1FCUA

Crystal structure (trigonal) of bee venom hyaluronidase
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
324
structure length
324
Chain Sequence
EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKDPNGNVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKRIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYALURONOGLUCOSAMINIDASE
publication title Crystal structure of hyaluronidase, a major allergen of bee venom.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
total genus 119
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1fcuA00
3S5YA 2E6DA 4M6QA 6ALDA 1AW1A 3ABSA 3NVTA 4G1KA 4EF9A 4M7SA 5BMXA 4NX5A 2B7NA 3FOKA 4JN6A 4HNNA 2D73A 3W7QA 5AHFA 1P1XA 1XDLA 3MUXA 1PE1A 4TO8A 3BK0A 3RLUA 5D32A 4MUZA 1MEHA 4QITA 4R53A 4UTHA 4JTGA 5DCDA 3MO7A 3OHIA 2XN2A 1K8XA 4N02A 4UFHA 4AAJA 4GUGA 3OVPA 3SI9A 4O4VA 5HWMA 1JCXA 2CLFA 1TTPA 2J9XA 5FF7A 3G1VA 3W7HA 3GNNA 5DN1A 4FXRA 3TNOA 4JDBA 1QWGA 2WSQA 3MBFA 3A23A 3HG2A 1ME7A 3TSBA 1QPNA 2V2HA 3DFNA 2GPTA 4Y96A 3MHGA 5CPNA 1UUOA 3BV4A 2CZEA 4UTTA 4CQ9A 3ZWTA 5DXXA 1OFBA 2QCHA 5K9DA 1J5TA 4GXMA 4YCPA 1AK5A 4LNYA 3E0IA 5GVJA 4PA8A 4FB7A 2NUYA 3KRSA 5G2IA 2RDUA 3R89A 3UY8A 3W22A 3W23A 2VEPA 5EL1A 4AHPA 1YTKA 4ZQCA 3LXAA 4UR7A 3W07A 2W79A 3TV8A 1YPFA 2JKAA 4GUHA 3PVFA 1W5MA 3PG8A 4FNSA 2J88A 2TSYA 3KVKA 1WQ5A 2CLEA 1BEUA 2DZWA 4GWEA 5TIMA 2YW4A 4WUIA 1Y0EA 1ALDA 4M7TA 2Y70A 3IRDA 3N73A 4JTFA 5CSSA 4IMGA 1GVSA 3PR2A 2P10A 1DQXA 3NZRA 2YX0A 3EX2A 2ZRZA 4Q32A 2YZRA 4NT0A 3PM6A 4LVAA 4QNWA 1IIGA 5T26A 1S3HA 3P80A 3FJLA 1SZGA 2VEMA 4HN4A 4O13A 1QPRA 2JGYA 3NO5A 3C2VA 3LX9A 1Q45A 3CM4A 2XN0A 1HG3A 4HHPA 4CCCA 1VRDA 3DI0A 1IIHA 3I65A 5D2XA 1H7OA 2OZ0A 1FWRA 2H8ZA 4RZ5A 1VLIA 3NPUA 5LKYA 1O5XA 1RQHA 1C8VA 2NZLA 1RV8A 4JX6A 3P62A 1PCKA 1TQXA 1FQ0A 1F05A 4AF0B 3BW4A 3QF0A 1AL8A 1R2SA 4N4PA 1U5JA 1R47A 2Y7EA 2ZA2A 4JS3A 1LP6A 4EOUA 3HGOA 3IIPA 3MP5A 5CZTA 2G97A 4MZYA 4JGDA 1THFD 3STGA 1FWSA 5FEWA 5CZJA 2QJHA 3UWZA 1G7UA 2V2CA 4UR8A 1K03A 1H62A 1WYIA 1UJPA 1DBTA 2NXHA 3EB2A 2P0OA 1K8ZA 1W5NA 5DCBA 3PF3A 2KZHA 4AXKA 3P5YA 5LNSA 3VI2A 1DKWA 3S5ZA 3SJ3A 4I9AA 3QC3A 4JYEA 1KFJA 3NR0A 2ZZ2A 4CCEA 5HNRA 1FDYA 1BTMA 1EP2A 4FHAA 1WXJA 5IM51 4IOTA 4JTLA 3HPZA 5F1VA 3WJXA 5EA9A 3HPXA 4UIOA 1H7PA 2CLKA 2V82A 3MI6A 3SECA 4E2BA 5F2MA 3GKFA 3W1PA 5CPMA 4JX5A 4RLIA 3I7SA 2YCEA 3IEBA 4Y6GA 5C55A 1Z48A 2NUXA 5CZ0A 3TH6A 2A5HA 1FCQA 4O54A 3UWUA 1WOBA 3S8HA 1AW2A 3C2EA 3G18A 5D04C 4BWLC 3LBMA 4GUJA 3LI0A 5KZMA 1KFCA 4RJEA 3G1YA 2BLEA 5HUOA 1YXYA 4JTTA 2PRLA 2X16A 5I3HA 2V5LA 3B0PA 4NX0A 4DXVA 3W7KA 4JR5A 2Q8ZA 4RR4A 4PTNA 4ALDA 1SZFA 3OG3A 2WSRA 1JCNA 4LV4A 3EXSA 5K9CA 1XI3A 2R91A 3A5FA 1GT8A 5FEZA 2FLIA 2VFHA 3GXPA 1RPXA 2NX9A 4CLMA 1LLWA 1ML1A 3NL2A 2QDHA 1FDJA 3RLVA 4JTJA 1V7YA 4WOQA 1XUZA 3EWBX 4TX9A 4UTLA 4DF1A 2Z6IA 3BG5A 4JEQA 5DY2A 4ADSA 1T8XA 3QW4B 1IF2A 4OU1A 3G22A 3S5OA 3W88A 4PODA 4DO4A 4XKYB 3ABQA 4RKAA 3L68A 3W7EA 2A4AA 1FXPA 3JR2A 1YLVA 3GK0A 8TIMA 2HSAA 3NQAA 1RD5A 4UFLA 1OX4B 4HPJA 4JYFA 2GOUA 1OX6A 4BK9A 3MHFA 1VQTA 3TQVA 4ZQRA 2IQTA 2YFNA 4D2JA 1G67A 3M16A 2XFWA 3FYPA 5FF3A 3EKZA 4AH7A 2RH9A 4LS0A 1H1ZA 4Z1CA 1JUBA 3N2MA 5EKYA 3LCFA 4Y8FA 4O8RA 3H54A 4JTSA 1TV7A 4Y9AA 3NDOA 2Q8LA 4O16A 3VE9A 3TMLA 2C15A 2CZDA 4NJKA 4A2SA 2GQ8A 1F7BA 1SZNA 5F4XA 1FCUA 4CCDA 2AQWA 4CNNA 1G6CA 4TIMA 1TJRA 1W5PA 1YTDA 3S6DA 3IV3A 3KRUA 3O8AA 1DOSA 4LS2A 1DQWA 3TW6A 1J2WA 1VZWA 3FA5A 2X1RA 3IGSA 4QAIA 3EEGA 1K3UA 3EKLA 2VFIA 1KFLA 4MZ1A 3IIOA 4XQ6A 3ZS4A 3O6YX 1FWWA 4RZ4A 2CZ5A 1W3NA 3HJZA 3W7DA 3DXIA 1R46A 4OQVA 3CPRA 2X1TA 1WOAA 2ZRWA 3IGXA 4KWVA 1KLYA 1A53A 3LXCA 5I3JA 3TW7A 2DZXA 4MOZA 3N3MA 3L66A 1QPQA 1SZEA 2Y7FA 5G4EA 3DFOA 1QOQA 1GG0A 5AC6A 3L0GA 1ZAHA 4MJMA 4OV4A 3NQCA 2QR6A 5IBXA 2QAFA 4FIQA 4X3ZA 3LHZA 4JTKA 2O7SA 3C61A 1YDNA 4ADTA 3LCHA 3PC0A 1X8FA 3BW2A 1TPDA 3G3DA 2ZRYA 1O95A 3TFCA 2V8ZA 4O14A 1AG1O 1OFAA 1NSJA 1GZGA 1P4CA 4WJEA 1F73A 1H7RA 1OFRA 5F1UA 1XKYA 4H3DA 1SO3A 4IWWA 1SFLA 3TIMA 3PY2A 2QCDA 3KRZA 2Z2UA 3G1XA 1T99A 5AHLA 3W1XA 4MVAA 3UZJA 3TQKA 4N9BA 1PHQA 3CTLA 3TA6A 3RFAA 4HNVA 1K7FA 1GOXA 5F4WA 3CEUA 3NM3A 3OBKA 2Q3OA 1EEPA 4MY9A 4A2RA 4MZ8A 1TTQA 2DJLA 4O52A 4O12A 4LC8A 4OWGA 4LOCA 2A85A 3A9IA 1A5CA 3O05A 3L0KA 2CFFA 3AO0A 4UTWC 3A24A 2GVLA 4B5NA 3W87A 1BKSA 5HWJA 3P5ZA 3SR7A 1A5AA 4OGZA 5C54A 3W7IA 1K02A 3NQGA 1GTEA 4IXXA 4UUIA 3C2RA 3W9ZA 4CNPA 4NZFA 2ISWA 2R94A 1TRDA 3W1UA 4AB4A 1B9BA 2NV1A 1F6PA 2CZFA 3EWZA 2X2GA 4FEZA 4ONVA 1ICQA 3H55A 3U6WA 4LTSA 2V0TA 3DKJA 1FCBA 3MJYA 3VCRA 1TPWA 4UFIA 1SR9A 4IUOA 1EX5A 3SSJA 5FI8A 4EVZA 5FF0A 1KM5A 1LROA 2A7RA 2Y61A 3GX9A 3W7RA 4O0KA 3CU2A 1TMHA 1HO1A 4HT3A 4DEFA 2NX3A 3TAOA 3LOTA 3LCGA 2Y63A 4IMEA 3EX6A 4LC6A 5LSMA 1K8YA 2YR1A 4FNTA 3P7YA 1LRQA 4LUJA 3GDLA 2QUVA 1OYAA 2Z1BA 4BF9A 3EX4A 4XTIA 3HF3A 1H1YA 1UCWA 4MIMA 3FEMA 3C2FA 2VFEA 5CGQA 4XZ9A 1LOQA 4MJZA 1EP3A 1IXPA 3STEA 3G1HA 2ZCGA 2E6YA 5G4WA 3W7CA 3G0SA 2YPIA 1ZCOA 2HS8A 3Q2DA 5TQLA 3NZ1A 1VGAA 4JIQA 1TRIA 1KTNA 3EX1A 4A29A 3FLUA 3PB0A 5H2ZA 4LUIA 2V5BA 4DELA 1ICSA 1SW7A 4PEKA 3B06A 