D0O D;  4L2L A;  3DPD A;  3MKQ B;  4IRU A;  5JJ6 A;  3DSU A;  2ZU6 B;  3PE4 A;  4KYO B;  4EBA A;  4DI4 A;  1UN8 A;  2AVP A;  3AJI A;  2J4B A;  4CYM D;  1FPP A;  3CR3 A;  3IBE A;  5ANR A;  4JA7 A;  1K1B A;  2V8S E;  3UIO C;  1ZU2 A;  3JYS A;  1OWN A;  4XIF A;  1MJ0 A;  2J07 A;  3JUI A;  4EZL A;  4CDR A;  2V5Q C;  2WXR A;  3MJW A;  2I9C A;  5KJL A;  5FQ6 A;  4Z68 A;  3RO3 A;  1O1R A;  1KZP A;  5FIN A;  3Q5M A;  1D8E A;  4KVO A;  3FU5 A;  3C5R A;  2J08 A;  3ISM C;  3T8K A;  4LSZ E;  2ION A;  5A23 A;  3AS4 A;  2PZI A;  3UIN C;  1MZC A;  4WND A;  1H6O A;  4HXI A;  3MA5 A;  2R17 C;  2L0I A;  2DCP A;  5G05 J;  5A7D B;  1YYH A;  2VYI A;  3JCK C;  4LUN U;  3L17 A;  3UT7 A;  3UTM A;  2GRL A;  1OWO A;  4XEI G;  1FVF A;  1N52 A;  4HNA D;  5HI7 A;  3C72 A;  3L08 A;  2GRR B;  3SI5 A;  3FTU A;  2LUH A;  2R02 A;  2FO1 E;  3MV3 B;  5C2Y A;  4WUY A;  2HYZ A;  1X5B A;  4HLL A;  3RSE G;  4XKB A;  3ESK A;  4JXT A;  4GPK A;  3HVE A;  4GMR A;  4NQ0 A;  4GTP A;  4JA9 A;  1JPL A;  3D9O A;  5FQ8 A;  2C0M A;  4ANX A;  4F1P A;  3CSF A;  3SY2 A;  4URK A;  3QB2 A;  5KBA A;  4U8V D;  2H6G A;  4XE0 A;  2YHE A;  3FTV A;  5G55 A;  3CK7 A;  3G2S A;  1U3C A;  3SBT B;  3E4B A;  3OXL A;  2M63 A;  1OWL A;  3DSW A;  5EN5 D;  3VLF A;  1N4R A;  4BX8 A;  3D9N A;  1E8Z A;  4HRL A;  2PM7 A;  3B7U X;  4BTB A;  3UIP C;  3BUA A;  3CVN A;  2I1K A;  3AG2 E;  3RJV A;  4YDE A;  3R7Q A;  3O4Z A;  1YCS B;  3UUX A;  4CZ2 D;  2ZIS A;  2GRQ B;  2WXL A;  2WXQ A;  4F1S A;  4AJW A;  3FUD A;  4FLH A;  4LNB A;  4PS3 A;  4N3C A;  4R7L A;  2X38 A;  3OXF A;  1TJC A;  5M72 A;  3SHF A;  3CQC B;  3JUE A;  4NRH B;  3DXK G;  1SZ9 A;  3UM1 A;  2XRY A;  2AXV A;  3TL5 A;  4RSY A;  3NZU A;  4P29 A;  3FUF A;  1N94 A;  2CHX A;  5EYL A;  4U8H A;  2F8Y A;  4GA2 A;  4XKC A;  2R59 A;  3ML8 A;  4HS2 A;  1N95 A;  5JMN D;  2GRO B;  3FWV A;  4BEP A;  2YHC A;  2AXU A;  3CHS A;  3CKB A;  3Q75 A;  5CBN A;  1E7U A;  3PE3 A;  3BG1 B;  4WWP A;  3ZKJ A;  5KWD A;  1L5J A;  4LRZ A;  4AIF A;  2IU1 A;  4GYW A;  2VGE A;  3QJZ A;  3FEX A;  3PVL A;  4B8C B;  1WG0 A;  4GPM A;  3PUJ A;  2EIM E;  2PM6 A;  3E32 A;  1HO8 A;  3HDX A;  5LP0 A;  2MRI A;  1UJJ A;  4JZY A;  5J90 A;  4EZJ A;  4I43 A;  3LKU A;  4G2V A;  2BUG A;  1PAQ A;  2WXI A;  3OTN A;  2FEZ A;  1SA5 A;  2XS1 A;  4JHR A;  2RFM A;  2OEV A;  4AP2 A;  5CRV A;  1NL4 A;  4PH4 B;  3HXE A;  5BPP A;  3O48 A;  1K8K G;  3FH5 A;  1MX6 A;  3RRN B;  4HQD A;  3UPV A;  3FP3 A;  5CHE E;  1TNY A;  2WQ6 A;  3Q49 B;  2Y4U A;  2VTB B;  4N5Q A;  4GZD A;  4J8Y A;  4DX5 D;  2GRN B;  3FH7 A;  4XZ4 A;  3FTW A;  3APC A;  3LPZ A;  2P2C P;  1BU9 A;  5BV1 A;  1AP7 A;  2J9Q A;  4YDW A;  3DST A;  5CCM A;  4O60 A;  5CBO A;  1SW6 A;  1MHQ A;  4B8A A;  3QC1 A;  5FTP A;  3HVE B;  3HXB A;  4UWG A;  3PS6 A;  4KT6 B;  4TRQ A;  3AU4 A;  4ILG A;  3NQP A;  4GA1 A;  1IHG A;  3CK8 A;  2WMN A;  1FT1 A;  4G23 A;  5CED B;  1NP7 A;  3L6A A;  4K5C A;  2R03 A;  1H2U A;  4KXK B; 
#chains in the Genus database with same CATH homology
 4DK5 A;  2VQ2 A;  5ARG A;  1IQR A;  3GYZ A;  3CVV A;  1DVP A;  3CHO A;  3KEZ A;  3IHV A;  2WVI A;  4AEZ C;  5FZQ A;  3FTZ A;  2PQN A;  3CVL A;  3FU6 A;  3PDN A;  2YIN A;  5G2N A;  4Q69 A;  2A4Z A;  1ELW A;  1E8X A;  1ZBP A;  2CFU A;  3CGH A;  4OVU A;  5DIZ A;  1PC2 A;  1UN9 A;  3EDT B;  3LVR E;  1N54 A;  3LXU X;  4FJY A;  2IJG X;  4K0R A;  3ESL A;  3CQG B;  5AYW D;  3PH0 C;  3KS2 A;  3RIB A;  3CVP A;  3ZYL A;  4OYS A;  2WXH A;  2DIW A;  3PEV B;  1YA0 A;  4V3I A;  4J0U A;  4RVB A;  3B7T A;  1WAO 1;  3QWW A;  3IV0 A;  4MKT A;  3U4T A;  4ATG A;  3T5V A;  3FUJ A;  4JPS A;  2I1J A;  3BEE A;  2LSV A;  4GZ5 A;  2P58 C;  2YQ8 A;  3T8M A;  3PUK A;  4B89 A;  3GW4 A;  3KAE A;  3U64 A;  2J09 A;  4N39 A;  4GMJ A;  4GCN A;  4IN3 B;  4HOQ A;  4ILH B;  2IQC A;  5BT1 A;  1H2T C;  3ZYM A;  5FZR A;  4CT0 A;  4AY6 A;  1VDY A;  2HO1 A;  4LEU A;  4BT8 A;  4DLQ A;  3FH8 A;  5CCL A;  5EDS A;  4EEC A;  