1FCHA

Crystal structure of the pts1 complexed to the tpr region of human pex5
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
323
structure length
302
Chain Sequence
SATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
publication title Peroxisomal targeting signal-1 recognition by the TPR domains of human PEX5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 130
structure length 302
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fchA00
3PE4A 3LKUA 2VSYA 2YQ8A 3CVNA 3ASFA 4U0SA 3MKRA 2WQHA 1HXIA 3E4BA 4I1AA 5LCWC 1HZ4A 2XGSA 3ZPJA 4HORA 3LY7A 5EKQD 2Y4TA 2VGXA 1QQEA 2UWJG 2GW1A 2XCBA 4HOTA 4NRHB 4N5CA 3QWWA 4U07A 2KCKA 2XGOA 4G2VA 3ULQA 4N3AA 4GA1A 2XPIA 4GZ3A 3U3WA 5AYWD 4CGWA 4HOQA 5D0OD 1ZBPA 3OXLA 3SF4A 5G04J 2FO7A 3LCAA 4I9CA 3Q5MA 4H7XA 3UPVA 3S7DA 3ZHEB 3OXGA 3Q15A 3LY9A 4G26A 5CHEE 2XEVA 5JJ7A 3CK8A 5D0QD 4CDRA 4I17A 3RJVA 4GCOA 4GA0A 3CVLA 5CCMA 2Q7FA 2BUGA 3HYMB 4YVOA 1ELWA 2PL2A 5G05J 4WNGA 4JA9A 4JHRA 3FWVA 3AS8A 2HO1A 3S7FA 5JJ6A 1Y8MA 5G04C 4AIFA 3RU0A 5DIZA 3TG4A 2KC7A 2PZIA 2I6HA 4UQZA 2WPVA 3ASHA 4BWRA 3Q49B 4WNEA 4BT8A 5LCWJ 3S7JA 4W9RA 3TAXA 4GZ6A 1IHGA 4J0UA 3CK9A 4F3VA 4YNDA 3WXXA 3CVPA 2FF4A 4KXKB 4UQYA 4YVQC 5ARGA 4N3BA 3VTYA 5KJMA 3CKCA 2KCLA 4G25A 1FCHA 2UY1B 4GYWA 4XI0A 4B94A 2KCVA 2C0MA 3CV0A 5BNWA 3ASGA 3GZ2A 4GZ5A 4UI9K 5FZQA 1E96B 4RG6A 4BTBA 4G24A 3LYAA 3EDTB 3KS2A 4GA2A 5FT9A 5A7DB 5BT1A 4CGVA 4ME2A 4EQFA 4JL0A 3QWVA 5DBKA 3MEKA 2C0LA 4APOA 4N2SA 4O6FA 2C2LA 4GYYA 3K9IA 4Y6WA 4AY5A 2XGMA 4U0UA 4GPKA 1NA0A 4N39A 4NQ0A 2VGYA 3Q4AB 3GZ1A 1QZ2A 3O48A 2PQRA 4Y6CA 3OXFA 4XI9A 2R5SA 4UI9J 5M72A 2VQ2A 3ZFWA 4GYOA 3PE3A 4I9EA 4N2QA 2OOEA 1A17A 3FFLA 4WNFA 3RKVA 3CK7A 1KT1A 2IF4A 4I2ZA 2QFCA 3KD7A 3VTXA 3RO2A 1XNFA 1WAO1 3ZGQA 5KJLA 1KT0A 3QKYA 3ZHEA 4GCNA 1NA3A 1KLXA 4J8FA 5KJNA 2J9QA 4J8DA 5HI7A 4UI9C 3GW4A 2E2EA 1PC2A 2FI7A 2VGXB 1NZNA 2V5FA 3QOUA 3IEGA 5C1DA 2HR2A 2VYIA 3CEQA 3FP3A 4WUYA 5FZRA 2XCCA 5FZSA 2JLBA 3BEEA 2NC9A 3MV3B 1HH8A 3RO3A 3U4TA 2Y4UA 3R9AB 5HQ8A 4UQXA 3ZN3A 3RIBA 3ESKA 1ZU2A 4KBQA 4RG9A 3N71A 4BTAA 2VSNA 5CCLA 3TGOA 3S7BA 4HOSA 3CKBA 4H7YA 2KATA 3JYSA 2UY1A 5A6CA 5EX3A 4G23A 1P5QA 2LSUA 4A1SA 4U04A 2HYZA 2MHKA 1W3BA 2ONDA 2LSVA 3CVQA 2P58C 2PQNA 4HOUA 3URZA 5FTPA 3MV2B 4WNDA 2FBNA 2DBAA 4LEUA 2IFUA 3LPZA 1ELRA 1WM5A 3SZ7A 3QWPA 3TG5A 1TJCA 1B89A 2L6JA 1YA0A 3GYZA 3ASDA 4XIFA 4I2WA 4AY6A 4KYOB 5FJYA 4G1TA 4J8EA 5JJTA 5BW8C 3AS5A 2AVPA 4U0ZA 3QDNA 5KJKA 1IYGA 5ARFA 3AS4A 4ABNA 2YHCA 3MA5A 3LY8A 4N3CA 3PDNA 3Q47B 4JA7A 3UQ3A 4AM9A 1OUVA 5G05C 2FEZA 4IN3B 4BT9A 3NF1A 2LNIA 3KAEA 3UUXA 5EX0A
chains in the Genus database with same CATH superfamily
3ZIMA 4DI4A 2DWZA 3KEAA 3J5PA 4OAVB 4CRWA 3HDXA 4I1AA 1HZ4A 4JW1A 3CHMA 3LY7A 2OV8A 2Y4TA 1SQMA 2V5QC 1SZ9A 2UWJG 4NRHB 5B1AE 1EYHA 4ILIA 3TWQA 2XPIA 3ISMC 2B0OE 5AYWD 5D0OD 1ZBPA 3EHNA 1H2UA 4ATGA 4U96D 3KSQA 4I9CA 4H7XA 4DPRA 5BXUA 3ZKJA 3S7DA 4GTPA 3ZHEB 2PM6A 5CHEE 2XEVA 1BLXB 1HG5A 4CDRA 2XS8A 4GCOA 1TNBA 2BUGA 4B0ZA 1MX6A 2A5UA 1ELWA 3UT8A 4U95D 4HQDA 4GMRA 4LNUD 2XEEA 3QB2A 5G04C 2Y1LE 4K5BA 3SHFA 3B7BA 4LNGA 3ASOE 4HLLA 3SFZA 3JCKC 4BERA 4CDNA 2ILRA 3ASHA 1QYMA 3UKRG 4DK5A 3Q49B 2M63A 3CHOA 5EYPF 3TAXA 2DYSE 2P2CP 4GZ6A 2R02A 4J0UA 3CK9A 4RSYA 4PS8A 3PZDA 3WXXA 4CCAA 1JWGA 4IYPA 3FU5A 4LCTA 1ELKA 2LAIA 5KJMA 3QAQA 2LXLA 1N95A 1PY1A 4AVXA 3DPYA 3EUVA 2P9LG 2AXZA 2ETBA 4XI0A 3DSSA 2KCVA 5G55A 5BNWA 2XQ0A 4GZ5A 3T5XA 3ABLE 3R7RA 4UI9K 2P9IG 1HS6A 1E96B 1DNPA 3T8KA 4BTBA 5EYLA 3T5VA 5D66A 2OEWA 5H7PA 2Y3AA 1Z6TA 2VJ8A 2A5EA 5A7DB 5BT1A 4EQFA 1VDYA 4A3VA 2NSZA 3C5RA 1TR4A 5ENRD 3IBEA 4BSZB 3Q9NC 3FULA 5DBKA 2OCCE 3T9KA 2IU1A 3ZXSA 2F37A 4HB5A 3PZ3A 2OEVA 2C2LA 4GYYA 3K9IA 3EJNA 4MBGA 4AY5A 2XGMA 4U0UA 4O1PA 4GPKA 4N39A 3B7SA 2VGYA 4NQ0A 4FULA 2V4LA 3GZ1A 3C98A 1QZ2A 4XI9A 4RVBA 2VQ2A 2OVFA 2DYRE 3CK7A 1JCSA 5B1BE 5E76A 4GZDA 3RO2A 4ANVA 1WAO1 5KJLA 3CHSA 3QKYA 3OAWA 4IRUA 4CEMA 5CMYA 4UI9C 3GW4A 2E2EA 1LD8A 1JWFA 2VGXB 2JEKA 3TJPA 4O60A 3FEYA 5AQ7A 3HXEA 2QZAA 2VTBB 3FP3A 4GPMA 2F8YA 5FZRA 4KMOA 3Q79A 2QYJA 2ZISA 2XCCA 1NFIE 2WXFA 3B95A 2JLBA 3B7TA 1H2VC 4C0MA 4DX6D 2BEDA 3RRMB 3UT4A 1N4SA 5FIOA 1H2TC 3TWRA 3R9AB 2LAHA 5CEAA 2FULA 3ASNE 3ESKA 3FU3A 4E85A 4FJZA 3CHPA 2I9CA 4LERA 5HKPA 5EDSA 4DX5D 4LNBA 1A5EA 4HOSA 2GRNB 4G8LA 4R7LA 5LOZA 1LF8A 3HXBA 2L6BA 2UY1A 3UMVA 3Q73A 5BV1A 5J90A 4U8YD 4A1SA 3ZEFA 1MX4A 3TWSA 2HYZA 4L23A 1NL4A 3CVQA 2P58C 2L0TB 4HOUA 1BD8A 1DCQA 4DRXE 2FBNA 4NACA 2BTDA 2GRPB 3MCXA 4HNAD 3ZYLA 4UWFA 1NP7A 4FC8A 2L6JA 3SGHA 2A4ZA 1KZPA 4RLYA 1X5BA 2F8XK 3L6AA 3E37A 4KYOB 3D9JA 4G1TA 4HVBA 1OCCE 4N5QA 5AARA 1JUQA 4XKCA 1HU3A 2WXLA 5FQ8A 5J08A 4PH4B 3HIZA 2AVPA 5EIBE 3BUAA 2KXPC 5HRYA 5AQBA 1AP7A 2I1KA 3AAAC 1QNFA 3UQ3A 1OUVA 4DJAA 1IQUA 5BXOA 2FEZA 4I6EA 4XE0A 2CHXA 4IN3B 1HG2A 4J8YA 5B3SE 1EF1C 5FQ6A 3U66A 3PE4A 4B8CB 3LKUA 3HVEA 3CVNA 2XEHA 1H0AA 2LXMA 5D2MC 4TUUA 4UWKA 1D8EA 3IHYA 3DSUA 3E4BA 3ABME 2X6FA 4EZLA 5LCWC 4JHJA 3ZPJA 4WWNA 1TNYA 4X8QA 4ACLA 3E34A 3L54A 1YYHA 3QWWA 4U07A 3C3QA 2WMOA 3ULQA 2P9KG 1HFAA 2AJAA 5EN5D 3SQVA 4HOQA 3ZU7B 3OXLA 1UN8A 2DCPA 5C2YA 4MS6A 4HLEA 5G04J 3NBNB 4URKA 3L16A 5AQ9A 2DIWA 4GMJA 3EU9A 3LJNA 5HS0A 3UPVA 3Q9UC 3OXGA 3FUMA 3Q15A 4EBAA 4GTRA 5CRUA 3NAWA 2F0YA 4PDXA 5D0QD 1HX8A 3NZSA 1E8WA 3EIQC 3KSLA 4I17A 1KZOA 3ESLA 3DEPA 2J07A 3HYMB 