3UPBA 5LGZA 5KTLA 1JR1A 3OEXA 5D09A 2BSLA 1HFBA 3NQVA 4N2YA 4EWND 2ISVA 3WK1A 1F5ZA 2EAWA 4ZMGA 2X1UA 2ATSA 1KM6A 2ZYFA 3HG4A 2Y7DA 2PRHA 3C0JA 5LHEA 1MXSA 4FNUA 3THAA 3T78A 3QJAA 3KFTA 4K38A 1JQVA 1XUUA 1H5YA 1MSSA 5C5YA 1ZNNA 3WJWA 1Z44A 2YSWA 4JX4A 3C52A 2NXGA 2Y89A 4XTDA 6TIMA 4K39A 2LLEA 4WY0F 1K7EA 1KTCA 4JXCA 5D37A 1FUYA 4EF8A 3O6CA 3DFSA 3IVTA 3W72A 4OBTA 4QSHA 1OFPA 3UWWA 4Q33A 3DAQA 5DXYA 3TAKA 1LM1A 3CWNA 1O5KA 3ABRA 1W1ZA 1LRTA 3KX6A 3UQNA 3W2KA 2RHGA 4Q4KA 3O06A 4AHQA 2OT0A 2I9EA 3BVJA 3MWAA 3W7JA 5TBOA 5EYWA 4LVBA 5MHBA 3ZWSA 1VLWA 1DL3A 4PC8A 3CLMA 3W1TA 3NQ2A 5EBUA 1M7PA 1XC4A 1QOPA 3N34A 5J5RA 1QAPA 3O15A 3WJZA 4IPJA 2QCNA 1B3OA 1YADA 3NYZA 3ZR4A 4PCFA 1T0OA 2RKXA 1YDVA 4BWLA 4EIVA 1LCOA 1LZOA 4IMDA 1PCWA 4R7JA 2QCGA 2PURA 3LRKA 3PULA 4N9EA 4H6KA 1X1ZA 4IX2A 4ZZ9A 5HWNA 2C14A 1DVJA 3M5XA 3M44A 4PFMA 1H61A 1F74A 1W5QA 3MMTA 3DU0A 2H90A 2EHHA 1JQXA 3W84A 3OIXA 3L9CA 1DV7A 4WZHA 3NQ7A 4AWUA 4GRSA 4UTMA 4XWUA 3CIXA 2V2DA 4ZL1A 2C6QA 4ZQOA 3LTSA 1XBZA 4S2CA 1I2PA 1XBYA 3HOJA 5F2LA 4R34A 4M19A 2A21A 2E5BA 2Y88A 3PWAA 3BPWA 1XXXA 2YFOA 1VR6A 3FYOA 4QNEA 2Q3RA 3G1DA 1PL9A 2J9ZA 2CLIA 3T55A 4GJ1A 3THQA 1VCGA 1L6WA 4YCOA 4DQWA 4HKPA 3NQDA 3SIZA 3W7MA 3MW7A 3M0ZA 4PH6A 2QF7A 3LHYA 5DCEA 4YWIA 3QPYA 2BTMA 4LRTA 1SO5A 5FEPA 1GTHA 4UTUA 3LBCA 2I14A 4FNPA 1QDSA 2FPYA 1YPIA 3AJXA 5LNWA 4DBEA 3Q37A 1VPXA 1OHLA 2DZSA 1CW2A 1TJPA 3WJSA 4O10A 3T7VA 2NWRA 1ZENA 2QAPA 1JJKA 3O6DA 3LCIA 4RXGA 3LCXA 4RX0A 4PL2A 3SFKA 3TFXA 1LLZA 4GUFA 3IVUA 5D2WA 4ORMA 1TV8A 1FY6A 2AAMA 3GYEA 3O16A 2VFGA 4K37A 4DF0A 3R8RA 3TJXA 4MFDA 4NJHA 2CLLA 4NZJA 3E96A 3SZ8A 3P82A 4M6PA 1EUNA 4U28A 3GKAA 1W37A 2NXIA 2QDGA 1LBFA 1SW0A 1IXNA 2G5WA 3M5YA 3C4UA 3INPA 5D2YA 3C6CA 1FDZA 3BLIA 3UWYA 1WBHA 2B7QA 1Q6QA 3LI1A 3UYCA 2YYUA 1SW3A 5L9FA 1HUVA 4UCGA 3G24A 2JKEA 4MY8A 1VYPX 1ZHAA 3CWOX 1G4TA 2PC4A 1YXDA 5AYZA 2DU2A 3OA3A 4TMCA 3GDKA 3BG3A 1TYGA 3F4NA 5I3GA 4IXHA 1TPUA 3G0UA 1LOSA 1DJNA 2H3DA 3LCWA 1SSDA 1O60A 1WBJA 2WV8A 2TMDA 3KVLA 1E51A 5HQEA 3P67A 4HPXA 3W1LA 1WV2A 1KLZA 3M1ZA 4FIRA 2GJLA 3IGUA 3QQ1A 5F2IA 3LLFA 1KBJA 3W2MA 1H7XA 5LZLA 1QR7A 5CSRA 5AYYA 3RMJA 2ZRXA 1QO5A 5AN7A 2RFGA 1M6JA 3W1MA 3W1QA 3EXTA 4NXSA 3CEPA 3QEZA 2HTMA 1W5OA 4O11A 3TC6A 1MO0A 3V75A 3NPWA 4Z0JA 4BI5A 3S5NA 1AMKA 3T44A 1TPH1 3FKKA 3HGRA 3NQ6A 1ZALA 3Q94A 3UY7A 1VS1A 1OFEA 4JTUA 1XM3A 3M7WA 1KV5A 3S1WA 4LS1A 4L4LA 4MPQA 1TQJA 2BXVA 3LHWA 2VXNA 5K4XA 3T4CA 5AC8A 1DORA 1Z42A 3P74A 3N14A 3LXBA 2YXGA 5BRBA 1KW1A 1L6SA 4RK8A 3LERA 3E02A 3IIXA 3B4UA 2BWGA 2C13A 3M9YA 1QCWA 4P61A 3GR8A 2GJNA 3GXNA 3NNTA 3WFAA 3D0CA 1OYBA 4UTWA 4GNJA 4RCXA 1R2TA 4O1BA 1SQ7A 4GE8A 2DJXA 3JS3A 1EP1A 4UTIA 3O1NA 4M6VA 1TPEA 3L0NA 3A22A 1GPWA 4QM1A 5HR7A 1DJQA 2YYTA 3U8GA 4O18A 2W6RA 5HINA 1RZMA 3W7NA 1N55A 2VFDA 1W56A 1H51A 4UC5A 4DO5A 3GDRA 1SUXA 4O19A 3QSRA 1TREA 3MYOA 5HULA 3P61A 3W74A 3NQMA 4O50A 1CX9A 4UNLA 2CLOA 5FF2A 3F1QA 4I7UA 3DBPA 4POCA 2CWNA 3HGJA 1W0MA 2NUWA 3NA8A 1KTBA 1OF6A 5LHFA 1W3TA 2DZVA 1GYLA 3L21A 5DLCA 5CPOA 4MLRA 1ZFJA 2TYSA 5J5DA 3DFTA 2FB2A 4HSNA 4JY8A 4OE7A 1JUKA 3QZEA 3W70A 4A22A 1I4NA 3S9YA 4UTKA 1PHWA 1I2OA 5K4ZA 2FTPA 3GLCA 4TMBA 4Z0SA 3HMJG 3V1PA 1TB3A 4R33A 5AHIA 5A8GA 3W83A 1OX5A 1ZY9A 3WK2A 3F4WA 4N6EA 3R12A 3W2LA 1G4EA 2J27A 2YGYA 1KV8A 3YPIA 1GQNA 3TDFA 1CI1A 2GVGA 4MY1A 2B4GA 3VKJA 1KM0A 4C1KA 3W76A 3N9SA 5KZEA 1NF7A 1KFEA 1XFBA 2E77A 4UFJA 5SWUA 3QSTA 3TR2A 2C16A 4IGHA 1QMLA 1KM4A 5K9XA 3LTPA 1W31A 1MEWA 5ABTA 1FWNA 4DO6A 4WOZA 4IMCA 2CW6A 3W3OA 4JTEA 3NM1A 1GVRA 5C2XA 4S2BA 2QJIA 1LBLA 1TCDA 1TPB1 2H6RA 2Z0IA 1FCVA 4JDYA 3QMSA 1UUMA 2VEKA 3W1NA 1OABA 3TROA 1S5TA 2OJPA 4MLJA 2Y7GA 4Z1DA 3W71A 3EWYA 5LNUA 2PRMA 1JULA 2EF9A 3FJ6A 3DHFA 3CIWA 3GNDA 5BOOA 3W7PA 5AHMA 1PS9A 4K6AA 2OX1A 1BWLA 2X30A 3LHTA 3LV5A 5DBTA 5BNKA 2X1SA 3NOEA 3EWUA 3ANYA 2ZZ6A 2EPHA 3TUUA 4GFSA 1ZAIA 1H63A 2E68A 3LTYA 4ZVJA 2C19A 2VOMA 3DI1A 3NGJA 4FNQA 2O7QA 4N9DA 5EY5A 3QM3A 1TPFA 3F03K 2QUTA 5G1TA 4AVFA 3GR7A 5EMUA 2CU0A 4QISA 2UV8G 4NJGA 5EPDA 4XKYA 2TRSA 3G0XA 3H53A 1MEIA 3TE9A 2V30A 2VELA 3G3MA 1EWEA 3MP4A 1OX4A 2E6FA 2WOQA 4RXFA 2PE4A 3PSVA 1L6YA 1NVMA 3NL3A 2ZZ1A 3QMRA 3EX3A 4NJJA 2ZQ0A 3STFA 3P8JA 3NL6A 3UWQA 3GB6A 2QCFA 1Q3NA 4JTHA 2GVJA 4UFMA 3L65A 1BWKA 5KITA 3L2IA 4UXDA 4ZQPA 4NNAA 3NQEA 1KM2A 2A1YA 3TQ0A 4JYDA 4A3UA 1X1OA 2FQIA 3QMTA 3I6RA 4AWSA 1VYSX 3BG9A 3W86A 4K36A 4GC4A 1VC4A 5G5IA 1FBAA 3S0CA 3KAOA 1UASA 5K7JA 3TSMA 4HNTA 4DPQA 3PBVA 4LVDA 3LB0A 1G7VA 3W85A 1SPQA 3G1FA 4K8HA 3SW6A 1RR2A 5K2ZA 2ZRUA 3NL5A 1SSGA 2JBMA 3C2OA 2B7OA 1ICPA 5AYXA 1XL9A 2GUUA 2ZZ7A 3O07A 1C29A 2HS6A 4WD0A 4P2VA 3BO9A 4MFEA 2VKZG 3BGJA 3TC7A 2JGQA 3QPZA 5E1QA 1ONRA 2E5CA 3PUDA 3DFQA 4FX6M 2ZZ5A 2C3ZA 3C8FA 4YL2A 4TU1A 4M5PA 2AGKA 1MZHA 1OJXA 1RQEA 1TTIA 4O57A 4LU0A 2Y6ZA 3B0VC 2QCLA 5FEXA 1RVGA 1EB3A 3M47A 4FX7A 1R30A 4XBKA 1SU5A 1M5WA 3DFPA 1GWJA 3VFLA 1KFBA 2FDSA 3MP3A 2E1DA 3GAYA 1IXQA 1OG0A 3DKLA 3KVJA 5D2TA 2E6AA 3BARA 2QCEA 2OMAA 4W9TA 4JICA 4JY9A 4N9CA 1U83A 3DENA 4UMAA 1LBMA 2TPSA 2QKFA 4LVFA 2J24A 1OK6A 5E0KA 