4L7T A;  3HIZ A;  2X6H A;  5FQ4 A;  4KZC A;  4KVM A;  1HX8 A;  4K03 A;  4J8E A;  4HOU A;  3CVW A;  3TG4 A;  2KCK A;  3RRU A;  4WWN A;  4L2Y A;  2E2E A;  2WXJ A;  2XGS A;  4HOS A;  2CHZ A;  3QK0 A;  3ZPJ A;  4CDM A;  3AS5 A;  2WXN A;  3ASH A;  3G2V A;  4YND A;  3ONL A;  3SZ7 A;  1TEZ A;  4JEH A;  3ULQ A;  4YVO A;  3QOU A;  5D0O D;  4FLB A;  4L2L A;  3FY4 A;  3DPD A;  1UW4 B;  4O6F A;  4CEM A;  2V5F A;  3I3N A;  3UX4 A;  4JEU A;  4HOR A;  3MKQ B;  4KZ0 A;  1INZ A;  1XNF A;  3QWP A;  4IRU A;  4C9B B;  1IQU A;  4J8D A;  4U04 A;  4DJA A;  5JJ6 A;  5T3R A;  2ZU6 B;  3PE4 A;  3LY8 A;  1UG3 A;  4A1S A;  3C98 A;  2OVB A;  4I6E A;  4KYO B;  2WXP A;  4MRU A;  4DI4 A;  4EBA A;  1UN8 A;  2AVP A;  5AJL A;  4GZC A;  5FQ7 A;  4CCA A;  4L23 A;  3L16 A;  1Z3X A;  2J4B A;  4PDX A;  3IBE A;  3CR3 A;  3FUI A;  1HE8 A;  3L13 A;  5ANR A;  3LS8 A;  4JA7 A;  4GZ6 A;  4FC8 A;  3UQ3 A;  2V8S E;  4APO A;  3IEG A;  3K9I A;  1E96 B;  1ZU2 A;  1OWN A;  3JYS A;  4XIF A;  3D9K A;  4I6G A;  2Q7F A;  3CVY A;  5FJY A;  3FU0 A;  2J07 A;  5T8I A;  3JUI A;  4FU3 A;  4A55 A;  2WPV A;  4EZL A;  4JHK A;  3ZW3 A;  2WXR A;  3MJW A;  4CDR A;  2I9C A;  4U0Z A;  5KJL A;  2XRZ A;  1HG2 A;  4EQF A;  4FA6 A;  5FQ6 A;  1QZ2 A;  3RO3 A;  1E7V A;  3U9W A;  1BPO A;  4ACL A;  2X6J A;  2WM9 A;  4G25 A;  4ME2 A;  3P1U A;  3FEY A;  2VSY A;  4XI0 A;  4LER A;  4RG9 A;  3Q5M A;  1OWM A;  3QAQ A;  4AV7 A;  1ELR A;  2PL2 A;  2JLB A;  3FU5 A;  2J08 A;  4KVO A;  4U07 A;  2ION A;  4AY5 A;  3ZN3 A;  3QKY A;  5A23 A;  3AS4 A;  3PRZ A;  4AVX A;  4G26 A;  2PZI A;  2VGY A;  5BV0 A;  3ENE A;  4WND A;  3SNX A;  2XGO A;  4HXI A;  2XCC A;  3MA5 A;  2R17 C;  3ML9 A;  3I4R B;  4GA0 A;  2L0I A;  4GYY A;  4I1O B;  4WNG A;  3S7J A;  2EQX A;  5JHB A;  2DCP A;  5G05 J;  4FUL A;  4NAC A;  3MKQ A;  4PS7 A;  3FFL A;  4KMO A;  5J08 A;  3VLD A;  5A7D B;  5BNW A;  4J6I A;  1HU3 A;  2OND A;  2VYI A;  3ZRH A;  1H0A A;  3JCK C;  1OUV A;  4LUN U;  2X6K