4ANXA 4L2YA 4TUMA 4WNGA 3PUJA 3FWVA 3AS8A 5CECB 2WXIA 1INZA 5DIZA 3FU6A 4CYMD 3ULEG 4U8HA 2KC7A 2I6HA 2WMNA 3IV0A 3LEWA 4UQZA 3C72A 5FINA 2VSOE 4BT8A 3S7JA 2EINE 3UXGA 2CHZA 3L13A 4ATZD 1TN6A 4YNDA 4CT0A 3CVPA 2XRYA 2FO1E 4UWHA 2GROB 4ZHBA 1IHBA 3BQOA 1PAQA 3CVYA 2KCLA 3CV0A 3D9LA 3ASGA 4BSXA 4EPZA 3APFA 3PNTB 3TWVA 1MYOA 4FLHA 4RG6A 1DVPA 1OWPA 3MJWA 1SZAA 2CHWA 4G24A 5ANLA 2AWIA 2IONA 5E75A 1TNOA 3SY2A 2KBXA 4F53A 3ML9A 3DBSA 3KS2A 4GA2A 5FT9A 3SBTB 3CHQA 2GRQB 3DSTA 2ZU6B 3L22A 3FUHA 3MEKA 2C0LA 4K5CA 3U64A 4L2LA 4APOA 1E7VA 5CRVA 1RW2A 2EIME 2JABA 4Y6WA 5KNHD 1N11A 3PZ4A 2MRIA 4FHJA 1NA0A 3CQCB 3DSWA 3Q4AB 2PQRA 4JEUA 5JHBA 4UI9J 5M72A 3ZFWA 4G8KA 2AXVA 4I9EA 4N2QA 4GTQA 3UX4A 3ABKE 2CG2A 5AAOA 3TL5A 4WNFA 4I2ZA 3V79K 3KD7A 5CBOA 1Z5SC 4ILHB 2WVIA 3JQ1A 3NQPA 1KT0A 3ONKA 3ZHEA 5T3RA 1KLXA 3FEXA 2J9QA 4ANWA 1PC2A 2IOSA 3IEGA 3FUFA 3HXDA 3D9HA 5C1DA 2X6JA 3MGBA 3PNLB 3APCA 3CEQA 1OCZE 4Z68A 2WXKA 4ILGA 3ULYA 2NC9A 1E7UA 1HH8A 3U4TA 3QK0A 3TWUA 3GZSA 4K03A 4C9BB 2KZTB 4UQXA 3RAUA 3RK6A 4CT4A 5JHAA 3RIBA 1ZU2A 3JXJA 4KBQA 4RG9A 5CCLA 3S7BA 5T4YA 3CKBA 5LX8A 3JYSA 4FJYA 5A6CA 5EX3A 1P5QA 3QJZA 3DWLG 2MHKA 1Q2ZA 1UW4B 2ONDA 1TNUA 2LSVA 4KVMA 1QBQA 5LFAA 2HE0A 3SFXA 4EHMA 2DBAA 2IFUA 1N94A 1ELRA 1WM5A 2E0IA 3QWPA 1SW6A 2XS1A 3TWWA 4NURA 3ASDA 4DLQA 3MKQB 4I2WA 1DC2A 4AY6A 5BUZA 4FP7A 4J8EA 4GTTA 4XX5A 4UUCA 5JJTA 4UWGA 5JMND 1OWMA 3DPDA 3AG3E 3RRNB 1MQSA 4ANUA 5IY5E 4ABNA 3AS4A 2YHCA 4N3CA 3PDNA 2J4BA 4AM9A 5EILA 3V31A 4XZ4A 1Z3YA 3CIAA 3OTNA 4A3TA 2R59A 1HE8A 2IQCA 2V4HC 2VSYA 2YQ8A 4P29A 1YCSB 4DLOA 1S64A 2WQHA 5ENNA 1HXIA 2Y69E 3G2VA 4LG6A 5A23A 5EKQD 1H19A 2RKKA 5AENA 2ETCA 1OXJA 1OWNA 3NB2A 2VGXA 2J08A 3X2QE 2BKKB 2GW1A 4HOTA 3ZYQA 4U7EB 1SA4A 1O1TA 3FUDA 2VTBA 2KCKA 2XGOA 3E32A 4G2VA 3PH0C 1EPUA 3PS6A 5CEDB 4CGWA 1AWCB 3JUIA 3Q7FA 3FH7A 4J8SA 1TJFA 3JUEA 4WWOA 4FLBA 4AP2A 1S63A 3Q5MA 2H6IA 4BESA 3BG1B 3DXKG 5AN8A 4C0EA 4G26A 3UM1A 1N4RA 3CK8A 2LO6A 4GZCA 3I4RB 1FT2A 4U63A 3ENEA 4TXRA 1E90A 1UG3A 3CVLA 5CCMA 2Q7FA 5T8IA 3Q78A 4YVOA 2I2OA 2XHEA 2WB2A 2PL2A 5G05J 2IEJA 3MYVA 3ONLA 2HO1A 3S7FA 5JJ6A 3EIJA 3RU0A 3TG4A 2PZIA 2P9UG 5JA4D 4TV3A 2CG3A 1UJJA 5CBNA 1HF8A 2H6GA 3G2WA 1S70B 1IHGA 3AJIA 4EBAG 1WG0A 4F3VA 3D3MA 2RFMA 1EDUA 4OYSA 4UQYA 3FUIA 3E30A 3VTYA 4CZ2D 2XRZA 3NOCD 4AEZC 1OY3D 4HS2A 2P9NG 4G25A 4L9PA 2RG8A 2PM7A 4BETA 3WG7E 2DVWA 3FTSA 4B94A 1FT1A 2C0MA 4JVSA 2CFUA 4JHKA 3HXFA 4HI9A 2WXOA 4YDOA 1WDYA 3UKUG 1ZB1A 2EILE 4B89A 3EDTB 3FUJA 3HXCA 4Q69A 3PEVB 1K1BA 4GTVA 2WXJA 1U2VG 1H6PA 3D9PA 3I4GA 4JL0A 2WXPA 2YINA 4LUNU 4LRZA 4XKBA 1TYQG 4I6JA 2CFZA 3KEZA 4K5AB 2P9PG 3G2UA 3NZUA 3QNKA 2WXHA 3V2XA 2GRRB 2R17C 2DZNA 2IY0C 4DX2A 1MZCA 2R5SA 3ZUVB 4HXIA 1Y6IA 4HRLA 2OOEA 3PREA 4KZ0A 1K1AA 4G11A 3CSTA 3ZNGA 1YMPA 3D9IA 2WXQA 3RKVA 4I43A 4BFRA 2IF4A 4HBDA 2QFCA 1MX2A 4HRNA 3VTXA 2GRMA 1XNFA 1RZ4A 1TN8A 1BI7B 1NA3A 1UJKA 4DX7D 3B7RL 5HI7A 1K8KG 4FA6A 2V5FA 1N4PA 3L82A 3LDZA 3QOUA 4QQIA 1TNZA 2HR2A 2VYIA 1TEZA 1MJ0A 2X38A 4DUIA 1N0QA 2XPZA 1SVXA 3CGHA 3MV3B 1Z3XA 3I5PA 3RO3A 1U3DA 3SD5A 2ZGDA 4B8AA 2WQ6A 4PUCA 3PZ1A 2WM9A 3CVVA 4MKTA 3W9GA 1H6OA 5KWDA 3UIPC 4YDEA 2DZOA 4L7TA 3N71A 4PS3A 2VSNA 3CR3A 3UINC 1WY6A 3LXUX 3TGOA 3D9NA 3PRZA 1JCRA 3UM0A 4G23A 3IXEA 2EIJE 2LSUA 3U9WA 4U04A 4WAFA 2KM4A 1W3BA 5AQAA 2XPYA 3EHRA 4LSZE 2PQNA 5G2NA 2MOWA 3C3OA 3IKOB 3URZA 4MRUA 1N4QA 1H6KA 4LEUA 4U8VD 4A1GA 3LPZA 4KZCA 3I3NA 3T8MA 1G3NB 3V30A 4E6HA 3SZ7A 2WXRA 3SNXA 3TG5A 3MX3A 1B89A 2ETAA 1YA0A 4GMLA 3GYZA 3D9KA 4Q94A 5ANRA 2RD0A 3JXIA 1OT8A 3S2AA 3SO8A 4O1OA 5FJYA 4JPSA 4GTOA 4UWLA 1U3CA 2WXNA 1TN7A 5BW8C 1BPOA 4YDYA 4IULA 3CSFA 3LY8A 1HO8A 4I1OB 3V2OA 1LD7A 3Q47B 3D9MA 3FTVA 4D10C 4JEHA 4FU3A 1FVFA 1IXVA 4NIKA 3TWTA 2X3MA 2LNIA 2BKGA 2X6KA 5AIJA 3ZW3A 3ASFA 3ZXPA 4U0SA 3MKRA 2R05A 3BU8A 4HI8A 3HG0D 5ENTD 2XGSA 4HORA 4JZYA 3R9MA 4WWPA 2J4DA 3UM2A 3PEUB 1QQEA 3IHVA 3VLDA 3FTYA 2XCBA 3QC1A 4FADA 3DSVA 4N5CA 2Y0BG 4EZKA 3LJ3A 2L0IA 3FDHA 2YNQA 3CHRA 3LVRE 2WQ7A 4N3AA 4GA1A 3FTZA 5KNGA 3EU5A 1BI8B 4GZ3A 3U3WA 1OCOE 1E8YA 3SF4A 1X81A 2WXGA 4GB9A 2FO7A 4OVVA 3LCAA 1IQRA 4AJWA 1N52A 2EQXA 4F7AA 4MLPA 5ENOD 2KZTA 1O1SA 3FTUA 3LY9A 3BG0B 5AJDA 5JJ7A 2OVBA 4PS7A 2P9SG 3RJVA 3CVUA 4GA0A 1FPPA 5FWQA 1MHQA 3FTXA 5ENSD 3E33A 4AV7A 4B93B 4JA9A 4JHRA 1UN9A 4GU5A 1Y8MA 3F6QA 1DCEA 1V55E 3P1UA 4AIFA 2J09A 2MYOA 3UT7A 3UM3A 3G2SA 5EIDA 2B6CA 2QYUA 2WPVA 3TXNA 1O1RA 2GRLA 3P2BA 4TXQA 4BWRA 5LCWJ 4WNEA 4ACKA 4W9RA 4JC8A 3LVQE 4DI3A 2FF4A 4KXKB 4YVQC 5ARGA 4N3BA 4AOFA 4JD2G 4HFGA 3L17A 4RQIA 1K3ZD 3W9FA 3CKCA 1FCHA 2UY1B 4GYWA 4TXPA 3MKQA 3ML8A 3FH5A 3GZ2A 4A63B 5ITZF 2ZXWE 1O5MA 2NYJA 5FZQA 2X6HA 4GAAA 3JQ0A 4L1BA 3MZLB 2EIKE 1D9SA 4C48B 2HM8A 3Q75A 4F1SA 3LYAA 2ZGGA 4A55A 5CERB 1JPLA 1V54E 3J5QB 3O4ZA 5AJLA 4CGVA 1XGWA 4JXTA 4ME2A 4BX9A 3LS8A 1JCQA 3UI2A 4XEIG 3QWVA 3FY4A 5LP0A 2RFAA 4EZJA 1SA5A 3TWXA 2VGEA 3VLEA 4N2SA 2WXMA 2NXPA 4O6FA 3PUKA 4GTMA 3FUNA 3QARA 2YHEA 1L5JA 1OWOA 4QFVA 3VLFA 5CMWA 3FU0A 2H6HA 3O48A 4Y6CA 4M7CA 1BU9A 3OXFA 4Q96A 3UTMA 2J49A 1OCRE 3HRAA 4GYOA 3AG2E 3PE3A 4KT6B 1A17A 5FQ7A 2VSXE 4GTSA 4FHKA 3FFLA 1KT1A 3HVEB 4M3OA 3R7QA 4DX1A 4F6RD 3ZGQA 5FQ4A 4GCNA 2AW6A 2XZTG 2L9BA 1S0PA 3RSEG 3NOGD 4J8FA 5KJNA 4J8DA 1UOHA 4AXHA 2IO3C 2FI7A 4V3IA 1NZNA 2J8SD 5BV0A 4I1MA 3RRUA 3FTWA 4WUYA 4YDWA 5FZSA 5KCMA 3L9TA 3ZYKA 3BEEA 1KPSB 4OAUC 3ZYMA 1IKND 2V8SE 2Y4UA 3D9OA 1NI1A 5HQ8A 3ZN3A 2R2LA 3SI5A 2AXUA 3AG1E 2IJGX 5ENPD 4BTAA 3DRAA 3AG4E 2V0PA 3CLJA 1OWLA 3CVWA 3FH8A 1D8DA 3PVLA 5BPPA 4H7YA 2KATA 3UIOC 4CDMA 2XENA 3AU5A 4BX8A 2H6FA 5KBAA 4J7WA 4K0RA 3B13A 3B7UX 3FHEA 3ZRHA 4BY6A 3DSXA 2QC9A 3G2TA 3TXMA 2I1JA 3EHMA 3FUKA 3CQGB 5FTPA 3AU4A 3MV2B 4WNDA 2R03A 4EECA 3DEOA 3SFYA 1E8ZA 4HRMB 1GW6A 4F1PA 1TJCA 1E8XA 2PNNA 1FVHA 4I6GA 3CVXA 2LUHA 2XZDG 4XIFA 3SBSA 1N9AA 2X6IA 1LTXA 1N0RA 3APDA 4JB8P 4APFA 3ZVVA 2QY7A 3FUEA 4KVOA 4OVUA 3AS5A 4U0ZA 2IOLA 3QDNA 3C3RA 5KJKA 1IYGA 3DXMG 5ARFA 3PZ2A 1N54A 3MA5A 2ZIRA 4BEPA 3L08A 4JA7A 5ENQD 2IO2C 3EHQA 5G05C 3Q7AA 4ZFHA 4J6IA 2BF0X 4BT9A 3NF1A 3KAEA 4TRQA 3UUXA 3HHMA 2GGFA 5EX0A