3W2NA 3W2UA 2NX1A 5CPLA 3TJLA 2G95A 3NPVA 2QCMA 1HO4A 2Y62A 1JUEA 1VCVA 1PVNA 1TTJA 4O1AA 5CKSA 3W7LA 2ZA3A 1H7NA 1Q6OA 1SO6A 4NUWA 1LTDA 3KVMA 3G1AA 1VH7A 1AL7A 4H4IA 1H7WA 2FPTA 3HIJA 4BFAA 2A0NA 2B7PA 3I7RA 1Z41A 1TSIA 3PG9A 3L5AA 3MHUA 1QFEA 3B8DA 3PUEA 1G4PA 5D03A 4O0ZA 4WY0A 3C3NA 1GVOA 5D33A 1P5BA 3S1XA 2EKCA 4O53A 2JK2A 3HGSA 1L2UA 2ZBTA 4ADUA 1S5VA 2G96A 3IIVA 4QIUA 1HL2A 4TR9A 3LRMA 2YDAA 5D2VA 2Y85A 1GVFA 4O28A 5DBUA 2A6NA 3LRLA 2A7PA 1YDOA 2E5DA 4NXKA 5H91A 4UFKA 2PCQA 1S5WA 2WKJA 3DH7A 3TKFA 3NG3A 2ABBA 3DZ1A 4I7WA 3LHUA 1IXOA 3R2GA 4O1DA 4FX8A 1EUAA 3A5VA 3LV6A 2ZZ3A 1LDCA 4LY8A 1W3IA 3CC1A 3WJYA 3PUOA 1LYXA 3E49A 2FFCA 2WNQA 3I68A 2C0AA 3O63A 1X7FA 1XBXA 1NFBA 4LW7A 4DBDA 3R13A 3TCEA 2XN1A 1LOLA 3PSWA 3C56A 1K7XA 3L5LA 1FXQA 1OYCA 2C18A 3MI2A 2ISSA 5L6UA 2QJGA 1EIXA 2A6LA 3NPXA 4CNOA 2QUUA 1YTEA 3S1VA 3G8RA 4GBUA 5AHEA 2ZTJA 4DPPA 2YW3A 1J4EA 4Z1BA 3N2XA 1I2NA 1B57A 1WAUA 3P60A 1OFQA 2CLMA 4ML9A 2QCCA 4NNBA 4UTTC 3UXAA 4X2RA 1A5BA 3TXVA 5KSWA 4X22A 5HUPA 1LORA 1TO3A 2Z6JA 1JCJA 3EXRA 4LVGA 3CHVA 3OVQA 2ATMA 2J9YA 3W1AA 1D3GA 1TIMA 3B0UX 5AFDA 2DZPA 5I3KA 3N19B 4AWTA 1ME8A 3STCA 1QO2A 1R2RA 5I3IA 3TSDA 1OF8A 2R14A 4Z08A 4Y90A 1VCFA 2R8WA 2OT1A 1W54A 3UNDA 3QH2A 3RF9A 2QCDB 5HJLA 3KOFA 1XDMA 3R5EA 3GXTA 4JD4A 3JRKA 1KM3A 4IPIA 3QW3A 1NAL1 4MKNA 4UMCA 1QPOA 1B4KA 1Q6RA 3HO8A 1A50A 3RU6A 3TMQA 4AMAA 3Q58A 3RK8A 4XUGA 2NV2A 4DF2A 2ZRVA 2E09A 4XBSA 4KKXA 4LT9A 3TX9A 2P1FA 3GDTA 1W8SA 4ZQNA 3N9RA 3NAVA 3LM7A 3VE7A 3M5ZA 3WK3A 1QNVA 2VENA 4ICNA 1OVDA 2VFFA 4E38A 5LNVA 4LRSA 4N4QA 3NQFA 3ZFHA 1GJPA 2FJKA 3W2JA 3NQ8A 5U4NA 3GZ3A 2ZDRA 1SFJA 3HG3A 1RQBA 1I2RA 5KMYA 3LDVA 1PV8A 3CT7A 3NXFA 1KBIA 3QFEA 3M6YA 3K30A 4Z1AA 3TXZA 4OT7A 3BLFA 2GQAA 3LHVA 4LV9A 1O94A 3B04A 1VJIA 4K7VA 1GG1A 5F2GA 4FXSA 4K8EA 2WJZA 3G8EA 2A7NA 2WNNA 2J6XA 1IGSA 5A5WA 3KHJA 1YYAA 1ZJIA 4NVTA 2BX7A 4UNKA 4N6FA 3E12A 1EPXA 4JIPA 3FIGA 4KWWA 1VHCA 5CG7A 3W6YA 4WX2A 2ZFAA 2CLHA 4WXYA 1L9WA 1EA0A 3CQ0A 2ABAA 4MYAA 2C1HA 3VNDA 1F76A 1N8FA 4U4MA 5G1YA 1I2QA 5LGXA 1GEQA 4RV8A 3PBUA 4IMFA 3UZ5A 3P81A 1HTIA 3ELFA 1H60A 3MBDA 3BGGA 4YMZA 1ADOA 5DY3A 1G69A 3PS7A 2FPVA 3RNDA 4AF0A 3UPWA 4HNUA 2ZA1A 4IJBA 3A21A 1P0KA 3W7GA 3FFSA 1KFKA 2DP3A 1D3HA 5F4SA 3HPSA 3UXDA 3GDMA 4K7YA 1GVQA 2H8XA 5C6MA 4FF7A 2VC6A 4NJIA 3SY5A 5U7SA 3SGUA 3L67A 3W73A 3I7QA 2EGZA 2W0UA 1PIIA 4KFOA 3W1RA 1N7KA 4O4WA 4PL1A 5D30A 4JTIA 3LCLA 3ATYA 4UTJA 3L5MA 4ORIA 3MI3A 1ZAJA 2FIQA 1AW5A 1EWDA 3GVGA 2F7FA 3G1SA 1M7OA 5AC7A 4NU7A 2WO5A 3PBYA 4I7VA 2WQPA 3PB2A 5G2WA 3W75A 2A2IA 4YXGA 4RZ6A 1TV5A 3DGRA 3IIZA 3S1UA 3KXQA 1JCMP 2NWSA 1VYRA 2ZTKA 1UBSA 4KFPA 2QEZA 2DORA 3GAKA 5D38A 3E9AA 4QJ1A 1KA9F 1WX0A 4S1FA 5D05A 1YXCA 1NEYA 1JRBA 3HG5A 3IVSA 2V9DA 2RDWA 1A5SA 1TPVA 5K3VA 3P8IA 5BMWA 1OFDA 1UB3A 3QYQA 2FB3A 3LGEA 3WK0A 4LWWA 4OHQA 4E2DA 1O4UA 3M43A 1XCFA 1F2JA 1H50A 4MYXA 2WSYA 5FF4A 1OFOA 5LNRA 4L4MA 3TU9A 3CB8A 1JRCA 4E0CA 3U2OA 1OK4A 1I8JA 4ZQMA 4BI7A 4BR1A 1GYNA 2RDTA 4YLWA 1JVNA 2ZZ4A 4X9SA 3UWVA 2BZNA 3FKRA 5E93A 2DZTA 4WY0B 3HB9A 3BW3A 4FO4A 5HR6A 3EWWA 4O1CA 4NNCA 3W7OA 2ALDA 5G2HA 5FESA 1I45A 1B4EA 3HBLA 5DELA 5AOUA 3PBWA 1X6UA 4QQ3A 3DHDA 3S42A 3B03A 4NQ1A 4AEOA 4A21A 3UD6A 4J9JA 7TIMA 3P84A 3USBA 4AHOA 4CQ8A 1JCYA 2I1OA 5AB3A 1D9EA 3PAJA 2H3BA 3LLDA 4WXZA 1G4SA 3FS2A 3EWXA 1NF0A 3ABOA 2F84A 1T96A 1JCLA 1XBVA 2DZUA 3M41A 3BLEA 4JNMA 4CQAA 3NEVA 3HQ1A 2VEIA 1TPC1 4FNRA 3QRHA 4IQLA 1Q6LA 3ATZA 4IX0A 2WPBA 2GQ9A 5CZSA 3B05A 1VHNA 4OV9A 2OCZA 2V81A 5I3FA 4HSOA 5KZDA 2WNZA 4HIBA 5IBXC 3GIYA 5D02A 3T40A 1WA3A 1SO4A 2B0MA 4UMBA 1ME9A 2NLIA 4KFNA 1FWTA 5AHNA 2HMCA 1F6KA 1LRNA 1P0NA 4BI6A 3QQ0A 4C1LA 3M5VA 1FX6A 3SGZA 1DHPA 2JKPA 4O15A 1KM1A 5KINA 4GUIA 1C9DA 5HMSA 3OVRA 3MYPA 4WQ6A 1V5XA 3TK7A 1WDWA 4O17A 5BW6A
chains in the Genus database with same CATH superfamily
2WZIA 3CASA 2J7EA 4GZ7A 6ALDA 4AD2A 3FXYA 4M7SA 2I9UA 2RJHA 2TODA 2B7NA 1E5NA 1FFRA 1XP3A 3W7QA 5AHFA 2EPMX 2FGBA 3GY1A 1EF2A 5BRPA 3RLUA 2WBGA 4MUZA 1EA9C 1J01A 2DIKA 3OHIA 4OFCA 4N02A 3PWIA 1UWSA 3B9EA 4UFHA 4AAJA 3OVPA 2YIHA 1WCGA 2CLFA 1O12A 2J9XA 3T0CA 3QHNA 5DN1A 2GVEA 1A5UA 5I79A 4XZLX 3MBFA 1Q65A 1XH0A 1V3KA 1AQFA 2D69A 3TSBA 3S6OA 3DFNA 5A2AA 5I07A 4CN1A 3VOHA 3BLKA 4RL3A 1K9FA 2PWHA 2PGFA 1T40A 3SDOA 1JPMA 1B2YA 2VEPA 1QASA 5EL1A 3UU0A 4UR7A 1ZL1A 3W07A 1V3MA 1YPFA 2JKAA 4GUHA 4XAZA 2J78A 4U3CA 1W5MA 1JZ5A 1G94A 1GVIA 1KXVA 2J88A 1UD5A 4R88A 1FKXA 4M7TA 2Y70A 1OCBA 4IMGA 1GVSA 2RDXA 2ZRZA 4MADA 4FLOA 3ZT5A 2YZRA 1LL7A 2Z1SA 3PM6A 1R9ZA 3BCJA 3NO1A 5T26A 1ZB5A 4HPGA 1QPRA 1V3HA 3NO5A 4KGJA 4ZB0A 4NYUA 4N7QA 3C2VA 3LX9A 3SQSA 4QE4A 4D6EA 3WIJA 2O56A 1H7OA 2OZ0A 1R8LA 3AS0A 2H8ZA 3NPUA 1RQHA 3TOPA 1MFVA 1RV8A 1OQFA 1TQXA 2VL4A 1F05A 3QF0A 3PWGA 2A3LA 3SEPA 2Y7EA 2ZA2A 3OGVA 4G1NA 4JS3A 4EOUA 3QR0A 3HGOA 3IIPA 3MP5A 2D0FA 3UVIA 4WEVX 1PKYA 4GYPC 5CZJA 3MUIA 3KBNA 1G7UA 1QHOA 4JCLA 4YVVA 2I56A 2P0OA 3S9IA 5DCBA 3PF3A 4AD3A 1GOIA 1A47A 3CLWA 3ZT6A 3SJ3A 3PK7A 4JYEA 3EPMA 4Q6XA 3W81A 1XLKA 3CUZA 1CBGA 1M41A 5HNRA 1SMDA 5A94A 1WXJA 