A;  3L17 A;  2LSU A;  3UT7 A;  2LAI A;  3GZ1 A;  4UI9 K;  4LCT A;  2GRL A;  1OWO A;  4UWL A;  3VTY A;  1FVF A;  1Z6T A;  1N52 A;  5HI7 A;  3CVX A;  3CVU A;  3L08 A;  2DBA A;  2RG8 A;  5G05 C;  2I2O A;  2UY1 A;  3MZL B;  3SI5 A;  5AJD A;  3HHM A;  3ASG A;  2L9B A;  2I6H A;  1NZN A;  3FTU A;  3MV3 B;  5C2Y A;  2WQ7 A;  1KT0 A;  4AOF A;  1UJK A;  4WUY A;  2FF4 A;  3FUK A;  2HYZ A;  5EKQ D;  4I9C A;  1X5B A;  2NC9 A;  4BT9 A;  3LYA A;  1EPU A;  3G2T A;  4XKB A;  5FWQ A;  3ESK A;  4JXT A;  4N5C A;  1DNP A;  4GPK A;  3RRM B;  2WXG A;  4UI9 J;  3HVE A;  2KCV A;  3ONK A;  2VSN A;  1P5Q A;  4NQ0 A;  4PUC A;  5T4Y A;  3VTX A;  2Y4T A;  4GYO A;  4JA9 A;  1JPL A;  3D9L A;  5DBK A;  2WXM A;  5JHA A;  3FTS A;  1H19 A;  1OWP A;  4APF A;  3U66 A;  3ZFW A;  3R7R A;  3D9O A;  4ILI A;  3RKV A;  4E85 A;  3GZS A;  3MEK A;  3S2A A;  5FQ8 A;  2C0M A;  4AM9 A;  4ANX A;  1IYG A;  1QNF A;  3CHQ A;  2WXK A;  3VLE A;  2AW6 A;  3CSF A;  1QQE A;  3LY7 A;  4WNE A;  3LJ3 A;  3TXM A;  4I9E A;  4URK A;  3QB2 A;  3PNL B;  2AWI A;  5LCW J;  3SFZ A;  4XE0 A;  1HXI A;  4G24 A;  2XQ0 A;  4IYP A;  2OVF A;  2YHE A;  3CIA A;  3D9P A;  3MX3 A;  3FUN A;  3FTV A;  5G55 A;  4B0Z A;  3CK7 A;  3TJP A;  4YVQ C;  2QY7 A;  5EX3 A;  2XGM A;  2WXF A;  3G2S A;  3UT4 A;  1U3C A;  4F7A A;  2V4L A;  3SBT B;  3E4B A;  1SZA A;  2L0T B;  4EBA G;  3OXL A;  2M63 A;  1OWL A;  4UWF A;  2IOS A;  4N2Q A;  4Q96 A;  2Y3A A;  2YNQ A;  3VLF A;  3SD5 A;  3Q15 A;  4GAA A;  3QWV A;  4C0M A;  2X3M A;  3IKO B;  4BX8 A;  3D9N A;  4HFG A;  4A1G A;  3FTY A;  1E8Z A;  2A5U A;  3B7R L;  2PM7 A;  3B7U X;  3B7S A;  4EPZ A;  4D10 C;  4BTB A;  4HVB A;  4Y6W A;  4C0E A;  4CT4 A;  3CVN A;  4A3T A;  2I1K A;  3FUE A;  3JQ0 A;  5AEN A;  3RJV A;  1NA0 A;  4N3A A;  3R7Q A;  1SQM A;  3CHP A;  3O4Z A;  3ZIM A;  4WNF A;  3UUX A;  3LY9 A;  3LEW A;  3KD7 A;  3CK9 A;  4BFR A;  5FZS A;  2WXL A;  2MOW A;  2WXQ A;  4L1B A;  4F1S A;  4AJW A;  4GCO A;  2AXZ A;  2FI7 A;  3FUD A;  4FLH A;  3I4G A;  3ZEF A;  4PS3 A;  2OV8 A;  1S0P A;  4JL0 A;  3RO2 A;  4N3C A;  4R7L A;  2BF0 X;  2X38 A;  3OXF A;  4FJZ A;  3ZXS A;  5ANL A;  1TJC A;  3SBS A;  5M72 A;  3SHF A;  2WQH A;  2LAH A;  3FUM A;  3CQC B;  4FP7 A;  1JUQ A;  4JVS A;  2WMO A;  4NRH B;  4PS8 A;  3Q4A B;  1HG5 A;  5JJ7 A;  3PNT B;  1FCH A;  1U3D A;  1SZ9 A;  2GW1 A;  3BG0 B;  2XRY A;  4GML A;  1H2V C;  2AXV A;  1WY6 A;  3FU3 A;  3TXN A;  4GB9 A;  3AS8 A;  3TL5 A;  3MV2 B;  2C2L A;  4H7Y A;  4U63 A;  4RSY A;  3NZU A;  4P29 A;  2V0P A;  5ENN A;  3EIJ A;  3FUF A;  2CHX A;  4ANV A;  2JEK A;  2LO6 A;  1A17 A;  3CLJ A;  4CDN A;  4KBQ A;  4U8H A;  4FHK A;  3EHN A;  5AIJ A;  4GZ3 A;  3D3M A;  3QNK A;  3FDH A;  3RK6 A;  4GA2 A;  4UQZ A;  1HS6 A;  2X6F A;  2NSZ A;  4I6J A;  4XKC A;  2R59 A;  5D0Q D;  3ML8 A;  5KCM A;  2XPY A;  4FHJ A;  4BX9 A;  4HS2 A;  5E76 A;  4BWR A;  3CHM A;  3FWV A;  4G1T A;  5CMY A;  1Y6I A;  2YHC A;  4GU5 A;  2AXU A;  3UMV A;  1LF8 A;  3CHS A;  3CKB A;  4WAF A;  3PZD A;  1PY1 A;  3P2B A;  5LOZ A;  1E7U A;  3HYM B;  4XI9 A;  1H6K A;  3PE3 A;  4J8S A;  2CHW A;  3BG1 B;  4WWP A;  3S7B A;  1EYH A;  3CEQ A;  3CST A;  3L22 A;  3URZ A;  1L5J A;  3NZS A;  4LRZ A;  4TUU A;  5HQ8 A;  5BUZ A;  2XPZ A;  2OOE A;  4AIF A;  4AXH A;  2IU1 A;  4GYW A;  3EJN A;  1EF1 C;  2KCL A;  2XPI A;  4J8F A;  4EZK A;  3SF4 A;  3QJZ A;  3GZ2 A;  4BTA A;  3CVQ A;  3FEX A;  3PVL A;  4B8C B;  3UT8 A;  2CG3 A;  5E75 A;  4Q94 A;  5KJN A;  2BTD A;  3PUJ A;  4JC8 A;  5ARF A;  3TG5 A;  4B94 A;  2PM6 A;  1HFA A;  2XHE A;  4JW1 A;  3LCA A;  4U0S A;  4UI9 C;  1E90 A;  1HO8 A;  2CFZ A;  3B13 A;  3HDX A;  4I2W A;  5BW8 C;  5LP0 A;  2KAT A;  4UQX A;  2MRI A;  1UJJ A;  3MCX A;  4JZY A;  5J90 A;  3D9M A;  3G2W A;  4M3O A;  3I5P A;  1KT1 A;  4I1M A;  4EZJ A;  4I43 A;  3LKU A;  2KZT B;  4G2V A;  3R9A B;  3EIQ C;  2BUG A;  1PAQ A;  2WXI A;  3OTN A;  2FEZ A;  4JHR A;  4MLP A;  4A3V A;  4HOT A;  4OVV A;  