1FCUA

Crystal structure (trigonal) of bee venom hyaluronidase
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
324
structure length
324
Chain Sequence
EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKDPNGNVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKRIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYALURONOGLUCOSAMINIDASE
publication title Crystal structure of hyaluronidase, a major allergen of bee venom.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
total genus 119
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1fcuA00
2QCDB 4N9EA 4NJKA 5CG7A 3A24A 1C8VA 4YWIA 3EEGA 3LV5A 2YPIA 3U2OA 3LLDA 1XCFA 4ZQOA 2A7NA 1SQ7A 5AHFA 3P84A 2CLFA 3NPUA 4HIBA 4LUJA 1DHPA 5BMWA 1I2QA 3OIXA 2WJZA 4A22A 3ATYA 3TW6A 5D33A 2QCHA 3VE7A 3QMSA 4RKAA 1J5TA 3U6WA 4TU1A 4GBUA 3S1XA 3QPYA 3BLIA 1NFBA 4N2YA 5F2MA 3NAVA 3TCEA 2B7OA 4LVDA 1N8FA 1F5ZA 4UTHA 4IMGA 4LVFA 1SW0A 1TO3A 4M19A 2NUYA 3MBFA 1QR7A 2EHHA 4UCGA 4UUIA 3V75A 1TMHA 2FFCA 2Q8LA 3LXAA 1OK4A 4HPJA 2QKFA 5L9FA 3B06A 1AL7A 5LNWA 3DZ1A 3SFKA 4WJEA 4NZFA 4GFSA 4O0ZA 2GJLA 3NQ2A 1TCDA 3KVKA 5G1TA 1W0MA 3JR2A 1BTMA 3CEUA 2ISVA 4O4VA 3NPWA 1ZALA 2CFFA 1KM0A 3TJXA 3N2XA 2Y62A 2TYSA 3RLVA 1SSGA 1W54A 1BKSA 2E5DA 2RFGA 3CIXA 2ZRXA 2ZTJA 3NVTA 4CQ9A 4MFDA 2WV8A 4I9AA 4HNNA 1SZGA 3DKJA 4UR8A 1GYNA 1YXCA 4Y9AA 5HMSA 1LBLA 4MYXA 3N73A 2QCEA 1SPQA 4R53A 3THQA 3TV8A 1TV7A 1TPVA 4DF1A 1L9WA 4PC8A 4O12A 1WAUA 1F05A 3B4UA 3NYZA 4JTLA 5DBTA 1JCLA 3W1PA 2BLEA 2FQIA 4OU1A 1GWJA 4B5NA 1PHWA 1XBZA 5G1YA 2VC6A 2NZLA 1YXYA 3HF3A 1OJXA 4Y6GA 1S3HA 3O63A 4NJIA 3G1AA 3LLFA 3W1NA 1XDLA 3NZ1A 2A4AA 1GYLA 3FYOA 3OG3A 1JUEA 2V2CA 5DY2A 1OX4B 5DLCA 2V5LA 4R7JA 4O13A 3KVLA 1M7OA 1LROA 1IXOA 5AN7A 1KFJA 1J2WA 2DORA 5EYWA 1N55A 3G0UA 1MO0A 3O15A 3HG2A 4JD4A 2R8WA 4E38A 4PEKA 3A21A 3N19B 3LERA 1LBFA 1WOAA 2R14A 3GAYA 3ATZA 4ZQRA 2ZZ5A 1R30A 4HHPA 4N9DA 1L6SA 3KRSA 1GT8A 1FCUA 3LM7A 3DI0A 1KTBA 5C2XA 1DOSA 4AHOA 2YW3A 2ATSA 4O19A 4IGHA 2VXNA 1AW1A 1TPUA 3LXCA 3QYQA 2NUXA 2R91A 5FF7A 4UTMA 1TPWA 4Q33A 2EPHA 4NJGA 5D37A 3L0KA 3PBYA 1OFAA 3Q2DA 2CW6A 1ML1A 3CM4A 4MVAA 2E5BA 4QNEA 1XBVA 2WNQA 2DJXA 3DENA 4I7VA 3TNOA 1IXQA 1G67A 2JKAA 1FWTA 3C2RA 2G96A 3GYEA 4OV4A 1DKWA 4M6QA 1MEHA 4UTIA 4LOCA 4UTUA 1F73A 1W3NA 3I7RA 1NAL1 2JBMA 4X9SA 4ADTA 4MJMA 3CU2A 4CQAA 2QEZA 5H91A 1LM1A 1A5BA 5CPMA 5KINA 3P60A 2JK2A 3W7JA 1D3HA 5E93A 4O1BA 1FXPA 3D0CA 3HO8A 2HMCA 3INPA 3NDOA 3L5AA 2Y7FA 4H6KA 4HT3A 3VE9A 4FX8A 2EF9A 3TQVA 3LCHA 3W7LA 5L6UA 4ORMA 2B4GA 4Y8FA 3O6DA 5BW6A 1MXSA 4EIVA 3L5MA 2QF7A 1RQEA 2NUWA 2CLOA 4JTKA 3TX9A 2FIQA 3GXTA 3E12A 2IQTA 3ZWSA 1OG0A 1WOBA 5IBXC 5TBOA 2FPTA 3P5YA 4Z08A 1F6KA 3MJYA 2E6AA 2O7QA 2Y7DA 2QDHA 4O8RA 3B8DA 5FI8A 3JRKA 3W7GA 1P1XA 3TFXA 2A2IA 1K02A 2I1OA 3PG9A 3W7CA 4WOQA 1V5XA 2QUVA 3FEMA 1GJPA 1NSJA 3WK0A 2Y85A 3C61A 5DCEA 3G1SA 5EBUA 4JTEA 3P7YA 3CWOX 2ZZ6A 3LHYA 4O18A 5F4XA 3BPWA 4ZQCA 3STCA 4JNMA 1SFJA 1YXDA 4LTSA 5DN1A 2EAWA 2YSWA 4UFLA 1KBIA 3T78A 1OHLA 2C16A 4UTKA 2AQWA 5HNRA 3LCLA 2OJPA 4QQ3A 1LYXA 1YPIA 1B4EA 3TMQA 4LVBA 3LXBA 1KM6A 1G4PA 4WY0F 5CZTA 4O52A 2GQ9A 3UWYA 3NQAA 1FQ0A 1S5WA 1LTDA 4O11A 1GG1A 1R2TA 2Y6ZA 2J24A 3LHVA 5EL1A 2NLIA 2VFFA 3LBCA 4O16A 2GQ8A 1B57A 2X16A 4DO4A 1Q6LA 3BW2A 3M7WA 3NG3A 4JTSA 2P10A 2P1FA 1BWKA 4CCCA 1EWEA 2C1HA 4O28A 3EX3A 3EX1A 4O50A 3FIGA 1XC4A 3DBPA 1MEWA 3UPBA 3L65A 4AWSA 4DF0A 2DP3A 1SO5A 3M1ZA 1OF8A 5D02A 2CLEA 3BGGA 5EMUA 2H90A 3MMTA 5LSMA 1OYCA 6ALDA 1KFCA 2B0MA 2ZQ0A 3TROA 1NVMA 1QOPA 1W5NA 3SIZA 4OGZA 4NXSA 2CLHA 4QISA 4M6VA 1KTCA 1SW3A 1OF6A 2ABAA 5E1QA 4RLIA 1QO2A 1RR2A 4DXVA 1LRNA 1VCFA 1W37A 1HL2A 4LVGA 4PL1A 1KV5A 1F7BA 3T7VA 1RVGA 5CZ0A 3W71A 1DJQA 1P5BA 5HJLA 3HGRA 2FDSA 3CPRA 5CKSA 2V8ZA 5GVJA 3W1AA 4O1DA 1DV7A 3F4NA 3B0UX 1OFPA 4A21A 3UWZA 4WZHA 5IBXA 2WQPA 5AHIA 1QOQA 4O1AA 2PE4A 2ZYFA 3UWUA 2WOQA 3LDVA 3NM3A 2ZA2A 3SR7A 1WBHA 1GVOA 2YFOA 3TE9A 1QO5A 4UTWC 5DXYA 2Z6IA 3KVMA 3TXZA 4HNVA 4WX2A 3IVTA 3QQ1A 5J5RA 2ZZ4A 3RF9A 3PB2A 1KFKA 1EX5A 3BG5A 1Q6QA 3VNDA 1TPFA 3G0SA 3HPSA 5AOUA 4BI6A 3NQVA 4QIUA 4CLMA 2OZ0A 3GLCA 4MKNA 4FIQA 3E0IA 3PVFA 3UZJA 4AMAA 3EX4A 5G4WA 3QQ0A 5HULA 4DELA 1KM2A 3GXPA 3NQDA 3QC3A 3UWWA 1VLIA 3RFAA 2J88A 2A1YA 2QCCA 3LGEA 2CZEA 3M16A 1OVDA 3UZ5A 2VFGA 1KV8A 3TAOA 3OHIA 1H1ZA 4C1LA 1G4TA 4KFPA 4UXDA 2D73A 4JTTA 4AHPA 1RQHA 5AB3A 4XBKA 1ME7A 4R34A 3C56A 3M6YA 3VFLA 3TKFA 3M5ZA 2QCDA 4O14A 4IWWA 1RPXA 2RKXA 3LCXA 3P67A 2A7PA 3G8EA 3TSDA 2VEPA 3NPXA 5G4EA 2VEKA 3A5FA 3BG9A 3R2GA 2DJLA 5AC7A 1XUUA 2A7RA 4RCXA 3KVJA 2QJIA 1R2SA 5FESA 1H60A 1QCWA 3IVUA 4TIMA 3HGSA 3QSTA 5E0KA 2A0NA 4WOZA 4WY0A 2NXHA 3W7PA 4LW7A 2E6DA 3NQGA 4UNKA 4HPXA 3ABOA 3I7SA 1SFLA 3BK0A 4GUGA 4TMBA 3EWUA 3PR2A 4YMZA 1OFDA 2CLLA 4L4LA 1QPQA 1TIMA 3WJZA 3C4UA 4ORIA 2C13A 2Y63A 3PUEA 2VEMA 5KZDA 2E09A 3MP3A 1EUNA 2X1TA 3W2KA 3TJLA 4UTWA 3LTPA 4N4PA 5D03A 2WPBA 3P62A 5D2XA 1LLWA 4LT9A 4FNPA 3E96A 3TSMA 3BW3A 4WQ6A 2CZDA 1PE1A 2DU2A 5EKYA 3PULA 5D09A 2WSYA 4JY9A 3SGZA 1W8SA 3W72A 3LBMA 1ME8A 5BMXA 3QM3A 1TTPA 3NM1A 2QCNA 4IOTA 2RDTA 