chains in the Genus database with same CATH topology
2IQCA 3PE4A 3ZIMA 4B8CB 2X6KA 4DI4A 5AIJA 3LKUA 3ZW3A 3HVEA 2VSYA 2YQ8A 3CVNA 4P29A 3ASFA 1H0AA 4DLOA 4U0SA 3MKRA 2WQHA 4TUUA 4UWKA 5ENNA 3IHYA 1HXIA 4CRWA 3E4BA 3HDXA 3G2VA 4I1AA 2X6FA 4EZLA 5LCWC 1HZ4A 2XGSA 4JHJA 3ZPJA 4HORA 4JW1A 4JZYA 4WWNA 5A23A 3CHMA 3LY7A 2OV8A 4WWPA 5EKQD 1H19A 4ACLA 2J4DA 2Y4TA 5AENA 1SQMA 3L54A 1OWNA 2VGXA 3PEUB 1QQEA 3IHVA 3VLDA 1SZ9A 2J08A 2UWJG 3FTYA 2GW1A 2XCBA 3QC1A 4HOTA 3ZYQA 4NRHB 4FADA 4N5CA 3QWWA 4EZKA 3LJ3A 4U07A 1EYHA 2L0IA 3FDHA 2KCKA 3FUDA 2VTBA 2XGOA 2YNQA 3CHRA 4G2VA 4ILIA 3LVRE 2WMOA 2WQ7A 3ULQA 4N3AA 4GA1A 2XPIA 3FTZA 1HFAA 3PH0C 4GZ3A 1EPUA 3PS6A 3U3WA 5AYWD 4CGWA 4HOQA 5D0OD 1ZBPA 1E8YA 1UN8A 2DCPA 3OXLA 4MS6A 5C2YA 3SF4A 4HLEA 3JUIA 3EHNA 1H2UA 2WXGA 3FH7A 4GB9A 4J8SA 5G04J 2FO7A 4OVVA 3LCAA 3L16A 4URKA 1IQRA 4AJWA 4ATGA 1N52A 2EQXA 1TJFA 4F7AA 4MLPA 2DIWA 4WWOA 4GMJA 4FLBA 2KZTA 4AP2A 3FTUA 4I9CA 3Q5MA 4H7XA 4DPRA 3UPVA 5FQ6A 3S7DA 3BG1B 3ZHEB 3OXGA 3FUMA 3Q15A 3LY9A 4C0EA 4EBAA 2PM6A 4G26A 5CHEE 2XEVA 3BG0B 5AJDA 5JJ7A 2OVBA 1HG5A 3CK8A 4PDXA 5D0QD 2LO6A 1HX8A 4PS7A 4GZCA 3NZSA 4CDRA 1E8WA 3EIQC 3I4RB 4U63A 3ENEA 4I17A 3RJVA 3CVUA 4GCOA 4GA0A 3ESLA 1E90A 1UG3A 3CVLA 5CCMA 2J07A 2BUGA 2Q7FA 3HYMB 5FWQA 5T8IA 4B0ZA 1MHQA 4YVOA 2I2OA 2XHEA 2A5UA 3FTXA 4ANXA 1ELWA 2PL2A 4L2YA 4WNGA 5G05J 3UT8A 4AV7A 2WB2A 3PUJA 4JA9A 4JHRA 3FWVA 3AS8A 3MYVA 1UN9A 3ONLA 2HO1A 4GU5A 3S7FA 5JJ6A 1Y8MA 3QB2A 5G04C 2WXIA 3P1UA 1INZA 4AIFA 3EIJA 3RU0A 5DIZA 2J09A 3SHFA 3TG4A 3FU6A 4U8HA 2KC7A 3UT7A 2PZIA 3G2SA 4TV3A 2I6HA 3SFZA 2GGFA 3JCKC 2WMNA 3IV0A 2CG3A 3LEWA 4UQZA 1UJJA 4CDNA 2ILRA 2WPVA 3TXNA 3ASHA 2VSOE 4DK5A 2GRLA 3P2BA 4BWRA 3Q49B 4WNEA 4ACKA 4BT8A 2M63A 3CHOA 3S7JA 5LCWJ 1HF8A 4W9RA 4JC8A 3TAXA 4GZ6A 3G2WA 2CHZA 1IHGA 3L13A 4J0UA 3LVQE 3CK9A 4EBAG 4F3VA 3D3MA 4RSYA 4DI3A 4YNDA 4CT0A 4PS8A 3PZDA 3WXXA 1EDUA 3CVPA 2FF4A 2XRYA 4KXKB 4OYSA 4UQYA 4YVQC 4CCAA 3FUIA 4UWHA 1JWGA 5ARGA 4IYPA 3FU5A 4N3BA 4AOFA 3VTYA 4LCTA 1ELKA 2LAIA 4HFGA 3L17A 2XRZA 4AEZC 5KJMA 4HS2A 3QAQA 1PAQA 3CKCA 3CVYA 2KCLA 4G25A 1PY1A 1FCHA 2UY1B 4AVXA 4GYWA 2RG8A 2PM7A 3MKQA 3ML8A 2AXZA 3FTSA 4XI0A 4B94A 2KCVA 2C0MA 3CV0A 5G55A 4JVSA 2CFUA 5BNWA 4JHKA 2XQ0A 3D9LA 3FH5A 3ASGA 3GZ2A 4GZ5A 4BSXA 4EPZA 3T5XA 3R7RA 4UI9K 3APFA 1HS6A 5FZQA 3PNTB 2X6HA 2WXOA 1E96B 4GAAA 4FLHA 4RG6A 1DVPA 3JQ0A 1DNPA 4L1BA 3MZLB 1OWPA 3MJWA 1SZAA 4BTBA 3T5VA 2CHWA 4G24A 2HM8A 4F1SA 5ANLA 2AWIA 3LYAA 2IONA 2Y3AA 5E75A 4B89A 3EDTB 3FUJA 4A55A 1Z6TA 2VJ8A 4F53A 4Q69A 3ML9A 1JPLA 3PEVB 3O4ZA 5AJLA 3DBSA 3KS2A 4GA2A 5FT9A 5A7DB 5BT1A 2WXJA 3SBTB 1XGWA 4JXTA 4ME2A 4BX9A 4EQFA 4CGVA 3LS8A 3CHQA 4A3TA 1VDYA 4A3VA 2NSZA 3D9PA 3I4GA 3IBEA 4JL0A 3QWVA 3FY4A 2ZU6B 3FULA 5LP0A 2WXPA 3L22A 3FUHA 5DBKA 4EZJA 3MEKA 2C0LA 2YINA 2IU1A 3U64A 3ZXSA 3VLEA 4L2LA 4LUNU 4APOA 2WXMA 4LRZA 4N2SA 2NXPA 4O6FA 4XKBA 2C2LA 3PUKA 4I6JA 1E7VA 2CFZA 3K9IA 4GYYA 3KEZA 3FUNA 4Y6WA 4TRQA 3EJNA 4AY5A 3G2UA 3QARA 2YHEA 1L5JA 1OWOA 3NZUA 4QFVA 3QNKA 3VLFA 2XGMA 4U0UA 4GPKA 2WXHA 2MRIA 4FHJA 1NA0A 4N39A 5CMWA 2R17C 3B7SA 2VGYA 3FU0A 4NQ0A 3CQCB 4FULA 2V4LA 3Q4AB 3GZ1A 3C98A 1QZ2A 3O48A 2PQRA 4Y6CA 3OXFA 4Q96A 4XI9A 2R5SA 4JEUA 5JHBA 4UI9J 4RVBA 2J49A 5M72A 3U66A 2VQ2A 3ZFWA 4GYOA 2AXVA 3PE3A 4HXIA 4I9EA 1Y6IA 2OVFA 4N2QA 2OOEA 3PREA 4KZ0A 4KT6B 1A17A 3UX4A 4G11A 5FQ7A 3CSTA 2VSXE 2CG2A 4FHKA 1HE8A 3D9IA 3FFLA 2WXQA 3TL5A 4WNFA 3RKVA 3CK7A 4I43A 1KT1A 4BFRA 3HVEB 2IF4A 4I2ZA 5E76A 4M3OA 3R7QA 2QFCA 3KD7A 3VTXA 4ILHB 2WVIA 4GZDA 3RO2A 3JQ1A 2GRMA 1XNFA 4ANVA 1WAO1 3ZGQA 5KJLA 3NQPA 1KT0A 3ONKA 3CHSA 3QKYA 5FQ4A 3ZHEA 4GCNA 2AW6A 1NA3A 3OAWA 1KLXA 2L9BA 4IRUA 5T3RA 1S0PA 1UJKA 4CEMA 3FEXA 4J8FA 5KJNA 2J9QA 4J8DA 5CMYA 4ANWA 3B7RL 5HI7A 4UI9C 3GW4A 4FA6A 2E2EA 4AXHA 1JWFA 1PC2A 2FI7A 2IOSA 2VGXB 2JEKA 1NZNA 2V5FA 4V3IA 3LDZA 3TJPA 3QOUA 3IEGA 3FUFA 3FEYA 5BV0A 4I1MA 2X6JA 3RRUA 2HR2A 5C1DA 3MGBA 2VYIA 2VTBB 3FTWA 3PNLB 3APCA 1TEZA 3CEQA 3FP3A 2X38A 4WUYA 5FZRA 4KMOA 2XCCA 5FZSA 2WXKA 2WXFA 5KCMA 4ILGA 2JLBA 3ZYKA 3BEEA 2XPZA 3B7TA 1H2VC 4C0MA 2NC9A 3RRMB 3UT4A 3CGHA 3MV3B 1E7UA 3ZYMA 2V8SE 1Z3XA 3I5PA 1HH8A 3RO3A 3U4TA 2Y4UA 1H2TC 1U3DA 3SD5A 3QK0A 4B8AA 3GZSA 4K03A 2WQ6A 4PUCA 2WM9A 3CVVA 4C9BB 3D9OA 3R9AB 4MKTA 5HQ8A 2LAHA 2KZTB 4UQXA 3RK6A 3ZN3A 4CT4A 2FULA 5JHAA 3RIBA 4E85A 3ESKA 3FU3A 1ZU2A 2AXUA 3SI5A 2IJGX 4L7TA 4KBQA 4FJZA 4RG9A 3N71A 4PS3A 4BTAA 3CHPA 2I9CA 2VSNA 3CR3A 1WY6A 5CCLA 2V0PA 3CLJA 4LERA 3LXUX 1OWLA 5EDSA 3TGOA 3S7BA 3CVWA 5T4YA 3FH8A 4HOSA 3PVLA 3CKBA 4R7LA 3D9NA 3PRZA 4H7YA 2KATA 5LOZA 5BPPA 5LX8A 