4IQJA 3MTWA 1R3TA 4WJ8A 1XIEA 3HPZA 3WJXA 1QK0A 4GQGA 2FH6A 3ZQ9A 4NKCA 3E3HA 2G50A 1H7PA 2CLKA 4PEEA 2RUSA 1PIFA 3EB4A 3TWBA 5F2MA 3GKFA 1HGYA 5CPMA 4KRTA 4RLIA 3I7SA 2GGHA 3IEBA 4CU7A 5C55A 3KRBA 3TH6A 3T2OA 3GE7A 1BXBA 3S8HA 5D04C 3AIRA 1H2JA 1FWCC 3LI0A 4O1FA 3AXMA 3O3RA 3BAYA 4C1NA 4DI9A 4JTTA 2PRLA 4MAZA 3W7KA 4YTSA 3IRSA 4PTNA 4ZO6A 2XPKA 1TZ7A 2L5HA 5HPOA 4WLCA 1QW8A 2REQA 3A5FA 3HQPA 2QNEA 4KH2A 3BLDA 2NX9A 3GVVA 1ML1A 1FDJA 3SCQA 4U3AA 2DSUA 3UPMA 2F6UA 5A8PA 1A5KC 2Z6IA 5LYRA 3KS5A 5DY2A 5I6SA 1HQTA 4PUNA 3G22A 2ZIDA 3M64A 4PODA 4AIUA 4QEHA 4RKAA 4L4OA 1WZMA 5GJNA 3W7EA 2FHFA 1A49A 2A4AA 5GNZA 3JR2A 3GK0A 3VC5A 5I09A 1MMFA 3NQAA 3N6HA 4IISA 4NZ1A 3L4TA 3CUGA 1OX4B 1W3KA 1AD1A 1EDQA 4QG8A 3CHDA 4BK9A 4JHZA 2OQHA 3OP2A 4CGTA 1G67A 2XFWA 5E70A 3R0DA 2HRWA 4LS0A 4ZOBA 4B5VA 4Z1CA 2OEMA 4JTSA 1TV7A 4XVEA 3E5PA 3NDOA 1ISVA 4IF2A 4Q7BA 1Z32X 1KGUA 1B3WA 1S2VA 3SUTA 1HP5A 4S23A 4YVXA 4GK8A 4CNNA 3WD3A 4XVDA 4LB3A 1YTDA 3GG8A 1HVXA 4GY1A 3LPOA 4OUEA 3KRUA 3O8AA 2O4QA 2EO7A 1LJYA 1LL4A 2YL5A 4CQDA 1VFLA 4QAIA 5BYWA 1E70M 1V51A 2GGEA 4GJIA 2BBFA 4LX4A 1QW7A 4L61A 1FWWA 4RZ4A 1W3NA 3HJZA 2OB3A 3LUTA 4OQVA 4FI4A 3KZSA 4JTAA 1HJXA 1WOAA 2ZVIA 3IGXA 2WYSA 1MYRA 1JDAA 1U2YA 3F2CA 2WC4A 1HNYA 3W25A 3AMGA 6XIAA 1A0EA 3M0KA 4LYRA 4MJMA 4OV4A 2BXZA 2QR6A 2C8NA 5BCAA 4H19A 2FGLA 3BURA 4FIQA 1EGVA 4FOUA 1YDNA 4ADTA 1UUQA 4DWDA 4DWSD 3TFCA 2V8ZA 3G6LA 1CGTA 4O14A 1AG1O 3TONA 5LA1A 3WH9A 1OFAA 3LZ5A 4JHOA 3VD3A 4UR9A 2V5DA 1SO3A 1O1ZA 1JPKA 3TIMA 2QCDA 5H6HA 2J8FA 3KRZA 1T99A 5AHLA 5EMYA 2IPJA 3UZJA 4CNTA 2ZUUA 1D3CA 2VQUA 4Z2KA 1K7FA 3MKCA 5F4WA 2Q3OA 1IEQA 2XSBA 4LYPA 5B7YA 2DJLA 4P7LA 5FSDC 4LOCA 1UR3M 2A85A 2X41A 3L0KA 4WRHA 4QQUA 3AO0A 3A24A 2VCAA 2EPLX 3QZ6A 1S2WA 1XGEA 4OGZA 4UUIA 3NQGA 2PDCA 4YJ5A 3W9ZA 4CNPA 2EEXA 3JVAA 2VR4A 1TRDA 1BG4A 4W85A 1ADDA 1B9BA 2NV1A 4ONVA 3UFYA 3FY1A 1X8CA 3U6WA 4U31A 4JIRA 2PTYA 3AOFA 4KQNA 2QPUA 1P0DA 4UFIA 1UROA 4HZ7A 4EVZA 2ONEA 1UR1A 4P8VA 2A7RA 4YTTA 1HO1A 2ZXAA 5CEWA 4DX3A 4DEFA 3TAOA 3EGJA 3EX6A 1K8YA 3WQ6A 5C2CA 3VVGA 4YNGA 3P7YA 4DN1A 4YS1A 1PX8A 1H1YA 1UCWA 1PX3A 3FEMA 3PZQA 2CYGA 1IHIA 1HF6A 4XZ9A 4PZVA 3IPWA 4FLRA 1IXPA 3STEA 3L2MA 5G4WA 3S47A 1V6WA 1TRIA 1P48A 1KTNA 4Y9NA 4D8AA 3PB0A 4S3EA 1GQLA 1NDZA 1M01A 2GWGA 4DELA 2NQZA 3TJIA 3G6MA 3FYYA 1JD7A 3W01A 5CBBA 3WK1A 1HL8A 3PZUA 4JIHA 2WLZA 4P7OA 2X1UA 1KM6A 3HG4A 1D7FA 2Y7DA 3WMSA 1E6NA 1GCYA 1MXSA 1TKKA 4FNUA 3T78A 2P3ZA 1TJ2A 1NTHA 1HKIA 4FMVA 5C5YA 1ZNNA 2PDNA 1ODUA 4IT1A 1Z44A 3SN4A 2YSWA 1NQ6A 4RW5A 4XTDA 2ZUSA 3U5YA 4INFA 2X7WA 1VF8A 1K7EA 1PO9A 3LG3A 3UGVA 3LA4A 4AFYA 3UWWA 3TAKA 1EGMA 3T08A 4N0RA 3E0VA 1IR2A 3QKEA 1W1ZA 1UP0A 3B8VA 3W2KA 3C5QA 4EK7A 2PCEA 3O06A 4XD4A 3NZQA 2OT0A 4AY8A 4R7WA 1WKEA 1NJJA 1P0EA 5EYWA 3ZWSA 4UOQA 1IQ8A 1VLWA 4GQQA 1DL3A 1W9XA 3DESA 2EPOA 2BB0A 2CWXA 4UCFA 3HPAA 3WLRA 1PTAA 3O15A 2BHUA 1XIHA 3WJZA 4IPJA 4AZ7A 3K8KA 2XHYA 1YADA 2OO0A 1JD9A 3VOIA 3U57A 3OODA 2G3MA 2CZVA 4EIVA 4R7JA 4D6HA 2QCGA 4E4FA 3WMBA 2UY3A 5E0FA 3R25A 4IX2A 3M5XA 4WDTA 5KEZA 3DU0A 3W84A 3OIXA 2AL1A 2YLAA 3NQ7A 4AWUA 4WK9A 4XWUA 2DT3A 4ZL1A 3MSGA 1I2PA 2PPGA 2E5BA 1CEOA 3BPWA 3PPHA 1XXXA 3NURA 2YFOA 3BAKA 2YDQA 1VBRA 3UGRA 2CLIA 3UJEA 3KP1A 3C86A 4GO9A 3TYCA 2VC5A 4LSBA 4XB3A 1Y5WA 3C3UA 3VIFA 3RO8A 3W7MA 4H41A 3PZOA 3LN3A 4PH6A 3GWQA 1UWQA 2I14A 4DBEA 2DVXA 1OHLA 1TJPA 3T7VA 1ZENA 5IDZA 2GGJA 3NJ3A 2OYKA 2H9AB 4EPBC 3KOXA 2VX5A 3IVUA 2OLSA 3TWAA 3CIVA 2Q09A 3R8RA 4MFDA 1EUNA 1JI1A 5BWAA 2OYMA 4J3SA 1IXNA 2G5WA 3CUHA 3M5YA 1V6YA 4O8AA 3UWYA 3ES7A 1Q6QA 3GIQA 4LAOA 3UYCA 4C7GA 5L9FA 2DVUA 2FHCA 4MY8A 1XLGA 5HATA 4TVCA 3E2VA 2HDJA 2V38A 4KRUA 3GDKA 3F4NA 1I6NA 1NOUA 3S2LA 4IIHA 1TPUA 2QV4A 1ZQ5A 3DG7A 1O60A 1WBJA 2TMDA 3V5FA 3KVLA 1H1NA 3KBWA 3F2BA 4CKQA 3R4IA 2WKGA 1UC4A 3ZVHA 5IFTA 1KLZA 2BY3A 3IGUA 3CUFA 4IP4A 5HNUA 1UWRA 1TCMA 3PBMA 3MANA 4HNOA 3H7UA 1MUCA 2PDFA 4BF5A 5LZLA 3MKKA 2WXDM 4ATWA 3BSHA 1XINA 4GC3A 3W1MA 2PGWA 3CEPA 1KGXA 3VGBA 3QEZA 2HTMA 1W5OA 1VENA 3K8MA 3GTXA 1MO0A 3NPWA 4Z2JA 3PZTA 3FKKA 1OCQA 2NQ9A 3ZXWA 1T6MA 3Q94A 1VS1A 4JTUA 4C6DA 3S1WA 3KCOA 4L7ZA 2BXVA 3VFCA 2VO5A 1OG6A 3LHWA 3VIMA 3T4CA 1O5RA 1OCNA 4CNSA 3PNUA 1SJBA 4GY7A 3MB9A 1ONXA 5BRBA 2XWDA 1L6SA 3LERA 5A2CA 3IIXA 3T0DA 1W6TA 3QR1A 1SQ7A 3WY1A 5TAOA 4HK5A 2QDDA 3V35A 4M6VA 3PNZA 3A22A 1V77A 5HR7A 2YYTA 4QFUA 5HINA 3TLLA 1N55A 1H51A 2VI0A 4QLLA 4UC5A 1GHSA 2YDSA 1BLIA 4H9MA 3WNMA 4YIWA 3QSRA 1AH3A 3NQMA 1CX9A 1CXLA 4XV0A 4I7UA 4POCA 3GNOA 3HGJA 1EHNA 1A3XA 1W0MA 4B16A 1CT5A 4JZ5A 1KTBA 1OF6A 2IW0A 5LHFA 3L21A 4GMEA 3BCFA 3C0QA 5C9UA 1GK8A 4I9TA 1S2AA 2VMFA 1FOBA 5J5DA 1LWHA 2E7FA 4OE7A 1JUKA 3GXDA 3WYZA 3S9YA 4UTKA 1IGWA 2VT0A 1PHWA 1DWJM 1E1CA 4J2MA 4LF1A 3HMJG 2CETA 3V1PA 2X0HA 3F4WA 5JBEA 1U5VA 2R1MA 2B4GA 4PRWA 4K68A 2W27A 1KFEA 1XFBA 2MANA 2O0TA 3EWDA 1W31A 3IK2A 3N2TA 1NWSA 3PZVA 3F4CA 5A6KA 3WQGA 4O0QA 2QJIA 1LBLA 4FA3A 2CKRA 1LL6A 3CV7A 1OGBA 1OABA 1S5TA 4Z1YA 3CH9A 4UQ9A 4UZSA 4QCEA 4WGHA 2VCCA 3GNDA 3W7PA 3M0IA 5AHMA 4JIEA 2B81A 2OX1A 3D6NA 3ITGA 3L12A 