3SZ8A 4FNRA 3QW3A 4JX6A 4O1CA 1TQXA 4AHQA 1G4SA 1LDCA 3W86A 3TFCA 4N6EA 3M43A 1YLVA 5LNUA 2X2GA 3N2MA 3N9SA 5FF0A 2VEIA 1OFOA 1VGAA 5DCDA 4BI5A 2E68A 1MSSA 4ML9A 3ANYA 2GOUA 5H2ZA 1O95A 4OT7A 4PL2A 4UMCA 3F4WA 5HINA 3DHDA 4MJZA 3KAOA 1AW5A 2QDGA 1Z41A 4IUOA 3BV4A 1KA9F 5I3GA 2H8XA 4M7SA 4Y90A 4GUHA 3EKZA 3R13A 4M7TA 3BLEA 1FWSA 1YDOA 2X1SA 2H3DA 3SY5A 2V81A 1M7PA 2DZXA 3TH6A 4DBDA 1H7NA 5LNVA 4UMAA 3A5VA 4YXGA 1QMLA 3DFSA 4ZVJA 1S5TA 3L0NA 1LLZA 4AF0B 2GVGA 1VHCA 1YTDA 2CZFA 5KZEA 1H7RA 1HFBA 4YCOA 4O0KA 1FWWA 4LS1A 5FF3A 3I7QA 3WFAA 3FFSA 2V30A 4MUZA 3AJXA 2XN2A 3IEBA 4EF8A 1O4UA 3TIMA 4ONVA 3N9RA 5F2GA 3W2NA 4I7UA 3O16A 4LC6A 4K38A 2WKJA 3W7EA 3BARA 2HTMA 3SI9A 1JUKA 1FDZA 3NQFA 3G1FA 2Z6JA 2CLIA 1G69A 1GVFA 2B7PA 2QJGA 5D2YA 5C54A 1Y0EA 1TTJA 1W56A 4HSNA 3QW4B 3N14A 3FLUA 2P0OA 3GXNA 3HGJA 3CIWA 2PC4A 2Y61A 3C8FA 1DORA 1UUMA 4AXKA 1KTNA 1VYSX 4WXZA 4AVFA 5LGZA 5BNKA 3C2VA 3ZWTA 1XM3A 1DVJA 5TIMA 3ZS4A 4JEQA 2ZRZA 4U4MA 3MHUA 4EVZA 1DL3A 3S5NA 1A5AA 2HS8A 1JQVA 5LNRA 1EWDA 4XKYA 4HN4A 2G97A 5KTLA 1TTIA 2C15A 3LI1A 1KW1A 1NEYA 1EP2A 4TX9A 3ZR4A 5FEWA 4FNTA 3M9YA 1ZAIA 2AAMA 4EOUA 1FWRA 3PS7A 2NV2A 4HSOA 3W1RA 4DPQA 3NO5A 2G95A 3G1HA 1YPFA 4FIRA 1OK6A 3W1XA 2ZZ3A 3MYOA 2Z0IA 3FOKA 3GDTA 5T26A 1FCQA 2CLMA 4RJEA 2BZNA 1R2RA 4KKXA 5D05A 3GVGA 4EWND 1I2OA 4NX0A 2TPSA 4NUWA 1GTEA 1QPNA 4O54A 2BWGA 2I9EA 4FNQA 4FXRA 1LRQA 5CGQA 2YW4A 4K7YA 2H3BA 4NX5A 3EX2A 1XDMA 4J9JA 5D32A 1IGSA 3O6CA 2HS6A 1VQTA 3HOJA 3O07A 1PVNA 2Z1BA 4MYAA 1XI3A 3HG5A 4YCPA 2ZA3A 3W7RA 3T44A 3PSWA 1W3IA 2OT1A 2ZFAA 3GDRA 1H7WA 3W2LA 4OV9A 1H61A 2ATMA 3W07A 5IM51 2JKEA 3DFOA 3STEA 3A9IA 4IQLA 4XTIA 1QPRA 4BR1A 4MFEA 4BWLC 2YDAA 4O17A 1H63A 1KBJA 5LKYA 5HWMA 2ZRYA 3H55A 2YYTA 1GVRA 2TRSA 3UXDA 5K3VA 3OVRA 4FXSA 2EGZA 1H1YA 1EP1A 1HO4A 1TRIA 4X22A 1W31A 2OCZA 1UASA 3FKRA 2YZRA 5HR7A 3CLMA 3W87A 3C0JA 5I3JA 1H50A 3MO7A 2RDUA 4IPJA 2ISSA 3DFQA 4UR7A 3NA8A 4Z1AA 3DFTA 4DEFA 4FHAA 4LNYA 3W7NA 4TR9A 3P74A 3G1YA 1EA0A 1RD5A 3QF0A 2V5BA 3W73A 1GG0A 3IRDA 2W0UA 2V2HA 3C52A 3GKAA 5FF2A 2Y70A 4GUFA 3W2JA 1L6WA 1SUXA 2NX9A 3LHZA 1Q45A 4JTFA 4MLRA 1N7KA 1SW7A 1SSDA 1SR9A 3IGSA 3MHFA 4E2BA 2DZUA 3R12A 4NQ1A 3NOEA 1MZHA 5AHLA 1F76A 5LHFA 4UMBA 2QAFA 1RZMA 4H4IA 2ZBTA 4JIQA 3QH2A 3W70A 4MY8A 1OFQA 1ICQA 1ZHAA 1PS9A 5AHMA 1LCOA 1A5CA 4GWEA 5DCBA 3GX9A 3EXRA 2ZRVA 1P0NA 4IXHA 1WX0A 3VI2A 3EWBX 1FBAA 1JRBA 1TB3A 1FUYA 3S0CA 5LHEA 1AW2A 4HNUA 4LRSA 3E49A 1ZFJA 5HUOA 2C6QA 4AAJA 2A5HA 3G1XA 3O1NA 4N9BA 3C6CA 3IGXA 3EWZA 3R8RA 1LOLA 1OFBA 1C29A 3DAQA 3LHTA 5CPNA 1OYBA 4GC4A 1EEPA 1SO4A 2ZCGA 2XFWA 3PAJA 1H51A 5G2IA 1K03A 3G22A 1ALDA 4UNLA 1XKYA 3S5OA 4P61A 1VPXA 1ICPA 4BWLA 5K4ZA 1Z42A 1Z48A 2C18A 4MZ1A 3HPXA 2BX7A 3G24A 2E1DA 3B04A 4CNOA 4JGDA 3CWNA 2RHGA 4GNJA 5U4NA 3G8RA 4BI7A 3IIXA 1C9DA 1DQWA 4K37A 4KWVA 4FNSA 1WBJA 4KFNA 4GJ1A 3EX6A 3NL2A 4FF7A 4O15A 1ZENA 3HG3A 3PF3A 2W79A 4NXKA 3W7DA 3CTLA 3M5XA 3N34A 1F74A 4QSHA 4PODA 1G4EA 2GQAA 3TA6A 5AHEA 3NGJA 4KWWA 5KSWA 4QM1A 3NQCA 3V1PA 2GPTA 3W22A 1OX6A 3KFTA 1EPXA 2TMDA 3LCIA 2VFEA 4XZ9A 3O05A 3P81A 2ALDA 3KRZA 3STGA 4QJ1A 3P8IA 1SU5A 3I6RA 3DFNA 3PSVA 5CSSA 1VLWA 3EWYA 1O5XA 4M6PA 1YYAA 3TK7A 4ZZ9A 8TIMA 2NXGA 3C3NA 1YTKA 3HGOA 1I2PA 4ZMGA 1QWGA 2NX1A 3KOFA 4AWUA 1PCKA 1Q6RA 3FKKA 3C2OA 2PRHA 2FTPA 5MHBA 5HR6A 3NZRA 2YR1A 3MP5A 2B7NA 4PFMA 2FPYA 5HUPA 4CCDA 3NL3A 1TPDA 3B05A 3NQ6A 3IVSA 3S5ZA 4CNNA 1JULA 4LC8A 3G0XA 3UY7A 4ZQNA 1M5WA 6TIMA 2BSLA 1I4NA 2VKZG 5F4SA 2QJHA 4LV9A 3RMJA 1PIIA 2FPVA 2J27A 3CQ0A 4W9TA 3MHGA 3C2EA 1Z44A 3LRKA 4UTTA 1SO6A 3LTYA 1K8XA 1UCWA 4G1KA 1EB3A 5CPLA 3T4CA 4JY8A 2EKCA 3QJAA 3W76A 3TC6A 3FS2A 1DQXA 3PWAA 5K7JA 2CU0A 4ICNA 4HKPA 5FF4A 1WYIA 4K39A 1J4EA 1FXQA 4JN6A 1AK5A 3W88A 2Y88A 1G6CA 3LCWA 4Z1CA 3O06A 2X1RA 4ZQPA 4ZQMA 5CSRA 1HTIA 1VYRA 2ZZ1A 2C3ZA 1XUZA 3GK0A 2Q3OA 1I2RA 1AMKA 4GXMA 4IMCA 2G5WA 1U83A 3O8AA 1VCVA 3TQKA 4JR5A 3IIZA 4CQ8A 2BXVA 1TQJA 4RZ5A 1LZOA 5HQEA 1Q6OA 3KHJA 2CWNA 1ZCOA 5G5IA 1PHQA 4WUIA 3S1VA 3OVPA 3RK8A 1PL9A 3W85A 1TPC1 5J5DA 5AFDA 4FX6M 5EPDA 4RXFA 2ZRWA 3BW4A 4N6FA 3LCFA 5K9DA 1NF0A 2CLKA 2QUUA 1R46A 1E51A 2I14A 3CC1A 4R33A 3TW7A 1R47A 3S1WA 2DZSA 4JXCA 3NNTA 5HWNA 1FWNA 2OMAA 2E77A 1IXPA 1W5QA 2E6FA 3NR0A 3LV6A 1K8ZA 2E6YA 1JUBA 1VR6A 3GDLA 3GZ3A 4DBEA 4Z0SA 2F7FA 3TSBA 4JTJA 1OX4A 1QDSA 3IIOA 3LX9A 2PRMA 3CEPA 4JTGA 3RLUA 4DQWA 1H7OA 3T40A 4K7VA 2LLEA 1SZNA 2PURA 3PUOA 1IIGA 4AWTA 2ZTKA 1K8YA 1SZEA 3Q37A 3LTSA 1XXXA 4XQ6A 2XN1A 2X30A 1VYPX 1H62A 3S9YA 3HMJG 4P2VA 1DBTA 4NJJA 3W7OA 4DO5A 1VZWA 3M5VA 2KZHA 1Q3NA 3UXAA 4NZJA 3PY2A 3KXQA 3G3MA 3EWWA 4PA8A 1H7PA 4JS3A 3GDMA 2JGQA 1GVSA 2Y7EA 1W5MA 4WY0B 3UNDA 3UYCA 4O57A 5EA9A 5I3KA 4A29A 4MY1A 5BRBA 3YPIA 4JDBA 3S1UA 2W6RA 2YX0A 1V7YA 3Q94A 3P8JA 5DBUA 3GR7A 1UUOA 1L2UA 5AC6A 5SWUA 2C14A 4OBTA 2QCLA 1CI1A 4XTDA 3UQNA 5G2WA 5C55A 2WSRA 2J9YA 2VELA 2DZWA 1LBMA 4WD0A 4YLWA 3DHFA 3VCRA 1KM1A 3GR8A 5CZSA 5CPOA 3W7MA 1OABA 3KX6A 5AYYA 2FJKA 4PCFA 3UY8A 3LB0A 1PV8A 3F1QA 4UTLA 3W3OA 1XBYA 4IMFA 4KFOA 4LVAA 4K8EA 4OHQA 1D9EA 2YYUA 3TR2A 5G2HA 