1LF8A 3JYSA 4CDMA 3AU5A 2UY1A 4FJYA 5A6CA 4BX8A 5EX3A 3UMVA 4G23A 1P5QA 5BV1A 4K0RA 3QJZA 3B13A 5J90A 2LSUA 4A1SA 3U9WA 3ZEFA 4U04A 4WAFA 3B7UX 2KM4A 3FHEA 2HYZA 2MHKA 3ZRHA 4BY6A 1UW4B 1W3BA 2ONDA 4L23A 2XPYA 2LSVA 3CVQA 2P58C 3G2TA 2L0TB 4KVMA 3TXMA 2I1JA 2PQNA 3EHMA 3FUKA 4HOUA 3CQGB 5G2NA 2MOWA 3IKOB 3URZA 5FTPA 5LFAA 3AU4A 4MRUA 3MV2B 4WNDA 2FBNA 4EECA 1H6KA 4NACA 2DBAA 4LEUA 2BTDA 2IFUA 4A1GA 3LPZA 1ELRA 3MCXA 1E8ZA 3I3NA 4KZCA 1WM5A 3T8MA 4E6HA 3SZ7A 2E0IA 2WXRA 3QWPA 1GW6A 3SNXA 3TG5A 3ZYLA 1TJCA 3MX3A 1B89A 1NP7A 4FC8A 2L6JA 4UWFA 4NURA 1YA0A 4GMLA 3GYZA 1E8XA 3SGHA 2A4ZA 3ASDA 3D9KA 4Q94A 1FVHA 1X5BA 5ANRA 4I6GA 3CVXA 2RD0A 4DLQA 3MKQB 3L6AA 4XIFA 3SBSA 4I2WA 4AY6A 4KYOB 2X6IA 3D9JA 3S2AA 5FJYA 4G1TA 5BUZA 4FP7A 4HVBA 4J8EA 3APDA 4JPSA 4UWLA 4XX5A 1U3CA 4APFA 1JUQA 3ZVVA 2QY7A 3FUEA 2WXNA 4XKCA 5JJTA 4UWGA 1HU3A 2WXLA 4KVOA 4OVUA 5FQ8A 5J08A 1OWMA 4PH4B 5BW8C 3AS5A 2AVPA 1BPOA 3HIZA 4U0ZA 2IOLA 3DPDA 3QDNA 3RRNB 5KJKA 1MQSA 4ANUA 4IULA 3CSFA 1IYGA 5ARFA 3AS4A 4ABNA 2YHCA 1N54A 3LY8A 3MA5A 4N3CA 1HO8A 2I1KA 3PDNA 4I1OB 1QNFA 3L08A 3Q47B 4JA7A 3UQ3A 2J4BA 1OUVA 3D9MA 3FTVA 4AM9A 4JEHA 4D10C 4FU3A 4DJAA 1IQUA 4XZ4A 5G05C 1FVFA 2FEZA 4I6EA 4XE0A 2CHXA 4IN3B 1HG2A 4J6IA 1Z3YA 2BF0X 4BT9A 2X3MA 3NF1A 2LNIA 3CIAA 3KAEA 3OTNA 3UUXA 5EX0A 3HHMA 1EF1C 2R59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PE4 A;  3LKU A;  2VSY A;  2YQ8 A;  3CVN A;  3ASF A;  4U0S A;  3MKR A;  2WQH A;  1HXI A;  3E4B A;  4I1A A;  5LCW C;  1HZ4 A;  2XGS A;  3ZPJ A;  4HOR A;  3LY7 A;  5EKQ D;  2Y4T A;  2VGX A;  1QQE A;  2UWJ G;  2GW1 A;  2XCB A;  4HOT A;  4NRH B;  4N5C A;  3QWW A;  4U07 A;  2KCK A;  2XGO A;  4G2V A;  3ULQ A;  4N3A A;  4GA1 A;  2XPI A;  4GZ3 A;  3U3W A;  5AYW D;  4CGW A;  4HOQ A;  5D0O D;  1ZBP A;  3OXL A;  3SF4 A;  5G04 J;  2FO7 A;  3LCA A;  4I9C A;  3Q5M A;  4H7X A;  3UPV A;  3S7D A;  3ZHE B;  3OXG A;  3Q15 A;  3LY9 A;  4G26 A;  5CHE E;  2XEV A;  5JJ7 A;  3CK8 A;  5D0Q D;  4CDR A;  4I17 A;  3RJV A;  4GCO A;  4GA0 A;  3CVL A;  5CCM A;  2Q7F A;  2BUG A;  3HYM B;  4YVO A;  1ELW A;  2PL2 A;  5G05 J;  4WNG A;  4JA9 A;  4JHR A;  3FWV A;  3AS8 A;  2HO1 A;  3S7F A;  5JJ6 A;  1Y8M A;  5G04 C;  4AIF A;  3RU0 A;  5DIZ A;  3TG4 A;  2KC7 A;  2PZI A;  2I6H A;  4UQZ A;  2WPV A;  3ASH A;  4BWR A;  3Q49 B;  4WNE A;  4BT8 A;  5LCW J;  3S7J A;  4W9R A;  3TAX A;  4GZ6 A;  1IHG A;  4J0U A;  3CK9 A;  4F3V A;  4YND A;  3WXX A;  3CVP A;  2FF4 A;  4KXK B;  4UQY A;  4YVQ C;  5ARG A;  4N3B A;  3VTY A;  5KJM A;  3CKC A;  2KCL A;  4G25 A;  1FCH A;  2UY1 B;  4GYW A;  4XI0 A;  4B94 A;  2KCV A;  2C0M A;  3CV0 A;  5BNW A;  3ASG A;  3GZ2 A;  4GZ5 A;  4UI9 K;  5FZQ A;  1E96 B;  4RG6 A;  4BTB A;  4G24 A;  3LYA A;  3EDT B;  3KS2 A;  4GA2 A;  5FT9 A;  5A7D B;  5BT1 A;  4CGV A;  4ME2 A;  4EQF A;  4JL0 A;  3QWV A;  5DBK A;  3MEK A;  2C0L A;  4APO A;  4N2S A;  4O6F A;  2C2L A;  4GYY A;  3K9I A;  4Y6W A;  4AY5 A;  2XGM A;  4U0U A;  4GPK A;  1NA0 A;  4N39 A;  4NQ0 A;  2VGY A;  3Q4A B;  3GZ1 A;  1QZ2 A;  3O48 A;  2PQR A;  4Y6C A;  3OXF A;  4XI9 A;  2R5S A;  4UI9 J;  5M72 A;  2VQ2 A;  3ZFW A;  4GYO A;  3PE3 A;  4I9E A;  4N2Q A;  2OOE A;  1A17 A;  3FFL A;  4WNF A;  3RKV A;  3CK7 A;  1KT1 A;  2IF4 A;  4I2Z A;  2QFC A;  3KD7 A;  3VTX A;  3RO2 A;  1XNF A;  1WAO 1;  3ZGQ A;  5KJL A;  1KT0 A;  3QKY A;  3ZHE A;  4GCN A;  1NA3 A;  1KLX A;  4J8F A;  5KJN A;  2J9Q A;  4J8D A;  5HI7 A;  4UI9 C;  3GW4 A;  2E2E A;  1PC2 A;  2FI7 A;  2VGX B;  1NZN A;  2V5F A;  3QOU A;  3IEG A;  5C1D A;  2HR2 A;  2VYI A;  3CEQ A;  3FP3 A;  4WUY A;  5FZR A;  2XCC A;  5FZS A;  2JLB A;  3BEE A;  2NC9 A;  3MV3 B;  1HH8 A;  3RO3 A;  3U4T A;  2Y4U A;  3R9A B;  5HQ8 A;  4UQX A;  3ZN3 A;  3RIB A;  3ESK A;  1ZU2 A;  4KBQ A;  4RG9 A;  3N71 A;  4BTA A;  2VSN A;  5CCL A;  3TGO A;  3S7B A;  4HOS A;  3CKB A;  4H7Y A;  2KAT A;  3JYS A;  2UY1 A;  5A6C A;  5EX3 A;  4G23 A;  1P5Q A;  2LSU A;  4A1S A;  4U04 A;  2HYZ A;  2MHK A;  1W3B A;  2OND A;  2LSV A;  3CVQ A;  2P58 C;  2PQN A;  4HOU A;  3URZ A;  5FTP A;  3MV2 B;  4WND A;  2FBN A;  2DBA A;  4LEU A;  2IFU A;  3LPZ A;  1ELR A;  1WM5 A;  3SZ7 A;  3QWP A;  3TG5 A;  1TJC A;  1B89 A;  2L6J A;  1YA0 A;  3GYZ A;  3ASD A;  4XIF A;  4I2W A;  4AY6 A;  4KYO B;  5FJY A;  4G1T A;  4J8E A;  5JJT A;  5BW8 C;  3AS5 A;  2AVP A;  4U0Z A;  3QDN A;  5KJK A;  1IYG A;  5ARF A;  3AS4 A;  4ABN A;  2YHC A;  3MA5 A;  3LY8 A;  4N3C A;  3PDN A;  3Q47 B;  4JA7 A;  3UQ3 A;  4AM9 A;  1OUV A;  5G05 C;  2FEZ A;  4IN3 B;  4BT9 A;  3NF1 A;  2LNI A;  3KAE A;  3UUX A;  5EX0 A; 
#chains in the Genus database with same CATH topology