4C6QA 3ANUA 1R38A 2BS9A 2VVSA 4S3JA 3NSNA 4A35A 3EWUA 3OVGA 3WQ5A 4L9XA 2AAAA 1QTWA 5M3WA 4LANA 3KTCA 1EFZA 2DGAA 3NEHA 3BOFA 1YW1A 4N9DA 1TPFA 2VGFA 1G5AA 2VDHA 1J0KA 5G1TA 4AVFA 3GR7A 2CU0A 3UZYA 1SFSA 4QISA 4BS0A 5A6BA 4NJGA 4XKYA 4CNUA 1RLCL 2Y8UA 3SY8A 4JN8A 1RALA 2E6FA 1BD0A 1P1MA 4A8RA 3PSVA 4GNKB 2ZZ1A 3E2RA 3NL6A 3VGHA 2HBVA 4JTHA 3L2IA 1N2VA 3WBXA 3QMTA 4AWSA 3P93A 1EOKA 1CWYA 1UASA 4GFIA 4UWMA 3QOKA 4YU1A 3TSMA 2YZ5A 4DPQA 2J6VA 1S39A 4IUGA 1CB2A 4LVDA 1TX2A 1MVYA 2XIQA 3B9NA 1KD0A 4MUPA 1EO5A 1SPQA 3G1FA 4K8HA 5FJIA 4PSRA 3WUBA 4F4RA 2C1IA 1UR4A 3WO8A 4BY3A 3A12A 3C2OA 4IICA 1XL9A 3DIPA 4XUYA 1JDEA 2R1LA 3BO9A 4GY0A 4MFEA 4ROQA 3NWRA 2ZWZA 4H2CA 3AICA 1E0TA 2Y5SA 3MZ2A 4HHLA 3TC7A 4GQ0A 3LPPA 4M5PA 1K70A 3VILA 1RQEA 1OJXA 1TTIA 3CHEA 4WSKA 4O57A 1VJZA 4TQTA 5HQMA 1DWAM 5TNVA 4ZENA 3BUVA 3M0VA 4PCTA 2ZX6A 1RLDA 2A3AA 1KRMA 3BAJA 1NDWA 4W87A 4E2OA 4XBKA 1SU5A 4JFTA 3BZJA 1LQ0A 4HPNA 3DFPA 1CNVA 1KKOA 3RAOA 3GAYA 1IXQA 1OG0A 3BARA 2QCEA 2NLYA 3POCA 2XINA 3TTOA 4JICA 3WDJA 4JY9A 1U83A 4DJEC 1EKOA 3PTKA 4J1OA 4UMAA 1C7TA 4EACA 2WMIA 2TPSA 4LVFA 2W5FA 1L2QA 4B5SA 5E0KA 4PTXA 2Z29A 3AAMA 3A4JA 3MMDA 2G95A 2JE8A 2Y62A 1DJGA 3GW3A 4LCRA 3F5JA 5ABFA 4NZ4A 3PAOA 3LGDA 3W7LA 1B90A 5IHRA 1SO6A 3ALFA 4NUWA 3G1AA 3CAKA 3LLXA 1ZRQA 5HDRA 3RLHA 2FGZA 2PDJA 5C8BB 1TELA 3TLQA 1XPGA 3PG9A 3MHUA 3PZIA 2PB1A 1GVOA 3C3NA 5D33A 1IEVA 4CUCA 3S1XA 3GC4A 4O53A 2JK2A 4ZBCA 3O2LA 4ADUA 1S5VA 3A4AA 2G96A 2OVLA 1HL2A 4TR9A 4BHYA 4NAEA 2OOFA 5D2VA 2R24A 2Y85A 3COTA 4EP8C 3LRLA 4H01A 2A7PA 4XAYA 1L6FA 1HKKA 2PCQA 3DH7A 1W9VA 3NG3A 1AODA 4PBFA 3LHUA 4U2ZA 3R2GA 1LDCA 2VGIA 4LY8A 1W3IA 4NILA 4ILSA 3WN6A 5XIMA 4HMCA 4H7CA 1KWGA 2QZRA 2Z2BA 4GH3A 2FFCA 4KESA 4GYKA 3W27A 1AQHA 3R13A 4NI8A 1YX1A 1KBKA 3CK5A 3SUVA 4ZOEA 3GHUA 5BU9A 4J2PA 2Q02A 3AMCA 3FSTA 3A6OA 4HOXA 1HJSA 4GZEA 2A6LA 2J66A 1YTEA 3VZZA 3G8RA 3H6OA 4Z1BA 1I2NA 1WAUA 3P60A 1W1B1 3OQEA 2CLMA 3MWCA 4KS0A 3UXAA 1CDGA 3ZIZA 3PZMA 3TXVA 4X22A 1LORA 1Q7QA 1VFOA 3EXRA 4CEXC 1ZP4A 2AGTA 5BXTA 3N29A 1EJWC 4MSSA 1TIMA 4R9OA 4C65A 5I3KA 4F0LA 4AWTA 1QHPA 4IQDA 1QO2A 3TSDA 3H2CA 3IWPA 1QVBA 2OTDA 5CLTA 3AU2A 5JMUA 3RF9A 2QCDB 5HJLA 3BICA 3R5EA 4HK7A 3WLLA 1VRXA 3WLOA 3QW3A 3G5EA 4MKNA 1GVEA 4CVWA 1OD8A 1V0MA 3TMQA 4HCDA 1OM0A 3NSXA 2IKJA 3S2JA 2GJXA 4H8NA 5T91A 4KKXA 3TX9A 4P5UA 4IMAA 8RUCA 3AHVA 1EBHA 3URAA 4DI8A 4PMVA 2VFFA 4LRSA 2BGQA 3MU7A 1V0LA 1OD0A 2FJKA 3NQ8A 3GZ3A 4P8UA 4W8LA 1D8WA 1JXKA 1SM9A 3HG3A 2F9RA 1KNWA 1OC7A 1IE7C 4RDZA 2ESCA 3LQLA 1UPMB 1PV8A 3CT7A 4S3BA 3TP4A 1S5NA 3H21A 3M6YA 3WD4A 4GYFA 3CTTA 4G8TA 1EC8A 4ACYA 1NFGA 2E9MA 2Z24A 1J2BA 1TE1A 1A4LA 2IPGA 3SSZA 3M07A 1JDCA 3EDDA 3B04A 1V02E 5F2GA 1FFQA 2CBVA 3ZO9A 1IGSA 3WQVA 5A5WA 4M1RA 1ISZA 1GKPA 1ZJIA 4K8GA 4UNKA 4N6FA 3N13A 1JNEA 4JIPA 3W6YA 1CGVA 3VD4A 4TXEA 4N42A 5CPTA 4P7NA 4BZYA 4NRSA 1L9WA 2ABAA 4MYAA 3TTEA 1AVAA 2BHYA 1C8QA 3KLKA 4US6A 1IEIA 1DWGM 4DJDD 1HTIA 1H5VA 1JEZA 5AZ0A 2GYIA 3QLLA 1G69A 1MFUA 1FHDA 1NH6A 2FPVA 2ZUMA 3CUIA 3TCSA 4AF0A 2B31A 1XICA 1D8CA 2A79A 3A21A 2Y4SA 1IWAA 2Z27A 3W7GA 4FS9A 1D3HA 2ZE3A 1AH0A 1NIUA 2QLYA 1OY0A 1I0DA 2H8XA 2X05A 5C6MA 5JH1A 4ATLA 3SGUA 2EGZA 1U5HA 4V28A 1PIIA 4S38A 4JTIA 3LCLA 3ATYA 4UTJA 3KBJA 3EMZA 3L5MA 4ORIA 1HZYA 2VD8A 2ZUTA 4GISA 1DEDA 3W00A 2W92A 1UP3A 4UQEA 3L4YA 1V4YA 2WO5A 3ERPA 3PBYA 3N1AA 1ISWA 3QBUA 4R9XA 4S3FA 1JCMP 2ZTKA 1DWFM 3I4KA 1ODZA 2YA0A 4ZODA 2UY4A 1V08A 3CHFA 2J7DA 3E9AA 3U4AA 1R6WA 4QJ1A 1E3ZA 4LY4A 1KA9F 1WX0A 2DQXA 4S1FA 3VMNA 3B8SA 3HG5A 4JNZA 3H70A 2F38A 3MKVA 4M29A 1RBLA 3TZNA 1J18A 2YCLA 1OFDA 1UB3A 3T0AA 2FB3A 3LGEA 3WK0A 1ADSA 4OHQA 3ZLGA 1O4UA 3O9NA 4LNCA 1F2JA 2EQDA 3CV1A 2WSYA 3W38A 4REQA 2XTKA 1DIDA 3TU9A 3PP7A 4MDPA 3TEVA 1CLKA 3AQUA 3U2OA 4ZQMA 2YXXA 6REQA 3IJDA 1JZ2A 4NAFB 2RDTA 3UWVA 2BZNA 5GJMA 3H4WA 5E93A 3NO3A 4WY0B 3WEOA 3FA4A 3B9DA 3BJFA 2ALDA 2D0GA 1YMYA 5FESA 1I45A 4GD0A 1B4EA 5DELA 3EA1A 1BYDA 2ZX7A 3AYTA 4AEOA 3SBFA 3VIKA 4J9JA 2E9BA 1W2VA 3USBA 4AHOA 3CJPA 3QVQA 4W84A 3I3EA 5AB3A 3PAJA 2H3BA 4WXZA 7XIMA 1UZ4A 3NOYA 1R3SA 3EWXA 1XGDA 1I75A 4LYKA 4CN6A 3ABOA 2F84A 5C9RA 4WDWA 1CLXA 2DZUA 3M41A 4CQAA 1H0GA 1Q6FA 2DSKA 2DUAA 2VEIA 3WF4A 1Q6LA 4IX0A 4V2XA 3SCWA 2CPUA 4IM4A 4IPLA 5E5CA 3WEMA 4F9JA 5CZSA 3B05A 3M0YA 4C6FA 3I3BA 2V81A 4HHHA 4Q4QA 2I5GA 2WNZA 3GIYA 2YB1A 2V3FA 1ZJHA 4NRRA 4KFNA 1Q6CA 1BVNP 1FWTA 2WVVB 2HMCA 5AHNA 1F6KA 1LRNA 4LCSA 4PMDA 3W6LA 4MB1A 2XIIA 3DC0A 3M5VA 1FX6A 1FKWA 3UCQA 1KM1A 3OJGA 5KINA 4C6JA 1R9YA 5HMSA 3VD7A 3H4GA 3TK7A 1WDWA 4O17A 3WH8A 2VHLA 4A8LA 3QFWA 3PN8A 3ARUA 4KPLA 4Z2IA 1N8IA 3FEQA 1KC7A 4JN6A 2VCBA 4HNNA 2D73A 1GVYA 1P1XA 1XDLA 1V02A 1PE1A 3BK0A 3V0UA 3SY1A 3ZJ6A 5FJTA 2BVYA 1MEHA 1TA3B 4KETA 5E09A 4HYRA 4GIEA 3MO7A 4YWSA 3N6QA 1NDYA 3I6EA 5DFAA 4RDYA 3SI9A 2XFRA 5HWMA 4CD6A 2BMBA 1P7TA 3ARXA 3DC8A 3OO2A 3W7HA 3OU8A 4HA4A 3KZPA 3GNNA 2DFAA 4FP1A 4J4KA 1QWGA 2PTDA 4YN5A 3TN3A 2VP8A 3VIGA 3M0JA 2GPTA 4IFKB 2OLHA 4Y96A 1UUOA 2PP0A 3BV4A 4UTTA 3ZWTA 4ACZA 1OFBA 1J5TA 3MV01 5BWFA 1JZ7A 3TJ4A 4ERIA 5I2UA 