1WXJA 2NWRA 2X1UA 2QCGA 1JRCA 4N02A 4AB4A 2Y89A 4MIMA 1DJNA 3CB8A 1ADOA 3HB9A 5F1UA 1AG1O 3W75A 4Z1BA 3L9CA 3NL6A 3MI6A 3E02A 3LI0A 4I7WA 3BG3A 4UFMA 2WNZA 4U28A 3W7KA 3L2IA 1FDYA 3S5YA 2DZPA 2JGYA 5K4XA 1O5KA 4MOZA 2V82A 1K3UA 1ZY9A 1VJIA 3W1LA 1I45A 1GPWA 4JYEA 4JICA 4FX7A 3OVQA 4ZL1A 1I2NA 3S8HA 2BTMA 4RV8A 4MPQA 5I3IA 3THAA 3WK2A 1L6YA 4OQVA 4CNPA 2VENA 1OYAA 4RZ6A 4S2CA 1W1ZA 3FA5A 1T0OA 3DKLA 1G7VA 3ABRA 5K9XA 4H3DA 4Q32A 4MLJA 1P4CA 4O4WA 1LP6A 1JVNA 2V9DA 5F1VA 3USBA 2WO5A 4FNUA 3SECA 3W74A 4NJHA 3W2UA 3WJWA 3QFEA 4D2JA 3FJLA 1LOSA 5CZJA 3L67A 3SW6A 3SJ3A 1HUVA 1TTQA 4NNAA 3T55A 4BFAA 1P0KA 2XN0A 2Q8ZA 1O60A 1THFD 4M5PA 1GEQA 2YCEA 2Z2UA 1TYGA 1SO3A 4JTUA 4JYDA 5AYXA 4LS0A 1TSIA 4POCA 2FLIA 4O53A 4GRSA 1HG3A 3W1QA 4S1FA 1U5JA 1JCMP 4CCEA 1LOQA 4A2RA 1D3GA 3MYPA 3GIYA 5A8GA 1F6PA 1NF7A 5DELA 4Z1DA 1GVQA 1KFEA 4PH6A 3QMRA 1ONRA 2GJNA 2ZZ7A 4A2SA 1IXNA 2DZTA 4GUIA 2V2DA 3ABQA 3G3DA 3QSRA 1M6JA 3A23A 3GNDA 3PBVA 2VFDA 3NQ8A 4JTIA 4NNCA 2Y7GA 3GB6A 3W1UA 5LNSA 3TC7A 1UBSA 1YTEA 1QPOA 4NNBA 1BEUA 3PUDA 5KZMA 2GVJA 4S2BA 2NWSA 4JDYA 4MZ8A 3HG4A 1G7UA 1T8XA 2QCFA 1VCGA 2C19A 3G18A 1BWLA 2ISWA 3IIVA 3QMTA 4LS2A 3VKJA 4UC5A 4X2RA 1T99A 2OT0A 3GAKA 3EXSA 3W2MA 3WJSA 1VS1A 3H53A 5TQLA 3N3MA 4LUIA 4XKYB 4JX5A 2VOMA 3TAKA 1XL9A 4N9CA 5LZLA 3MBDA 2OX1A 3EB2A 2ZA1A 2H8ZA 5F4WA 3TXVA 4E0CA 2VFIA 3UPWA 4DO6A 1WDWA 4XBSA 3ABSA 4K36A 4L4MA 4UFKA 1HO1A 1YDNA 3PB0A 3DU0A 3CHVA 3EKLA 1W3TA 4OWGA 3ZFHA 1XBXA 3P61A 1VRDA 4IX2A 3TU9A 4QITA 3UD6A 5DY3A 1O94A 3W7HA 1ZAHA 2ABBA 2B7QA 4WXYA 3A22A 2RDWA 3NQEA 1PCWA 1VC4A 1K7EA 3QEZA 3NXFA 4QNWA 1JCJA 5F2LA 1K7XA 1EP3A 3BGJA 1H5YA 3DI1A 4C1KA 1TPEA 3W23A 2FB3A 5FEZA 1X7FA 3WK1A 4BF9A 3SGUA 4ADSA 5D38A 1FY6A 3TUUA 3B0VC 3DGRA 1I8JA 3TDFA 4BK9A 2J9XA 1WQ5A 3LCGA 3PG8A 4UTTC 3LHWA 3W1TA 3CT7A 3I65A 2GUUA 1LRTA 5AC8A 4IMDA 3M5YA 3QRHA 5KITA 1A53A 3STFA 3W7IA 2Q3RA 1EUAA 4LRTA 3KRUA 2QR6A 5C5YA 4IPIA 1TV5A 3QZEA 1K7FA 1JCXA 3L0GA 3AO0A 5HWJA 1MEIA 1H7XA 1KM3A 4E2DA 1VH7A 5BOOA 3MW7A 1KFLA 3B0PA 5D2VA 4YL2A 3L68A 3GDKA 4MZYA 4N4QA 1YADA 3NEVA 5FEXA 1S5VA 1JJKA 4LWWA 2R94A 4IMEA 3QPZA 4IXXA 3TQ0A 3LRLA 1FCBA 1SZFA 3P82A 3NL5A 5K9CA 3NQMA 3L21A 3M47A 1TPH1 5FEPA 3R89A 1TV8A 2WNNA 2F84A 3S42A 3OBKA 3L5LA 5AYZA 4DF2A 1TJRA 1F2JA 3MUXA 4Y96A 5KMYA 3L66A 4UFJA 3O6YX 5D04C 3K30A 4PTNA 3HPZA 2NV1A 4RK8A 3P80A 3G1DA 4NU7A 1TPB1 3LHUA 1QNVA 1RV8A 5F2IA 4DPPA 3OEXA 3WJYA 5LGXA 3B03A 5U7SA 3IV3A 4NT0A 3PC0A 1JR1A 1B4KA 1WA3A 4AEOA 4NVTA 2A6LA 3FYPA 4FB7A 3C2FA 3LRMA 1VHNA 3GKFA 1LORA 3WK3A 2WSQA 2GVLA 3BVJA 5I3HA 4UFHA 4RXGA 3U8GA 3HIJA 1OX5A 3MWAA 2CZ5A 2QAPA 4JTHA 1KFBA 3M44A 4RX0A 3R5EA 2PCQA 1UJPA 3H54A 2J6XA 4IX0A 1RQBA 1QAPA 1CX9A 3I68A 2V0TA 3BO9A 1A50A 4LV4A 2H6RA 4TMCA 4GUJA 2TSYA 3MI3A 3Q58A 1ZNNA 1TRDA 2AGKA 3W1MA 1EIXA 1GZGA 1GTHA 4EF9A 3NQ7A 2YGYA 1T96A 3HQ1A 4UTJA 1KM5A 2O7SA 1W5OA 1WV2A 2PRLA 1A5SA 3E9AA 3W7QA 4JX4A 1AL8A 1JQXA 4AH7A 3F03K 5D2TA 1QFEA 1IF2A 3RU6A 1XFBA 2A21A 4Q4KA 1JCNA 1UB3A 3DFPA 3M0ZA 2C0AA 4X3ZA 3NPVA 5AHNA 4AF0A 3EWXA 1ICSA 4XWUA 2E5CA 5D2WA 2YFNA 1OFEA 4RR4A 1FCVA 2RH9A 2FB2A 4A3UA 5I3FA 3IIPA 5DXXA 2YXGA 2UV8G 3SSJA 2J9ZA 4K6AA 4UIOA 2VFHA 2ZRUA 1FX6A 3W84A 4MY9A 5A5WA 3LOTA 4OE7A 3HBLA 2ZZ2A 1TREA 4JIPA 3UWQA 1FDJA 2QUTA 5EY5A 3PM6A 5D30A 3PBWA 1ZJIA 4FO4A 4LU0A 2NXIA 3TMLA 3PBUA 3GNNA 4K8HA 3FJ6A 3WJXA 3M41A 2NX3A 3DH7A 3ELFA 3IGUA 3P5ZA 4ALDA 1KM4A 3W6YA 5ABTA 1ME9A 4IJBA 2A6NA 1KLYA 1X1OA 4RZ4A 1X8FA 1GQNA 3W9ZA 1B9BA 2JKPA 3MP4A 4GE8A 1JCYA 5C6MA 3W83A 1GOXA 3S6DA 2ZDRA 1B3OA 2QCMA 1KLZA 3UWVA 4JYFA 4UFIA 1W5PA 2HSAA 1CW2A 4TO8A 3DXIA 4QAIA 7TIMA 1YDVA 2DZVA 1ZAJA 4O10A 3EXTA 3JS3A 3HJZA 4ADUA 5K2ZA 4FEZA 4LY8A 2A85A 3G1VA 4XUGA 3OA3A 3RNDA 1IIHA 1X1ZA 3BLFA 4HNTA 4Z0JA 1X6UA 1TJPA 1OFRA 3MI2A
chains in the Genus database with same CATH superfamily
1CTNA 3ZIZA 3GU1A 2YXOA 2YPIA 3CO8A 4PUDA 3U2OA 1S1RA 4ZQOA 4AD1A 2IQDA 1T8QA 3CUGA 2CLFA 4TVDA 3LQLA 4LUJA 4W8BA 4NZ5A 4P8VA 1J6PA 2PC8A 4QHRA 3R0DA 5FJTA 2YBVA 3AYTA 1BHGA 5D33A 2QCHA 3VE7A 1UP2A 5A2AA 4RKAA 3BLPX 3ONCA 3BAIA 4PCSA 1T6MA 4GBUA 4W88A 3TCEA 4N2YA 1N8FA 1F5ZA 4UTHA 1XRVA 4IMGA 4LVFA 1TO3A 3XINA 2NUYA 1IT7A 7ENLA 2EHHA 5FKYA 2Q8LA 1QHZA 1AL7A 2NLYA 1PX8A 4ZR8A 3UZWA 1LUCA 1M03A 4O0ZA 2GJLA 2P3EA 3F2DA 1TCDA 4QLJA 3KVKA 5BOEA 1EJWC 1BTMA 3CEUA 3W81A 3ZSSA 3TJXA 4C6EA 4MWAB 7PTDA 3O3RA 5A95A 3ZVIA 3LU2A 5REQB 3E5BA 1W54A 3MDUA 4DYJA 3MV01 2RFGA 2W4XA 3CIXA 2ZTJA 3NVTA 1BRLA 4MFDA 2OO0A 4DN1A 3E0VA 3WCZA 1GYNA 1TV7A 2HXTA 5DX7A 1KXTA 3VU2A 4WLCA 1WAUA 2B81A 3P6LA 1AQFA 5DBTA 2GK1A 1EJUC 4DJFC 1J0HA 2Z2BA 3DGBA 3MWCA 4IL0A 3AHVA 1XYBA 3EA3A 1SJCA 5G1YA 1I6NA 2XZ7A 3KL3A 2Z4GA 1OJXA 2HCVA 4NJIA 3W1NA 1LQAA 1GYLA 3VIOA 1JUEA 2V2CA 1OX4B 3BCJA 2RUSA 3R0UA 1PKYA 3GHUA 3KVLA 2XVGA 1OZMA 1AH4A 2RGMA 1IXOA 1TWIA 2WQDA 1XISA 4DZ5A 1N55A 1X96A 1B31A 1HN1A 1MXDA 2EO7A 5HANA 4E38A 4UQ9A 2EXOA 4LBUA 1WOAA 2FDMA 1IEWA 4QEEA 2WMKA 2R14A 1KCKA 3ISIX 2ZZ5A 3AIVA 3KRSA 1GT8A 3S2MA 4W85A 4E2VA 1DOSA 4AHOA 2PWVA 1FWEC 1OGSA 1FH9A 2CC0A 1TPUA 4UTMA 3AXMA 2ZE3A 4V2XA 2Y1HA 1TWDA 3LM3A 3Q2DA 2CW6A 3QGAC 2IXUA 2E5BA 4QNEA 4A05A 3RLGA 4GLEA 1ONXA 2WNQA 3M46A 2DJXA 3HQOA 3URBA 1VB9A 4UQBA 4ERGA 5ABHA 4M6QA 4UTIA 2JBMA 4ADTA 2QEZA 1LM1A 3BOLA 2VEFA 4H8VA 4QJ3B 4F0LA 1KFWA 4XZBA 3HPAA 1MW2A 4PTWA 3CB3A 3IUIA 3W7JA 1D3HA 1RD6A 3KL5A 3NTYA 3CUZA 2WM1A 3NDOA 4Z42C 2H9AA 3L5AA 4RNIA 1OCJA 1CNVA 4Q4MA 3VE9A 3FEQA 3UR5A 4AEEA 3WNMA 1JIBA 3C0QA 3UVIA 1J0KA 2QF7A 2CLOA 3GXTA 5TD4A 1US0A 2IQTA 3ZWSA 2J78A 1RCQA 3P5YA 4LAUA 1F6KA 5I7GA 2Y7DA 4E6MA 1EC8A 2I1OA 3PG9A 3VABA 1US3A 3U57A 3FEMA 1GJPA 3GVVA 1NSJA 1V3LA 4DJED 3G1SA 3AOFA 4JTEA 3H4WA 1B3YA 4Q8PA 5FD0A 3CWOX 3LHYA 1JAEA 5BRQA 3QOMA 4JNMA 3LQGA 4PCNA 1K9TA 2YSWA 2F6UA 3KBVA 2WMIB 4JPGA 2KAUC 3GDBA 3LCLA 4QQ3A 1JDDA 1E70M 1G4PA 1REQB 1ISVA 1FWFC 3EMCA 3UWYA 4ACZB 1LTDA 4L9XA 4O11A 1HQTA 1GG1A 1QW9A 3UZXA 3EZ4A 2Y6ZA 4GQGA 3LHVA 2VFFA 4L6HA 4O16A 2FGLA 1R6WA 4FXJA 1W9BM 4L56A 4Z2JA 4JTSA 2Q02A 3O0FA 2P1FA 1TVNA 1EJXC 1EWEA 1J8VA 1KWGA 4YHEA 1XC4A 1GNXA 1NDWA 4AWSA 1XG4A 2DP3A 3E0WA 1SO5A 3THDA 3MMTA 4HYVA 3N2TA 3RGTA 2ZC1A 1XP3A 3TVAA 4L1XA 4OGZA 2CLHA 4QISA 1GKRA 4M6VA 1OF6A 2ABAA 4RLIA 1UD5A 5GJMA 2QHAA 3VO0A 4LVGA 2CHRA 1RVGA 2ZWZA 3W71A 3RX3A 4NHVA 3AIQA 4AD4A 1XYLA 4RNHA 4NZ4A 2FDSA 5CKSA 5GVJA 4B2DA 4NYYA 2J4GA 2DFAA 2CXGA 1DV7A 3OLEA 2X2YA 1OFPA 2WQPA 2DT0A 4HD5A 2ZYFA 3NM3A 3SR7A 1QO5A 1GPFA 1XIGA 5BROA 4WX2A 4ENLA 3QQ1A 2C8NA 5J5RA 4RPPA 3BG5A 1TPFA 3G0SA 3HPSA 4BY3A 1K9DA 2OZ0A 4CLMA 3E0IA 5CLTA 3WQEA 5HULA 4PMVA 5FIPA 4Q8MA 3NQDA 3D3AA 2DPEA 3H2FA 5DT5A 3AS3A 3EOSA 3WH7A 1OVDA 1RY8A 4KCTA 3TAOA 3OHIA 1H1ZA 3HFYA 3SDOA 4C1LA 4XSLA 4P8UA 5DRCA 4KFPA 1B30A 3BUVA 1B54A 3U0HA 2P88A 4AHPA 3CO4A 2OO6A 4D1JA 1X38A 4GY7A 3VFLA 1XG3A 2RKXA 3H24A 1PWMA 3TSDA 5LA2A 1OB0A 3AZTA 5AC7A 1XUUA 4IFKB 1XYFA 4RCXA 2FZDA 5ABFB 3QKEA 4YVVA 2QJIA 1H60A 1QCWA 3IVUA 2INZA 3HGSA 2WVVB 3AXXA 3F4VA 2PSNA 1PSCA 4QDPA 3NWRA 4HPXA 3ABOA 3EBVA 4AY1A 3MQTA 1JZ5A 4YHGA 2ZX9A 1E56A 1OG6A 3ARPA 3K1GA 5BXSA 3PR2A 4YMZA 3WLRA 3B8SA 5A8NA 3VDAA 1BVNP 3WJZA 4IG2A 3UBPC 4AW7A 2Y63A 4DWSA 4CN1A 1YRRA 1QI4A 4B92A 1QNPA 3G2GA 4AY8A 3BAKA 1I1WA 4NYUA 5BYWA 5D2XA 1LLWA 4MB1A 1H41A 2X0HA 2ZKMX 4FNPA 4YYFA 3TSMA 5IDIA 3PULA 2W63A 5BXRA 4RDYA 1W8SA 2WZTA 5MF5A 1RLCL 2WKGA 3GQYA 2OKTA 4FNRA 1MNSA 3IANA 4U5KA 3TFCA 5H1WA 1YLVA 1JPMA 5FF0A 1OFOA 2E68A 3QLDA 3ZT5A 2GOUA 4GFIA 2EQDA 2OXNA 4PL2A 4D6IA 3PZIA 3DHDA 3KAOA 4AISA 1OWQA 1GGOA 1MRQA 3DG6A 3HV9A 5E6ZA 1KA9F 3IAQA 2DSZA 4FLOA 6CGTA 1BD0A 3BC9A 4WSJA 1RCOB 2DZXA 4EE9A 3S83A 4UMAA 3VMNA 3A5VA 1LF1A 2XU2A 3GSMA 4DUOA 2CZFA 3GUWA 1L8NA 1FWWA 4LS1A 5FF3A 2R82A 3LPGA 1W1B1 2V30A 4GKTA 3IEBA 2PU1A 1Q2RA 2HVOA 3TIMA 4R7OA 3A4AA 3HTWA 3W2NA 3O16A 3LENA 4LC6A 1CIUA 2WKJA 3NQFA 3G1FA 1NWSA 2PDMA 3QR0A 4C6IA 2B7PA 1I0DA 4W5ZA 1Y0EA 4AYSA 2R1NA 3PFRA 3SY8A 3QW4B 4ZE4A 4FZIA 3HV8A 3I3DA 1VYSX 5LGZA 5BNKA 3CS2A 1N8WA 3WUGA 3IUDA 4JEQA 2XH7A 3ZO9A 3A6OA 4REQB 4U4MA 4EVZA 1DL3A 3S5NA 3VCCA 4ZOAA 1A5AA 1JQVA 4JNZA 4L64A 3CL7A 1TTIA 2C15A 3LI1A 4GQBA 4C90A 4J3ZA 3ZR4A 3T8LA 1A5NC 1EF3A 3A4WA 4EOUA 4AD2A 3Q65A 1EOMA 1XYCA 3H26A 3PS7A 1UMLA 2NV2A 1ONWA 1P7TA 3BMVA 4HMCA 3W1RA 3IJ7A 3G1HA 3CV2A 2ZZ3A 1F4HA 5BCAA 1TUFA 3PPFA 2VOTA 2OZ3A 4HB7A 4B5VA 2B31A 5D05A 3GVGA 4WK9A 3T8QA 4U5IA 3ARXA 2G3NA 1I2OA 4EWND 4YNGA 2VL4A 3CZGA 5CBJA 1LQ2A 2OSYA 2ASHA 4F0KA 1WKEA 3VPLA 4L6DA 3WLSA 4YYCA 2VI0A 2IW0A 4O54A 4FXRA 1LRQA 3Q45A 5CGQA 2YW4A 3W4RA 4I8DA 1UROA 1EF2A 1XDMA 3VOIA 1R9YA 5D32A 4RDZA 3BH4A 4HPGA 1IGSA 3O6CA 5CBBA 2HS6A 3DHPA 1VQTA 1UOKA 1PVNA 3S3GA 4PB3A 5HMFA 4OBSA 3IJ8A 1EYEA 1CB7B 4A3QA 2WW5A 1BQCA 2ZUSA 1MYRA 4IQLA 3DESA 4BR1A 3I3EA 2J7EA 4O17A 3U4FA 2OB3A 3WF1A 4HZ8A 1POKA 1N8IA 1GVRA 5K3VA 3UXDA 1LL6A 4FXSA 4US6A 1E4LA 1TR9A 1HO4A 2NVCA 3F5JA 1W31A 3MANA 1UASA 2I9UA 2ISDA 2D2HA 1IV8A 3C0JA 3N04A 3MO7A 2RDUA 4HHHA 4M81A 4Z1AA 3DFTA 4HK7A 1DXFA 4FHAA 3OYXA 1W17A 3W7NA 2XISA 4XVEA 4TR9A 4JEJA 3N9KA 4IIFA 3WLQA 1AFSA 3FHAA 3W73A 3LUTA 2XIBA 2GJRA 1L6WA 3LHZA 1Q45A 4PRWA 1W6TA 2DZUA 4ATLA 4L4PA 4RNFA 5AHLA 1M3UA 4UQAA 3NZQA 4NKCA 3U7VA 2QAFA 4I9TA 1RZMA 4MNMA 1R38A 4LUYA 3ZJKA 1D7KA 1UZDA 1OFQA 1UQYA 1PS9A 4RE2A 3QPEA 2E8YA 3R94A 5DCBA 3H8AA 3B3DA 1P0NA 2CBJA 4IXHA 1WX0A 1UIPA 1FBAA 3QXBA 1JZ8A 1R3QA 4GIEA 1A5LC 1M01A 3TN6A 3M0YA 2A5HA 5FJUA 3EWZA 3R8RA 2QJJA 3WQPA 1OFBA 2NQ5A 5KEZA 4HHMA 2AAAA 3TWBA 1V02A 3OZYA 1EEPA 5IRPA 1SO4A 2XFWA 3H2CA 1XKYA 1UWQA 4Q7NA 2PMQA 4BWLA 1Z42A 1Z48A 2C18A 1M7XA 1EPVA 2BX7A 3G24A 2E1DA 4CNOA 2V3GA 5M3WA 5U4NA 2E3ZA 4DM1A 3AIBA 1NQ6A 3WKZA 1XS2A 4GJ1A 3PZMA 3EX6A 3ERPA 3NL2A 4ZTYA 3HG3A 4Y8EA 1ZP3A 4RE0A 3OW1A 1M9HA 1R7AA 2CNCA 4LGXA 4QSHA 2NQZA 3OJGA 3AZSA 4DWSC 5AHEA 2O0TA 3ITYA 3KP0A 4QM1A 4B5WA 5BXPA 1A3XA 3PANA 1EPXA 4QQUA 1N82A 2PDYA 2I5GA 4UQDA 3ZM8A 4ROPA 1JYVA 4LCQA 1XLKA 3STGA 2WVUA 3P8IA 3I6RA 4J3XA 2V67A 3PSVA 2Y24A 5CSSA 3CUFA 1SYTA 5AKQA 4EWJA 3A4JA 3Q4DA 4J5NA 5T8GA 1I0BA 1YYAA 3ZZ1A 2NXGA 4E8CA 1JPIA 3KZPA 5E0FA 3IJDA 2GJXA 3CAKA 2FTWA 3UF9A 1R3VA 4FAMA 2YR1A 3JZEA 1PDZA 1LJYA 1UPMB 2B7NA 4PFMA 