 3ZIM A;  4DI4 A;  2DWZ A;  3KEA A;  3J5P A;  4OAV B;  4CRW A;  3HDX A;  4I1A A;  1HZ4 A;  4JW1 A;  3CHM A;  3LY7 A;  2OV8 A;  2Y4T A;  1SQM A;  2V5Q C;  1SZ9 A;  2UWJ G;  4NRH B;  5B1A E;  1EYH A;  4ILI A;  3TWQ A;  2XPI A;  3ISM C;  2B0O E;  5AYW D;  5D0O D;  1ZBP A;  3EHN A;  1H2U A;  4ATG A;  4U96 D;  3KSQ A;  4I9C A;  4H7X A;  4DPR A;  5BXU A;  3ZKJ A;  3S7D A;  4GTP A;  3ZHE B;  2PM6 A;  5CHE E;  2XEV A;  1BLX B;  1HG5 A;  4CDR A;  2XS8 A;  4GCO A;  1TNB A;  2BUG A;  4B0Z A;  1MX6 A;  2A5U A;  1ELW A;  3UT8 A;  4U95 D;  4HQD A;  4GMR A;  4LNU D;  2XEE A;  3QB2 A;  5G04 C;  2Y1L E;  4K5B A;  3SHF A;  3B7B A;  4LNG A;  3ASO E;  4HLL A;  3SFZ A;  3JCK C;  4BER A;  4CDN A;  2ILR A;  3ASH A;  1QYM A;  3UKR G;  4DK5 A;  3Q49 B;  2M63 A;  3CHO A;  5EYP F;  3TAX A;  2DYS E;  2P2C P;  4GZ6 A;  2R02 A;  4J0U A;  3CK9 A;  4RSY A;  4PS8 A;  3PZD A;  3WXX A;  4CCA A;  1JWG A;  4IYP A;  3FU5 A;  4LCT A;  1ELK A;  2LAI A;  5KJM A;  3QAQ A;  2LXL A;  1N95 A;  1PY1 A;  4AVX A;  3DPY A;  3EUV A;  2P9L G;  2AXZ A;  2ETB A;  4XI0 A;  3DSS A;  2KCV A;  5G55 A;  5BNW A;  2XQ0 A;  4GZ5 A;  3T5X A;  3ABL E;  3R7R A;  4UI9 K;  2P9I G;  1HS6 A;  1E96 B;  1DNP A;  3T8K A;  4BTB A;  5EYL A;  3T5V A;  5D66 A;  2OEW A;  5H7P A;  2Y3A A;  1Z6T A;  2VJ8 A;  2A5E A;  5A7D B;  5BT1 A;  4EQF A;  1VDY A;  4A3V A;  2NSZ A;  3C5R A;  1TR4 A;  5ENR D;  3IBE A;  4BSZ B;  3Q9N C;  3FUL A;  5DBK A;  2OCC E;  3T9K A;  2IU1 A;  3ZXS A;  2F37 A;  4HB5 A;  3PZ3 A;  2OEV A;  2C2L A;  4GYY A;  3K9I A;  3EJN A;  4MBG A;  4AY5 A;  2XGM A;  4U0U A;  4O1P A;  4GPK A;  4N39 A;  3B7S A;  2VGY A;  4NQ0 A;  4FUL A;  2V4L A;  3GZ1 A;  3C98 A;  1QZ2 A;  4XI9 A;  4RVB A;  2VQ2 A;  2OVF A;  2DYR E;  3CK7 A;  1JCS A;  5B1B E;  5E76 A;  4GZD A;  3RO2 A;  4ANV A;  1WAO 1;  5KJL A;  3CHS A;  3QKY A;  3OAW A;  4IRU A;  4CEM A;  5CMY A;  4UI9 C;  3GW4 A;  2E2E A;  1LD8 A;  1JWF A;  2VGX B;  2JEK A;  3TJP A;  4O60 A;  3FEY A;  5AQ7 A;  3HXE A;  2QZA A;  2VTB B;  3FP3 A;  4GPM A;  2F8Y A;  5FZR A;  4KMO A;  3Q79 A;  2QYJ A;  2ZIS A;  2XCC A;  1NFI E;  2WXF A;  3B95 A;  2JLB A;  3B7T A;  1H2V C;  4C0M A;  4DX6 D;  2BED A;  3RRM B;  3UT4 A;  1N4S A;  5FIO A;  1H2T C;  3TWR A;  3R9A B;  2LAH A;  5CEA A;  2FUL A;  3ASN E;  3ESK A;  3FU3 A;  4E85 A;  4FJZ A;  3CHP A;  2I9C A;  4LER A;  5HKP A;  5EDS A;  4DX5 D;  4LNB A;  1A5E A;  4HOS A;  2GRN B;  4G8L A;  4R7L A;  5LOZ A;  1LF8 A;  3HXB A;  2L6B A;  2UY1 A;  3UMV A;  3Q73 A;  5BV1 A;  5J90 A;  4U8Y D;  4A1S A;  3ZEF A;  1MX4 A;  3TWS A;  2HYZ A;  4L23 A;  1NL4 A;  3CVQ A;  2P58 C;  2L0T B;  4HOU A;  1BD8 A;  1DCQ A;  4DRX E;  2FBN A;  4NAC A;  2BTD A;  2GRP B;  3MCX A;  4HNA D;  3ZYL A;  4UWF A;  1NP7 A;  4FC8 A;  2L6J A;  3SGH A;  2A4Z A;  1KZP A;  4RLY A;  1X5B A;  2F8X K;  3L6A A;  3E37 A;  4KYO B;  3D9J A;  4G1T A;  4HVB A;  1OCC E;  4N5Q A;  5AAR A;  1JUQ A;  4XKC A;  1HU3 A;  2WXL A;  5FQ8 A;  5J08 A;  4PH4 B;  3HIZ A;  2AVP A;  5EIB E;  3BUA A;  2KXP C;  5HRY A;  5AQB A;  1AP7 A;  2I1K A;  3AAA C;  1QNF A;  3UQ3 A;  1OUV A;  4DJA A;  1IQU A;  5BXO A;  2FEZ A;  4I6E A;  4XE0 A;  2CHX A;  4IN3 B;  1HG2 A;  4J8Y A;  5B3S E;  1EF1 C;  5FQ6 A;  3U66 A;  3PE4 A;  4B8C B;  3LKU A;  3HVE A;  3CVN A;  2XEH A;  1H0A A;  2LXM A;  5D2M C;  4TUU A;  4UWK A;  1D8E A;  3IHY A;  3DSU A;  3E4B A;  3ABM E;  2X6F A;  4EZL A;  5LCW C;  4JHJ A;  3ZPJ A;  4WWN A;  1TNY A;  4X8Q A;  4ACL A;  3E34 A;  3L54 A;  1YYH A;  3QWW A;  4U07 A;  3C3Q A;  2WMO A;  3ULQ A;  2P9K G;  1HFA A;  2AJA A;  5EN5 D;  3SQV A;  4HOQ A;  3ZU7 B;  3OXL A;  1UN8 A;  2DCP A;  5C2Y A;  4MS6 A;  4HLE A;  5G04 J;  3NBN B;  4URK A;  3L16 A;  5AQ9 A;  2DIW A;  4GMJ A;  3EU9 A;  3LJN A;  5HS0 A;  3UPV A;  3Q9U C;  3OXG A;  3FUM A;  3Q15 A;  4EBA A;  4GTR A;  5CRU A;  3NAW A;  2F0Y A;  4PDX A;  5D0Q D;  1HX8 A;  3NZS A;  1E8W A;  3EIQ C;  3KSL A;  4I17 A;  1KZO A;  3ESL A;  3DEP A;  2J07 A;  3HYM B;  4ANX A;  4L2Y A;  4TUM A;  4WNG A;  3PUJ A;  3FWV A;  3AS8 A;  5CEC B;  2WXI A;  1INZ A;  5DIZ A;  3FU6 A;  4CYM D;  3ULE G;  4U8H A;  2KC7 A;  2I6H A;  2WMN A;  3IV0 A;  3LEW A;  4UQZ A;  3C72 A;  5FIN A;  2VSO E;  4BT8 A;  3S7J A;  2EIN E;  3UXG A;  2CHZ A;  3L13 A;  4ATZ D;  1TN6 A;  4YND A;  4CT0 A;  3CVP A;  2XRY A;  2FO1 E;  4UWH A;  2GRO B;  4ZHB A;  1IHB A;  3BQO A;  1PAQ A;  3CVY A;  2KCL A;  3CV0 A;  3D9L A;  3ASG A;  4BSX A;  4EPZ A;  3APF A;  3PNT B;  3TWV A;  1MYO A;  4FLH A;  4RG6 A;  1DVP A;  1OWP A;  3MJW A;  1SZA A;  2CHW A;  4G24 A;  5ANL A;  2AWI A;  2ION A;  5E75 A;  1TNO A;  3SY2 A;  2KBX A;  4F53 A;  3ML9 A;  3DBS A;  3KS2 A;  4GA2 A;  5FT9 A;  3SBT B;  3CHQ A;  2GRQ B;  3DST A;  2ZU6 B;  3L22 A;  3FUH A;  3MEK A;  2C0L A;  4K5C A;  3U64 A;  4L2L A;  4APO A;  1E7V A;  5CRV A;  1RW2 A;  2EIM E;  2JAB A;  4Y6W A;  5KNH D;  1N11 A;  3PZ4 A;  2MRI A;  4FHJ A;  1NA0 A;  3CQC B;  3DSW A;  3Q4A B;  2PQR A;  4JEU A;  5JHB A;  4UI9 J;  5M72 A;  3ZFW A;  4G8K A;  2AXV A;  4I9E A;  4N2Q A;  4GTQ A;  3UX4 A;  3ABK E;  2CG2 A;  5AAO A;  3TL5 A;  4WNF A;  4I2Z A;  3V79 K;  3KD7 A;  5CBO A;  1Z5S C;  4ILH B;  2WVI A;  3JQ1 A;  3NQP A;  1KT0 A;  3ONK A;  3ZHE A;  5T3R A;  1KLX A;  3FEX A;  2J9Q A;  4ANW A;  1PC2 A;  2IOS A;  3IEG A;  3FUF A;  3HXD A;  3D9H A;  5C1D A;  2X6J A;  3MGB A;  3PNL B;  3APC A;  3CEQ A;  1OCZ E;  4Z68 A;  2WXK A;  4ILG A;  3ULY A;  2NC9 A;  1E7U A;  1HH8 A;  3U4T A;  3QK0 A;  3TWU A;  3GZS A;  4K03 A;  4C9B B;  2KZT B;  4UQX A;  3RAU A;  3RK6 A;  4CT4 A;  5JHA A;  3RIB A;  1ZU2 A;  3JXJ A;  4KBQ A;  4RG9 A;  5CCL A;  3S7B A;  5T4Y A;  3CKB A;  5LX8 A;  3JYS A;  4FJY A;  5A6C A;  5EX3 A;  1P5Q A;  3QJZ A;  3DWL G;  2MHK A;  1Q2Z A;  1UW4 B;  2OND A;  1TNU A;  2LSV A;  4KVM A;  1QBQ A;  5LFA A;  2HE0 A;  3SFX A;  4EHM A;  2DBA A;  2IFU A;  1N94 A;  1ELR A;  1WM5 A;  2E0I A;  3QWP A;  1SW6 A;  2XS1 A;  3TWW A;  4NUR A;  3ASD A;  4DLQ A;  3MKQ B;  4I2W A;  1DC2 A;  4AY6 A;  5BUZ A;  