4LNYA 5GVJA 1JZ6A 3KL3A 4PA8A 2NUYA 4AHPA 4NF7A 4ZQCA 4KEZA 3PTDA 4E3VA 2W79A 3U0HA 5A69A 5CLWA 3KVKA 4S3AA 2DZWA 5TIMA 2A3EA 5HNNA 2YW4A 4WUIA 3L4ZA 1Y0EA 2C71A 1WB0A 3IRDA 4JTFA 3BMWA 2P10A 1DQXA 3WMLA 3EX2A 1R5YA 2Y24A 2PD9A 1KQYA 5CZKA 4JN7A 4G7EB 1OEPA 4H00A 2DSZA 2PS2A 3AC0A 2DY3A 2OODA 2BY2A 1Q45A 3CM4A 1HG3A 4LEQA 1VRDA 1IIHA 3HU7A 3THCA 3I65A 3AZSA 3F4DA 1F3TA 1NP2A 4RZ5A 3WUGA 5LKYA 1XF0A 1O5XA 1OSEA 1C8VA 1E4MM 4F0KA 4XBJA 2O9RA 2WWDA 3EZ4A 3RJYA 1R2SA 1R47A 4D71A 1V7AA 1LP6A 3GS6A 2G97A 5JBDA 1MQQA 4GGHA 4L1GA 3UWZA 4UR8A 1RA5A 1K03A 3EOEA 3N2OA 4NSBA 1NU5A 3KTXA 2XSAA 3N04A 4I9AA 2IXVA 3EPOA 2ZZ2A 3TR9A 4DYKA 1BTMA 1TFVA 4OUIA 3W6MA 1KCKA 2PLCA 4KGLA 3IJQA 1E6QM 3CAVA 1P6WA 3GXMA 2ICSA 2JEPA 3VMOA 3BH4A 2ACSA 3UT0A 2QDEA 3G18A 3W24A 4AC1X 4MWAE 3GDBA 2ZXQA 3CQJA 3FX4A 3NVDA 4HYWA 2BLEA 1ITUA 1YXYA 2J79A 5CSYA 1XD0A 3UETA 2ASHA 2VDGA 1IWBA 1S38A 3B0PA 4NX0A 4JR5A 4ALDA 2I57A 1FVPA 4IPNB 3EXSA 5ENLA 5K9CA 3I4EA 2WHJA 4M80A 3GH5A 4CLMA 4F0MA 3FJNA 3HFYA 5LIWX 1V7YA 2PA6A 2X2YA 3EWBX 4TX9A 4UTLA 2PMQA 5AVNA 1Y7VA 5D9PA 3BG5A 1T8XA 2BODX 2OU4A 4GIRA 2Z1KA 3N3TA 4OU1A 1M53A 3WNKA 3S5OA 1DWHM 4XKYB 2PODA 3ABQA 2QJJA 1AD4A 1G9HA 3NIYA 3BOXA 3SRHA 8TIMA 1RD5A 4UFLA 3VYLA 4MB3A 1L0PA 2VTFA 4QP0A 4KMQA 1VQTA 4R5EA 2YFNA 2G37A 4D2JA 4DUOA 4AH7A 3EKZA 2RH9A 2VM8A 5AC5A 3N2MA 4Y8FA 5GQBA 2Y0FA 3H54A 3S2MA 4Y9AA 3AMKA 2AQVA 4I90A 3VE9A 4DVOA 2C15A 2CZDA 4NJKA 3OZOA 1SZNA 1XQKA 3ZJ7A 4G5DA 3H7RA 1EQCA 1G6CA 3ARVA 5FJJA 3VCCA 4M3PA 3S6DA 2A3BA 2VX6A 1DOSA 2WVUA 1DQWA 3TW6A 2J7FA 1XIJA 4GVFA 3FA5A 4C7DA 1YEYA 3IGSA 3UESA 3EEGA 2XM2A 3N25A 1KFLA 4MZ1A 4UTFA 4GKLA 1MRQA 3H2OA 1EIBA 3W7DA 1R46A 3CPRA 3WLPA 4DRSA 1GQIA 3UCDA 1KLYA 3LXCA 3SB0A 2DZXA 3HQOA 1YE6A 2GJRA 4W4QA 4AXNA 1VIZA 1WXYA 1SZEA 5G4EA 3DFOA 4QCFA 7PTDA 4RE3A 3L0GA 4FXFA 3M46A 4S3CA 3FJ4A 4JHMA 1J0HA 3WQ4A 5IBXA 3CZGA 2QAFA 1Q7MA 3BC9A 4LBRA 4JL1A 4DY1A 2O7SA 2JQXA 1TPDA 1ZSXA 2Q71A 1E5JA 5I00A 1CENA 4WJEA 4QTGA 1B9ZA 1W91A 1F73A 1TWIA 1XKYA 2VNCA 3T1GA 2V68A 1EJ7L 1EJUC 5ABEA 3G1XA 3W1XA 4MVAA 4HNVA 3TA6A 3CBWA 1GOXA 3DBNA 3NM3A 1QI3A 4A2RA 5E6ZA 4O52A 2W62A 4OWGA 3NZGA 4AZCB 3F5LA 1WUEA 2CFFA 1UP2A 7ENLA 3WQCA 2GVLA 1ZJAA 2VZUA 1BKSA 2UY5A 5I77A 4B3KA 4MHBA 1FWJC 3W7IA 3C2RA 3AROA 2PDWA 3U2ZA 4NAEB 3W1UA 1CXEA 1U1HA 2JIEA 4ZXOA 1LG1A 3TTSA 1F6PA 3OLDA 4FEZA 2PSNA 2UZ9A 2PU1A 1DQUA 3HV8A 1XSJA 1TV3A 2V0TA 5CG0A 4KWSA 4DB7A 1MW2A 1V8EA 1FCBA 3KOYA 3MJYA 3VCRA 1SR9A 1EX5A 5FI8A 1XHGA 2QHAA 1OB0A 2Y61A 3VDAA 4O0KA 1MI3A 2J13A 4MWAA 2XIJA 2ZVRA 2NX3A 3LOTA 4V33A 4LC6A 4LH8A 3T07A 5FL1A 1F6YA 4E8DA 4JQ2A 2QUVA 1UOKA 1C93A 1OYAA 5CC5A 4XTIA 3V4BA 4AC7C 4MIMA 4QG6A 3QPEA 3VNYA 3BQ5A 1LOQA 4MJZA 1JPIA 1V6UA 1EP3A 3G1HA 2ZCGA 3G0SA 1ZCOA 2YL9A 1DXFA 3PHAA 3OZPA 1HVQA 3EX1A 2AQOA 5H2ZA 4MKSA 2V5BA 3WD1A 2VYOA 3UPBA 3MDWA 3L2LA 5B80A 5KTLA 4ZGYA 2BSLA 1HFBA 3AS2A 3GC2A 4E2VA 3M4HA 1YPXA 1PEZA 3OLIA 2OKTA 2EAWA 4ZMGA 2CERA 2QW5A 4M51A 3VMPA 3RPTA 1QNRA 3AS1A 3THAA 3KFTA 4K38A 1JQVA 1O1HA 1RK6A 1MSSA 1LLOA 3ISIX 3CMFA 4DUXA 3KCJA 1UZHA 3MVTA 4JX4A 2J77A 3UCCA 5KETA 2PF0A 3M0MA 4K39A 4WY0F 3REQB 1SJCA 5D37A 2W3ZA 1QNQA 2NSOA 3W72A 2E1WA 3S6TA 3QLDA 4QSHA 2DUXA 1OFPA 3QTGA 1O66A 1YNQA 5A3HA 8A3HA 5DXYA 1K77A 1RCOB 3UR5A 2RHGA 1MDLA 3SCRA 1ZS2A 1ZTVA 3CB3A 3PTMA 4AHQA 3BVJA 5DX7A 3MWAA 2WC3A 1VIWA 1TVNA 3ARQA 1UIOA 3ZR6A 2HPMA 3HZ3A 4W8AA 4QS6A 2C91A 4Z2LA 4PC8A 3CLMA 3W1TA 3NQ2A 2Q01A 3ZM8A 1XC4A 1QOPA 5J5RA 2CHRA 1BHGA 3NXLA 3N2CA 4AVOA 2QCNA 4U10A 3NYZA 1NARA 4PCFA 1DXEA 1YDVA 1NOWA 1LCOA 4OIFA 1M7JA 2PURA 3GSMA 2D1ZA 2W66A 3ITTA 3WDPP 2VWSA 4H6KA 1MQPA 4EWJA 4JQ1A 1X1ZA 4ZZ9A 4IL0A 2C14A 2EHHA 3VNZA 1AZ1A 1S3TC 2WHKA 4JQ3A 3FN9A 1M65A 4GRSA 4BJHA 1X96A 4PTWA 3KWXA 4ZQOA 2QYGA 3LTSA 1TIWA 5IFPA 1VPQA 2VZVA 3RX4A 4GINA 4XZNX 3DOPA 2Y88A 3UG5A 3FYOA 3R94A 1PL9A 4ENLA 3T55A 5JVLA 1VCGA 2GQ3A 4AZ5A 4A4AA 6ENLA 3QC0A 1F3XA 4Q8WA 2I5IA 9XIMA 4HBKA 3M0ZA 2QF7A 3LHYA 5DCEA 3QPYA 4US5A 2BTMA 1C8YA 1Q6EA 3E5BA 3LBCA 4IIGA 1BGAA 1KBLA 1QDSA 4UQAA 5LNWA 1XYMA 2XUCA 1VPXA 3Q37A 4IG2A 2C0HA 2DZSA 1CW2A 1XLFA 4RDVA 1WNOA 1EPVA 4HP5A 1VD6A 4D6DA 2QAPA 1JJKA 3LCIA 4RXGA 4PL2A 3SFKA 1HIZA 2J7BA 2W67A 2UWFA 1TV8A 2WVTA 3HV9A 2NVCA 2VFGA 1EJVC 3TJXA 5CBIA 3PJUA 2CESA 1XG3A 3E96A 3HMCA 2WZEA 4M6PA 3CT2A 3GKAA 1W37A 2QDGA 3MVIA 4DXKA 1PJ9A 2WJFA 3OBEA 1FDZA 5CH9A 2GUBA 2AL2B 2DV0A 3LI1A 4IIDA 2HXTA 3BJTA 1IV8A 4XAGA 1EJSC 1L8PA 1VYPX 1ZHAA 1G4TA 4GGBA 1YXDA 3MCOA 2X40A 3OA3A 4QLKA 3GBEA 3BG3A 3WQWA 1X7IA 3G0UA 1LOSA 2OQYA 1VFHA 2WV8A 1E51A 3V36A 4GQBA 4MJ4A 2PDIA 3AISA 3W1LA 1WV2A 5BZAA 4FIRA 3LLFA 4BQ2A 4EPEC 1H7XA 1J0ZA 1TV2A 4C60A 3WBYA 3RMJA 5BXPA 1V93A 5MKGA 4TVUA 2ZRXA 1ITXA 2G8ZA 3C8NA 3VZYA 1BQCA 4F2BA 4LAKA 1PZ1A 3LPGA 3W1QA 3ZLHA 4BI5A 1BRLA 3S5NA 1AMKA 1IYXA 4QE5A 3WQOA 4MB5A 3UY7A 3IJIA 2OSYA 3OB8A 5AKQA 1OFEA 5BOFA 1IWPA 3S2NA 2ZE0A 4H7VA 1KO0A 1Z7AA 4ZFCA 3GNPA 2VXNA 2QJMA 3A4XA 2DVTA 1DORA 3ZR5A 3P74A 5AY7A 2ACUA 1EXPA 1PXGA 2VC7A 2VEFA 5D9MA 4IPPA 4RK8A 2YJQA 1XLCA 3E02A 4HU0A 3B4UA 2C13A 3M9YA 