5CXPA 1AJ2A 1TPDA 3B05A 3V0SA 1ECEA 3WSUA 2VGGA 3G1RA 1EBHA 2YB1A 1V51A 3S5ZA 5A6BA 5HPOA 1TWSA 1QHOA 3G0XA 3L23A 1QI3A 1UA3A 3MSRA 2VKZG 4G7EB 3B8VA 4GYKA 3P3BA 2FFIA 4W9TA 5AC5A 3C2EA 4KCVA 4OTKA 1NWRA 3UG4A 2G8ZA 1K8XA 4P8WA 1UCWA 3VGGA 2WZHA 4G1KA 3SY1A 2PWFA 2EKCA 3QJAA 3TC6A 3FS2A 2GJPA 2CU0A 2PWEA 2GL5A 4HU8A 1P0BA 4JTQA 5FF4A 2XIOA 4LANA 2F2KA 4K39A 1J4EA 1EQCA 1A5UA 4ZA0A 1FXQA 4MMWA 2DGAA 2Y88A 1TELA 1V79A 1BAGA 4CQBA 2ZZ1A 4TX8A 1XUZA 1UR2A 2QYGA 2Q3OA 1B2YA 1AMKA 5CBIA 4GVIA 3C0LA 8A3HA 1VCVA 1ITQA 1QW8A 3EOEA 4CQ8A 1JNDA 2XFFA 1TQJA 2I7GA 3TYCA 3QVQA 3KHJA 1ZCOA 5G5IA 1K6WA 1PHQA 4WDTA 1TPC1 3ABXA 5EPDA 4K1WA 4RXFA 3BW4A 1LL7A 5K9DA 1R46A 3QV8A 3BV7A 3P0XA 4LUSB 1V6UA 3NNTA 4IIBA 4LY4A 5HWNA 4IH3A 5M17A 2E6FA 4GC3A 1YKWA 2BHYA 3ANUA 3LV6A 1K8ZA 2BHUA 1PDYA 2E6YA 3B4YA 1PTDA 3TSBA 4ICMA 4JTJA 1O5QA 1W32A 2PBGA 5J8LA 3IIOA 2WC7A 4P7NA 4FXFA 2PRMA 3CEPA 4XD3A 3UXIA 1YE6A 4K7VA 1W2VA 1IIGA 1DJHA 2ZTKA 4MB5A 3MUCA 1SZEA 1WUEA 1BGAA 3LTSA 1XXXA 4AVNA 4DLMA 3WDPP 3C2YA 3W28A 2X30A 1FHUA 3WQFA 1CGXA 2YCLB 2D24A 3UGVA 5HBFA 1VZWA 2HZGA 2ON3A 1Y8BA 5H8UA 1EIBA 4B16A 1VBGA 3KXQA 3G3MA 2D69A 4Q8VA 1TFVA 3LZ5A 1H7PA 3F7JA 1P6WA 1Q65A 3UYCA 4ZO8A 1MDRA 5BRBA 4FOKA 5FOOA 1V7YA 4K3ZA 3Q94A 2XSXA 3GR7A 1ZTVA 1UR3M 1L2UA 2C14A 2Z1WA 2QCLA 5C55A 1J2BA 4LPCA 1IR2A 2J9YA 4GXPA 2GGGA 1QI5A 2PDCA 4L61A 3WQGA 4WD0A 3DHFA 3N4EA 5EB8A 5CPOA 3W7MA 1OABA 1CT5A 1YBQB 3JVAA 2XHYA 3GC2A 3I6TA 1XBYA 2HQAA 4LVAA 3ES7A 2YA1A 3TR2A 3TZFA 2NWRA 1Q8AA 4DYKA 1JPKA 1JRCA 2IUZA 4Z1BA 3WH9A 4A3HA 3PK7A 5IFTA 1UMYA 3NL6A 3MI6A 3U7BA 3OLDA 4JKMA 4UFMA 2WNZA 4U28A 4I5RA 3W7KA 4V33A 3S5YA 1JZ7A 2PBOA 1O5KA 2PLMA 4UBPC 4MOZA 1EKOA 4MWAD 2V82A 4XD5A 4FPSA 1GPWA 1YMYA 4DRSA 4JYEA 2EPLX 3WD1A 4ZL1A 4MPQA 5I3IA 4GOAA 3FVDA 3NZGA 3WK2A 4JIIX 1OC6A 2OQLA 1BSIA 1V0KA 4S2CA 1D8WA 2BVDA 5CEWA 1YDYA 3QR3A 4Q32A 2FKPA 3MJMA 3IWPA 4O4WA 1P4CA 3USBA 2WO5A 4FNUA 3TYZA 3W74A 3FJLA 3N4AA 3T55A 4KT2A 3VDCA 1P0KA 2Q8ZA 4QDMA 1BYCA 3SCNA 2VX6A 1GEQA 2Z2UA 1SO3A 4JYDA 4QS6A 4LS0A 1TSIA 3VAVA 1EJVC 3W1QA 5CGMA 4A2RA 1D3GA 1E1CA 3GIYA 2PS2A 1GVQA 1W1TA 1SJBA 1ONRA 2NVAA 3L2LA 1NFGA 4A2SA 3MZ2A 3TWAA 4GUIA 3QSRA 1M6JA 4MAZA 4W8AA 3A23A 3PBVA 2VFDA 3NQ8A 4JTIA 3OOQA 2DUZA 2J7BA 3VZYA 1KC7A 1O68A 2GVJA 2HEJA 1RH9A 2NWSA 5AY7A 4FALA 3BZJA 4MZ8A 3HG4A 1EC9A 1G7UA 4QROA 3VKJA 4S3JA 3TJ4A 3WUFA 5AC4A 4TVUA 4KEMA 4L1GA 2YBTA 3GAKA 3W2MA 3WJSA 1WB0A 1Q6GA 5TQLA 4XKYB 1TVLA 4GNVA 4JX5A 3TAKA 3OA5A 3NSMA 2OX1A 4IIHA 4EPBC 3AHTA 4C7DA 1FHVA 1VEMA 2PLCA 2D22A 3AAMA 1V77A 1V02E 1NWTA 4BQ4A 4L4MA 3VCNA 4Q8WA 1YDNA 3OVGA 1XIHA 4XSMA 3L4VA 3TR9A 3ZFHA 4LCSA 4QITA 4INFA 3V0UA 3W7HA 2B7QA 3A22A 2RDWA 3BQ6A 2VVSA 1R3WA 1K7EA 3QEZA 4QNWA 4BJHA 4HCHA 5F2LA 4CU6A 1VP5A 1TPEA 5FEZA 2E67A 1X7FA 1NTHA 4AC7C 3WK1A 4R27A 3SGUA 1RCXB 4NZ3A 4GCXA 4LYQA 3DGRA 3PZ9A 1B9ZA 3MMWA 4ZOCA 2HVNA 1FFRA 1QNRA 1D7FA 3H22A 3W1TA 3WLLA 4IMDA 3QRHA 2ICSA 5KITA 3F2CA 5FJJA 1FWJC 2EG6A 5C9RA 4LRTA 2WWCA 4YTQA 3PFMA 1AVAA 3WQ8A 1KCLA 1W2PA 4QEHA 5DT7A 1JCXA 1EBGA 4HOZA 1H7XA 3AS0A 2YCJA 4S3AA 1DHKA 5BOOA 2VDHA 2ZOXA 3V3WA 4Y7EA 1S5VA 3TEVA 1FHDA 1E72M 2R94A 3L4WA 3TQ0A 3LRLA 3WF3A 1S46A 3M47A 2X7WA 1DE6A 1TPH1 4GYPC 2FVKA 1QW7A 2F84A 2WNNA 3OBKA 4B9YA 5BXTA 5AYZA 2DQWA 1LT8A 3FGCB 1K4HA 2OTDA 2J79A 1Z8AA 1ZZMA 2O4MA 4RK8A 1TPB1 3RPDA 7REQA 3K4AA 1RV8A 5F2IA 5U7SA 4NT0A 1WDQA 1B4KA 1WA3A 3MA8A 6XIAA 1DJXA 3WD0A 1K70A 3C2FA 4ZENA 2GVLA 4GQQA 4MDOA 2PWHA 1IZJA 4C7FA 3DN5A 2CZ5A 1P0DA 4IPLA 4PB5A 2J6XA 2P50A 3ZT7A 1X8CA 1QAPA 1JDAA 5C71A 1A50A 2GDVA 1GONA 4TMCA 4GUJA 1OT1A 3SCSA 1S3TC 1Z9AA 2AGKA 3N17A 1EIXA 5CC3A 1GTHA 1F9CA 2WK2A 4GI6A 2YDQA 4UTJA 1W5OA 2CCRA 3VDHA 1TIWA 5JIWA 5A2BA 1NP2A 1AL8A 1JQXA 4AH7A 3F03K 1YNQA 4B5TA 2HK0A 3WBEA 5AVNA 4X3ZA 7XIMA 1VBHA 4AF0A 2UY5A 3EWXA 2VRJA 2E5CA 3H4XA 2PDXA 5CC7A 2D0FA 2ZADA 3V36A 2RH9A 4J27A 4ZB5A 1ZQ5A 4PFHA 2V5CA 2YXGA 3MB9A 2OKOA 1BG9A 3MKVA 1HP5A 3M0VA 2XSAA 2ZRUA 1FX6A 2ZE0A 4IL2A 3LOTA 2ZZ2A 1TREA 3PM6A 4LBSA 4KW2A 2OYLA 4B4HA 3W02A 2NXIA 4ASTA 4GX8A 1H11A 1ZCCA 5BRPA 1XLDA 4E3VA 3M41A 3DH7A 3ELFA 3P5ZA 3AMGA 3C86A 1GOOA 3V16A 1KLYA 5IXEA 1TUXA 2XSBA 3SRKA 3B0XA 1GQNA 4D8LA 4S3KA 2IXVA 4HVXA 4JL2A 2I16A 4HHLA 3SCOA 2QCMA 2VHLA 3THUA 3CUXA 3RIKA 1U22A 3DXIA 3V5OA 7TIMA 1YDVA 2Z1VA 4PEEA 1AUSL 4LY8A 2OSWA 1X1ZA 5I24A 3U48A 4HNTA 4Z0JA 1TJPA 3MT1A 3CAVA 5CG7A 1SMAA 2GQ3A 4YWIA 3LV5A 1M1BA 3LLDA 3KCOA 2A7NA 2HVMA 5AHFA 3KOXA 5EMLA 3MSGA 3NPUA 1CCWB 2Z29A 3S6TA 5BMWA 4GO9A 1TZZA 5IFPA 3ATYA 2ESCA 3TW6A 3AHXA 3QMSA 2ZXQA 1J5TA 3CHFA 1POJA 3B9EA 4JIHA 4TU1A 3QPYA 1NFBA 1G01A 5F2MA 2B7OA 3Q67A 2WB5A 5CJNA 4M19A 2ADAA 3KZSA 1QR7A 4UUIA 4UCGA 3V75A 2V3DA 2FFCA 1W8GA 3LXAA 1DIKA 4ZOEA 3WG6A 1OK4A 1HGYA 4HPJA 3H2OA 4DNMA 5L9FA 4HTYA 2BB0A 3BMXA 1UZ4A 4WJEA 4RV3A 1E6SM 5DMMA 4V15A 3NQ2A 5LIKX 3JR2A 3S47A 4HPNA 1ZALA 2CFFA 3A13A 3CQIA 4WJXA 1SSGA 3B97A 3VVGA 1ISZA 2BY0A 5FAGA 4B5UA 1SZGA 1RJQA 4Q22A 1LBLA 4IP4A 2XFRA 4DJEA 2QCEA 3THQA 4R53A 3E0LA 1TPVA 3UR7A 1B1YA 1HKJA 4MKSA 4QCFA 4PC8A 2R9RA 