4FP7 A;  4J8E A;  4GTT A;  4XX5 A;  4UUC A;  5JJT A;  4UWG A;  5JMN D;  1OWM A;  3DPD A;  3AG3 E;  3RRN B;  1MQS A;  4ANU A;  5IY5 E;  4ABN A;  3AS4 A;  2YHC A;  4N3C A;  3PDN A;  2J4B A;  4AM9 A;  5EIL A;  3V31 A;  4XZ4 A;  1Z3Y A;  3CIA A;  3OTN A;  4A3T A;  2R59 A;  1HE8 A;  2IQC A;  2V4H C;  2VSY A;  2YQ8 A;  4P29 A;  1YCS B;  4DLO A;  1S64 A;  2WQH A;  5ENN A;  1HXI A;  2Y69 E;  3G2V A;  4LG6 A;  5A23 A;  5EKQ D;  1H19 A;  2RKK A;  5AEN A;  2ETC A;  1OXJ A;  1OWN A;  3NB2 A;  2VGX A;  2J08 A;  3X2Q E;  2BKK B;  2GW1 A;  4HOT A;  3ZYQ A;  4U7E B;  1SA4 A;  1O1T A;  3FUD A;  2VTB A;  2KCK A;  2XGO A;  3E32 A;  4G2V A;  3PH0 C;  1EPU A;  3PS6 A;  5CED B;  4CGW A;  1AWC B;  3JUI A;  3Q7F A;  3FH7 A;  4J8S A;  1TJF A;  3JUE A;  4WWO A;  4FLB A;  4AP2 A;  1S63 A;  3Q5M A;  2H6I A;  4BES A;  3BG1 B;  3DXK G;  5AN8 A;  4C0E A;  4G26 A;  3UM1 A;  1N4R A;  3CK8 A;  2LO6 A;  4GZC A;  3I4R B;  1FT2 A;  4U63 A;  3ENE A;  4TXR A;  1E90 A;  1UG3 A;  3CVL A;  5CCM A;  2Q7F A;  5T8I A;  3Q78 A;  4YVO A;  2I2O A;  2XHE A;  2WB2 A;  2PL2 A;  5G05 J;  2IEJ A;  3MYV A;  3ONL A;  2HO1 A;  3S7F A;  5JJ6 A;  3EIJ A;  3RU0 A;  3TG4 A;  2PZI A;  2P9U G;  5JA4 D;  4TV3 A;  2CG3 A;  1UJJ A;  5CBN A;  1HF8 A;  2H6G A;  3G2W A;  1S70 B;  1IHG A;  3AJI A;  4EBA G;  1WG0 A;  4F3V A;  3D3M A;  2RFM A;  1EDU A;  4OYS A;  4UQY A;  3FUI A;  3E30 A;  3VTY A;  4CZ2 D;  2XRZ A;  3NOC D;  4AEZ C;  1OY3 D;  4HS2 A;  2P9N G;  4G25 A;  4L9P A;  2RG8 A;  2PM7 A;  4BET A;  3WG7 E;  2DVW A;  3FTS A;  4B94 A;  1FT1 A;  2C0M A;  4JVS A;  2CFU A;  4JHK A;  3HXF A;  4HI9 A;  2WXO A;  4YDO A;  1WDY A;  3UKU G;  1ZB1 A;  2EIL E;  4B89 A;  3EDT B;  3FUJ A;  3HXC A;  4Q69 A;  3PEV B;  1K1B A;  4GTV A;  2WXJ A;  1U2V G;  1H6P A;  3D9P A;  3I4G A;  4JL0 A;  2WXP A;  2YIN A;  4LUN U;  4LRZ A;  4XKB A;  1TYQ G;  4I6J A;  2CFZ A;  3KEZ A;  4K5A B;  2P9P G;  3G2U A;  3NZU A;  3QNK A;  2WXH A;  3V2X A;  2GRR B;  2R17 C;  2DZN A;  2IY0 C;  4DX2 A;  1MZC A;  2R5S A;  3ZUV B;  4HXI A;  1Y6I A;  4HRL A;  2OOE A;  3PRE A;  4KZ0 A;  1K1A A;  4G11 A;  3CST A;  3ZNG A;  1YMP A;  3D9I A;  2WXQ A;  3RKV A;  4I43 A;  4BFR A;  2IF4 A;  4HBD A;  2QFC A;  1MX2 A;  4HRN A;  3VTX A;  2GRM A;  1XNF A;  1RZ4 A;  1TN8 A;  1BI7 B;  1NA3 A;  1UJK A;  4DX7 D;  3B7R L;  5HI7 A;  1K8K G;  4FA6 A;  2V5F A;  1N4P A;  3L82 A;  3LDZ A;  3QOU A;  4QQI A;  1TNZ A;  2HR2 A;  2VYI A;  1TEZ A;  1MJ0 A;  2X38 A;  4DUI A;  1N0Q A;  2XPZ A;  1SVX A;  3CGH A;  3MV3 B;  1Z3X A;  3I5P A;  3RO3 A;  1U3D A;  3SD5 A;  2ZGD A;  4B8A A;  2WQ6 A;  4PUC A;  3PZ1 A;  2WM9 A;  3CVV A;  4MKT A;  3W9G A;  1H6O A;  5KWD A;  3UIP C;  4YDE A;  2DZO A;  4L7T A;  3N71 A;  4PS3 A;  2VSN A;  3CR3 A;  3UIN C;  1WY6 A;  3LXU X;  3TGO A;  3D9N A;  3PRZ A;  1JCR A;  3UM0 A;  4G23 A;  3IXE A;  2EIJ E;  2LSU A;  3U9W A;  4U04 A;  4WAF A;  2KM4 A;  1W3B A;  5AQA A;  2XPY A;  3EHR A;  4LSZ E;  2PQN A;  5G2N A;  2MOW A;  3C3O A;  3IKO B;  3URZ A;  4MRU A;  1N4Q A;  1H6K A;  4LEU A;  4U8V D;  4A1G A;  3LPZ A;  4KZC A;  3I3N A;  3T8M A;  1G3N B;  3V30 A;  4E6H A;  3SZ7 A;  2WXR A;  3SNX A;  3TG5 A;  3MX3 A;  1B89 A;  2ETA A;  1YA0 A;  4GML A;  3GYZ A;  3D9K A;  4Q94 A;  5ANR A;  2RD0 A;  3JXI A;  1OT8 A;  3S2A A;  3SO8 A;  4O1O A;  5FJY A;  4JPS A;  4GTO A;  4UWL A;  1U3C A;  2WXN A;  1TN7 A;  5BW8 C;  1BPO A;  4YDY A;  4IUL A;  3CSF A;  3LY8 A;  1HO8 A;  4I1O B;  3V2O A;  1LD7 A;  3Q47 B;  3D9M A;  3FTV A;  4D10 C;  4JEH A;  4FU3 A;  1FVF A;  1IXV A;  4NIK A;  3TWT A;  2X3M A;  2LNI A;  2BKG A;  2X6K A;  5AIJ A;  3ZW3 A;  3ASF A;  3ZXP A;  4U0S A;  3MKR A;  2R05 A;  3BU8 A;  4HI8 A;  3HG0 D;  5ENT D;  2XGS A;  4HOR A;  4JZY A;  3R9M A;  4WWP A;  2J4D A;  3UM2 A;  3PEU B;  1QQE A;  3IHV A;  3VLD A;  3FTY A;  2XCB A;  3QC1 A;  4FAD A;  3DSV A;  4N5C A;  2Y0B G;  4EZK A;  3LJ3 A;  2L0I A;  3FDH A;  2YNQ A;  3CHR A;  3LVR E;  2WQ7 A;  4N3A A;  4GA1 A;  3FTZ A;  5KNG A;  3EU5 A;  1BI8 B;  4GZ3 A;  3U3W A;  1OCO E;  1E8Y A;  3SF4 A;  1X81 A;  2WXG A;  4GB9 A;  2FO7 A;  4OVV A;  3LCA A;  1IQR A;  4AJW A;  1N52 A;  2EQX A;  4F7A A;  4MLP A;  5ENO D;  2KZT A;  1O1S A;  3FTU A;  3LY9 A;  3BG0 B;  5AJD A;  5JJ7 A;  2OVB A;  4PS7 A;  2P9S G;  3RJV A;  3CVU A;  4GA0 A;  1FPP A;  5FWQ A;  1MHQ A;  3FTX A;  5ENS D;  3E33 A;  4AV7 A;  4B93 B;  4JA9 A;  4JHR A;  1UN9 A;  4GU5 A;  1Y8M A;  3F6Q A;  1DCE A;  1V55 E;  3P1U A;  4AIF A;  2J09 A;  2MYO A;  3UT7 A;  3UM3 A;  3G2S A;  5EID A;  2B6C A;  2QYU A;  2WPV A;  3TXN A;  1O1R A;  2GRL A;  3P2B A;  4TXQ A;  4BWR A;  5LCW J;  4WNE A;  4ACK A;  4W9R A;  4JC8 A;  3LVQ E;  4DI3 A;  2FF4 A;  4KXK B;  4YVQ C;  5ARG A;  4N3B A;  4AOF A;  4JD2 G;  4HFG A;  3L17 A;  4RQI A;  1K3Z D;  3W9F A;  3CKC A;  1FCH A;  2UY1 B;  4GYW A;  4TXP A;  3MKQ A;  3ML8 A;  3FH5 A;  3GZ2 A;  4A63 B;  5ITZ F;  2ZXW E;  1O5M A;  2NYJ A;  5FZQ A;  2X6H A;  4GAA A;  3JQ0 A;  4L1B A;  3MZL B;  2EIK E;  1D9S A;  4C48 B;  2HM8 A;  3Q75 A;  4F1S A;  3LYA A;  2ZGG A;  4A55 A;  5CER B;  1JPL A;  1V54 E;  3J5Q B;  3O4Z A;  5AJL A;  4CGV A;  1XGW A;  4JXT A;  4ME2 A;  4BX9 A;  3LS8 A;  1JCQ A;  3UI2 A;  4XEI G;  3QWV A;  3FY4 A;  5LP0 A;  2RFA A;  4EZJ A;  1SA5 A;  3TWX A;  2VGE A;  3VLE A;  4N2S A;  2WXM A;  2NXP A;  4O6F A;  