1QCWA 4P61A 1RSCA 5CJMA 2EXOA 4RCXA 1R2TA 1U1JA 2HE5A 4IH3A 4GE8A 2WCAA 4FF5A 4GH1A 2DJXA 2Z7KA 3JS3A 2OEJA 4TV6A 4UTIA 1TPEA 5CGMA 5A6TC 3T81A 1AJ2A 3N15A 3ID7A 2W6RA 1GW9A 4GVGA 3H12A 3MUAA 1W56A 3CYVA 2Z26A 3QGVA 4JKLA 2R6OA 3MYOA 3U7VA 5LXXA 5HULA 1KQZA 2Y5EA 4B9YA 3P61A 3KUMA 3W74A 1PUDA 5T9BG 1U1UA 4UNLA 3DHPA 4RE4A 3DBPA 3EAUA 3ZJKA 3VZXA 1RHCA 4Y9OA 5G1MA 1RAKA 5TD4A 2YA1A 2DZVA 1GYLA 1V6VA 3TN5A 4CCZA 3KHDA 1PTDA 4YPJA 2D3LA 3MCNA 4CEUC 2TYSA 5CPQA 3WLMA 3GFZA 4ES4A 8XIMA 1A3WA 4WKFA 5J8LA 4HSNA 3QZEA 3QTPA 4GBDA 4ROPA 4A22A 4C6OA 3V0TA 5K4ZA 1KGWA 2PDQA 2XISA 1TB3A 5AHIA 5A8GA 1ZY9A 4Q4MA 1PYMA 1TR1A 1G4EA 3YPIA 1CI1A 2XZ9A 4MY1A 5XIAA 3VKJA 4IHCA 3T0BA 3N9SA 3V0SA 4D6FA 2D0HA 2WZTA 1IZJA 1JI2A 5A2BA 2C16A 1QMLA 1UKQA 1XYLA 2GLKA 4PTDA 2NQ5A 4WOZA 1YBQA 4WHBA 1SVDA 1TCDA 2Z0IA 1FCVA 2Q6ZA 3QMSA 1K6AA 1UUMA 2OJPA 2PLMA 3W71A 5LNUA 3FGCA 1JULA 1JDFA 1JZ8A 2DPEA 3CQIA 1TMQA 5IOBA 3E6EA 3OOQA 1PS9A 1I1XA 5DBTA 2X1SA 2ZX5A 1ONEA 3E0FA 2ZZ6A 2EPHA 1RXOB 2JEQA 3WF0A 1ZAIA 1E0UA 1H63A 2QV5A 4E8GA 3MMUA 3LTYA 1X1NA 3NSMA 1MW0A 3WNNA 2OO6A 2R1KA 3EA3A 5C9WA 5JIPA 2PWDA 1YE4A 1W9DM 5CAHA 1UR2A 2D24A 5REQA 5EPDA 3NTYA 3H53A 1WDQA 4MG4A 2CHOA 1ZCCA 2IPWA 2HBXA 2PE4A 3NL3A 2X1IA 2ZQ0A 1A4MA 3P8JA 3GB6A 2QCFA 4ZQPA 4NNAA 1KM2A 4XX6A 3TQ0A 3KEHA 4A3UA 1X1OA 1VEOA 5LA2A 4GVHA 3H4XA 1HJWA 4K36A 5AZ1A 1EDGA 4GC4A 4I5RA 5DRCA 1JZ3A 3KAOA 1NOFA 1Y5XA 1VAHA 3PBVA 3AMLA 1YIXA 4OTKA 3GXFA 1E72M 3VAVA 2PAJA 1XYBA 1RR2A 2D22A 2YXOA 3HJEA 5K2ZA 4C6CA 3NL5A 1RJRA 2CNCA 5HXMA 4LUSB 3ARTA 5CBJA 1ICPA 3PFMA 1E9LA 3UERA 3O07A 1C29A 3KM8A 2R1NA 3OLGA 1OADA 4GI6A 2EPKX 3BGJA 1B1YA 1JF6A 3N9KA 1CTNA 3QPZA 3DFQA 3APGA 2C3ZA 1X6LA 2GGIA 4IP7A 3H2MA 4TU1A 3TYBA 2AGKA 4C6KA 4LU0A 3WELA 5LIKX 3CAWA 1B3ZA 4ZXLA 5BXRA 4H9XA 1XWYA 3K4WA 5FEXA 3K8LA 1RVGA 1NWTA 1ZBWA 1R30A 3T09A 4WSJA 1L8NA 1XIBA 4ICCX 4W5ZA 4P7QA 2FDSA 3DKLA 3KVJA 1E3XA 4I9MA 2OMAA 2CC0A 2KAUC 3A64A 4FAMA 3EMQA 1P6CA 2R82A 1P6BA 1BTCA 4URIA 3WLIA 3W2NA 5CPLA 1ZU8A 1ZJBA 3NPVA 1JUEA 1X98A 5CKSA 2ZA3A 3CH0A 1H7WA 1JAEA 3WLQA 1V6XA 2F2HA 3I7RA 4K2SA 1Z41A 2V3EA 3TQPA 3L5AA 3MS8A 1QFEA 3B8DA 4LUTB 1XIGA 2RGMA 5D03A 4KWUA 1JDDA 2W9MA 2QMKA 1L2UA 4GXWA 2J8TA 3VOJA 2BVWA 2Z1VA 3WL1A 3LRMA 2WPGA 3QV8A 1TUXA 2A6NA 5AYIA 3WNLA 4EXQA 4FK9A 3DN5A 3WLHA 4NXKA 3T2QA 1YNYA 5H91A 1A5LC 4PUMA 1S5WA 3TKFA 4WSHA 5A95A 4GX8A 4I7WA 1IXOA 4EPDC 4DHGA 4JAWA 3A5VA 3OGSA 1WUFA 2VJXA 3CC1A 3RPDA 4ZO7A 1S1RA 2CITA 1LYXA 2C0AA 2NQHA 4K1GA 1XBXA 4LW7A 4DBDA 2XVPA 1TZ9A 1GZ1A 3CV6A 4Y8EA 3DERA 1K7XA 3DX5A 1FXQA 3B9OA 3GNRA 5I78A 2C18A 3MI2A 1TV4A 2NT0A 2ISSA 2IQ0A 4H8UA 3RO6A 3P2VA 5C9ZA 3W53A 3S1VA 4GBUA 1TE6A 2ZTJA 2PDUA 4IZGA 3T6CA 1J4EA 3N2XA 3SUWA 1OFQA 4ML9A 2QCCA 4UTTC 5I03A 8XIAA 3RJXA 3NUKA 3AIVA 4KW2A 1TO3A 5AVHA 4ATDA 3P3BA 4LVGA 3CHVA 3RITA 5AFDA 1ME8A 1Q2RA 2R14A 4U33A 1A0DA 2PD5A 1Q63A 1E15A 1W54A 3BSMA 3QH2A 4ZCWA 3UNDA 4RNHA 3PBGA 3GXTA 2J4GA 3UYIA 3JRKA 4IPIA 2ZADA 1GNXA 1QPOA 3RR1A 1QNOA 3AHYA 1W3LA 3RK8A 3BCDA 1AUSL 4XUGA 2XH7A 4DUWA 3I6TA 3IV8A 4DF2A 4XBSA 1BXCA 4LT9A 3TZFA 1F9CA 4PBEA 5I0DA 2FVMA 2HVMA 1IEWA 3N9RA 3H23A 3VE7A 3M5ZA 1QNVA 2VENA 4ICNA 3VKDA 4XD6A 4G56A 5EMKA 1OVDA 3EEZA 2BHZA 3HURA 2Z28A 4RDWA 3FV9A 3NQFA 3CL6A 3ZFHA 3ITYA 4IIBA 4RPQA 4LFYA 5U4NA 2TAAA 1SFJA 1FHUA 1RQBA 1GPFA 4PUUA 3R79A 1TWZA 4RV3A 1JYXA 3SO7A 4KF1A 3TW9A 3TXZA 4Q4PA 4BKNA 2QIIA 4X63A 2GOKA 4LV9A 1O94A 1RJPA 2XYLA 3D47A 4P8WA 4DYEA 2ZOXA 1JYWA 2IUZA 4TVDA 5TF0A 1VJIA 4K7VA 1GG1A 4FXSA 2WJZA 2WNNA 1E6XM 4AU0A 1YYAA 4R85A 3E12A 1W2PA 1GYMA 2DDXA 4FALA 1BSLA 3LZ3A 4WX2A 1I0BA 3R0KA 1FWIC 1EA0A 3CQ0A 3VNDA 2XU2A 4DAFA 5I24A 2UY2A 3DUGA 1I2QA 1GEQA 4XZHA 4U2YA 3NQBA 4S39A 2GK1B 5M1TA 2OX4A 1UKOA 3QZAA 1JFHA 3FNDA 4H6RA 4MNJA 3BE7A 2HZGA 4IJBA 2WM0A 3SM0A 3LNPA 1UKPA 3IJ7A 4JIIX 1QI2A 1W17A 1EDTA 4W7WA 3HPSA 3UXDA 3GDMA 4K7YA 4HQVA 1C8XA 3TYDA 2PDBA 1SGJA 5FACA 4L5ZA 3SY5A 3L67A 3RCMA 4KFOA 3W1RA 1X6NA 1N7KA 2OG9A 4J3XA 4L65A 4PMUA 4HMEA 3ARYA 1GOQA 1AW5A 2F7FA 3VGEA 3G1SA 1FWGC 3D46A 2PBOA 2CLPA 4I7VA 5G2WA 3GG1A 4UQDA 3VNKA 4JEJA 4J3ZA 1V3IA 1ZBVA 3M0HA 4RZ6A 1PBGA 3MSYA 3U5UA 2O4MA 4OBSA 3SGGA 1GOMA 2XVGA 4Y9PA 1VYRA 1E9IA 4LCQA 1WP6A 2QJNA 2V5CA 3MCMA 3DYPA 4IJCA 1QWKA 1JRBA 3AFBA 3N6JA 2HE8A 3FDGA 1US2A 1TPVA 5K3VA 3VM5A 4DIAA 1LQAA 5BMWA 1BYAA 3P0XA 4F2TA 3IUHA 4BF7A 4GCXA 4E2DA 1YHTA 4MYXA 5LNRA 4L4MA 4KT2A 2PWVA 1JRCA 4E0CA 1OK4A 1J5SA 3ITLA 4GO8A 1JVNA 4X9SA 2E67A 3FKRA 1C3FA 3BW3A 4FO4A 1L6GA 3SUSA 5HR6A 4UB9A 1IEXA 4NNCA 3AHXA 3W7OA 3EPNA 1OZMA 4I6KA 1J6OA 3PBWA 4CD5A 2CHNA 4PMQA 3SCUA 3GTFA 2QT3A 6PTDA 1XIDA 2DZAA 1KXTA 2EJ1A 2FJUB 1J79A 1C91A 1FWHC 1SZRA 1T96A 1JCLA 3BLEA 1DJHA 4JNMA 4Q4OA 5DRIA 4FNRA 3QRHA 5M5DA 3ATZA 3BV7A 1NFPA 4H1ZA 1CPUA 2XM1A 2OCZA 1UA7A 1AFSA 5EBAA 1UC5A 3VU2A 5IBXC 1SO4A 5HA7A 1ME9A 2NLIA 4KBXA 2V5KA 1JAKA 4AQLA 9CGTA 3XIMA 1P0NA 4BI6A 3QQ0A 1CGYA 1DHPA 1E71M 2XH2A 4GUIA 1UH2A 1TWSA 4ML4A 4QAWA 5RUBA 7TAAA 3S5YA 1M9HA 4M6QA 3ARSA 2FTYA 1AW1A 4HD5A 3ABSA 3NVTA 4G1KA 4EF9A 5BMXA 2WSKA 4NX5A 