2VCAA 2E9MA 1V0NA 1XLAA 1P0EA 2NQJA 1WE5A 1V6YA 4OU1A 3ICJA 1QNOA 2J7CA 2G50A 2OLSA 2P8CA 3OGSA 4WKAA 2VC6A 4C7GA 4XZLX 4W86A 1I1XA 1S3HA 3O63A 1FRBA 3LLFA 2R1KA 3WLPA 1I60A 3MCOA 3FY1A 2IPGA 5DY2A 3VGEA 5DLCA 3BTNA 4E4PA 4O13A 3CQKA 1M7OA 1LROA 3EEZA 4PMZA 3QHNA 5A2CA 3ARSA 3K5XA 3O15A 3HG2A 4JD4A 5A8PA 1D2KA 4A6GA 3A21A 3QKZA 3LERA 3MC5A 3KE0A 4ZOBA 1F61A 3GG7A 1RBOB 4P7RA 1VFFA 3BZGA 1L6SA 4J3WA 3GWQA 1XLEA 2ATSA 3H2AA 3QN3A 4O19A 1AW1A 1O66A 1TPWA 2A3AA 4JTDA 3FNDA 2XFYA 1WDRA 3EDEA 3L0KA 3WDJA 1OFAA 1YQ2A 5FSEC 4AZGA 1GQLA 3SN1A 1XBVA 4I7VA 3ZSTA 3TNOA 2X41A 1RJPA 1G67A 2BY1A 3QLLA 4QG9A 4IP7A 1DKWA 1NJJA 1FTXA 1GZ1A 4PZVA 4LOCA 4UTUA 1F73A 4A35A 4RW3A 3AMCA 4B15A 1VJZA 1X97A 2ACUA 4TV5A 5KINA 4XB3A 4BEQA 1H49A 3KBSA 4ZEPA 3VD4A 5E70A 3HO8A 4GZEA 4ZO7A 2Y7FA 4H6KA 1GORA 4FX8A 2ZXAA 3WO8A 4XO7A 3LCHA 5L6UA 1GKPA 1PKNA 3KDNA 4NSBA 3O6DA 3CH0A 1VFMA 4DI8A 3L5MA 1JYXA 2NUWA 4JTKA 4DHGA 3RX2A 2CERA 2C0HA 5TBOA 2P53A 4KGLA 1Q5MA 4LF2A 4Y2WA 3VK5A 1EGZA 2O7QA 1P1XA 3TFXA 1K02A 1O5RA 1GQKA 2WJDA 3FXYA 2IMRA 4YTUA 5DCEA 3U2ZA 2GUYA 3PWIA 3WQCA 3BJFA 4CN6A 4DUVA 3STCA 2PGWA 2WHJA 1SFJA 2WKLA 4LTSA 1CXEA 3UCQA 2FTYA 2EAWA 3PJWA 3T78A 1OHLA 4UTKA 1UZ1A 2AQWA 2OQHA 2IPJA 4LVBA 1HXJA 1C9WA 2V3FA 1FQ0A 3WNLA 2PDLA 2EG7A 4XX6A 1R2TA 2J24A 1E4IA 5EL1A 2NLIA 1B57A 2X16A 2ZUNA 5LXEA 4NRSA 3M0KA 1BWKA 5LA1A 2C1HA 3EPOA 2JIWA 4O28A 4PUKA 3UR8A 4O50A 5LIXX 3FIGA 3DBPA 1SZRA 1KCZA 1MEWA 3A3HA 1AJZA 1OF8A 5D02A 2CLEA 3BGGA 5EMUA 1OYCA 4A3YA 2QJMA 4Q8UA 4D6HA 1KFCA 4K8GA 2B0MA 2ZQ0A 1HL8A 4XZWA 1GHRA 4NXSA 2G37A 5GNXA 4DXVA 1JL8A 1VCFA 4PL1A 1L0PA 1QNQA 5CZ0A 3SURA 1ONEA 5GJPA 3DFYA 3DYOA 3HGRA 1XDJA 3CPRA 1Y5XA 4O1DA 4D9PA 3W25A 4F2BA 1BWVA 5IBXA 5AHIA 3F5LA 3K2GA 4PBEA 2PE4A 3UWUA 3VNLA 2WOQA 4DI9A 2ZA2A 4MAVA 1WBHA 2YDSA 3KVMA 4HNVA 2WZIA 4GMEA 3PB2A 3ECQA 3QV6A 1MQPA 1Q6QA 4MADA 2EEXA 3VC5A 3PUGA 4P7QA 3GLCA 4MKNA 5FCZA 4OECA 4AMAA 2PFHA 5G4WA 1H3GA 1BQGA 4HK6A 2FHBA 4DJFD 4GY1A 4WSKA 3M16A 3B8UA 3UZ5A 2VFGA 3PZOA 4LH8A 4NASA 4KMQA 4YJ5A 1FKXA 4V1XA 3I4EA 1QHPA 3TN5A 3LEPA 2ZUWA 3ZLHA 4F0HA 3T81A 4F2UA 1V3JA 1KGUA 2PWGA 1TA3A 1DTUA 2YZ5A 1L6FA 5FJPA 3TKFA 3V0TA 4HBKA 4EK7A 2VO5A 3UGRA 4NAEB 2YCKX 2A7PA 1R0MA 2VEPA 3NPXA 3GRIA 3REQA 3R2GA 2OOGA 3C8NA 3M6DA 2A7RA 3KVJA 5FESA 5I2UA 3GXDA 1Q6EA 5E0KA 4A4AA 4MHBA 3UFYA 1ZBCA 4HCDA 3CL6A 2IKIA 3PZTA 1ZL1A 3FJ4A 2VT0A 3WNNA 2CLLA 4L4LA 1QPQA 1TIMA 1MQRA 3O7UA 3R1ZA 1EHAA 2C13A 3DUGA 1WDDA 8CGTA 4XZMX 3APTA 3MP3A 3OU8A 4A8RA 4XIMA 1EUNA 1VRXA 4DJEC 2X1TA 3TJLA 1RALA 5CCZA 4UTWA 4ZODA 4OJYA 2F8QA 2GOKA 3UT0A 1TZ9A 1XRFA 3LLXA 1CDGA 1TX2A 5EKYA 1Q6DA 4ATWA 2WSYA 4JY9A 3L2MA 1ME8A 3RUBL 3QM3A 3NM1A 3AMKA 2RDTA 2JEQA 3EAUA 4M0XA 3SZ8A 1AA1B 1TMQA 4JX6A 1AZ1A 4O1CA 4AHQA 1LDCA 4N6EA 5LNUA 1B3WA 4DAFA 3T6CA 2I5IA 3N2MA 3N9SA 3IGHX 1CXKA 1VGAA 4C6DA 1MSSA 1XGDA 1IT0A 1O95A 3ABZA 4UMCA 3ITGA 1LLOA 1ITUA 3F4WA 3NSXA 4A8LA 3ITXA 4HZMA 2QDGA 5IOBA 5I06A 1Z41A 3BV4A 4Y90A 5HXMA 1C8QA 4LAKA 4M7TA 1WKDA 1EL3A 1YDOA 2X1SA 1M7PA 4WEVX 3KHDA 1CENA 5LNVA 1H7NA 4YXGA 3AUOA 5E09A 4MSSA 1LLZA 2PTWA 1VHCA 1H7RA 1HFBA 3I7QA 4HPHA 1UOZA 1ITXA 3VIKA 3O0KA 4C6FA 1CGUA 3NGFA 1P6BA 3N9RA 3GO2A 5F2GA 4I7UA 1E6RA 4HMEA 4LALA 2PAJA 4K38A 3PTKA 3TNBA 3FDKA 1JUKA 1E15A 5I77A 2X42A 2Z6JA 3H21A 4XG1A 4L1WA 2WBKA 3I3BA 3D47A 3HFTA 4G7FA 2QJGA 8XIAA 2AGTA 5C54A 2QW5A 1JDCA 1W56A 4HSNA 4B9ZA 3R0KA 4C6PA 3FLUA 2P0OA 4AXKA 3CIWA 2Y61A 4WXZA 4C1KA 1UUMA 3OLGA 4J1OA 4AVFA 2DZAA 2W91A 2Z2AA 1DVJA 2YIHA 2QIIA 1KWKA 2ZRZA 1YNPA 1JYNA 3WBWA 3MHUA 2ZX5A 4LF1A 5LNRA 3GTIA 1EWDA 2E9BA 4HN4A 2FJUB 4JKKA 3S2CA 1RLDA 1NEYA 1EP2A 1J93A 1XLIA 4H8UA 4D72A 1FWRA 3WEZA 1A47A 4AZCA 3NO5A 1XQKA 1OK6A 3ZVHA 4GINA 2O9RA 5MKGA 3BICA 1FCQA 5AZ0A 5BWFA 1KGXA 4ZTXA 4FA3A 3M0HA 1TKKA 3AS2A 3KRBA 3MKKA 3W00A 1S38A 3WBAA 1QPNA 2C1GA 4FNQA 4TQTA 4W7WA 1CXLA 1S2TA 2H3BA 3GVRA 3SB0A 4GD0A 3LMZA 4J9JA 1M41A 5CPQA 1JDFA 5XIAA 3T05A 3HOJA 2JALA 3CPUA 4JZ5A 2Z1BA 4MYAA 1PAMA 2IS7A 1Q7ZA 2W5FA 3W7RA 4DM2A 3H2MA 4QGCA 1Z7AA 1W3IA 3CLWA 2ATMA 3BAWA 5A8QA 5IM51 3A9IA 5JQ9A 1QPRA 4MFEA 3NQBA 4DJDD 1KBJA 4O1FA 2YYTA 1BFNA 3OVRA 4C6LA 3GH5A 4M1BA 2EGZA 2VVNA 1TRIA 3IJ9A 4X22A 2HWGA 2ZX7A 2XYLA 3FKRA 3KOYA 2HE5A 3QHOA 3ARUA 2PDBA 3LYEA 5I3JA 4JOMA 1Y65A 1H50A 2ISSA 3DFQA 4UR7A 1EA9C 2ZX8A 2OLHA 4DEFA 4L9YA 3BL3A 4YTRA 2ZVRA 1EA0A 3N3TA 1RD5A 3AIRA 2V5BA 6PTDA 4ERIA 3IRDA 4F66A 4N7QA 2V2HA 2OLAA 1EOKA 5FF2A 3LNPA 2XTKA 4GUFA 3W2JA 2NX9A 2VQTA 1J9YA 1N7KA 1P48A 1G1YA 4E2BA 4NQ1A 1EXPA 1F76A 3L7RA 2ZBTA 1UZHA 4XIAA 3W70A 4MY8A 3WIJA 2Z7KA 1LCOA 1A5CA 4GWEA 4JTCA 3GX9A 3GTFA 6ENLA 1SR0A 2WHLA 3CAQA 4M82A 3RPMA 3CZLA 3PZVA 3EWBX 1TB3A 1FUYA 4US5D 3SCQA 4C1NB 4HNUA 2ALRA 2V5KA 3VNYA 3E49A 3ZR6A 5HUOA 2C6QA 3GYCA 1NOUA 1U5VA 3G1XA 4UTFA 5A8MA 3C6CA 1HZYA 4LBRA 1LOLA 4CD7A 2YKKA 3DAQA 1KXQA 1EJSC 5A94A 1OYBA 1SMDA 2VUNA 2ZCGA 3OBAA 3SUTA 5G2IA 4PGLA 3V18A 1ALDA 4L65A 3S5OA 3T9PA 3KS6A 1VPXA 1ICPA 5K4ZA 1LT7A 4HA4A 3AXHA 3EDFA 4MZ1A 3B04A 1A4LA 2RHGA 3G8RA 1NELA 4BI7A 3IIXA 5C9XA 4U31A 4EANA 3OHMB 