4HLE A;  4UWK A;  4ANW A;  1TJF A;  5KJM A;  4AP2 A;  2L6J A;  3APF A;  2QFC A;  3SGH A;  4PH4 B;  2J4D A;  3D9J A;  3FUL A;  4N3B A;  3AU5 A;  5BPP A;  5LCW C;  5KJK A;  4G11 A;  3O48 A;  5LX8 A;  2C0L A;  3ZHE B;  4ACK A;  4DI3 A;  4DPR A;  4BY6 A;  3TGO A;  5C1D A;  3FH5 A;  1HF8 A;  2MHK A;  4CGW A;  2IFU A;  2NXP A;  2FO7 A;  2VSO E;  3RRN B;  2X6I A;  3UPV A;  3FP3 A;  4XX5 A;  3S7D A;  5CHE E;  4E6H A;  5A6C A;  4Y6C A;  4U0U A;  2E0I A;  2IOL A;  4NUR A;  5G04 J;  2WQ6 A;  3Q49 B;  2Y4U A;  4MS6 A;  5FT9 A;  2VTB B;  2WXO A;  3G2U A;  4JHJ A;  3TAX A;  2VGX B;  4H7X A;  3IHY A;  3ZYQ A;  5LFA A;  4GZD A;  4UWH A;  1W3B A;  2FUL A;  1HZ4 A;  3ASF A;  4UQY A;  3PRE A;  4I1A A;  3FH7 A;  2KM4 A;  4XZ4 A;  3OXG A;  5EX0 A;  3FTW A;  2GGF A;  4FAD A;  4CRW A;  4CGV A;  5G04 C;  2ILR A;  3CV0 A;  5JJT A;  3APC A;  1KLX A;  3LPZ A;  3LDZ A;  2UY1 B;  2IF4 A;  3T5X A;  3MYV A;  5BV1 A;  3ZVV A;  2J9Q A;  3Q47 B;  3N71 A;  4F3V A;  5CCM A;  1NA3 A;  2WB2 A;  2LNI A;  4B8A A;  1MHQ A;  2KZT A;  1E8W A;  2PQR A;  4ABN A;  4BSX A;  5CMW A;  4IUL A;  4I2Z A;  3QC1 A;  3CKC A;  3NF1 A;  5FTP A;  3APD A;  3HVE B;  4F53 A;  4UWG A;  3PS6 A;  4KT6 B;  2CG2 A;  2FBN A;  2RD0 A;  3ZYK A;  1MQS A;  3EHM A;  2VJ8 A;  1FVH A;  1EDU A;  3DBS A;  3ASD A;  3FHE A;  4QFV A;  4TRQ A;  3AU4 A;  3RU0 A;  3D9I A;  3MKR A;  3ZHE A;  4DLO A;  4ILG A;  4WWO A;  3FTX A;  4N2S A;  2VSX E;  3S7F A;  3NQP A;  1HH8 A;  2HM8 A;  3ZGQ A;  3JQ1 A;  1ELK A;  4TV3 A;  4GA1 A;  1IHG A;  2XCB A;  3CK8 A;  1JWG A;  1JWF A;  2KC7 A;  3LVQ E;  4RG6 A;  2GRM A;  3QAR A;  1GW6 A;  2WMN A;  1E8Y A;  2J49 A;  1WM5 A;  4W9R A;  3U3W A;  3CHR A;  4G23 A;  3FUH A;  3L54 A;  3MGB A;  1NP7 A;  3L6A A;  3QDN A;  4I17 A;  2UWJ G;  4ANU A;  1XGW A;  2HR2 A;  3WXX A;  2VTB A;  2R5S A;  1Y8M A;  2XEV A;  3OAW A;  1B89 A;  3PEU B;  1Z3Y A;  1H2U A;  2VGX A;  4KXK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...