4C6EA 4LUYA 3F4VA 3VIJA 5CCZA 3MUXA 1T8QA 1W1TA 1XRTA 4KCWA 5FIPA 1E6RA 4E3TA 5D32A 2QPSA 3VOCA 4UTHA 2F6KA 3BQ6A 5DCDA 1JGMA 2VRQA 4NG3A 5AC4A 3QHOA 4GUGA 3VUPA 2P76A 1EC9A 4DXXA 3SCOA 3OQ8A 4JDBA 3WD2A 4B5UA 3WLJA 3A23A 4PTMA 1U30A 1XRVA 1ME7A 1XSKA 2YBVA 4H2HA 4HMDA 3VDBA 3CZLA 4YHEA 4AZGA 1WZLA 4W5UA 3MHGA 5CPNA 2CZEA 5EMMA 2INZA 1OBAA 4CQ9A 2PTXA 2YLLA 2QCHA 4K3ZA 3VNMA 4GXMA 4YCPA 4MWAC 2PTWA 1BRLB 3E0IA 2PEVA 1TVPA 3L4UA 5G2IA 3R89A 1R85A 1REQB 2HCVA 1XW8A 1YTKA 2PGRA 1Q8JA 4DWSA 4DM2A 2XIOA 1BQGA 2TSYA 1WQ5A 1BEUA 4GWEA 4PUJA 1ALDA 3N73A 3GZAA 5I23A 3NZRA 3W0KA 2YX0A 1ZZMA 4Q32A 1S5MA 4LVAA 4UQCA 4QNWA 1IT7A 3P80A 1SZGA 1VB9A 2VEMA 1J96A 1UPPA 3KDNA 4O13A 2JGYA 2Z00A 1JPHA 1BWVA 5C0QA 1UHVA 2XN0A 1G01A 4Y9MA 1QOXA 4CCCA 1QI5A 2VGGA 3SUUA 1W8GA 5D2XA 2EG6A 4HCLA 1FWRA 1EJRC 3U2CA 3SCTA 4PSPA 1ENUA 1AZ2A 4WF7A 4UQBA 2NZLA 3BL3A 1M7XA 1PCKA 1FQ0A 1LT8A 3BW4A 1AL8A 2HQAA 1HJVA 1UA3A 1U5JA 1EJTC 3ZT7A 1PKLA 5A8MA 3CPUA 1THFD 1KR1A 3STGA 2QJHA 3B9AA 2V2CA 2V5JA 4FSAA 3OA5A 4PRRA 4B2DD 1FHVA 1UJPA 5BRQA 2NXHA 3EB2A 1K8ZA 2BOGX 3F2DA 1R87A 2KZHA 4B9ZA 2JALA 1Q2SA 4CU6A 2XH4A 3EYPA 2NV9A 2F8QA 5LNSA 1DKWA 3RDKA 3S46A 3WNPA 1IT8A 5GNXA 1BPLB 3NR0A 2VD9A 3QY7A 4CCEA 3FAXA 5EB8A 2XIBA 1B3VA 1EP2A 3RU8X 1DJXA 3DFHA 4FHAA 4Q22A 4E5TA 5E0CA 5IM51 3T8LA 2X42A 1XLDA 4JTLA 7CGTA 1Z6KA 3VDHA 2QS8A 4GIAA 1ECEA 3KP0A 3MI6A 3UF9A 3U7BA 3M0XA 3W1PA 3APYA 3B8UA 4JX5A 3MO4A 5I7GA 3A9BA 2A5HA 4IP5A 2ZUNA 3GVQA 4M82A 4O54A 3UWUA 1TJ1A 1BKHA 3AUJA 1PPIA 3LBMA 4GUJA 3HQNA 1KFCA 3KLLA 3G1YA 6XIMA 3LK6A 2YCJA 5I3HA 1PDZA 2V5LA 2XIMA 5CSUA 2OELA 4V1XA 4RR4A 2WSRA 2Z2AA 4GI8A 1NQKA 3GVRA 3S2CA 4LV4A 3M0LA 4GIYA 2FLIA 2J74A 1KWKA 3UG3A 3GXPA 4C6IA 4ZFMA 1LLWA 4EPKA 1PKMA 3NL2A 5HJYA 3RLVA 1XG4A 4QDWA 4WOQA 3W29A 4B90A 2YOCA 3IUDA 4DF1A 4GABA 2G3IA 3CXOA 4KCVA 4ADSA 3BWWA 3QW4B 1IF2A 2IKIA 4O1EA 4DBWA 4DO4A 1AH4A 3L68A 1XYCA 5F7UA 4F48A 3VK5A 1MXDA 2IPFA 3GM8A 1QXLA 4HPHA 2GOUA 3KTSA 1OX6A 1OZQA 2DIJA 3TQVA 3EOSA 3M16A 5FF3A 3RX2A 1H1ZA 4Q8MA 3OYXA 1JUBA 3EDEA 3L4XA 1AQMA 5EKYA 3VIOA 3LCFA 4O8RA 3E2QA 4DZIA 2BVDA 4O16A 4JNYA 1DIOA 1F7BA 1CB7B 5F4XA 3LPFA 4JBRA 4CCDA 2GGGA 4QS5A 1CGUA 1VP5A 1TJRA 4UBPC 3UBPC 1PIGA 4DBUA 3LNMA 5A6LA 1ELSA 4PMJA 4PMXA 5D9NA 4QSFA 1J2WA 4FR6A 3UWEA 2OEKA 1KKRA 2X1RA 1T41A 1R9XA 1OC6A 2AKMA 3EKLA 2VFIA 4PCNA 4XD3A 3IIOA 3ZS4A 3O6YX 3DXIA 3THDA 3RIKA 2X1TA 3B3DA 4KWVA 1EC7A 5I3JA 4DJFC 2CCRA 5D8ZA 3OG2A 3L66A 3K13A 3MUCA 1XX1A 3URQA 1QOQA 1GG0A 2WMGA 3GFYA 2XVNA 5AC6A 4JL2A 1ZAHA 4F66A 2FZNA 1UWIA 4HA3A 1RCQA 1UD2A 4Q4SA 4X3ZA 3UXIA 4B2DA 4IGNA 4JTKA 1R7OA 5C2GA 1N8WA 2NSXA 1X8FA 3V3WA 3CL8A 3G3DA 2ZRYA 1O95A 3GH4A 1TJ0A 1NSJA 2HV5A 2PZNA 1E43A 1H7RA 3N4EA 5F1UA 4H3DA 4IWWA 2ZDSA 3PY2A 2ZUWA 3TQKA 1MW1A 5C71A 1W32A 4NHVA 3OBKA 1EEPA 4MY9A 4MZ8A 1TTQA 5FAJA 4LC8A 3AXHA 5CC7A 3N2BA 3STPA 3O05A 4F3HA 1V03A 2NQJA 4ICMA 3W87A 4AZBA 5HWJA 3SR7A 1K02A 4IXXA 1GTEA 5D8WA 4RPPA 4AB4A 4FLQA 2CZFA 3EWZA 1ICQA 1JXJA 4JTCA 3K1DA 2SFPA 4IUOA 4XIMA 4XAPA 1KRBC 2DH2A 1LROA 4F79A 4L6DA 3CU2A 1B0IA 4PUKA 3PZNA 5JIWA 3P6LA 3LCGA 2Y63A 2P88A 3VA8A 1SJDA 2YR1A 4FNTA 1XIMA 1BG9A 1LRQA 4LUJA 3GDLA 1XLJA 3LGGA 5D4YA 2Z1BA 4DAIA 3EX4A 1XD1A 4PYSA 5CGQA 2VFEA 4LBSA 3R43A 2ACQA 4C91A 3MSDA 2E6YA 3W7CA 2YPIA 2HS8A 3Q2DA 3NZ1A 1HGWA 1MNSA 4JIQA 3AUOA 4HGXA 4LUIA 1WDSA 3IJ6A 1ICSA 3VUSA 4QJ5B 4PEKA 4QXIA 4RNFA 3ARWA 3SJNA 1NP0A 1QI4A 2Z25A 4TX6A 3OEXA 5D09A 3OZYA 2DQWA 2P53A 1VEPA 3DGBA 2IKHA 2IS7A 1B54A 4EWND 2WMKA 1F5ZA 1K9EA 4D1IA 3Q4DA 2ATSA 2ZYFA 1PYFA 1SYTA 4CQCA 3C0JA 5LHEA 5HMFA 1QI0A 3CZJA 1XUUA 1H5YA 2CBJA 5HK4A 3AWOA 3WJWA 3ES8A 4J35A 1XH2A 1TR9A 3VNIA 3C52A 2NXGA 4YTUA 3LMZA 2AOSA 3IANA 3WG6A 2LLEA 3GNXA 4C1NB 4EF8A 1FUYA 3RPMA 1RUSA 3Q45A 4HB7A 3IVTA 1GOWA 5A6SA 1EXBA 3RUBL 4OBTA 3GHSA 1VPYA 3MC5A 4Q33A 3DAQA 1LM1A 1H4PA 3CWNA 3ABRA 1TUFA 1LRTA 1ITQA 2REQB 3CQKA 3UQNA 5XINA 3EDKA 5EU9A 5C70A 3OHMB 4Q4KA 4QX4A 2VZTA 3AIWA 3RMEA 3V1HA 1E9YB 3FK4A 4L4PA 1YKWA 1B30A 3PPGA 3QV9A 3W7JA 3D5HA 1Q4NX 1NM9A 3H22A 3RILA 5MHBA 3D3AA 1GJUA 3V18A 5PTDA 1B31A 1VEMA 4F8XA 3WF3A 3TTQA 4J7RA 3RRAA 1JZ4A 3OLEA 3RRXA 1NWRA 4DNMA 4JKKA 1B3OA 3AHTA 1BF2A 1A0CA 3ZR4A 2CBUA 1ISXA 1HXJA 4BWLA 2FFIA 1LZOA 3AZRA 1HL9A 3LRKA 2PGEA 2DW6A 3U2EA 1K6WA 3OZMA 1UR9A 5HWNA 3MUZ1 1EO7A 7A3HA 1H61A 1F74A 4AYSA 2QGHA 1QUMA 4J3WA 4F0RA 4GPNA 3BJSA 1Z9AA 4UTMA 2F2KA 2V2DA 2C6QA 1XBZA 4S2CA 1QK2A 1CCWB 2P3EA 2A21A 3PWAA 1KCZA 3I10A 4QNEA 1RJQA 3G1DA 2J9ZA 4UOJA 1UH3A 4GJ1A 2E9LA 1XGZA 2PLKA 1CECA 1FHLA 4YCOA 4DQWA 4HKPA 3MW7A 3LU2A 3VX1A 2VOTA 3IK4A 3TYEA 4LRTA 1SO5A 1OIMA 1GTHA 4FNPA 2J7GA 2WMFA 2BGNE 2FPYA 1YPIA 3AJXA 2DSWA 2YBUA 4O10A 2NWRA 4MPKA 4X9YA 3O6DA 4PCSA 1GQKA 3WEZA 2YL6A 2Z1WA 3TFXA 1LLZA 4GUFA 5FJUA 3WBEA 1X97A 4NYYA 4ORMA 1FY6A 2AAMA 3O16A 4K37A 4DF0A 4ZEPA 2GDVA 3ONCA 1FRBA 2J47A 2VUNA 3SZ8A 4OBRA 1MUWA 4U28A 3BOLA 4PGLA 2NXIA 1LBFA 1SW0A 1FWBC 3C4UA 3INPA 1R3QA 3C6CA 5D2YA 3BLIA 2OLAA 5FCZA 1WBHA 3GG0A 5I06A 1X39A 1LUCA 3DCPA 1HUVA 1J9YA 1RP9A 3WX7A 3CWOX 2DU2A 5CJNA 4TMCA