1WBJA 4KFNA 4H9VA 4AZ5A 4FF7A 4O15A 1ZENA 2IKJA 3GHTA 3KOWA 2W79A 4NXKA 3W7DA 2VZUA 3N34A 4IJCA 4EX4A 4PODA 3RAOA 2GQAA 3WD4A 1DXIA 3NGJA 3B9OA 3N2CA 1MUCA 5D9MA 1ZJBA 3KM8A 3E3HA 4HYRA 4EAMA 3KWXA 1JAKA 1XC6A 2VMFA 1XR2A 2FVLA 2F61A 3K8KA 4XZ9A 3P81A 1B0IA 1NM9A 5HAOA 1R3SA 4MNLA 1SU5A 4V27A 4H04A 3DFNA 1UD3A 4FSAA 2WJEA 1BTCA 1ECQA 3CQJA 2DIKA 4PUWA 1VLWA 1RVKA 4M6PA 1G9HA 2E9LA 1VAHA 3TK7A 4JN7A 2GDUA 4YIWA 1YTKA 3EDDA 3HGOA 1Q66A 4ZMGA 2NX1A 3FKKA 4GH3A 3COTA 3IK2A 2FTPA 2XZ9A 5MHBA 5HR6A 1Y7VA 2VZVA 1UPPA 3NZRA 4ZFCA 4CNTA 1CLVA 1C7SA 4LYRA 4PUJA 3WLTA 1OC7A 3RHGA 2FPYA 1QUMA 4CCDA 1TCMA 3NL3A 5A6SA 2CESA 3NFUA 5FSDC 1QVBA 4CNNA 1UWRA 4ZQNA 3M0JA 6TIMA 4H9ZA 1HJSA 3G6MA 2BBFA 2QJHA 2G41A 3ARWA 4LV9A 1PIIA 2PTZA 1YHTA 4GABA 2UWFA 4IJRA 1CYGA 3ZJ6A 3LTYA 2OZ8A 5CZKA 1XSIA 2QPUA 4C6KA 4QR6A 4JY8A 3EWDA 5K7JA 3T42A 4KPLA 4BZYA 4JN6A 1AK5A 3W88A 1G6CA 2INFA 3D3FA 4IQDA 4ZQPA 1HKKA 4PSPA 4ZQMA 1VYRA 3EWCA 2XH2A 4JQAA 2C3ZA 2HPMA 2Z1KA 3GK0A 1I2RA 4GXMA 4IMCA 1U83A 4MWAA 5REQA 3IIZA 4FS9A 1PZ3A 2VNCA 1W1PA 2WMHA 1Q6OA 3AMLA 1BG4A 3N2BA 2A3HA 2VM8A 1CGVA 4QLKA 1VFTA 1H5VA 4XK2A 1NF0A 2R24A 3EKGA 4R33A 5HA7A 3UJEA 1DWFM 1MUMA 4JXCA 2DZSA 3D5HA 3WLIA 3RO6A 1P43A 3FA3A 5FL1A 1V3IA 2E77A 3M0IA 1XRSA 3NR0A 4WVXA 3DECA 2NT1A 1JUBA 1CXHA 4IGSA 4DBEA 4Z0SA 2DIJA 3GXFA 1FWIC 1XGEA 1FHLA 4J3TA 1OX4A 1QDSA 1JI2A 3RLUA 4DQWA 1H7OA 4S3BA 3PUOA 3GBEA 1K8YA 4MJ4A 3VKAA 4U3CA 4XQ6A 2XN1A 1L6GA 2XVPA 4V28A 1H62A 1UH2A 3V7PA 4L4OA 2FVMA 2CIPA 3GU9A 4AD0A 4I9MA 2KZHA 2WJFA 2ODOA 1G5AA 3UXAA 3V1HA 4RDVA 4NZJA 3PY2A 3O9NA 4H7VA 2PWDA 3TN3A 4JS3A 3RXZA 3GDMA 2JGQA 4WY0B 2Y7EA 3UNDA 5BU9A 4GG9A 4O57A 4I9JA 5EA9A 1V3MA 3L4TA 3YPIA 2JF6A 2YX0A 2A79A 3RM9A 4F0MA 4FI4A 4OBTA 2AL1A 3EYPA 3RU8X 3QGKC 1XLJA 2JQXA 1KB3A 2DZWA 5CAKA 1GVYA 1A5KC 1BXBA 2PD9A 3GR8A 5CZSA 3TZNA 1B90A 3GC4A 2J7GA 4XKMA 2FH6A 5AYYA 2FJKA 4PCFA 1JZ4A 4IHCA 2PTXA 4IMFA 2V38A 3OYZA 3RN6A 2YYUA 3EPNA 4H19A 5G2HA 4A8IA 1WXJA 5DANA 3VOFA 3K4WA 4AB4A 2Y89A 5F1UA 3W75A 4R85A 4FLSA 1FH8A 3E02A 4I7WA 3GNOA 2EBNA 1FDYA 1VFOA 2J8FA 3T4WA 1W3LA 1BSLA 5K4XA 4E8DA 4URIA 2W67A 4H9XA 1ZY9A 4OUIA 1I45A 5AZ1A 1I2NA 1TZ7A 3A47A 4OBRA 4Y9PA 3QBUA 3OO2A 4KGJA 4OQVA 4ZO6A 3R8GA 4CNPA 1OYAA 4RZ6A 2I5QA 4QBXA 1XLBA 5EBAA 4UB9A 4GZJA 4BA0A 3ABRA 4GGHA 1R87A 4TOQA 3RJYA 4AX7A 2CITA 1JZ3A 3QOKA 1HNYA 3IJIA 3KCLA 1JVNA 1SVDA 4HTBA 5F1VA 1PKLA 3SECA 2NQ9A 2PDGA 2WLYA 2WMIA 3WJWA 2PZ0A 4D2JA 1REQA 3SJ3A 1TTQA 1GZJA 4ACZA 2O55A 3IUHA 2PCEA 1O60A 1THFD 4M5PA 3IJ6A 2BGQA 1IR1A 4MF4A 1R7OA 2YCEA 4DYEA 2W92A 3OZPA 3AYRA 4JTUA 1YEYA 5AYXA 1CEOA 4O53A 3CASA 5TNVA 4S1FA 4OIFA 2PDUA 3SFWA 1LOQA 3MDWA 3MYPA 1E4MM 5A8GA 4YU1A 2TAAA 1NF7A 3WF2A 3HA1A 2WC3A 4DO7A 3TYUA 1OBAA 1XHGA 1DJGA 1ODUA 2QDEA 2WBGA 2DZTA 4Z1YA 2V2DA 2BVTA 3TC7A 3TC3A 2VCBA 1UBSA 2VGIA 4NNBA 2CLPA 3H7VA 2GGJA 4JDYA 3BAYA 1CXFA 1T8XA 1VCGA 1GW1A 1BWLA 3BSHA 1T40A 2VZOA 2CYGA 1EJTC 1XCWA 3SADA 1C91A 2ISFA 2YL9A 2OT0A 3IAPA 5HNNA 1VS1A 2VX4A 3H53A 1XIIA 5CAHA 5CJMA 5LZLA 3L4ZA 3MBDA 3MKCA 3SGGA 4JTRA 1WAWA 4G5DA 4PTXA 2H8ZA 1CLKA 5F4WA 3WFLA 4CD6A 1XF0A 3TXVA 3UPWA 1E0TA 2R1LA 2Z25A 4LCRA 4ES4A 4TV6A 5DRIA 2PF0A 1I9CB 1GW9A 4J3VA 1W3TA 1M68A 3LPPA 2WCSA 2PLJA 3TU9A 1V6WA 3VILA 1OD0A 2OELA 5DY3A 2C71A 3OGRA 2V69A 2WVSA 1XLCA 2UY2A 3WDRA 1PCWA 1VC4A 2J7FA 3OG2A 3VFCA 4R3UA 4XZHA 3I10A 4PB4A 1K7XA 4YS1A 1VFUA 3W23A 1QU4A 2TODA 4BF9A 4ADSA 5D38A 1OGGA 5HNUA 3SCPA 3B0VC 1I8JA 5B7ZA 2W62A 3DHUA 2J9XA 2Y5EA 3LCGA 3CT7A 3ITOA 3I65A 4J7RA 1LRTA 1PB0A 3M5YA 4ROQA 1XD0A 4AY7A 5DMYA 3AI0A 1XIDA 4IFKA 5ABFA 5C7HA 4GQRA 4J35A 5C5YA 4IPIA 3I6EA 3L0GA 3RCYA 3AO0A 3KLLA 3E2QA 2PGFA 2WVVA 1MEIA 3RO8A 4HU0A 3B0PA 5D2VA 1BPLB 2ZXBA 3AXIA 3CUHA 4IFOA 4N4QA 1YE4A 2GVYA 3R58A 3NEVA 5FEXA 4ZBCA 4LWWA 3QPZA 4IXXA 4AWEA 4S38A 1DWAM 2VC9A 2FMOA 3P82A 3NL5A 3B9NA 2ANUA 3L21A 1ZUAX 3WL1A 1Z3NA 1F2JA 2BODX 3MUXA 3N2OA 1UR4A 3BE7A 1XPGA 3O6YX 5JBFA 1OQFA 4PTNA 1VBRA 4NU7A 2Q6ZA 3LHUA 2ONEA 3CJPA 3WJYA 5LGXA 1OINA 3PC0A 2Z24A 3OODA 5JBEA 3LK6A 1SJDA 6REQB 2HNEA 2WCGA 2A6LA 4FB7A 2QULA 1RA0A 3GKFA 4CNUA 4RXGA 1A3WA 4OUEA 3HIJA 2DIEA 5I78A 3GNXA 3UU0A 3OB8A 4JTHA 3R79A 4AD5A 2DVXA 3PWGA 3I68A 2V0TA 3BO9A 2BS9A 1VEOA 4D71A 2H6RA 3WLKX 4NAFB 1XV8A 2HROA 3MI3A 3UERA 4WDUA 2FH8A 2HBVA 4ZXOA 4MWAE 1AH3A 3VNIA 1KM5A 1MVYA 1JPHA 1WV2A 1SFTA 1A5SA 2GYIA 3W7QA 4RNJA 4AUBA 1QFEA 3ZYZA 3VIJA 3SCRA 1Q2SA 3RU6A 3CZJA 4PMDA 2PDQA 2A21A 3MUAA 3OZMA 3H7UA 4HA3A 2C0AA 1XH0A 3NPVA 3G77A 2QPXA 3GR4A 3AS1A 4CU8A 1ICSA 4XWUA 1MW3A 2Q71A 2YFNA 1QTWA 2AOSA 4A3UA 1X7IA 5I3FA 2EPMX 1TJ1A 4KEVA 3AROA 3TW9A 4BS0A 4K6AA 4UIOA 2VFHA 1K8CA 5GNZA 3W84A 4Z2IA 4OE7A 4OFCA 1HGWA 2XGIA 4G9PA 4JIPA 3CV1A 1XLGA 2ZC8A 4GYFA 3PBWA 5HOSA 5DFAA 4KCUA 1ZJIA 4LU0A 3TMLA 5CJ5A 1UWUA 4HNLA 4C5YA 4K1GA 1S5NA 1KM4A 2QNEA 4ML4A 1PTAA 1NDVA 1DIDA 3BAXA 3LZ3A 1X8FA 1NU5A 1DE5A 4AIUA 2JKPA 1J5SA 4IQJA 1JCYA 5C6MA 3SRFA 4GX9A 1GOXA 1EZ2A 2ZDRA 3GZAA 4REQA 1E40A 2V5DA 4JYFA 2OSXA 4UFIA 4XAFA 4C65A 2HSAA 4IZGA 5CC6A 4Q4OA 3CBWA 3W53A 1OCNA 4X61A 