3PUK A;  4GTM A;  3FUN A;  3QAR A;  2YHE A;  1L5J A;  1OWO A;  4QFV A;  3VLF A;  5CMW A;  3FU0 A;  2H6H A;  3O48 A;  4Y6C A;  4M7C A;  1BU9 A;  3OXF A;  4Q96 A;  3UTM A;  2J49 A;  1OCR E;  3HRA A;  4GYO A;  3AG2 E;  3PE3 A;  4KT6 B;  1A17 A;  5FQ7 A;  2VSX E;  4GTS A;  4FHK A;  3FFL A;  1KT1 A;  3HVE B;  4M3O A;  3R7Q A;  4DX1 A;  4F6R D;  3ZGQ A;  5FQ4 A;  4GCN A;  2AW6 A;  2XZT G;  2L9B A;  1S0P A;  3RSE G;  3NOG D;  4J8F A;  5KJN A;  4J8D A;  1UOH A;  4AXH A;  2IO3 C;  2FI7 A;  4V3I A;  1NZN A;  2J8S D;  5BV0 A;  4I1M A;  3RRU A;  3FTW A;  4WUY A;  4YDW A;  5FZS A;  5KCM A;  3L9T A;  3ZYK A;  3BEE A;  1KPS B;  4OAU C;  3ZYM A;  1IKN D;  2V8S E;  2Y4U A;  3D9O A;  1NI1 A;  5HQ8 A;  3ZN3 A;  2R2L A;  3SI5 A;  2AXU A;  3AG1 E;  2IJG X;  5ENP D;  4BTA A;  3DRA A;  3AG4 E;  2V0P A;  3CLJ A;  1OWL A;  3CVW A;  3FH8 A;  1D8D A;  3PVL A;  5BPP A;  4H7Y A;  2KAT A;  3UIO C;  4CDM A;  2XEN A;  3AU5 A;  4BX8 A;  2H6F A;  5KBA A;  4J7W A;  4K0R A;  3B13 A;  3B7U X;  3FHE A;  3ZRH A;  4BY6 A;  3DSX A;  2QC9 A;  3G2T A;  3TXM A;  2I1J A;  3EHM A;  3FUK A;  3CQG B;  5FTP A;  3AU4 A;  3MV2 B;  4WND A;  2R03 A;  4EEC A;  3DEO A;  3SFY A;  1E8Z A;  4HRM B;  1GW6 A;  4F1P A;  1TJC A;  1E8X A;  2PNN A;  1FVH A;  4I6G A;  3CVX A;  2LUH A;  2XZD G;  4XIF A;  3SBS A;  1N9A A;  2X6I A;  1LTX A;  1N0R A;  3APD A;  4JB8 P;  4APF A;  3ZVV A;  2QY7 A;  3FUE A;  4KVO A;  4OVU A;  3AS5 A;  4U0Z A;  2IOL A;  3QDN A;  3C3R A;  5KJK A;  1IYG A;  3DXM G;  5ARF A;  3PZ2 A;  1N54 A;  3MA5 A;  2ZIR A;  4BEP A;  3L08 A;  4JA7 A;  5ENQ D;  2IO2 C;  3EHQ A;  5G05 C;  3Q7A A;  4ZFH A;  4J6I A;  2BF0 X;  4BT9 A;  3NF1 A;  3KAE A;  4TRQ A;  3UUX A;  3HHM A;  2GGF A;  5EX0 A; 
#chains in the Genus database with same CATH homology
 2IQC A;  3PE4 A;  3ZIM A;  4B8C B;  2X6K A;  4DI4 A;  5AIJ A;  3LKU A;  3ZW3 A;  3HVE A;  2VSY A;  2YQ8 A;  3CVN A;  4P29 A;  3ASF A;  1H0A A;  4DLO A;  4U0S A;  3MKR A;  2WQH A;  4TUU A;  4UWK A;  5ENN A;  3IHY A;  1HXI A;  4CRW A;  3E4B A;  3HDX A;  3G2V A;  4I1A A;  2X6F A;  4EZL A;  5LCW C;  1HZ4 A;  2XGS A;  4JHJ A;  3ZPJ A;  4HOR A;  4JW1 A;  4JZY A;  4WWN A;  5A23 A;  3CHM A;  3LY7 A;  2OV8 A;  4WWP A;  5EKQ D;  1H19 A;  4ACL A;  2J4D A;  2Y4T A;  5AEN A;  1SQM A;  3L54 A;  1OWN A;  2VGX A;  3PEU B;  1QQE A;  3IHV A;  3VLD A;  1SZ9 A;  2J08 A;  2UWJ G;  3FTY A;  2GW1 A;  2XCB A;  3QC1 A;  4HOT A;  3ZYQ A;  4NRH B;  4FAD A;  4N5C A;  3QWW A;  4EZK A;  3LJ3 A;  4U07 A;  1EYH A;  2L0I A;  3FDH A;  2KCK A;  3FUD A;  2VTB A;  2XGO A;  2YNQ A;  3CHR A;  4G2V A;  4ILI A;  3LVR E;  2WMO A;  2WQ7 A;  3ULQ A;  4N3A A;  4GA1 A;  2XPI A;  3FTZ A;  1HFA A;  3PH0 C;  4GZ3 A;  1EPU A;  3PS6 A;  3U3W A;  5AYW D;  4CGW A;  4HOQ A;  5D0O D;  1ZBP A;  1E8Y A;  1UN8 A;  2DCP A;  3OXL A;  4MS6 A;  5C2Y A;  3SF4 A;  4HLE A;  3JUI A;  3EHN A;  1H2U A;  2WXG A;  3FH7 A;  4GB9 A;  4J8S A;  5G04 J;  2FO7 A;  4OVV A;  3LCA A;  3L16 A;  4URK A;  1IQR A;  4AJW A;  4ATG A;  1N52 A;  2EQX A;  1TJF A;  4F7A A;  4MLP A;  2DIW A;  4WWO A;  4GMJ A;  4FLB A;  2KZT A;  4AP2 A;  3FTU A;  4I9C A;  3Q5M A;  4H7X A;  4DPR A;  3UPV A;  5FQ6 A;  3S7D A;  3BG1 B;  3ZHE B;  3OXG A;  3FUM A;  3Q15 A;  3LY9 A;  4C0E A;  4EBA A;  2PM6 A;  4G26 A;  5CHE E;  2XEV A;  3BG0 B;  5AJD A;  5JJ7 A;  2OVB A;  1HG5 A;  3CK8 A;  4PDX A;  5D0Q D;  2LO6 A;  1HX8 A;  4PS7 A;  4GZC A;  3NZS A;  4CDR A;  1E8W A;  3EIQ C;  3I4R B;  4U63 A;  3ENE A;  4I17 A;  3RJV A;  3CVU A;  4GCO A;  4GA0 A;  3ESL A;  1E90 A;  1UG3 A;  3CVL A;  5CCM A;  2J07 A;  2BUG A;  2Q7F A;  3HYM B;  5FWQ A;  5T8I A;  4B0Z A;  1MHQ A;  4YVO A;  2I2O A;  2XHE A;  2A5U A;  3FTX A;  4ANX A;  1ELW A;  2PL2 A;  4L2Y A;  4WNG A;  5G05 J;  3UT8 A;  4AV7 A;  2WB2 A;  3PUJ A;  4JA9 A;  4JHR A;  3FWV A;  3AS8 A;  3MYV A;  1UN9 A;  3ONL A;  2HO1 A;  4GU5 A;  3S7F A;  5JJ6 A;  1Y8M A;  3QB2 A;  5G04 C;  2WXI A;  3P1U A;  1INZ A;  4AIF A;  3EIJ A;  3RU0 A;  5DIZ A;  2J09 A;  3SHF A;  3TG4 A;  3FU6 A;  4U8H A;  2KC7 A;  3UT7 A;  2PZI A;  3G2S A;  4TV3 A;  2I6H A;  3SFZ A;  2GGF A;  3JCK C;  2WMN A;  3IV0 A;  2CG3 A;  3LEW A;  4UQZ A;  1UJJ A;  4CDN A;  2ILR A;  2WPV A;  3TXN A;  3ASH A;  2VSO E;  4DK5 A;  2GRL A;  3P2B A;  4BWR A;  3Q49 B;  4WNE A;  4ACK A;  4BT8 A;  2M63 A;  3CHO A;  3S7J A;  5LCW J;  1HF8 A;  4W9R A;  4JC8 A;  3TAX A;  4GZ6 A;  3G2W A;  2CHZ A;  1IHG A;  3L13 A;  4J0U A;  3LVQ E;  3CK9 A;  4EBA G;  4F3V A;  3D3M A;  4RSY A;  4DI3 A;  4YND A;  4CT0 A;  4PS8 A;  3PZD A;  3WXX A;  1EDU A;  3CVP A;  2FF4 A;  2XRY A;  4KXK B;  4OYS A;  4UQY A;  4YVQ C;  4CCA A;  3FUI A;  4UWH A;  1JWG A;  5ARG A;  4IYP A;  3FU5 A;  4N3B A;  4AOF A;  3VTY A;  4LCT A;  1ELK A;  2LAI A;  4HFG A;  3L17 A;  2XRZ A;  4AEZ C;  5KJM A;  4HS2 A;  3QAQ A;  1PAQ A;  3CKC A;  3CVY A;  2KCL A;  4G25 A;  1PY1 A;  1FCH A;  2UY1 B;  4AVX A;  4GYW A;  2RG8 A;  2PM7 A;  3MKQ A;  3ML8 A;  2AXZ A;  3FTS A;  4XI0 A;  4B94 A;  2KCV A;  2C0M A;  3CV0 A;  5G55 A;  4JVS A;  2CFU A;  5BNW A;  4JHK A;  2XQ0 A;  3D9L A;  3FH5 A;  3ASG A;  3GZ2 A;  4GZ5 A;  4BSX A;  4EPZ A;  3T5X A;  3R7R A;  4UI9 K;  3APF A;  1HS6 A;  5FZQ A;  3PNT B;  2X6H A;  2WXO A;  1E96 B;  4GAA A;  4FLH A;  4RG6 A;  1DVP A;  3JQ0 A;  1DNP A;  4L1B A;  3MZL B;  1OWP A;  