3RYSA 2DZVA 3AUJA 3HJZA 4ADUA 1BLIA 1NDYA 4FEZA 1IYXA 3G1VA 1YW1A 1IIHA 1X6UA 4QRNA 4N9EA 2VR2A 4NJKA 3A24A 3EEGA 1JZ6A 2PP3A 2P0IA 1XCFA 6XIMA 3P84A 3A4XA 1RHCA 1HVQA 4FMVA 3DIPA 4OOUA 3QZAA 1DHPA 3B40A 3OIXA 3W24A 1WZMA 4A22A 1Q63A 2Y0FA 3W37A 1EH9A 2VJXA 4M56A 3R4IA 4W84A 3NAVA 4LVDA 5H8PA 1SW0A 3UPMA 1UC4A 3MBFA 3R43A 4HMNA 1TMHA 1JF5A 1LWHA 3AHYA 3LPOA 3B06A 2J13A 5LNWA 2OYKA 3DZ1A 4A8NA 4DXXA 1XYAA 4NZFA 1W9UA 3NDZA 4W7UA 3WQWA 2GVEA 1QBBA 3SRHA 4B3ZA 1JYWA 4O4VA 3KWSA 4E8GA 3IARA 3BGAA 5I3DA 3OGVA 1BKSA 4QJ4B 1HJXA 3W82A 3C3UA 3JU2A 2ZRXA 2YA0A 3STPA 2WV8A 4RE3A 1G0CA 3RRXA 3RR4A 3THCA 3GVQA 1HP4A 3DKJA 4UR8A 4Y9AA 1M53A 1NIUA 5HMSA 1JGMA 3N73A 1E6PA 1SPQA 1GQIA 4QTGA 3TV8A 4DF1A 4IUGA 3GXIA 2PD5A 3BLKA 4QE4A 4O12A 2OEJA 4JTLA 1UD4A 4Z2GA 2P3ZA 1JCLA 3W1PA 2FQIA 1E43A 1GWJA 4B5NA 3E2SA 4UQEA 4JQ4A 2YL6A 1XBZA 1CLXA 1YXYA 3II1A 3SUSA 4PMJA 3FYOA 3OG3A 2OX4A 3UZZA 3HQPA 4R7JA 3NXLA 4IQEA 2F6XA 5AN7A 1TWZA 1KFJA 1J2WA 2Y8UA 5EYWA 1MO0A 3T08A 4M24A 1PO9A 2R8WA 4XD4A 3MS8A 4KEUA 1B3ZA 1LBFA 4HGXA 4ZQRA 3ATZA 4HHPA 4D1IA 2Y2WA 4N9DA 4BQ5A 1U2YA 2WMJA 1FCUA 3PJTA 3DI0A 3ARRA 5JH1A 2YW3A 5GNYA 1XGZA 5HQMA 2VXNA 1V6XA 3LXCA 4DB7A 4EXAA 4TVCA 3QYQA 5FF7A 4Q33A 1PUDA 3NO1A 3F2BA 2EPHA 5D37A 1XLLA 3PBYA 3WLMA 3TTEA 3CM4A 4MVAA 1DJYA 1W9VA 1RXOB 4CUCA 4J3SA 1JEZA 4GVFA 2JKAA 4YTSA 3C2RA 1JZ2A 2G96A 3GYEA 3VOJA 1ZP4A 1MEHA 1W3NA 4PCTA 2O4QA 1H4PA 4MJMA 3CU2A 4CQAA 2F6KA 1PPIA 4BEUA 5H91A 3VIHA 1A5BA 5CPMA 3M0XA 3VX0A 1UYQA 3AHZA 3C5QA 5H6HA 2JK2A 1UG6A 1CXIA 4QE1A 1XFCA 3WELA 5E93A 1FXPA 1UP3A 3D0CA 3ZJ8A 1XW8A 4PMNA 2HMCA 3INPA 1OC5A 4CGTA 5A69A 1ZPTA 4EKJA 3TQVA 3PP7A 3W7LA 3BAJA 1CGTA 2B4GA 4Y8FA 5BW6A 1MXSA 4DJFA 4EIVA 3CYVA 2L5HA 2PA6A 2VX7A 4JQ1A 1E0VA 3TX9A 2DW6A 1OG0A 1WOBA 4GPNA 1IWBA 2FPTA 1QK2A 1C7TA 4GJIA 3MJYA 2E6AA 2QDHA 4O8RA 3UWEA 4WDWA 5FI8A 3JRKA 1M04A 2YLAA 2QMKA 2A2IA 5KETA 3EPMA 2QUVA 3P0WA 4LB3A 3N18A 3C61A 3DG7A 5EBUA 2ZZ6A 1RBLA 2P8BA 1HJUA 4CEUC 4IIDA 5DN1A 3FYYA 5A8OA 4UFLA 1VENA 1KKOA 1Y5WA 1B4EA 4GI8A 3TMQA 1KM6A 1X1NA 1EZWA 5I79A 3NQAA 2AMXA 3VM7A 4CEXC 2GLKA 1Q7QA 2HBXA 2EPOA 3USZA 3BQ5A 4DO4A 1UP0A 1Q6LA 4F9DA 3M7WA 4PUEA 3NG3A 2P10A 3UVAA 4G7EA 4CCCA 2J66A 3KS5A 3EX3A 2HJPA 3UESA 1QWKA 3L65A 2X0YA 4DF0A 3U3HA 3WLOA 4ZXLA 2AL2A 1EX1A 1NVMA 4J2PA 1QOPA 2JE8A 1W5NA 5EMMA 3NDYA 1HX0A 3KBJA 4AG0A 1KTCA 4NZCA 3ARYA 3R11A 1PXGA 4JQ2A 2WSKA 4AEFA 2QIWA 1QO2A 1RR2A 4B5SA 4AZBA 1W37A 1HL2A 1XPYA 4MKVA 2WSPA 3CUJA 5C2GA 5HJLA 2V8ZA 1K9EA 3DDMA 3W1AA 2NQHA 1PWLA 3F4NA 3DOPA 4A21A 2E28A 1HKVA 2VTFA 4O1AA 1DJZA 2DSUA 2VZSA 3LDVA 3FSTA 4IT1A 3LA4A 5DMLA 2WANA 4Q6XA 3TXZA 1ZBVA 1KXVA 3IVTA 1KFKA 3T2PA 3VNDA 4BI6A 4QIUA 4QG6A 1J01A 2GWGA 1NDZA 3EX4A 3W38A 3GXPA 1B3VA 3ARQA 4O0QA 2J88A 3AIUA 4PTMA 3VZXA 2CZEA 3PZNA 2IPFA 5M03A 2O9TA 1G4TA 4R7WA 4X2PA 2D73A 3T0TA 4JTTA 4HMDA 2YJQA 1RQHA 2E7FA 1ME7A 4R34A 1DPMA 1E9YB 1U30A 2DVUA 2YXXA 3T09A 3EOLA 3M5ZA 2A3BA 2QCDA 3MPGA 1L8PA 4IWWA 1RPXA 2BXZA 1A0DA 4WGXA 3P67A 1J79A 3T0AA 2YCLA 5G4EA 3A5FA 4IF2A 2FGBA 1R2SA 1XX1A 4QE5A 1KO0A 3CWHA 2A0NA 4WOZA 9CGTA 2NXHA 3W7PA 4LW7A 2VCCA 4DZHA 1KR0A 4D6CA 4ZGYA 4UNKA 2QLYA 4N0RA 2W66A 1SFLA 3BK0A 4Y9MA 2A3EA 2J75A 4GUGA 1KGWA 4TMBA 2VP8A 1A0CA 3EWUA 3GD6A 4H9TA 2PDKA 9RUBA 3AJ7A 4ORIA 1DWIM 1FP8A 1TX0A 3PUEA 1M65A 1YBQA 4C6MA 4H83A 4CNSA 1YIXA 3KW3A 5KZ6A 2BMBA 3LTPA 4N4PA 2WPBA 1Q85A 3KEHA 4LT9A 1SFSA 3E96A 8RUCA 4WQ6A 2CZDA 4MM1A 3VZZA 2DU2A 2W9MA 2CETA 5D09A 3LBMA 3PTDA 1J6OA 3CL8A 2X8RA 1HF6A 2QCNA 4IOTA 3U2EA 3UJ2A 1TQXA 5BU6A 1ODZA 4OOZA 3AQUA 4UZUA 2VEIA 3OP2A 5DCDA 3ANYA 4PBFA 4LUTB 2RGLA 2GUBA 4KWSA 4OT7A 1HJVA 4MJZA 1J12A 1F3TA 4YPJA 1GJUA 4HJFA 1ESWA 2REQB 3EKZA 3R13A 1U1JA 1FWSA 3SUWA 2H3DA 3GIPA 4DJDA 3TH6A 4DBDA 1QMLA 1OEPA 4ZVJA 5I09A 1S5TA 3TONA 2GVGA 1YTDA 1R3YA 1L2QA 5CGTA 3S46A 1NH6A 4AZ7A 1J11A 3WFAA 1OIMA 3FFSA 1D8CA 1HT6A 3AJXA 4EF8A 1O4UA 5DQPA 3XISA 2BDQA 3UCDA 4GA8A 4DIAA 4MPKA 3GG0A 2E8ZA 1ELSA 3W7EA 3BARA 2PDNA 5HK4A 1A3HA 2CLIA 3VKCA 4AXNA 1GVFA 3CV7A 2SFPA 1UWTA 3TTYA 1GOKA 5D2YA 1ZLPA 3M64A 3N14A 3DEQA 2F2HA 1Q7MA 2PC4A 4HU4A 1DORA 2YLLA 4DBWA 1KD0A 3C2VA 3EDKA 3ZWTA 1VD6A 1XM3A 3GU2A 5TIMA 3UA4A 4WHBA 3IACA 1R3TA 4BKNA 5M2FX 4E4FA 1FKWA 4XKYA 4U33A 1JG9A 4US5A 2ZWYA 5KTLA 4L9ZA 4B90A 4H1ZA 4H2HA 3WBYA 4QAWA 5CSYA 5FJOA 1VPQA 4TX9A 4ZB2A 2CHNA 4FNTA 1ZAIA 4KWOA 2AAMA 1E1FA 2XH0A 4UR9A 3S1GA 4DPQA 2G95A 4FIRA 5LA0A 1EJ7L 4G56A 2Z0IA 3GDTA 5T26A 3HPFA 4LXFA 2BZNA 2X09A 4R88A 1C92A 1DIOA 2XWDA 3AISA 4NUWA 2WAGA 3CIVA 3GW0A 3WFZA 1GTEA 1OIFA 1BF6A 3VTRA 2BWGA 2I9EA 5B7YA 2E4TA 5I5RA 3EA1A 2Q09A 5JIPA 3HU7A 4NX5A 1TJ2A 4JTAA 1UBPC 4OKDA 3WEOA 2NVDA 3KP1A 1UD6A 3B9DA 1LWJA 4S3FA 4WIWA 1LUCB 3M0LA 3MVIA 2ZA3A 4EXBA 1DWGM 4GZIA 3PSWA 5LXXA 8XIMA 2ZFAA 3GDRA 3H7RA 4OV9A 1H61A 2YBUA 3W07A 4RDWA 3DFOA 9XIAA 1X39A 4XTIA 2AKMA 4BWLC 4IPNB 2YDAA 2V68A 1BRLB 3BLLA 5LKYA 5HWMA 2CHOA 4NG3A 3H55A 2TRSA 4R9OA 1FWBC 2VR5A 4S3EA 1EP1A 5JUVA 5DF0A 3TOYA 3CT2A 3IPWA 5C0QA 1X6LA 2GK1B 2JIEA 4IPJA 2NQLA 3NA8A 2FGZA 4DXKA 4H8HA 3W6MA 4LNYA