3MJW A;  1SZA A;  4BTB A;  3T5V A;  2CHW A;  4G24 A;  2HM8 A;  4F1S A;  5ANL A;  2AWI A;  3LYA A;  2ION A;  2Y3A A;  5E75 A;  4B89 A;  3EDT B;  3FUJ A;  4A55 A;  1Z6T A;  2VJ8 A;  4F53 A;  4Q69 A;  3ML9 A;  1JPL A;  3PEV B;  3O4Z A;  5AJL A;  3DBS A;  3KS2 A;  4GA2 A;  5FT9 A;  5A7D B;  5BT1 A;  2WXJ A;  3SBT B;  1XGW A;  4JXT A;  4ME2 A;  4BX9 A;  4EQF A;  4CGV A;  3LS8 A;  3CHQ A;  4A3T A;  1VDY A;  4A3V A;  2NSZ A;  3D9P A;  3I4G A;  3IBE A;  4JL0 A;  3QWV A;  3FY4 A;  2ZU6 B;  3FUL A;  5LP0 A;  2WXP A;  3L22 A;  3FUH A;  5DBK A;  4EZJ A;  3MEK A;  2C0L A;  2YIN A;  2IU1 A;  3U64 A;  3ZXS A;  3VLE A;  4L2L A;  4LUN U;  4APO A;  2WXM A;  4LRZ A;  4N2S A;  2NXP A;  4O6F A;  4XKB A;  2C2L A;  3PUK A;  4I6J A;  1E7V A;  2CFZ A;  3K9I A;  4GYY A;  3KEZ A;  3FUN A;  4Y6W A;  4TRQ A;  3EJN A;  4AY5 A;  3G2U A;  3QAR A;  2YHE A;  1L5J A;  1OWO A;  3NZU A;  4QFV A;  3QNK A;  3VLF A;  2XGM A;  4U0U A;  4GPK A;  2WXH A;  2MRI A;  4FHJ A;  1NA0 A;  4N39 A;  5CMW A;  2R17 C;  3B7S A;  2VGY A;  3FU0 A;  4NQ0 A;  3CQC B;  4FUL A;  2V4L A;  3Q4A B;  3GZ1 A;  3C98 A;  1QZ2 A;  3O48 A;  2PQR A;  4Y6C A;  3OXF A;  4Q96 A;  4XI9 A;  2R5S A;  4JEU A;  5JHB A;  4UI9 J;  4RVB A;  2J49 A;  5M72 A;  3U66 A;  2VQ2 A;  3ZFW A;  4GYO A;  2AXV A;  3PE3 A;  4HXI A;  4I9E A;  1Y6I A;  2OVF A;  4N2Q A;  2OOE A;  3PRE A;  4KZ0 A;  4KT6 B;  1A17 A;  3UX4 A;  4G11 A;  5FQ7 A;  3CST A;  2VSX E;  2CG2 A;  4FHK A;  1HE8 A;  3D9I A;  3FFL A;  2WXQ A;  3TL5 A;  4WNF A;  3RKV A;  3CK7 A;  4I43 A;  1KT1 A;  4BFR A;  3HVE B;  2IF4 A;  4I2Z A;  5E76 A;  4M3O A;  3R7Q A;  2QFC A;  3KD7 A;  3VTX A;  4ILH B;  2WVI A;  4GZD A;  3RO2 A;  3JQ1 A;  2GRM A;  1XNF A;  4ANV A;  1WAO 1;  3ZGQ A;  5KJL A;  3NQP A;  1KT0 A;  3ONK A;  3CHS A;  3QKY A;  5FQ4 A;  3ZHE A;  4GCN A;  2AW6 A;  1NA3 A;  3OAW A;  1KLX A;  2L9B A;  4IRU A;  5T3R A;  1S0P A;  1UJK A;  4CEM A;  3FEX A;  4J8F A;  5KJN A;  2J9Q A;  4J8D A;  5CMY A;  4ANW A;  3B7R L;  5HI7 A;  4UI9 C;  3GW4 A;  4FA6 A;  2E2E A;  4AXH A;  1JWF A;  1PC2 A;  2FI7 A;  2IOS A;  2VGX B;  2JEK A;  1NZN A;  2V5F A;  4V3I A;  3LDZ A;  3TJP A;  3QOU A;  3IEG A;  3FUF A;  3FEY A;  5BV0 A;  4I1M A;  2X6J A;  3RRU A;  2HR2 A;  5C1D A;  3MGB A;  2VYI A;  2VTB B;  3FTW A;  3PNL B;  3APC A;  1TEZ A;  3CEQ A;  3FP3 A;  2X38 A;  4WUY A;  5FZR A;  4KMO A;  2XCC A;  5FZS A;  2WXK A;  2WXF A;  5KCM A;  4ILG A;  2JLB A;  3ZYK A;  3BEE A;  2XPZ A;  3B7T A;  1H2V C;  4C0M A;  2NC9 A;  3RRM B;  3UT4 A;  3CGH A;  3MV3 B;  1E7U A;  3ZYM A;  2V8S E;  1Z3X A;  3I5P A;  1HH8 A;  3RO3 A;  3U4T A;  2Y4U A;  1H2T C;  1U3D A;  3SD5 A;  3QK0 A;  4B8A A;  3GZS A;  4K03 A;  2WQ6 A;  4PUC A;  2WM9 A;  3CVV A;  4C9B B;  3D9O A;  3R9A B;  4MKT A;  5HQ8 A;  2LAH A;  2KZT B;  4UQX A;  3RK6 A;  3ZN3 A;  4CT4 A;  2FUL A;  5JHA A;  3RIB A;  4E85 A;  3ESK A;  3FU3 A;  1ZU2 A;  2AXU A;  3SI5 A;  2IJG X;  4L7T A;  4KBQ A;  4FJZ A;  4RG9 A;  3N71 A;  4PS3 A;  4BTA A;  3CHP A;  2I9C A;  2VSN A;  3CR3 A;  1WY6 A;  5CCL A;  2V0P A;  3CLJ A;  4LER A;  3LXU X;  1OWL A;  5EDS A;  3TGO A;  3S7B A;  3CVW A;  5T4Y A;  3FH8 A;  4HOS A;  3PVL A;  3CKB A;  4R7L A;  3D9N A;  3PRZ A;  4H7Y A;  2KAT A;  5LOZ A;  5BPP A;  5LX8 A;  1LF8 A;  3JYS A;  4CDM A;  3AU5 A;  2UY1 A;  4FJY A;  5A6C A;  4BX8 A;  5EX3 A;  3UMV A;  4G23 A;  1P5Q A;  5BV1 A;  4K0R A;  3QJZ A;  3B13 A;  5J90 A;  2LSU A;  4A1S A;  3U9W A;  3ZEF A;  4U04 A;  4WAF A;  3B7U X;  2KM4 A;  3FHE A;  2HYZ A;  2MHK A;  3ZRH A;  4BY6 A;  1UW4 B;  1W3B A;  2OND A;  4L23 A;  2XPY A;  2LSV A;  3CVQ A;  2P58 C;  3G2T A;  2L0T B;  4KVM A;  3TXM A;  2I1J A;  2PQN A;  3EHM A;  3FUK A;  4HOU A;  3CQG B;  5G2N A;  2MOW A;  3IKO B;  3URZ A;  5FTP A;  5LFA A;  3AU4 A;  4MRU A;  3MV2 B;  4WND A;  2FBN A;  4EEC A;  1H6K A;  4NAC A;  2DBA A;  4LEU A;  2BTD A;  2IFU A;  4A1G A;  3LPZ A;  1ELR A;  3MCX A;  1E8Z A;  3I3N A;  4KZC A;  1WM5 A;  3T8M A;  4E6H A;  3SZ7 A;  2E0I A;  2WXR A;  3QWP A;  1GW6 A;  3SNX A;  3TG5 A;  3ZYL A;  1TJC A;  3MX3 A;  1B89 A;  1NP7 A;  4FC8 A;  2L6J A;  4UWF A;  4NUR A;  1YA0 A;  4GML A;  3GYZ A;  1E8X A;  3SGH A;  2A4Z A;  3ASD A;  3D9K A;  4Q94 A;  1FVH A;  1X5B A;  5ANR A;  4I6G A;  3CVX A;  2RD0 A;  4DLQ A;  3MKQ B;  3L6A A;  4XIF A;  3SBS A;  4I2W A;  4AY6 A;  4KYO B;  2X6I A;  3D9J A;  3S2A A;  5FJY A;  4G1T A;  5BUZ A;  4FP7 A;  4HVB A;  4J8E A;  3APD A;  4JPS A;  4UWL A;  4XX5 A;  1U3C A;  4APF A;  1JUQ A;  3ZVV A;  2QY7 A;  3FUE A;  2WXN A;  4XKC A;  5JJT A;  4UWG A;  1HU3 A;  2WXL A;  4KVO A;  4OVU A;  5FQ8 A;  5J08 A;  1OWM A;  4PH4 B;  5BW8 C;  3AS5 A;  2AVP A;  1BPO A;  3HIZ A;  4U0Z A;  2IOL A;  3DPD A;  3QDN A;  3RRN B;  5KJK A;  1MQS A;  4ANU A;  4IUL A;  3CSF A;  1IYG A;  5ARF A;  3AS4 A;  4ABN A;  2YHC A;  1N54 A;  3LY8 A;  3MA5 A;  4N3C A;  1HO8 A;  2I1K A;  3PDN A;  4I1O B;  1QNF A;  3L08 A;  3Q47 B;  4JA7 A;  3UQ3 A;  2J4B A;  1OUV A;  3D9M A;  3FTV A;  4AM9 A;  4JEH A;  4D10 C;  4FU3 A;  4DJA A;  1IQU A;  4XZ4 A;  5G05 C;  1FVF A;  2FEZ A;  4I6E A;  4XE0 A;  2CHX A;  4IN3 B;  1HG2 A;  4J6I A;  1Z3Y A;  2BF0 X;  4BT9 A;  2X3M A;  3NF1 A;  2LNI A;  3CIA A;  3KAE A;  3OTN A;  3UUX A;  5EX0 A;  3HHM A;  1EF1 C;  2R59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...